4TOYH

Structure of 35o22 fab, a hiv-1 neutralizing antibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
242
structure length
242
Chain Sequence
EGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 35O22 Fab Heavy chain
publication title Broad and potent HIV-1 neutralization by a human antibody that binds the gp41-gp120 interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2014-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4toyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4toyH01
3UX9B 5FKPB 4LP5A 1B0WA 3DYOA 3N9GH 3MNZA 1QACA 3GSWA 4EI5C 1S9XB 5FKPA 4PG9B 4PD4K 4PS4H 1YDPA 4OSUL 2HRLA 3U30B 2YOCA 4YZFE 1EHAA 4QOKE 5ADPH 5DEZA 3V6OC 4QKXB 2JB6B 3TZVC 5HI4C 2CH8A 3RZCB 3QEQB 5T1DL 1EZVX 1PG7X 1WCBB 2X4OA 4IDJH 5T5FH 4UTAH 3RZCA 4LK4A 2APBA 1F3DH 4U6TA 2XKSA 3D1MC 5F7UA 1XF5B 4QCIA 3WLWD 1YEHH 4BQ6A 4NJAH 4JRWA 4GW4B 3T3PF 3FQUA 3RNQA 1FFOB 1F4YH 4HIXH 2CLZA 2XZZA 4P2RB 2DF3A 5L8JB 4OB5H 3MFFB 2BRRL 4HKZA 3T2OA 6FABH 5DR5L 2VXUH 2XPGB 1W0WB 2CD0A 4D3CL 1KV3A 2NY6B 3AS3A 3VI4E 4JG1H 3GSNH 1NLBH 4LCIH 1XF2B 3ARDB 4U31A 1K4CA 5FYKU 2BSRA 1U8JA 1TNMA 4HK0B 1CGWA 4JY6A 4PLJC 3ZTNL 3A6CL 4CDGC 5JNYA 4HK0A 2HT4D 3QG6A 2R0ZL 2DJSA 3HI1B 4OZHE 2BVUA 1X6NA 4FQ2H 4JFXA 1JPSL 1E4WH 3HI1A 5CIPH 1CICC 4HUVA 4N8VG 4PRPE 5I76A 4X83A 4MCZB 3VFSB 2X5PA 1NGPL 4UDUB 5J4MA 1VADA 4G8IB 4IRSB 1RZKL 4JVWA 3LH2H 2J12B 3RJDA 3SGDH 4WW1B 3F7QA 4PRHE 3RFZC 2HRPH 2DQJH 3R0NA 2LTQB 3VFGH 4U4BA 3TVMB 1A9BB 1LE9A 1QFWL 2AJXH 4XHJD 1A9BA 2X70A 3AVEA 4ONGL 4I77H 3S36H 4OQTH 4HWUA 2EECA 4KZEH 3FQTA 3I9GL 5AZ2H 4JQVC 2I24N 4UOW1 5ISZE 2B1AH 2YPKB 2WAHA 4ODUA 5IQ9A 1W72L 3EYFB 4FTVD 3TNNA 2ICES 4OZFB 3RU8L 1A7RH 5CZVH 2YPKA 1ORQA 3EYFA 3CU7A 1QLFB 4KJPD 4NQDB 1QLFA 2AAVA 3HE6A 3SJVD 1GC1H 1IGYA 3FMGL 1QNZH 4R8WL 5DQ9A 3WIHL 4NN5B 4Z6AT 4UDTA 3QUYD 4NQVA 4JDVB 1LP9F 1LILA 3L9RA 5E99H 1TNNA 3L3HB 4JDVA 3VH8G 3EFFA 1X5YA 1BIIA 3GSUA 4F2MA 1FPTH 1EXUA 3MGAA 1F5WA 2VAAB 3IXTB 4IIQC 3VG9B 3WNKA 1LHZA 5I1AB 3BO8A 1BP3B 2VAAA 4KZDH 1KTDA 1OPGH 1U8KB 2P7TA 4DKFH 1JZ4A 5I1AA 4LQ1A 1A2YB 4NSKB 1TETL 5T3ZH 1BECA 2H9GA 2E9JA 2KUTA 2OI9B 5GS2H 4FFYL 4FOMA 1CVSC 5T33H 5I30H 3P3YA 1NGZA 4BELD 3DVFA 1G6VK 1A1OA 2GAZA 5E03A 2K1MA 1D3CA 2R0LH 5HI3C 4YXHL 4XCCL 1LNUA 1LWRA 3DV4B 4HWBH 3KLHC 4ACPA 4AH2B 1RFDL 1S5IL 3GMPA 1IBGH 1ZS8B 3DV4A 5FO9B 1OF2B 2CIKB 3C2SA 3MYZA 1ZS8A 4CMHC 1FRGL 2CIKA 3OKNB 5F7EH 3RVTC 4X4YB 3KS0J 2IQAB 4X4YA 5HYFA 1T21A 3FQRB 4HMDA 5JOPE 3LIZL 2V17L 4H25B 5DJDA 4KKAD 1MRCL 3QUXC 5CSZB 1LO4H 2HFEB 3RY5A 3RWIB 5CD5D 1Q94A 1WC7B 4JO3L 5F70A 4QEGA 5GRXG 1P5VA 2NY3D 2HFEA 1P6AB 3I6LD 4K7PY 4NQCE 1NFIB 3OKDB 2C3HA 5GZND 4UBDD 1KJVB 1FAIH 1OTSD 1P53A 1HIML 1KEGH 4XNMA 2I9TA 1KJVA 5D1QC 1C5BL 1L7TL 4W4NA 4DJMA 3VXMA 2AK4E 4Y4HC 3HPJA 3BE1H 3GZKA 1T22B 5EZJB 2YPLA 5C2BL 4GS7B 2R56L 3RY4A 3VFNA 5E8DH 1T22A 2ITDA 3JV4B 4XAKE 3VD9A 3FO1B 4DK3A 4RISH 2PCPA 2B4CH 5D7LE 1KN2H 3QXWA 5IFHL 2F58L 2ADJB 1ADQL 3KLDA 3VXTA 1X5AA 2ADJA 2Z92A 4LPYA 3DVNA 1UZ8B 1UACL 5AYUH 5BVPH 2D2OA 4L8SC 3SCMA 2D3VA 3DX7B 4P46C 1CFBA 4ZSOB 3B3IB 3QXAB 3GBLA 1G0XA 3QI9A 1OB1A 2HWZH 3P4NB 5TE7L 3WMSA 4OZIB 1OAQL 1JNLH 3MLTB 4NM8L 3O8XD 5H37G 3K3QA 4OD1L 1ZANL 3BEWA 1C5DA 2XI9A 5L88H 4JY4B 1CI5A 5BOZG 4LDOB 4JY4A 3NA9L 4I5BA 5K9KB 3IDXH 1NBYB 2EDHA 3JTSA 4IRZH 5J1TC 5C0NC 4L8DB 5K9KA 3QHZH 3GMLB 4GBXC 5JW3L 3MR9A 4LSUH 4D0CB 4L8DA 4LVOC 5EZLB 4D0CA 5DMJB 5CBEA 1OP9A 4JEGB 1JK8A 2E9IA 1HQ4B 5AUMB 4ORZC 1HSBA 4L3ED 2Z31D 4NN6C 3V4VH 3ZT7A 1CCZA 1MFBH 4HIJA 4JJ5A 5FYJU 3S8WA 1F4XH 3OX8B 1WT5A 4M7ZC 5FUOL 1NCDL 2DM4A 2D0GA 3OX8A 2VXVL 1L9MA 1P84J 3VWKD 3VMOA 4WFEE 1WTLA 1CLOH 5EBLB 1JF1B 1A1MB 1KLFA 1EBAA 5FYLE 2WP3O 1JF1A 4ZFZA 3ARFA 2KBGA 3ILQD 3C5ZA 1OGTB 2NQCA 1EPFA 4JDTH 4NZDA 3ULUH 4U6XA 4C54A 3FHQA 4EXPX 1CD1A 4HC1A 4N1CA 2JCCB 3H7LA 5BVJB 4EQ3A 4MJ5A 1JGDA 1TFHA 2LE9A 2ZUXA 3KGRA 4Y16C 3TPKA 3VFOB 2JCCA 5J3HC 1JNJA 3KHQA 2BHZA 4F7CB 5CJOL 3RDTD 4YDJA 3VFOA 2WQ8A 5D6DC 4A6YL 1XEDA 1PEZA 3HC4L 3EOAB 1T89A 4LHUG 3TNMB 4P0DA 4K23H 2DAVA 4NDMA 4OCNC 3VFRB 5I1LB 1WAAE 4X6CB 4ENED 4FMKA 4ONHA 3EOAA 3TNMA 2BNUB 3EJYD 4UNUA 2QSCH 5ESVB 4R0LC 5I1LA 1TQBC 2EDXA 1BD2D 4N8CL 5ID1A 3MRMB 5ESVA 1YEDB 1KGCD 3PDOB 3MRMA 3NH7H 2OJZH 4KDTC 1YEDA 1MRFH 3QDJA 5IF0B 3QHFH 3U7YH 4PJBB 4JFZH 4DKAA 3PNWA 3D48R 4BFIB 4M61B 3OJDA 4OJFH 3LN5A 1DR9A 4XNZC 2YZ8A 1V5JA 3GHBH 1F4WH 3L3JA 4QWWC 1BGXH 3SDAD 3TYFA 5GGVY 4Y5VA 5D70H 1T04A 5DWUH 3OPZL 5IMKA 1QKZL 4AG4H 2X4QA 4IEFB 4FG6C 1BQLL 4AT6B 2R1XB 3TGXA 2EDBA 4OLYH 5E70A 1J10A 5LGJA 3ZDYE 1LEGB 4AT6A 1IC5H 1II4E 2R1XA 3ALXA 3W9DB 1X44A 1IM9A 2DQCH 4MS8D 3KYOB 4KTEH 3W9DA 4OCYL 4G9FD 4OM1L 5DJXA 1QSED 4OCWL 3TJEH 4HCRH 3AS1A 2E7LC 3QDGD 4OBSA 4FTVB 3QR2A 4RNRB 1WZ1L 1OGAD 3A67H 2ICCA 3L7EA 1UKSA 1EJOL 3D39D 1C1EL 3BUYB 3OSKA 5GRYA 3OXSA 5GHWL 1HHHB 1RVFH 3BUYA 2VDQL 2CKNA 4PJ9A 1VGEL 2A83A 3SJVB 3VD3A 4HXBH 5GRZA 1R3KB 4IBLT 5I8OH 4TPRL 3SJVA 2DM2A 3QUYB 5EA0H 1H8OA 5IKCB 1R3KA 2ITCB 3DETC 3NCYP 1TTUA 1JGUH 5IUSA 1J1PL 1RIHL 4OI9A 2ITCA 2HAZA 4ORGB 