4PAZA

Oxidized mutant p80a pseudoazurin from a. faecalis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTAHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4pazA00
4HAKA 3CVDA 3DTUB 2XU9A 3HB3B 3OMNB 3X1EA 1GSKA 3V9CA 1KV7A 2VN3A 5AKRA 1MDAA 1ZDSA 1BQRA 3NSYA 3NJLA 1PLBA 1GR7A 1R1CA 5D4HA 3ZDWA 1L9SA 1ASQA 2YAMA 4KNTA 3H4FA 2XV2A 2BHFA 4FAAB 4QKTA 5E9NA 1ASOA 1JVLA 3ABMB 2UXGA 1JZJA 1AS6A 1PZBA 1ET8A 4DP1X 7PCYA 5F7AA 2YAOA 1RCYA 3KW7A 4HHWA 2OCCB 2ZONA 1N70A 3UGEA 4A67A 3NSFA 2BP0B 3FQ2A 1L9PA 4KO6A 4A66A 1IBYA 3TBBA 4NAJA 3OM3B 1E5ZA 1TKWA 1JVOA 2TSBA 9PCYA 3NYKA 3ASNB 3NSDA 3S3BB 1ET7A 3T6VA 1MG2C 4YSPA 1BXVA 2QPDB 1J9SA 2IDFA 1CC3A 2XX1A 3FU8A 4E9SA 3AG1B 4BDVA 2IDTA 1JXDA 1MG3C 4DP9X 1X9UA 1GS8A 4DP5X 1OCRB 4KOBA 2YARA 4YSEA 3OQRA 3S8FB 3CVCA 3CDZB 2H5UA 2HXAA 1OE1A 1ZIAA 3KW8A 2FQGA 4YSRA 1AZCA 4HCGA 2YAPA 2YQBA 4FA7B 1ID2A 4NB7A 3UABA 3UACA 3GXUB 1AOZA 1BEXA 1I53A 1FA4A 3AW5A 2J56A 1JZEA 4YL4A 1WAEA 3AY2A 1ET5A 1TU2A 5I6PA 2PCFA 3RYMA 3WNIA 2I7SA 1L9RA 5B7FA 1AR1B 2MTAA 2WO3B 3U25A 4YSCA 1OE2A 4P5RA 1ZPUA 4E9TA 1A4BA 3ERXA 4GY4A 1AS8A 1JZGA 2JXMA 3NJGA 4UF7C 1NWPA 2PPFA 2FT6A 4GYBA 2QDWA 3FU7B 1N68A 1KCWA 7PAZA 3ZIYA 3PAZA 4Q89A 1PCSA 1X9RA 3WKPA 1M56B 3C75A 5ANHA 4X4KA 3NJJA 1CUOA 4BWUA 1NICA 3QJQB 5IY5B 2AANA 4DPAX 3JT2A 5I28A 2VM3A 1A3ZA 2AZUA 1NIDA 2BW4A 1NIFA 1WS8A 1ZDQA 2P80A 3EF4A 1L9TA 3FS9A 3QJVB 1XB8A 2QPEB 2BWIA 1FFTB 1SJMA 2YXVA 2UXFA 3EH5B 5A7EA 1J5DA 5D4IA 2IDQA 2JFCA 2ZOOA 1SFDA 4L0PB 1E65A 1AZNA 2XX0A 2ZWNA 4E9RA 1ETJA 4ZK8A 2CCWA 2IH9A 1NIAA 5I6OA 4KNSA 2UX6A 1RKRA 2VW7A 4F2EA 2B3IA 1PMYA 3X1NA 3GDCA 3EH3B 1W8EA 2W88A 3X2QB 4NERA 4A68A 2P80D 4G71B 3NT0A 1KCBA 5B1JC 2DV6A 1L9QA 2XLLA 2BZ7A 2UX7A 2DWTA 5I6LA 1PF3A 3PLYA 4CSPA 2X87A 4A2HA 2IWFA 3UAAA 2I7OA 2NRDA 3FYIB 1URIA 3WNJA 3FQ1A 3QQXA 5D4JA 2CJ3A 2GC7C 4RH4A 4F7KA 4DP6X 3QJRB 1AZRA 2TSAA 3QJTB 4BWTA 1BXAA 4TXVB 5I6NA 2VW6A 5TK4A 4KOCA 1PLAA 3PAUA 4UAHA 4N8UA 1XB6A 2PP8A 3QPKA 2J5WA 2HZHA 1MZYA 4AX3A 1UATA 1SHXA 4DP4X 3FSVA 5I26A 1PY0A 1BAWA 2HRHA 3QJSB 3QJUB 3UADA 1OE3A 3FSAA 1W6LA 2Y1AA 1SDDB 1WA1X 4YSTA 1PZCA 5AZUA 4E9XA 1PZAA 1JXFA 3IN0A 2MRYA 3PPSA 1PNDA 4E9WA 3N2JA 2PP9A 2XVBA 1ILUA 2BP8B 4DP8X 1V55B 2IDUA 1BQ5A 4GP5B 4YSAA 2IWKA 1OCZB 2FNWA 2Q9OA 3T6ZA 1HAWA 1F56A 3ZX1A 2PCYA 1V10A 1AG0A 1M9WA 2PPAA 1J9QA 1BYPA 2XV3A 4YSDA 5PCYA 1VLXA 3NP3A 4YVUA 3CG8A 2XWZA 2OJ1A 3T6WA 3OMAB 2XXGA 4AI7A 3H56A 1NPJA 3ABKB 3EHBB 2GIMA 4HHGA 3FYEB 1ZIBA 1NIBA 4GXFA 4BK5C 4DPBX 2IH8A 3TBCA 4KO5A 3X1GA 2EINB 4KO7A 1JERA 5I5IA 1PAZA 2I85A 2HRGA 2Q5BA 4G70B 2YAFA 3V9EA 2J55A 1AAJA 3CVBA 5AFAA 4KO9A 1AANA 2GBAA 1NDTA 4BXSV 2BP0A 1QHQA 1XB3A 3SQRA 5I6MA 1TEFA 3SBPA 3D12B 1A8ZA 1IBZA 1EHKB 4YSQA 2YXWA 