4V1DE 4N90D 5ENWB 1UXWA 4E0RA 3LHPH 5ENWA 2PW1B 2X4NB 2X09A 4WHYG 4KUCD 3T77A 2YR3A 3SY0B 2PW1A 4PB9H 1SYSA 1RPQA 5JXED 1FZMB 2IPTL 3LQZA 4NUJB 4RDQG 3SY0A 1FL6B 2IFFH 3MBED 1MHCA 5HHQB 4N0YH 5MHSD 1FZMA 1NGXB 3PIQB 1FL6A 4L8CB 3QZWB 4NKIH 2C1OB 1H15B 2E8ZA 1UQSA 1JGVL 3MRKB 3QO0B 1NAMB 2PTTB 2C1OA 2OTUA 3LKNA 1H15A 4JM2C 4R7NB 4FABL 1NGQL 4GAYA 4R7NA 1OAYL 1P9MC 4Y2DD 5EIQA 1JP5A 4TQEH 4P23A 3NA4A 3UAJC 2YK1L 4MDJB 5JMRA 3H3BC 3QXUA 4M1DH 1YYMH 3NAAL 1OQOA 5EU3B 3F58L 4MDJA 5EO9B 2ORBH 3FB6B 1ODAA 3LKOA 1S7XB 2PNDA 2BNRD 3GI9L 5ITFA 1J8KA 2P8PA 4M4PA 3IFPB 4HBQA 5KJRH 4J3WA 4EKXA 4D94A 1Q0YH 5I19L 1S7VB 4LKXB 2ARJB 2NY3B 3P0VH 5HYEA 3KPSE 2Y36L 1KLUB 4LKXA 1AXSB 4C58B 1KTLA 5CWSA 1KLUA 3BVNB 4TTDC 4M1CC 3WFZA 2SEBA 5FYJL 3OJMB 2CPCA 4NP4L 3SDXB 3VFTB 3PWLA 4X9BA 3SDXA 2AVGA 3NTCL 5TDNA 3BPOC 5DTFB 3KYNB 3T4AB 2RFXA 5TQ2L 4YEEA 5DTFA 1WJ3A 2C3GA 1Z0NA 4AIOA 3WKNA 4U3XA 1JWMB 3IT8D 3SE4C 2EDOA 3HC0B 2KDGA 1J1OL 3SKJH 2NXYD 4DW2H 3EYSH 4I2XE 1ZGLA 5M95B 4UMGA 5SWZE 2NW3A 5JORB 4H88L 5C09D 3TBSA 1UZ6E 1I9EA 5M7QA 3RWFB 1XH3A 1MNUH 3KXFE 4LSVH 5KTEL 2CKBB 5C0AE 3RWFA 4UUJB 5JA8B 1I9RH 5DJYA 4HG4J 2CKBA 3LV3B 2A77L 4JRXD 1KB5B 2RBLA 4XP9L 3BOVA 2HFTA 5GRUL 1DSFH 5E08L 2YD9A 3U7AA 5DJZB 3WUZA 1KYOJ 1NLDL 1M6OA 4MA8L 2ZJSL 3O8XA 1T83A 4OUUA 4YK4B 5EO1A 5DJZA 2P1YA 3IJHB 3PGFL 5DA0B 2Q7YB 1Q1JL 2HFFA 3P30H 4HZLB 1IJ9A 5FYKD 1MREL 4KROC 3IJHA 2VDKH 2I07A 3K4ZA 4NYLA 3GGWB 1AIFB 2A38A 3RHWF 1QYGL 3GGWA 1GAFH 4YDVA 4WO4C 4GRLA 3K46A 4YC2B 1CFQB 1NEUA 2HJKB 2VDMH 4Q9RH 2FD6L 1YEGH 3L95B 3V8OA 2HJKA 2QQLH 1OP3K 1BMGA 4L3EB 2Z31B 3WFDL 3PDDA 3C09B 3GMNB 3KS0H 2JK5B 3RWGA 3DROB 5TE6L 2WBWB 3D18A 1G6RL 1NMAL 2XICA 4LSQH 4NUGL 2JCCF 3DROA 2J88H 3KPTA 4MZ2A 3ILPB 4P3DB 3VWKB 3O3EB 1AO7E 4JJHA 4S2SA 3WNOA 4HH9A 2NY7L 5CGYD 3V79C 3ILPA 3VWKA 3O3EA 2W0KA 4X6FB 1N7MH 3RUGB 3PGDB 3UJJL 3GBNL 4ERSH 4QRPD 4J8RB 3PGDA 3CDFA 1QFPA 3DI3B 5MENE 4IRJD 4LVHB 4PJ5D 1I8KB 5BRZD 3CH1B 5BV7L 3IFOA 4N0UA 5K9OB 1MCWW 4LSSH 2EH8L 3UJTH 4MLSA 4ALAH 1JUFA 4KK8D 2H3NB 3EOBB 1ZK9A 4JFDE 3RDTB 2BFVH 1D5ZB 2AABL 4OCMC 7FABH 4YHIB 5IJKA 2H3NA 3RDTA 3MREB 3C5SB 2HLAB 4UINL 3EO1A 1JZ8A 1YMMA 3C5SA 1JE6A 3FT3A 3HPLB 4NZUL 2D03H 2HLAA 4R9HA 2D31B 2ZPKH 3WDHA 1BD2B 2FJHA 2FL5B 3BP4A 2VLRA 5L8KB 5J6HA 3HG1E 4JO1H 2BMKA 4PJ7A 2EH7H 5ACZA 4CJ1A 4IS6B 1JVKA 4M7KL 4RMSA 4MB5A 1VSCA 1WISA 3P0YL 1S9YB 1TVDA 1MEXL 3TF7C 1FVCA 4KKBD 3GFUA 4IS6A 1K8DB 5E4EC 4G8EB 3IB4A 3GSOA 1K8DA 4EUPA 4ODXB 5DJ0B 4RSVA 3SDAB 2NR6D 4OF7A 5DJ0A 4JO2H 5IVXA 1JI1A 5IOPB 1RUAL 5D7KD 2X89D 4GW1B 5IT2L 3JWDC 5BXFB 3BUTA 4GW1A 4DZ8A 15C8L 2IJ0C 4H20L 4F7EA 5F7DB 2Z93B 5CINL 2VH5H 3SGEH 1QUNA 1Q9KB 5D6CB 3B9KC 25C8L 2Z93A 1QPPA 1ETZB 4AEHL 4G9FB 1IQWL 2E7CA 5FF6B 2E27H 3QP3A 1N6UA 1QSEB 1ETZA 1DLHB 4QTIH 4G9FA 4ZPTB 5FF6A 3QDGB 3AREA 1ZMYA 1DANU 1DLHA 1S7RB 4MJIE 3LKRA 3Q6FB 4LQFH 1OGAB 4GG6B 4WI5A 4PY7B 4JPIA 3D39B 3Q6FA 2CJUL 1ZHBA 3MBXL 5DS8B 5D2NE 1W72B 5HDQL 1T2QH 4D9RE 2G60H 1FVDA 5AWNH 2X2YA 1LE5A 3KWWA 2CRZA 1J87A 4O9HH 1OD7A 3S5LG 1J86A 3IDJB 5FOJA 3ULUE 4HH8A 4JR9L 1KCRL 3UMTA 3B5TA 3UTQB 4M6AA 4NHUB 1NFDE 3LN4A 2DQGL 4P57B 4NHUA 1NAKH 3OMZA 5DD6B 3JUYA 2WBJD 4P57A 4X4MA 3ET9F 1QFWM 3MBEB 3ARBD 4OCSH 1FG2A 2R4RL 3HI6H 2GJ6D 4GO6B 4E5XB 1J05B 4OI8A 4J2XA 3LKQB 4Q97A 4U6VH 4E5XA 3IDYC 4ZUVA 4JPKH 3DX9A 4OD3H 4UAOB 3CUPB 3PWNB 3AAZB 5HVHC 3VGAB 4Q9QL 1ZAGA 4J4PD 4PP1D 4Y2DB 3CUPA 3AAZA 4LGSB 4NT6B 1M7IB 5C07E 1FIGL 2GQHA 5HPMA 2FJFB 4NT6A 1JPTH 1M7IA 4R26H 1YN6B 1KC5L 1A14L 2H1PL 1ZEAL 4AEFA 1MFEL 5EFIA 3WFEL 3VXRD 4KY1H 2GK0B 1I8LC 4JO4L 2FSEB 1X4ZA 4DUVA 4EOWH 5A2FA 2BNRB 5SWSE 1YECL 4NQSA 5KOMC 1SM3L 4X6DB 4U1NA 2VXTH 4JHAL 2BOBB 2BNRA 3PQYD 3GBMH 5T1KD 4X6DA 1HNFA 1HHGB 2YS4A 2XZQL 4MD5A 4OKVB 3CDYA 3T04D 1MIML 2V2XA 4NWUL 3V6ZB 4OKVA 3GB7A 4LP4A 2XZAL 4LL9A 5LJYH 1XT5A 3ZKNC 2GSGB 4WI9A 1OTTC 1YEFH 3VA2C 4N0CD 1I8IB 5FKAA 2GSGA 2R2BB 3RTQA 4TNVF 3B9AA 4BM7A 1IAMA 4WU5B 4FQIL 2VZ3A 1H3TA 1JMZA 1TIUA 2IMNA 4XCFL 1IAII 3EBAA 4WU5A 3WIIL 4KI5D 3GSRA 2AEQL 1WFTA 2KZ1B 3QWOB 1QG3A 1DVFC 5FYJD 1NH6A 5EWIL 4PLKC 1CFSB 4APQA 4OFPA 1U36A 2ZCLL 3QA3B 2A2QT 2B5IB 2XKNA 1MAMH 5F1OB 5GGVH 2VDRL 3QA3A 1FV1A 4PJ8C 3F5WA 4Z7NF 4JGMA 2NXYB 2V5YA 5J11C 4TYUA 2FHCA 2D0HA 4PJGA 3OWEA 3RBGA 4MNHB 5H35A 5C09B 4XTRD 4OZFH 2A9NH 5C09A 4A2LA 3NBNA 5LGKA 2AJUL 3DIFA 2OTWB 4UB0H 2AEPH 2OTWA 4JRXB 2G2RA 4J3SA 4MLIA 2ZOKB 3U36A 1JTPA 2UZIL 1A6ZB 3QQ4A 4HIHB 3LPFA 2KL6A 4E9LA 1OQXA 1VKXA 3CVHL 3QEHB 4O51B 4LCYB 4X6EB 1EERB 4K55A 3BW9A 1BFVL 5CMAA 2GTZA 4OBRA 3L5JA 4P5TA 2AEIT 2NCMA 5HXMA 3VXNA 5D1ZA 2XNAB 4MA1C 5JQ6L 4N9GB 4HX1A 2R9HD 4NO0D 3I6GA 4JQXA 4KKLC 4L4TE 4HS6B 5D93C 3IFLH 4N9GA 1MF2H 2NY5H 3B4NA 1KENL 2VN7A 3TBTA 1IAIH 4DVRH 4KGLA 5F89B 5DUMH 3V7AG 4MXWL 3ECBA 3HNTH 3BD3A 3MV11 4DKDC 5IHZA 1NFKA 1IC7L 1E4JA 5ACLA 3W11C 5TJWK 3BGFB 5I0DA 1EEYA 3SPVA 2CLVB 4WTXA 3VRIA 4L3CB 1U6AH 3BMWA 2W9EL 1HKLH 2IALB 2GFBA 3OKOA 3ROLB 3HNVH 3BZEB 5ICYA 3NIFE 4QRPB 3UTTD 4G6KL 3V5KA 5HHPB 2QQNH 4D8PB 4IRJB 4NQEE 5CS7A 1IFHH 3OV6A 4Z7UB 1RMFH 1TQCC 4P2CG 4PJ7F 1HEZB 5ETUB 1RY7B 3G6JE 2Y6SC 4PJ5B 5GJTL 5BRZB 4ZODA 3O3DA 2C1PB 1TJIH 4Z77A 5IR1B 1HEZA 4GQ9L 5GSRB 1CBVH 4WEBH 5BRZA 4PD4J 4HFUH 1SVZA 4Y1AA 1UM4H 4HDIB 1YEIL 3UTSD 1VFOA 2YD5A 5INCA 3T2NL 4HDIA 4YQXH 4JFFE 4XAWL 1EVUA 1DBML 1N5YL 1CLZH 3C6LC 5FHAL 1VERA 2O5ZH 3Q3GA 3BP6B 4HK3J 4A6YB 4GJTB 5IVXF 4IOIB 3X11A 4G8GD 5IBTH 5KZCD 1NEZG 1T7WA 4UTBH 43CAB 4XPTH 2YN5A 4NOFA 3DUHA 5LBSL 1KULA 4GG8B 43CAA 4S1RH 2VDPH 4WWKC 3FB5B 4GH7B 4GG8A 3MRRA 1TITA 5KOVC 2FHBA 2X05A 3EW3B 2FO1A 1U3HC 4MSWA 1KXVC 4CNIA 1MVFA 3IKCA 4PV9B 4J6RL 3HA0A 1WIOA 5CJXA 4OGAC 4YPGA 1KTRL 2FO4B 1PG7W 1BIHA 4LU5L 4M43H 1BM3H 4WUKH 4Z0BH 5LQBL 4M1GH 2WSKA 2DYPD 2ICEA 1I9IL 1OM3H 2V9TA 3BPNC 4X4XB 3TFKD 4JFPA 4U3CA 3AC0A 3PWPE 5L7XH 4GOSA 4NHCH 4X4XA 2UWEB 4MAUL 2XFXB 3MV9E 3W0WE 5GZOD 3QRFM 3PV6B 4UT6H 1K4DA 3QULB 3T0EE 2EZ0D 4QO1A 5E6ID 2DDQL 3T0XA 4QLRA 4OAWB 5MERB 3D6GA 3QCVL 3P0GB 1S7SA 4OGYL 3QIWC 4OAWA 1QBMH 4OF8A 4MMXC 4OFDA 3MOAL 3MRGA 2X4PB 3RNKB 5HYQB 2KQNA 1LDSA 3LSOB 5EOCJ 3EGSB 5ALCL 4XPBH 2X1OA 2XWJA 4JCLA 5GJSL 1CL7L 4PIRF 3LSOA 1MH5B 1RZ7L 3CFKA 1UJ3B 3SDDA 2EIEA 2VLJA 1NCAH 3DGGB 1OTUD 1EEZB 4FS0A 3VFUB 3B2UC 1F3JB 5ID0A 1NC4D 1EUTA 5F96L 4LARH 3QDMA 3JSSA 1S9WB 2X6MA 4XI5C 2WBJB 2PO6D 2XY2A 1J9CT 3E8UH 1FLRL 1ZXQA 1SJHA 3BIAX 3QXVA 3ARBB 2GJ6B 3EYOA 3C8DA 3ZYOA 1MCSA 2HG5B 1JYXA 2QHRH 2GJ6A 2IAMD 1WGOA 5KVDH 4G6ML 2X1PA 4ZTPH 1YQVH 2P48B 4X6DF 4XMPL 1X5FA 5C9JA 5DXWA 1NUNB 2D7NA 4UT7L 3FO2B 5HHOD 4NGHH 3V7AE 5CSBA 1MUJB 1N0XH 3IU4H 4X5LA 5L9DH 5FYLL 1O7VA 1RJYB 1O5DT 3VXRB 3IDMB 2OMNA 2ZCKH 1HE7A 1MCEA 1D5XA 4FQXC 3AM8C 5FGCE 5A2LH 4G43A 4HQQL 4OZFG 4JREB 4JN2B 2AK1H 3GJEA 1J7VR 3MLVL 4EBQL 3TPUB 1OARL 3PQYB 5T1KB 2P8MA 9CGTA 3TPUA 5HYSB 2Q86A 1PGRB 1F45A 2NLJB 1PBYA 3PQYA 1FYHB 1RU9L 4LRIA 4E41E 4P3CL 4ZAKC 4HF5L 2DWDB 2NLJA 4HJ0C 2I25N 2MPAL 4FQLL 4S1QL 5B8CA 2ZUQB 4Q7DA 5HYJE 2XG5A 1ZT1A 3S36X 2KKQA 4XC1H 4K8RC 4G7YL 1N3NB 2ATPB 4BYHA 2LU7A 4FQ1L 3O9WD 1N3NA 2ATPA 4PJGF 3A6BH 5FDWB 3VDBA 2FDBP 5JW4R 3BESR 1E4KA 3FQWB 3PL6D 3SGKC 1DE4B 4LCWA 3H9SD 2OXHA 4PV8B 4LRNH 1DE4A 1U8MA 5JR1L 2Q7NA 2FZ3B 2CGRH 4XPHH 4Z7WB 4DQOL 4AJ0A 5I8KH 4YBQC 5FCUH 2VMFA 2V5TA 3O6KH 4XP4L 4DN4H 3NZ8A 3O6FC 1WWBX 3OAZH 4RQQB 1TZGL 4GSDL 3EYUL 1DQTA 3EHBD 1S7WA 4LSPH 3M07A 4GRWB 4JHWH 3WN5C 3TH2T 5L0QC 2NXZD 3X12B 3QEQE 3QIUD 1BOGA 3TEUA 3DMMA 4POZC 5E2JA 3X12A 3U79A 5DMKB 5HYIA 5KSBB 3DUUA 3NFNB 4OLVL 1KJ3L 3VFMB 3SOBH 5DMKA 4F15C 1AFVL 1RZ8A 2DWEA 5AD0B 1J0ZA 3WNMA 3CFEB 3DX8B 3OG6B 5IW6B 4UU9B 2BOCB 1G9EA 4P2RE 3CFEA 4I3SH 3DX8A 1AHWB 2IF7A 4U7KA 4EN3A 1Y18A 1AHWA 4MHHI 1QQDB 1CR9H 4Y5XB 3U46A 4DZBB 5DRNB 1MHEB 4PRNB 4UV7H 2F5BH 1QQDA 4NO0B 4FP8L 3RX5A 1EHXA 1MHEA 4UNVA 4PRNA 2DMKA 4NO0A 5BJTB 5K33A 4YHLH 2VZTA 5C7XH 2CUIA 4MNGB 3SO5A 5BJTA 1FBIL 1Z5LA 1NAMH 3Q5OA 1GGBH 3MA7A 3HMXA 1NGYA 4MA7L 4WFGD 5EBMB 3V4UL 1XF1A 5EBMA 4NRZA 5IEKA 1JF6A 3OTTA 1JHKL 4PJEB 2HT3D 3G6DH 1KJMB 1DBBH 3I6KB 5DHXB 4CU8A 4UILL 2FIKA 3HS0B 2UY6A 1EO7A 3D2UA 3GRWL 3L3OB 2HVKA 3I6KA 1G6RB 4GQPH 4RA0C 3QUKA 1WEJL 4RWYL 3UTTB 4HS3A 3TIEA 1GGIL 4Z95L 3S4SA 4Z7OF 1KBGL 1TZHA 3UTTA 2AKRB 1CIUA 4QHMA 4QF1B 4UV4L 2K9UA 5B39A 2AKRA 1GC1C 1GH7A 1BFOB 2ZUWA 4I9WE 3V0WL 3N1MC 3CSBA 4TN9A 2PXYC 4DN3H 1BFOA 5HVFB 3NN8B 3TT1H 3BN9C 3UTSB 3UYRH 4C83B 4WV1A 5BV7B 3UCRA 5E9DA 2DLFL 1G7QB 4C83A 3P4OB 3QSKB 3GMMB 1BQSA 3WIFA 1NDGA 1TCRB 3K2MC 2CUHA 3FB7A 4NQTA 3RL1A 5IB2B 3LMJL 4G8GB 3ZSSA 1TCRA 5KZCB 3V5DA 4KMQA 5I1CH 3C60C 2N7AA 4KJWC 4LSRH 1A7NH 1VEPA 3KPPB 3O2DA 4QHKJ 1M4KA 3RGVC 5GXBB 4YBLB 3C9NB 4QT5B 4GAFB 2J6EH 4XP6L 3VMNA 4QT5A 12E8L 1NBVH 4K71B 3V5HA 4FQHB 1B4RA 4I8DA 3T8XB 3ULVL 1B3JA 4S0TD 4YDKL 5AG9A 4TOYL 1FDLL 3PE9A 1YEEH 2GJJA 2DKSA 2A74A 4I1NB 3SQBA 5JLZB 5F6IB 1GPOH 1LO3L 2FEDC 3QFDB 3QIBC 1I7RB 1JGEB 5JLZA 2DYPB 4P9MH 3CDGA 4I48A 1I7RA 2MCG1 1IKNC 4RFNC 4TSCH 2DYPA 1KB5H 2VDLH 1FCCA 1XGQB 4M7JL 1YEJL 1FFNB 1U41A 2M1KA 1LD9A 1XGQA 4NPYB 4PJDA 4QXGH 2Z91A 4XP5H 1GYAA 5EUKA 3WD5H 3QJHA 5E6IB 5DT1H 1OAUH 2VUYA 3ROOB 1A3LH 4YGVB 1LK2B 2WUCL 4X99A 2VXSL 3QUML 2AJSH 5BMFL 3ROOA 4EI6B 3T2QA 3U9PL 5CUSH 1EMTL 3WFBL 3S88H 1P4BL 4FFVC 1Z9LA 1U8LB 1UEMA 1PX4A 3UBXI 2VSDA 4YFDB 4QGYA 4ODSH 4QRSA 4R2GC 1GZPB 2B4CC 5KW9H 2BNQD 1EO5A 1SBSL 1ZKAA 3NMEA 4HWZB 4DTGL 1NC4B 4XC3H 2G75B 2I60H 5KAQF 2PO6B 4XVUC 3REWB 4QNPF 2J3SA 2E9WA 1T4KA 3NFPA 2PO6A 2VLME 1S3KL 4MXQD 1UM5L 4OSUH 4S1SL 3IAQA 4D0BA 1R3IL 2IAMB 1FGNH 5T1DH 3HRPA 2OXGA 5F3BA 5HHOB 1AD9B 1IL1A 1OW0C 2HT2D 2XZCL 3DUSA 1AD9A 4L8BA 1I3GL 1HINL 1FZKB 1IM3B 1QA9B 4AQOA 1KOAA 3C8KB 4OIBA 1L4IA 1IM3A 3FONA 2BRRH 1E6OL 5DR5H 1R3LB 1SY6A 4R7DB 3LAFA 3P40A 2ZUTA 4L29B 4D3CH 5FYLD 1PZ5B 3Q5YA 4QXTB 4R7DA 1D5BB 1K6QL 4L29A 5E5UB 1PZ5A 3WHE0 4KI5F 3TCLB 2X4SA 5IBUB 4ZSOE 3NPSB 4U1JA 4WNQB 1QR4A 1A0QL 1A7QL 2HLFC 3ZTNH 5BQ7B 2Y23A 3S96B 3A6CH 4OZIE 2MQ3A 3MCKA 4FZ8H 5T3XE 3GI8L 1E28B 3OAUL 1OP5K 3S96A 5BQ7A 4JPVL 4X9IA 5DJ6A 1JPSH 3O9WB 2JTDA 1E28A 3WSQH 1IGML 2HKHL 5C0JB 5I6XC 4XH2B 5IVZB 5DSCB 5JOFB 4PG2C 1MRDL 4UQ3B 2R0WL 3PL6B 1ZA3B 2FECI 4XH2A 5D2NC 1BZ9B 2X4RA 1NGPH 5ECJE 4LEXH 5DSCA 3H9SB 2WM0A 4BK4A 3MRQB 3PL6A 3QH3A 1ZA3A 1AR1C 4G6AC 1RZKH 3K8MA 1BQHB 1MCFA 1FZJA 3QZWG 3H9SA 3M1BB 1DBAL 3MRQA 3E1F1 4O5LL 5HDBF 3GO1L 3RKDC 5IQ7H 1BQHA 3QYCA 5KG9B 3B6SA 2OR9L 4JFHD 3ZMRA 3ULUC 1M71B 4LLMB 3U0WL 3QNZB 2KQMA 1QFWH 4ODVL 2R4SL 3F7VB 4ONGH 1P7HL 5J57B 1T1ZB 1PYWA 5DQJA 5EUOB 3WJJC 3I9GH 1JN6A 4RX4D 2NXZB 1S78D 2HP4A 4PYHA 5I1EL 1TMCB 3FCTB 3QIUB 4LLUB 1QSFA 3LS5L 3QIUA 1B9ZA 1JWUA 3MLZH 4WCYL 4NJ9L 5C0FA 2Y07L 5JIKA 1E4XI 2ERJC 1MCWM 1OT1A 3NIGF 4Y4KD 3FMGH 4R8WH 3WIHH 1WWCA 2JCCE 2OR7A 2RQ8A 5D71L 4WW2B 1UH2A 2FBOJ 4QHLB 3TO4A 3MRLA 4JVUA 4OLEA 5I18L 4M4RA 1X5ZA 5FUCE 2YRLA 4DFHA 2X1WL 1HSAB 4OV5B 4X6CE 4G42A 4LAQL 5C3TA 4U1KB 1UA6L 5FO7B 2NY1D 3ESVF 1ORSB 4KV5F 4U1KA 1TETH 1WBXB 1WSST 4FFYH 2IWGA 2E6PA 1CT8A 4BKLA 3DI2B 4J1UA 5HY9B 3VRJB 4YLQT 4LAJH 4PJBE 5A16B 4BQ8A 4AY0A 3VRJA 1HHKB 4JFQA 4YXHH 4XCCH 3T65B 2EDTA 5ANMA 2D7PA 5EZIL 1RFDH 3J7HA 2H32H 4R96B 1V7ML 5HVWA 1CXKA 4L9LB 1QVOB 1ZLWK 1FRGH 3QUZD 2BVPA 4B53A 3MA9L 2COQA 4ODHL 3H0TA 3KNBB 5BZWA 4BUGA 5ITBL 3KPNB 2V17H 3LIZH 4Z7VA 4JLRA 3UDWA 5FM4A 1RZGB 1CD0A 5EU5A 1MRCH 1CE1L 1AY1L 1F8TL 4Y89A 4FFWD 2FX9L 3F6IA 4JO3H 3OGCB 4LCUB 4LBEA 3G5ZA 3ZYIA 5BOPA 2FR4A 5D1XC 5KSAD 2F5AL 3I2CL 4YHML 4FTVE 4KXZI 3BD5A 3QT2A 2VAJA 1SJEB 1G84A 4QRUA 3GSXA 1U8OB 5IEHB 3SBWA 5F1NA 1HIMH 3ZE0E 3CFJA 1J0IA 2VDOL 1U8OA 5IEHA 5C0CA 1C5BH 5DC0A 1L7TH 4Q6IC 2IH3B 3SJVE 4X80L 2GITB 1TPXC 3ARGC 5KVEL 5H2BA 3PF2A 5C2BH 4M48L 2GITA 2R56H 5F9DC 4XPGL 2DJUA 1EK3A 1XCQA 2P44B 2QBWA 4Q0XL 4MZ3A 4H5SB 5C0BD 3X14A 5TDOB 3NABL 5E8NB 2R1YB 5FO8A 2R0KL 1F6LL 3MRIB 4PJDF 2R1YA 5CD3A 5IFHH 6CGTA 2F58H 3FJTA 4F37K 1ADQH 3JWOL 4DCQB 5IHLB 1DQDL 4JHZA 2VABA 1C12B 1VHPA 2YWYA 4ZPVA 1UACH 2IAND 3ULVD 2R29L 1B0GB 1C12A 1Z6JT 4OZGB 1RUML 4GT7A 3NGBC 4X7EC 5D8JL 3F6LA 3FFCA 5HD8C 3GSQA 4MAYC 3UZQA 5K9QI 4P4RB 3MX0A 2FB4L 1LO0L 1P7KA 2JJSC 3WCYA 3D25A 4XRCB 2FRGP 5DRXB 1DBKL 1YA5A 1T03L 5IJVB 3FT4A 3BI9X 1DFBL 2AXGA 1OAQH 3X13A 1MI5A 4NM8H 2R23A 1HI6B 4MWFB 4WHCA 4KUZH 4OD1H 3TIDB 3L3KA 3JWNC 1ZANH 3FOMA 4MWFA 1HI6A 4ZOBA 5GGSB 4PJAB 3T1FB 1G7IB 3VDAA 3KJ4B 4KPHL 5GGSA 4PJAA 5HGDB 3NA9H 2OCFD 1G7IA 4JZJA 5DJCB 1J5OL 1NCNA 4HT1L 2H2SC 1GJIA 4ETYA 3H7BA 5E2TL 3WUWA 3ARXA 1EFXA 4LOUC 4EUPG 1F3RB 2BNQB 4YHKL 4ZXBC 3I6LE 3MRBA 4YFEA 3N50A 1X5GA 3QEUB 4G8FB 3EYVB 1JGLL 5IHUL 4M03A 3I02B 4BJLA 3ZDZF 1KUMA 5B3JF 4G8FA 4JY5L 2H8PA 3P4MA 5FA4B 4J7RA 3I02A 4GUPA 1DN0B 1QRKA 3HFML 5FUOH 1NCDH 5MI0B 3SDCA 4BUHA 1DN0A 2VXVH 5EDXA 4R4BB 5IROC 3L3IA 1FLTX 4R97C 4XPAL 3SDXE 1RUQL 4M02A 3MJ8B 4EI5A 2V2WA 4BH7A 2H2PC 4X5WB 5DFVD 5J1AB 3NCBB 3VMPA 3V6OA 3UTZB 4X5WA 1G7JA 5J1AA 5E6ZA 3D3VA 1G1YA 3GMOA 3UBXA 2AJ3A 3HZMB 1AGDA 3VH8B 3HZMA 3QHTC 1N4XL 4P4KC 3ZKSD 1A6TB 4HGKC 5DD3L 1FNAA 3V4PL 4CVZB 3VFVB 1S7QA 3GJFA 1A6TA 2L4OA 5EC2A 4B7LA 4JKMA 2OX5A 4Z5RA 3QFJD 1X6LA 4A6YH 4CVZA 1BVLB 3HC4H 3EO9L 3Q48A 3U4BL 1Z3GL 4PR5B 4XWOC 5J3HD 4Q9CA 3QRGL 3EIFA 2DL2A 1NCTA 4KK9C 4QHUB 4PR5A 2RGSA 5EZOL 4WFFD 4YNYA 2ICWB 4UOJA 4LEOB 4KI1A 4MNQA 4ZS7L 1T3FB 2KPNA 4UIKH 4Z7QF 4FNLL 3WFHB 3SKOB 3ZKQD 3MLUL 3WFHA 3QDHA 1JWSB 1I1CA 2DI8A 3T0EC 4M8QB 2EXYC 1MJ8L 3VXSD 4M8QA 4PB0L 1ZGLP 2QSQA 5HI5C 5GGQL 1CICA 1MJJA 3VE0B 3O4OB 4HJGB 3MV7D 3FZUC 3H6JA 3VE0A 1QKZH 2A6DB 3VXPA 3MJ9A 1BQLH 5I73B 2XTLA 1NMCC 1U8NB 4XT1C 4U1MA 4M5ZL 4XCNB 4H1LH 1Z9OA 4RMTA 2JELL 1U8NA 5F9AC 4L3EE 5F8RC 4X7TB 4FG6D 1CU4L 5J8OA 4OCYH 4OM1H 4EXKA 1WIUA 4DEPB 4X0KA 3C08L 4P5MA 4OCWH 4GFTB 4LLQB 1LDPL 1EHLL 4RX4A 4LLQA 1WZ1H 3ZHKA 3WHE1 1NCWL 1QZ1A 4KJYA 3U0PA 2GJZB 1EJOH 3RUGE 1C1EH 1TVHB 5DVKA 3QB7C 5TDPB 5GHWH 3O3UN 4RRPA 1YEKL 1SBBA 4K94C 2Q8BH 2MCPL 1F6AB 3ARQA 4S1DD 4JQVA 1EVTC 4L3AA 2VDQH 5DVLA 1VGEH 4K3JL 1L0QA 4Y4KB 1TCMA 1NBZA 3BIKB 4POYA 4S11A 2NY2C 3GNML 4TPRH 4Y4KA 2H32A 4FMFA 3PWVA 3VD7A 2UZYB 3R8BB 3BQUC 4PRAB 1J1PH 1RIHH 5F9WC 5E8EB 1AXTL 3HLAB 1SHMA 3KPMB 2LU4A 3QCTL 4TVPL 3HLAA 3KPMA 5IB5B 5CGMA 2NY1B 1BD2E 2X44D 1KPUB 3L1OL 2IPTH 1KGCE 4UZGA 1KPUA 4IIQA 4JFYB 3RBSA 1BVZA 3EDJA 4B41A 2JJTA 1JGVH 1ULVA 4Z7VF 1C08A 1OWRM 4FABH 4WU7B 3BKML 2FIRT 1NGQH 4LSTL 1OAYH 1DQQB 1NSNL 4ZOAA 2FWOB 3S3PA 5LAXB 5I74C 5D4QA 1LO5B 5DC4B 2YK1H 4LLYA 4WI4A 3NAAH 2YSSB 2K3TA 3TN0D 4L5FL 3QUZB 3F58H 3BWAB 3OJ2C 1DLFL 2F53D 3F12A 1CXHA 3HAEB 3QUZA 3FT2B 4PJFB 3H2WA 1ZVSA 4TRPL 1HYSD 1D9KC 3GI9H 2AJVL 2DQDL 3FT2A 5F1KC 4PJFA 4YDIL 4ZMAT 5FGRA 4KDVA 2VWEE 3D0LB 1NJ9B 4G9FE 4KHXH 1XZ0A 1IKFL 3DSFL 2WLZA 5B4MD 3WO4C 1QSEE 5A1AA 5I19H 5KSAB 1GCFA 3QDGE 2Y36H 4LCCB 1A1NA 1QBBA 4I0PD 4NQXA 1DUZA 5KSAA 2VUOA 4PJCB 3U30C 4GG6E 1Y6NR 1A6VL 32C2A 3B83A 3D39E 4PJCA 1KN4H 5FYJH 4NP4H 2DLIA 1AC6A 2N4IA 3NTCH 1BBJA 1XAUA 1K2DA 5B22A 5JZ7C 1MWAL 3LQAL 5D1QA 5TQ2H 2IPUK 4LVEA 4Y4HA 5C0BA 2EDKA 3HI5L 3OKKA 4N90E 4ZS6C 1HDMB 2IBGA 1I1AD 4XXCC 3STBA 4GRWH 4LFHG 3Q1SL 2M8XA 4JRYA 1J1OH 1WBZB 1T1YB 2NY6C 4OD2B 4HULB 2IANB 1QLRA 4UIMA 2YUVA 3BYTA 4OD2A 1PD6A 5LGHL 4H88H 3M17B 1G7HB 1XF3B 2NX5D 5MHSE 4PJAF 3ARDC 1I1YB 2EYSB 1RULL 1A6WL 1G7HA 5KTEH 4X9GA 1CD9B 2FX7L 3ES6B 3OKEB 1PKQA 2OS7A 4Y19D 5FECB 2A77H 2XV6B 1X5JA 5E7FA 3ES6A 4XP9H 5L2JA 4HBCL 3OG4B 5GRUH 3D85D 5E08H 4P46A 3CD4A 1PLGH 1R3HA 5FA3A 4QHNB 4MA8H 2ZJSH 3V52L 3K1KC 3PGFH 4WTZG 2KZWA 1Q1JH 4QHNA 3TWCL 3TA3D 4IRSC 5TFSL 3WNPA 2EEAA 2BNRE 4Y5YB 2DKMA 4X6DE 1CYGA 2YC1B 1CLYL 1QYGH 1KXTB 2PF6A 4CU6A 5EH1A 2LTQC 1VFAA 3IF1A 2KH2B 2HJLA 3P77A 3TVMC 1CVRA 2EC9T 2FEEI 2FD6H 1T1XB 5DK3A 4QY8B 3S98A 1AI1L 1AP2A 2ILLA 3GIZL 3WFDH 2NZ9C 3QWRD 1U93B 4ODBD 1FYTD 5TE6H 1NMAH 4Q2ZB 5H94A 2J8OA 5DHYB 1T1WB 4PJIB 5TGBA 2CDFA 5IFJA 5DHYA 1A4KB 1T1WA 2NY7H 2EO9A 3BH9B 5D5MB 2YD6A 5KN5B 3DNKA 1BJ1J 1D6VL 3BH9A 3UJJH 2G5BA 3GBNH 2VOTA 3G08B 3RVXC 1ZT4A 4OZ4B 4NN5C 3CZFB 4WI3A 3G08A 1U42A 3P9LB 1U95A 5BV7H 3KYMB 2APFA 2EH8H 3ELAT 2V9QA 3LS4L 2ATKB 3MXWL 1U3JA 3BGMB 3KYMA 3MJ7B 4OLZL 3CCHB 3MQIA 2ATKA 3QFJB 3VG9C 3BGMA 2AABH 5C09E 3O4LD 4PFEA 5EU4B 2NMSA 4QRRD 5DK0B 4UINH 5J12B 2VERN 1FSKB 3L6FA 4Y16A 3U82B 1H5BB 5DK0A 5ILTL 1IAOB 4TUJB 2OI9C 4M8VA 3PP4L 5D6DA 5FHBL 4Z8FL 1IAOA 2X1XR 5D96B 1CFNA 1CGVA 3P2TA 4JRXE 2M2DA 1T80A 3GUTB 4M7KH 4FXGB 5MP6L 3P0YH 4U1LA 4Y8DC 4MB3A 4R0LA 1FGVL 4FXGA 4U1HA 2ICWJ 3VXSB 1ZA6B 2ZP0T 5FYKE 5DMGC 4KDTA 1QHPA 2O61B 5EO0A 1JRHL 4EVNB 2YKLL 5TF1L 1RUAH 2O61A 3MV7B 5D7JC 5IT2H 3O3BB 3MV7A 5ABDE 1L6ZA 15C8H 3MTRA 4H20H 4NRXA 4NNPL 4PJXB 5CINH 2BVYA 1UJTA 2GCYB 4JZNA 1MLBB 3RWEB 25C8H 4XXDB 2W60A 2XTJD 3OKLB 4AEHH 1IQWH 5IK3B 2CMRL 4XXDA 2C3VA 4ZUSA 4KJQC 5JTWA 3B9KD 5DVMA 5IK3A 1IGCL 3QWQB 4ODWB 1S8DB 3SKNB 4EIGB 1UWEL 5I15L 2ED8A 5DEFA 4ZYKA 4L4VA 2HH0L 5T5NF 4CVXB 4RGND 4I3RL 1MVUB 5CBAB 4U7MA 2NW2A 5C3LD 3QPQD 4QRPE 3MBXH 4EZMA 1MVUA 1OHQA 4GS7C 5HDQH 4Z7UE 4Z78B 1YC7A 2W9DL 3GKZA 4PJ5E 5BRZE 2APVA 5IV2A 2YD1A 3PWUB 1MLCB 4NC2B 3BX7C 3PWUA 1MLCA 1Y0LB 1GRWA 4JR9H 1KCRH 4DVBA 3RL2A 4C57C 4JKKA 3KPQB 4X98A 3DO7B 4YX2L 2W07A 2DQGH 4TUKL 1R24B 2DQHL 3KPQA 4M9PA 4NZJA 5L2KD 4NN7B 4Y4FD 2VN4A 5I17A 1MHHB 4NBZB 2W0LA 4F7MA 2R4RH 1PQZB 1FO0A 3KG5A 1I7ZA 3AS2A 2F54D 4J3UA 2ZZUT 4TVPD 4E42A 4XX1G 4PJFF 4RIRA 5LG1A 2J7LA 2VTFA 1AC0A 4Q9QH 3CFCL 2EC9U 4BFEA 3RWJA 1FIGH 5C0IB 1J0JA 3MRCB 3TN0B 5C08A 1KC5H 4JM2A 5D7KE 2H1PH 1ZEAH 1CDHA 1MFEH 3WFEH 2F53B 2E7MA 2Q6WB 4JO4H 4PJCF 2V7NB 1KEMH 3REVB 4ELKB 1BPVA 1NC2D 1BEYH 2FATL 1YECH 4BSVA 1MCCA 1SM3H 4I0KA 4ELKA 3REVA 4JHAH 4BZYA 4HIIB 2XZQH 2P24B 2UWEE 4AEIH 1MIMH 4NWUH 1CFTA 2XZAH 2DQTL 5SX5H 2VE6B 3NIDF 4I0PB 3QG7L 3MLSL 1FNSL 3PWJB 2VRAA 4DFIA 2MMXA 1GOHA 4D0DA 5DD5L 3MRNA 1YY9D 4JFEA 5J0BA 1RZIA 4FQIH 3ZKND 2Z35B 1OTTD 4RAVB 1U0QA 4XCFH 1RUKL 5ADPL 5IB4A 5GS1B 3WIIH 5F1SA 3A6OA 2AEQH 1FL3B 4XVSL 4RAVA 5T3XL 3WLWC 4JZOA 2VR9A 3D0VA 1HWHB 5DZNA 5EWIH 1LEKB 2BHUA 5TPWH 1YEHL 2ZCLH 2RAMA 5E5RB 3F7RA 3P73A 3BDXA 4JQIL 2PYEA 3BZ4B 3FB8A 1I1AB 4OKDA 2VDRH 4BK5A 2MHAA 4NM4L 4WIQA 4BH8B 3BZ4A 1T89C 3MOQA 3RGHA 5FUCC 1U3YA 2GK2A 4LLVB 2NPLX 1IC1A 4BH8A 4BQBA 4ZUUB 1B90A 1ZSDB 4K3EL 1KELL 3S4SG 3GMQB 2NX5B 3W9EA 4M62H 2GJ6E 1ZSDA 1H3VA 3SE4A 1MCIA 2ESVA 1QP1A 3GMQA 4XMLL 5B39G 2NX5A 5E5MB 1QO3A 4X8JB 2AJUH 3RHWK 3AGVA 4NKDB 2HT4C 3KPRD 4Y19B 1T20B 3H42L 4Y19A 3SKUD 3WJLA 3D85B 4F9PC 1T20A 2CRYA 5IG7A 2UZIH 1JHTA 4KVCL 2W92A 3TO2A 1R5WB 3CVHH 2HVJB 1S9VB 3UYOD 1VDGA 3VXRE 5C92A 3OKYA 3TBVB 3TA3B 1BFVH 1G7LB 5DEGA 1INDL 3TA3A 5D2LF 1MY7A 5C70A 1G7LA 4HC1L 3QQNA 3KPOB 4ZUTB 3PQYE 5JQ6H 4MD0A 4FZEL 1Q9LA 3KPOA 2YD7A 3LH2L 2P5WA 1Q72L 1BLNB 3IDNB 4XHJC 1M05B 1BLNA 3MACL 3WXVL 3UJIL 1UVQA 1M05A 3BKJL 1X9QA 2BX5A 4MXWH 4WO4A 3ZTJH 1FYTB 5JHDA 5JIHA 4H26B 1Q9OB 1A3QA 4UOW0 1KCVL 4JAMA 3TESA 3G6AB 1FYTA 3AXLB 2CDGB 1IC7H 4HKJA 3G6AA 4KI5E 1KPVB 4MXVF 5C0DB 3V0VA 4KJPC 3O2VL 3CPLA 2BXZA 2EE9A 3RPKA 5FYJE 5EG6C 1UB6B 4G6KH 3I50L 3S5LB 4GKZA 3QUYC 4Z7WE 1HQRA 5GJTH 4WY7L 4XX1E 1OSPL 4GQ9H 3BWUC 2CK2A 3MJGX 4GW5B 3KAAA 5LWYH 1YEIH 1C16A 1GSMA 5CZXD 1FVEA 1ZE3C 1EGJA 1F97A 1ZV5A 3WBDA 1ZHNA 2HJFA 2FLRT 3O4LB 3T2NH 5MEQA 4QRRB 4GRWE 4CADA 2WIIB 4HGWA 4WJ5B 3O4LA 3UEZA 4LF3A 4XAWH 3WV0A 1N5YH 4H0HB 4QRRA 5HDBE 4WJ5A 4P5KB 1I1FA 3R06B 3SKMB 1F90L 2OJEB 4P5KA 4KMTL 3R06A 3SKMA 5KSBE 5E1AB 4YHNB 2HTLD 5LBSH 3DXAA 5GPRA 3WEXB 3BYYA 5KBNC 1EAPB 4IOFD 3PHQB 3GSVA 4K7FB 3EZJB 1E6JL 1X7QB 5JO5B 2N1KA 1INQB 5JO5A 2DMBA 5JA9A 1HWGB 1A4JB 2DQIL 1FNGB 3HE6D 1INQA 3OR7B 2WUBL 4J6RH 3V2AR 4HJJL 5F7EL 5HHVL 1YNTB 4LU5H 2DRUA 3QJFB 4KKAC 4MNGE 1YNTA 5LQBH 5L6YH 1I9IH 5CD5C 2YUXA 5ESQA 3UYPA 2XTJB 1IGIL 2NY3C 5KS9A 5FM8A 5GZNC 4UBDC 1OTSC 4PJEE 4KVNH 3B9KA 1SJVA 4TTGA 1L0YA 2DDQH 4RGNB 5FXCH 2Y25A 5MEPA 5E56A 1KEGL 4KV5E 3QCVH 3UTTE 4OGYH 1LP9B 1TLKA 5IBUG 4ZFOB 3CK0L 4QOKA 2Y1VA 3CSGA 1CL7H 3QPXL 5GJSH 2EE3A 4NFCA 4F58L 4ZFOA 1IGTB 1RZ7H 5CFHA 3U4AA 3UTSE 2UYLB 4KMLB 2W91A 2X7LB 3RWDB 1BJ1H 2IG2L 2UYLA 2X7LA 5F96H 2HMIC 3FO0L 4A2MA 3V8CA 3MXVL 4J3OC 5L2KB 4Y4FB 4JM2F 4G8GE 1FLRH 5L2KA 5C6PB 1RZJC 4Y4FA 1BQHG 5I16A 2F54B 2XN9D 3TM6A 5F1IB 3RWHB 2F54A 1MOEA 5IMOB 4G6MH 5F1IA 3BGAA 2QADC 1L7IL 2VIRA 3ARRA 3BP5A 3RWHA 5IMOA 1QRND 1AGBB 4XMPH 1PEWA 1T7XA 4UT7H 3DBXB 2LQRA 1AGBA 4YK4C 2XA3A 1MJUL 3BXNB 2BVQB 4H8WL 4XGZA 5J89A 3DBXA 1U91A 3BXNA 5FYLH 5GGTA 2VXQH 4OZHA 3VXMD 4KWUA 2AQ2A 4FQQA 2YPLD 4HQQH 3TBYB 1ACYL 1NC2B 5KSVA 3SQOL 3GDBA 3MLVH 4JKPL 4EBQH 5EIIB 3TBYA 2EXWD 1OARH 1XGPA 2OL3B 2YHGA 2R2CA 4JPWH 1FFQA 4AIZA 4YC2C 1LEIB 5EIIA 2OL3A 3S37L 1I8LA 4KK5D 2ZSVB 1RU9H 2R2EB 4P3CH 3N1QC 4HF5H 4F7TA 2NTSP 2Z31C 5IESH 2ZSVA 3ZE1F 2MPAH 3C09C 4S1QH 2Q76A 2P8LB 4PGEB 3S35L 5K9JH 3SCMD 3V4VL 1RZJL 1D6EB 2CKBL 5ICZA 3HZYB 4G7YH 1J1XL 4HMCA 3VWKC 4CN6A 4FQ1H 1RAMA 1VGKB 3RRQA 2BVTA 1ZWIB 2LV4A 4NO2A 3QI9D 1MCPL 3U0TA 3ILQC 1LGVA 4ISVA 1ZWIA 5ISZA 5DHVB 4LVHC 2X1QA 3BRGC 2Q20A 3CLFL 4UQ2B 4ZD3L 5JR1H 4M6NL 5T3XD 4U6YA 3VXUD 4DQOH 4ZNEA 5GGUB 5IJKC 4Y0GA 3RDTC 1DVFA 4XP4H 1VEOA 1YJDL 1M7XA 4MHHG 2YEZB 5C2UB 3ZTJG 3WNLA 5GGUA 3W39B 2XXCB 3PGCA 1F2XK 1TZGH 3MOBL 4OF3A 3DRTB 5DUPL 2Y7QA 3R1GL 4ENEC 3CDCA 3EYUH 3ARSA 1JIBA 3EJYC 3DRTA 3O6FD 5DRZA 1KLGA 1R5IB 5E1HB 4CVWA 3SO3B 3KPRB 4YFLI 5DJ8A 1NANH 2XWTA 3NFSL 3GSWB 5HHOE 4K8RH 3KPRA 1KJ3H 4OLVH 3BP7A 1QD0A 5B3JE 1YDPB 1AFVH 2F74B 1P6FA 2VO5A 4M7LL 3IFNL 2F74A 2E9BA 3SDAC 3SGDI 4G3YL 4CDHA 2CXGA 4OJFL 1T2JA 2NNAB 5CEXA 2X4OB 3MZTA 3MRJB 4U0RB 1PAMA 2EDLA 2W0FB 2NNAA 4QCIB 3ARFD 1XCTA 4O00A 3GK8L 2AJYL 3MRJA 2BP3A 4HUUA 4M6OL 3C5ZD 1OWWA 2W0FA 4FP8H 3RVUD 2V7HA 1IEBA 3FQUB 3RNQB 1RZKC 2GT9A 2CLZB 1R0AL 4MS8C 4HKZB 2VWEC 1FBIH 5H37H 3CLEL 5J7CC 5I2IB 2N7BA 4PGDA 4W4OA 2DQCL 4MA7H 5IWLC 1W8OA 1I3RA 5I2IA 4KTEL 4M3JA 1NCBL 3V4UH 3JTTA 1GZQA 1Y6MR 2OZ4A 2ZSWA 5MEOA 1IEAB 1JHKH 1K4CB 1XR9A 2BSRB 1U8JB 1IEAA 4UILH 3GRWH 4AM0A 3HAEH 1Z0MA 4JY6B 5C9KA 1CFVH 5JNYB 3H9SE 3UPCA 3QG6B 1WEJH 5EU6D 3ZL4L 4RWYH 2F8OA 3QDJD 1GGIH 4MVBD 4Z95H 3MCG1 4JFXB 4Z7QE 1KBGH 4HUVB 2PETA 5I76B 4UV4H 5SWQA 1P4IL 3VWJD 3LOWA 2AK4A 4OIAA 3V0WH 5JPMA 4X7SL 1VADB 1OT2A 2Y5TA 3C5JA 2RJMA 4U1IB 2DLFH 2WWMD 4PBVC 1CTOA 5EUOE 1YNLL 4G6FD 2X9YA 5JXEC 4U1IA 3A0OA 3MBEC 4RCAA 5T1LA 2AS5M 3LMJH 2XQYK 3WUWG 1LE9B 1AGEA 4KK6D 1IM9D 2D4DA 3IJYA 1ZVYA 2X70B 1UFUA 1ES0B 3I3EA 4OFYA 4UAOC 3ZYJA 3C6LA 3VGAC 3FQTB 3O11A 1ES0A 1ZVHA 4Y2DC 5EOCL 3ZSTA 4ODUB 5IQ9B 3IAPA 4KQ3L 1RURL 3TNNB 5T3ZD 4YDLB 3IDIB 4RMQA 5KS9F 4U2YA 3L3DA 3MLPA 5GGRY 1ORQB 12E8H 1CG9A 3SGJC 3IDIA 4HKBA 4WWKA 4HPYL 3ULVH 3MO1A 3ZKMD 4YDKH 4TOYH 1FDLH 1YYML 1C7TA 2E7HA 3HE6B 4PJ9D 1IGYB 4PRBA 35C8L 1CGSL 3DWTA 5DQ9B 3IRPX 3QQ9D 4UDTB 4NQVB 4HXAL 2A6JA 1FN4A 3L9RB 1U3HA 2AGJL 1EHNA 2AEWA 5E2UL 1KNOA 3EFFB 4WFGE 1BIIB 1KCSL 3GSUB 4YZFF 4F2MB 2YA0A 3CGTA 1EXUB 1WK0A 1N8ZA 4M7JH 5DUBA 3BO8B 1YEJH 1KTDB 3BKCH 2P7TB 2VISA 3NACL 1AD0A 1MJ7L 1N6QL 3V0AC 4GRMA 2VC2L 2H9GB 1GOGA 1N5AA 2WUCH 5GS0L 1T7ZA 2VXSH 1NGZB 3QUMH 5BMFH 3EO0B 1A1OB 2GAZB 2MJWA 3U9PH 2RCSH 3WL9A 1EMTH 3WFBH 3EO0A 1P4BH 1LNUB 1QBLL 1JI2A 4P23D 3FN9A 3GMPB 2B5IC 1VPOL 3QIWA 1OLZA 1RHFA 2NTFA 4NFBA 3KYKL 4Z0XB 1JFQL 2NXYC 2WZPD 1JMXA 1SBSH 4DTGH 1HK6A 2CLRA 4Z0XA 5KVFL 1T21B 2VL4A 3B43A 3SKJL 3BAEL 4OZHF 1P7QD 4N5ED 5DJDB 1UM5H 5CILL 1CD8A 2XN9B 1U58A 4S1SH 2XQBL 1WLHA 1OCWL 1Q94B 1R3IH 2DI9A 1MNUL 2XN9A 3GMRA 3FQNB 4RBPK 43C9A 4P2OC 1QRNB 3FQNA 2VYRE 4HIEA 4FQJL 1QRNA 2XZCH 2W38A 2BDNL 4XNMB 2I9TB 1CGUA 5J9PA 1HHIA 4HLJA 1DSFL 4WHYH 3DV6A 3X3FL 3VXMB 4RZCA 3HPJB 3BFOA 3WKML 1E6OH 2YPLB 1WZKA 1TXKA 3VFNB 4RRPG 5JXAL 2ITDB 2VKXA 4U1GB 3IXAB 4MCYB 1U8IA 5CP7A 4OZGE 2PCPB 3T1WA 3SE8L 3IXAA 4MCYA 1K6QH 2GW5A 1U8QA 4FQXA 2GTWA 3AM8A 1FNFA 2Y9RT 3IVKA 3VXTB 1MCRA 1KJ2B 2Z92B 4OLUL 3DVNB 1KJ2A 1A7QH 3AY4C 4U6HB 3SCMB 2ZUSA 3S97C 3ARZA 3GI8H 5F3HA 2PR4L 3BGFC 4M9OA 4U6HA 4JPVH 3D9AL 4PLOB 2WP3T 5CGYC 2EC8A 4PJAE 2ADGB 1IGMH 2HKHH 3OB8A 5KANG 5EOTA 2ADGA 1MRDH 2A6KA 2R0WH 3QI9B 1OB1B 1RJLB 1AH1A 4IRJC 2BJML 1H3WM 2EEDA 4Q9BA 1RJLA 3WS6A 2UY7A 4XNXH 1DBAH 4O5LH 5FYKL 1K3ZA 3BEWB 3GO1H 3VXUB 1C5DB 3DTXB 2BNQE 2OR9H 4X5XA 3SGKA 4KK8C 3VXUA 4OIIL 1Q9WB 3IGAA 2JKXA 4I5BB 3DTXA 3JTSB 5HVGB 2OYPA 1SMOA 4HK3N 1Q9WA 4ODVH 2R4SH 2DN7A 3MR9B 4U1SA 3ZT5A 2ENYA 3O6FB 3ZHLA 4PGCB 2O5YH 4GRLD 4XCEB 3KR3L 5CBEB 3O6FA 3HAEG 5F7YC 4PGCA 1JK8B 3Q6GL 4V1DA 5I1EH 4XCEA 2QHLA 3LS5H 1HSBB 4KKBC 2BSSB 4HIJB 3FOLA 4JJ5B 1HH6A 5EIVA 4WCYH 4K7PL 4NJ9H 2BSSA 2Y07H 2DBJA 4HSQA 3GSNA 3RI5F 5T1MA 2NR6C 5LKNA 2MFNA 5D71H 5FEBA 4XNQB 3HE7D 5I18H 3W2DH 1BFSA 4ZFZB 3ARFB 1V7NL 4WI7A 4XNQA 3PV7A 3SE9L 2NY0D 5B38A 3C5ZB 3MRDB 4PREA 2FX8H 2BCKA 5CIPA 1VACA 4K9EL 3P11L 3N85H 3MRDA 4K3GA 4U6XB 4LAQH 1CD1B 3BT2L 3ARPA 4MJ5B 1UA6H 3MMEA 1JGDB 3UO1L 3OZ9L 1TJGL 1IZJA 2P5ED 4YDJB 1AGFA 1FE8L 2FYYB 2V5MA 3O3AA 4NDMB 2VKWA 3E2HB 3DVGB 1YMMD 4ONHB 2FYYA 4JGUA 5CLTA 2PUQT 1QHOA 2CUMA 3DVGA 5ID1B 1ROWA 3SDYL 3RA7L 2VLRD 5FOBA 2DS4A 5EZIH 2MKWA 4LQFL 1OAZL 1V7MH 5EU6B 3QDJB 1IRAY 5F9JA 4OQTA 3CMOL 5EU6A 3MA9H 1BZQK 2EYTB 2OLDA 3IS0X 3PNWB 4ODHH 1ZLWH 1G0YR 4XP1L 3OJDB 4JFHE 3LN5B 1ITCA 2JE8A 4JE4B 2EYTA 4KAQH 4LHUA 5A3ID 5ITBH 1UJ3C 3L3JB 3VWJB 3TYFB 8FABB 3VWJA 4Y5VB 4XCYB 1P2CA 4JN1L 1CE1H 1T04B 1AY1H 8FABA 1F8TH 2FX9H 5IMKB 4XCYA 1TJHL 4QTHA 2VZ1A 2WBJC 2X4QB 1A6AB 4G6FB 3H9HA 2R2HB 1JPGB 2F5AH 5LGJB 3I2CH 3ARBC 3HRZB 2PXYA 4YHMH 2DBLL 1A6AA 4LASL 2R2HA 3VFWA 1JPGA 3OXRB 1G9ML 3HRZA 1IM9B 4NKOA 5D1XD 3M45A 3OXRA 3AMKA 2VDOH 5BW7C 3MV8D 3WHXB 4I2XA 5K9QG 4HS8L 5DJXB 5E00A 4DGYH 3JV5A 5SWZA 5F88A 2NYYD 4W6XB 4X80H 3WHXA 4J4PC 4PP1C 1YMHA 1PX3A 2PTVA 5KVEH 3ARED 4IDLA 2CIIA 3INUL 3KXFA 4M48H 3C60A 4FXKA 1EEQA 4XPGH 5SV3A 1WVZA 4Q0XH 5C0AA 3L7EB 4JB9L 3NABH 3OXSB 2R0KH 4G7VL 4I18B 1P1ZA 4PJ9B 2A83B 4I18A 4JREC 3JWOH 5JUEL 4R26L 2C7UB 5ESAB 5IB3A 1NCUA 5HDOA 4LVNB 4DUWA 1DQDH 5DD1L 2C7UA 5ESAA 3G04A 1U3ZA 4HWBA 1RK1B 2R29H 4N5UA 3ZDXE 5CEYB 3EKCA 1RK1A 3TJHD 1G7MA 5CHNA 5D8JH 1Q8MA 3GBML 2QKIA 4ONFL 4P99A 5CEYA 1UXWB 5FGBC 4E0RB 1URLA 4N8PA 2ZUQC 3QIBA 4HUXA 1BQUA 2FB4H 1WCQA 1LO0H 4RFNB 3T77B 4O2FA 4N0CC 4YO0A 1DBKH 1SYSB 1T03H 1IKNA 2CDEB 3LQZB 4NWTH 3BH8B 1JV5A 2MOVA 1MHCB 2Z9TA 4YHYB 3SE3C 2CDEA 5CJ5A 1XR8B 3BH8A 4KI5C 4LNVA 3N0PB 4ZOCA 3RVWD 1UQSB 5HGBB 1XR8A 2DTML 4KPHH 2OTUB 3LKNB 3OR6B 4GMTL 5HGBA 4GAYB 1J5OH 4PJFE 5GS0D 3PJSB 2GSIB 5I1IL 1AO7A 4KRLB 3OR6A 4HT1H 4DWHA 4P23B 4NFDA 1CDJA 3PJSA 5E2TH 2GSIA 4U33A 1BWMA 4Z18A 3BDYL 4YHKH 5EN2A 2P43B 5MENA 1ZLVH 3OF6A 1VENA 3LKOB 5IHUH 2OQJA 4XTRC 4PJCE 4JY5H 5ITFB 2P8PB 3MYJA 1P7QB 1U92A 3HFMH 3U6RB 4KQ4L 1P7QA 4JFDA 3U6RA 3P9WB 4XPAH 3CXDL 3B5GA 1RUQH 1MCNA 3TBWB 1BREA 5DFTA 3TBWA 4EDWH 1KTLB 5HSFA 5CWSB 1HH9B 5C0BE 4HKXA 1HH9A 3RTQD 1G9NC 4YIQA 3ZKXB 2SEBB 1AHWC 2BY2A 2WQRA 3MV01 2VQ1A 3PWLB 1A8JH 1E27B 1N4XH 5FUZL 3ZDYF 3V4PH 4Y5XC 5DD3H 3VFPA 5I1KL 4OF6A 5TDNB 1OW0A 1E27A 4I13B 3H8NA 3ULVE 2IANE 2R9HC 1B0RA 2RFXB 1M1SA 4LLDB 4APQD 3MUZ1 2LAAA 3EO9H 1N6VA 4HUWA 5D9SA 3U4BH 1Z3GH 1FJ1A 1A02N 4LLDA 4ZTOL 1AR2A 2EDEA 3QRGH 3IYLW 1BBDL 5FV1L 2D7TL 5EZOH 4HWEL 4EDXA 4ZS7H 2EIZA 1IAIL 2X4TB 3O6LL 3KHOA 1ZGLB 4MMZC 2NW3B 4FNLH 2X4TA 3TBSB 3CFBA 1T66D 4EJ1C 3FFDA 1XH3B 1IAKA 3HNTL 3IDGA 1MJ8H 2H26A 5DJYB 1HOCA 4PB0H 3TH3T 1DTUA 1UM6L 1ND0A 5GGQH 2WW8A 1G9NL 1EBPA 3MSPA 3QCUL 4QYOA 1M6OB 3O8XB 4OUUB 5EO1B 2BRQA 4N68A 2HFFB 5D2NA 1YY8A 4M5ZH 1TJIL 2JELH 3L5WB 4P5TD 4RGOL 5BV7C 1X5KA 2MQ0A 3DURA 2ARWA 1CU4H 2I07B 3QDAA 4NYLB 1XIWD 2ZWLT 3L5WA 5D1ZD 1MAJA 3B9DA 5I71B 3C08H 4YDVB 4LMQE 4GRLB 3HMXL 1IGJB 4Q6YA 1ZGLM 4PJIE 1LDPH 1EHLH 4PY8J 1IGJA 1U8HA 3STZA 5D5ME 1NFDA 5CAYB 2X4UB 5SX4H 1YEKH 2MCPH 3RWGB 4NO3A 4YBLC 3ULSA 1E0OB 3L7FA 2X4UA 3D18B 4K3JH 5DDHA 4YFLF 5EORL 4KTDL 1HXMA 5GRVK 4S2SB 3GNMH 4RGMB 4K71C 4HH9B 2FJGB 4Q58C 3SGEI 5GRVL 2W1NA 1I9JL 3BPLB 3LPWA 4LFHD 2FJGA 3HE7B 5M94B 3QFJE 3MODL 3GIVB 3IETA 3HE7A 2NY0B 4X9HA 1WV7T 5F6IC 5FK9A 3GIVA 1AXTH 2ZG3A 1MPAL 5JPNB 4WVRA 4GMSL 3QCTH 4TVPH 1GXEA 3IFOB 4N0UB 4WFFE 2BK8A 5JPNA 3TFKC 3L1OH 4YBHA 1BM3L 3HZVB 4Y1AD 1JUFB 2P5EB 4KKCD 3KLAA 3U1SL 3HZVA 5GZOC 2P5EA 4LGRB 1RUPL 4ESKA 5EBWB 4XWGL 3EO1B 4NHCL 1YMMB 2EZ0C 5FFLA 4LIQE 3FT3B 3VXSE 3LKSB 5E6IC 5EBWA 3BKMH 4LSTH 3O2DL 2FJHB 4I4WA 3BP4B 2VLRB 3LKSA 3MNVB 5J6HB 4M5YL 2BMKB 4PJ7B 1C8PA 5ACZB 3MNVA 4K94H 4BSWB 1LO2L 1A22B 3GKWL 1FVCB 4BZ2L 3MV7E 4O4YL 4BSWA 1DLFH 3UC0L 4HCRA 4HW6A 3GSOB 2AV7A 4EUPB 2WV3A 4IHOA 3BEVB 1HHJA 4TRPH 1JPST 1T5XA 4PJXE 4NNYA 2AJVH 1G1CA 1OTUC 2DQDH 3JXAA 3ARVA 5F7FA 3BEVA 3IRZA 4YDIH 1UZ6F 1YQ2A 1X3DA 2Q1EA 5IVXB 1MELA 3DSFH 2IQ9L 3AS0A 2PO6C 4YHPA 1VESA 1QFHA 1V3JA 3NVQA 3K74B 4DZ8B 3K2UL 4F7EB 5ADOL 5D1XB 1A6VH 3HUJA 5ICXA 4F9LA 2IAMC 3VGDA 2DI7A 3MV8B 1UEYA 3O41A 5D1XA 1O7SA 5DHVH 4AK1A 4TULL 2DLGA 3JVGC 4D9QD 3MV8A 1P69B 1JNNL 2YBRA 3NZHL 3AREB 2R8SL 3V95A 1GIGL 3LKRB 3RKPA 4PRDA 4ZO8A 1MWAH 3LQAH 4JPIB 2YPVL 2P4AB 3ARYA 3CNKA 1ZHBB 3ARGA 3HI5H 3DHJA 5IW3A 2IBZX 1MFCL 1N0XL 1OSZB 3TV3L 1FVDB 3Q1SH 1LE5B 1OSZA 3KWWB 4ZS6D 3RWCB 1N0LA 1BF2A 1DJSA 3IJSA 1KPRA 5LGHH 3RWCA 3G9AB 3SDDD 4XBGB 2VLJD 5IM7B 5E0QA 1KIRA 1EA9C 1RULH 1BAFL 1A6WH 1UXSA 4XBGA 5IM7A 3LN4B 3DYPA 2FX7H 3QDMD 5DGRA 3O9WC 4HBCH 1FG2B 3QXDB 3LB6D 5DVNA 1KB9J 3VCLA 7CGTA 3KVQA 3U48A 3CX2A 3QXDA 4IOSD 3T3ME 2JJSA 3PL6C 3V52H 4ZUVB 2F53E 3TWCH 4JHBA 3DX9B 2EDJA 4JVPA 5TFSH 5C0RL 5EBGA 4OCRL 1EV2E 1CGTA 3STLA 4G80A 5HPMB 1CLYH 1SY6L 3VXQB 1TVBB 5F9OL 4XZUA 3UTOA 5EFIB 1SYVB 3VXQA 1TVBA 4F33A 3UZEA 1SYVA 3O6KL 4YHZL 4GAJL 1AI1H 5AAMA 3EHBC 3GIZH 3G6JA 4NQSB 2B1HL 4U1NB 1N2RA 1KACB 2FNBA 2NXZC 4FQCL 4MD5B 3QIUC 4ZXBA 1RZFL 1KCUL 4DGIL 2V2XB 4MYWB 3GB7B 3WYRA 2CRIA 4OGXL 4JFFA 2XWBA 3VD4A 3VJ6A 4LLAA 1F4AA 3ALWA 5IROA 5FKAB 4X4ZA 5F6HI 3RTQB 4NQDD 3QQ3A 5E8PB 4WW2C 3BSZL 4N0RA 3GSRB 5EU7E 5E8PA 1AXIB 4PP2A 1A7PL 3LS4H 2V9RA 3MXWH 1XGYL 1JZ5A 3EFDL 4OLZH 4LCWD 2VL5B 5GGRA 1H3GA 4APQB 2NX5E 2Z8RA 4K3DH 2VL5A 4P4KA 2HFGL 2XKNB 5INDA 3DPBA 5ILTH 1FV1B 4WGVB 3F5WB 2AJZA 5JDJA 5FHBH 3DRQA 5IHBA 4Z8FH 4Y19E 2W65A 4PJGB 2EKJA 5H35B 5MP6H 2NY4D 3MFGB 3G5XB 1UB5A 2HT3C 3ZHDA 1WTGT 1FGVH 1PY9A 3VGBA 3G5XA 4YUEL 1OY3B 3PWPA 3DIFB 4LKCB 5LXGL 1PKOA 1NMBL 3DMMD 2J8UB 3MV9A 4L9LC 4LKCA 3W0WA 1DBBL 1MSPA 3ULUF 2G2RB 1EH9A 2J8UA 1JRHH 3U36B 2XYCA 2YKLH 5TF1H 3QQ4B 1NFDF 1FC1A 1AKJA 1VKXB 2XY1A 4LHQB 4ZFGL 3BW9B 3DVIA 5CMAB 2GTZB 1UWXK 4NKMB 4EN3D 4NNPH 5D7JD 3WO3B 4P5TB 4R4ND 1G7PA 4M93B 4NKMA 1XIWB 3VXNB 5D1ZB 1FYTE 2ARJQ 4HX1B 1NL0L 1XIWA 2CMRH 3E6HB 1IC4L 3I6GB 1XFPA 3D87B 1IGCH 3E6HA 1B88A 1RHHA 3TBTB 1MIEL 2A6IA 1UWEH 2MNUA 8CGTA 2JJVA 5I15H 1FFPA 3T3PE 2V2TA 2C26A 2HH0H 1PSKL 3CXHJ 4KJQD 4WEMB 3BRDA 4P9HL 4I3RH 1FNHA 3N06B 3ECBB 3LN9A 3LVEA 4D9LL 3IDUA 1LK3L 3OB0K 5IHZB 2W9DH 2B7DT 4MGXA 1EEYB 3SPVB 3VRIB 2VZVA 3LEVL 3D2UD 3EOTL 1UYWL 1I7UA 2GFBB 3OKOB 1WWWX 1ZT7A 5ICYB 4H0IA 4MX7B 3O4LE 3V5KB 3LDBB 4QRRE 4W81A 4MX7A 3MGOB 4YX2H 5C0EA 1I85C 4XB8A 3WLBA 3O3DB 2DQHH 3RZWA 4Z77B 3MGOA 1KIQA 1S7UB 3U4EB 4AMKL 4Y1AB 4PGBA 5HGAB 1S7UA 3U4EA 4BQCA 3JV0A 5I66A 5INCB 5HGAA 5E9DD 1KCKA 2PW2A 2HN7A 2BSTA 3FN3A 1J8HD 3Q3GB 4OCXL 3CFCH 4E41A 1CF8L 4HEME 3X11B 2D9CA 2IPUG 4I0CC 5CSGA 3FQXA 4HHAB 4DAGL 3KJ4C 5HYJA 2YA1A 4HHAA 4WWID 5E94B 3HUJF 5E94A 3MRRB 5K93A 3O45B 3L5XL 1MWAA 3CSYA 1PZUB 1SQ2N 5I1DA 1DUYA 4BZ1L 2VITA 3O45A 4CU7A 4N9OB 2XTJE 4MSWB 4CNIB 1KG0B 3EJJX 3IKCB 3V9FA 3OGOE 3CX5K 1IQDB 4O02L 1KG0A 1FZOB 4YPGB 2DQTH 3PHOA 4I3GA 1IQDA 2XT1B 2E7BA 3MUJA 3QG7H 1FNSH 1FZOA 3BKYL 5MI0C 2WWKO 2ICEB 4CJ0A 4RGNE 5DD5H 1R6VA 4ZO9A 3RVVD 3EUUA 4JFPB 5GRWA 1WQVT 1S9XA 1LP9E 4PG9A 1RUKH 1JTTA 1UWGL 4XVSH 5T3XH 2HT2C 5JW5B 4ZFFB 1FGNL 1K4DB 4PBXA 4F57L 2JB6A 3QEQA 5JW5A 1WFUA 4Y8AA 4ZFFA 1WCBA 3MLYL 1S7SB 4HV8B 1C5CL 4JQIH 1XF5A 3MRGB 4YHOL 4HV8A 4NM4H 5GRJL 4GW4A 1FFOA 2XWJB 5L2KE 5C71A 4P2RA 3MFFA 4K3EH 1KELH 3CFKB 2VDNL 3SDDB 2VLJB 4XXCA 2XPGA 2F54E 4CN4A 1W0WA 4TVPE 4XMLH 5ID0B 2ENSA 4ODTH 1JJUA 3QDMB 3DGCR 1XF2A 4KRPD 3ARDA 1H8NA 3H42H 1SJHB 3NIFF 3VXOB 3AB0B 1OL0A 3EYOB 4FZ8L 4N1HB 3AMLA 3VXOA 4KVCH 2EDQA 3G6JF 1F00I 3WSQL 4M6ML 3S34L 2BY3A 1INDH 3O4OC 5C9JB 3GJFK 1FIEA 4HC1H 5CJ8A 1IE5A 4QRTB 4LEXL 1PY4A 4MCZA 3VFSA 5I73C 4FZEH 2XRAH 4QRTA 4UDUA 2BXYA 4G8IA 4IRSA 4QRQB 3H3PL 1CLCA 1Q72H 1ZLSL 5IQ7L 1JPFB 1D5XB 1REIA 3DO3A 4QRQA 1RV6X 4G43B 3MACH 3WXVH 1NKOA 1UG9A 1JPFA 3UJIH 3GJEB 4WW1A 4QXUL 4DEPC 3BKJH 3VG0L 3TVMA 1O0VA 2VZUA 1S78C 2P8MB 2OP4L 3FO9B 1KCVH 2Q86B 4R4FL 4U49A 5LCVL 1CXEA 3KYAA 3ARUA 3FO9A 5CJQL 5B8CB 2IFGA 3O2VH 1F58L 1ZT1B 3C8HA 5CZKA 4Y4KC 1H3PL 4OZFA 3MLZL 3I50H 1TTFA 1FFRA 4ZNEE 4OLXL 2BVOB 4NQDA 4WY7H 1OSPH 1QFUL 1IZKA 2BVOA 3MJ9L 4R6UA 4LCWB 1HXYB 1U8MB 4NC0B 1HXYA 3L3HA 2NY1C 1F13A 3K80A 2DL9A 4HMEA 2QQKH 2J8UF 5GS3A 5D7IB 2JJTC 3IXTA 5FM5M 3NZ8B 4LPWA 4AZ8A 1F90H 3KPRE 4XMKL 4JM4L 5D7IA 4KMTH 1OAKH 1U8KA 4YH6A 1A2YA 3MCLH 2NY4B 1S7WB 4MQXD 2FECL 1CDIA 4NSKA 1FH5L 3KPLB 2I27N 2VQUA 4OFIA 1FNEB 1QPXA 3KPLA 2VJXA 5TQ0L 5FM5O 1BWWA 1FNEA 1BOGB 1QSFD 3DMMB 3CMGA 2APTA 1E6JH 2A0LD 3QUZC 3DUUB 1ZTXL 2HTKC 4EIZC 1RZ8B 3NCEB 3MUY1 2DQIH 4AH2A 2DWEB 1XF4B 2RB8A 5FO9A 2WUBH 4HJJH 1OF2A 3V7MA 1PG7L 2IADB 1XF4A 5HHVH 2OK0H 1DQLL 3OKNA 5I0ZA 1RJZB 4EN3B 2IADA 5DD0L 1Y18B 5D7JB 4LPTA 2IQAA 4J3XA 3TO4D 1BF8A 1UT9A 3LEXB 4FFWC 1RJZA 1FG9C 3FQRA 5D7JA 3U46B 1IGIH 3LEXA 5KSAC 3ARTA 4H25A 4LCCC 4BFBD 2J2ZA 1U2CA 3HB3D 5CSZA 1ACZA 1H0DB 1E4XL 5BO1L 5JHLL 3RWIA 1WC7A 1DL7L 1Z5LB 1VEMA 1H0DA 1IAIM 1NFIA 3MA7B 3OKDA 1NGYB 4WENB 5BCAA 1EO8H 1N26A 5F72S 4NRZB 5IEKB 3N1GC 3MROB 3CK0H 1WFOA 3AUVA 2YMXL 2YRZA 5IBLD 2IH1B 2FIKB 3QPXH 2VZOA 4F58H 3MROA 3D2UB 2HVKB 5EZJA 2IH1A 2CQVA 3QUKB 2GUOB 4OTXL 3JV4A 4HS3B 3TIEB 3FO1A 5EULV 4FHBD 3S4SB 2P45B 2GUOA 1TZHB 2IG2H 3I85A 3ULVC 4DUXA 2Q3ZA 3FO0H 4QHMB 4OFKA 5B39B 3MXVH 2DKUA 3DJ9A 4X8XA 3MGTB 4XNUL 2HMID 1UZ8A 4WV1B 2N56A 5E9DB 3MGTA 1CZ8H 2FGWL 5C8JB 3QAZB 5C8JA 1L7IH 1J8HB 3WIFB 1NDGB 3DX7A 1CN4A 3FB7B 3RL1B 2E5EA 2RR3A 1J8HA 4ZSOA 3V5DB 4G6JL 3B3IA 3QXAA 5D72L 2QADD 3IAGC 2BC4B 1MJUH 4H8WH 1AQKL 1MCHA 4TNWK 5C0CD 3ZE2F 4KUZL 3P4NA 4OZIA 2BC4A 3MLTA 2E6JA 4FN0A 2Y4SA 4Y5YC 1F11B 1ACYH 4WHTB 1F11A 3SQOH 4IMKC 4JKPH 3O0RL 4WHTA 3V5HB 1NBYA 4YWGL 3S37H 3GMLA 5DQDL 3WNNA 4GAGL 2A74B 1Z9MA 1CDBA 5EZLA 3OAYK 3F7PC 4FRWA 4V2CB 4WDIB 3S35H 5B38G 3EJZD 4WTWA 1RZJH 2CKBH 3CDGB 1HQ4A 4I48B 1J1XH 5I8CB 5AUMA 4WDIA 1F42A 4Z9KB 3R8QA 3FFCD 3RIFF 1MQKL 4HUNB 5I8CA 1WWAX 3LD8C 3T2PA 4LGPB 5DZLA 5DFVC 1LD9B 5LVEA 4PJDB 2AI0H 3T0DA 5CKGA 2Z91B 1MCPH 1RIVL 3K7UA 5FV2A 2VLLB 5EUKB 3LEYL 1CIDA 3QJHB 5CCKL 5EBLA 1MI5D 3QEGL 1A1MA 1EX0A 2VLLA 2C3WA 3CLFH 4DGVL 4LDEB 1J18A 4ZD3H 4X99B 4M6NH 4JGJA 3FAXA 1GGCH 3OBAA 1OGTA 4LPUA 1YJDH 4KH2A 2QV2A 1Q0XH 3MOBH 5DUPH 5BVJA 1UKTA 3WFCL 5J12C 3R1GH 1FSKC 2G9HB 1H5BC 2YD4A 2XN9E 3DX6B 1EFXD 4F7CA 2G9HA 4QRSB 5D96C 3DX6A 5IP4A 4AL8L 1GGUA 3VFRA 4MB4A 1QRNE 4X6CA 2EIDA 1T0PB 3NFSH 2BNUA 4KRPB 3VD5A 1T4KB 3NFPB 4UIKL 4HAFA 3SDCD 3PDOA 1MCLA 4D0BB 2PN5A 4M7LH 3IFNH 4YXKL 3VGFA 3VXME 4G3YH 5IF0A 4EI5D 2YPLE 4PJBA 4BFIA 4M61A 4F9PA 1QFWI 1J11A 5F3BB 1IL1B 3DUSB 1SEQL 3GK8H 2AJYH 2BVEA 4M6OH 2B39A 3D3VD 3TZVD 5HI4D 5J13B 4L8BB 2LABA 4XB7A 5C0GB 1R0AH 3FONB 5C0GA 3CLEH 2EO1A 2P47B 1PDKA 1R3JB 1IMHC 1LEGA 2DM7A 4C55A 1JF5A 2I26N 1NCBH 1R3JA 4PGZA 5BS0D 4TUOB 3KYOA 4TSAL 4X6BB 2X4SB 1GVIA 4L1HA 4P59L 4TUOA 4U1JB 4X6BA 4BSJA 4MNQD 4S1DC 3MRPB 2DQUL 4FTVA 4EUPH 4NQUA 3MCKB 4RNRA 3L5IA 3ZL4H 4LIQL 3MRPA 3FRUB 2Q3AA 2R15A 4UT9L 1DEDA 2Q8BL 3VDCA 5DJ6B 1EAJA 1PFCA 2R0ZH 3WS3B 2F9BT 3FRUA 3VXUE 5D7IF 1HHHA <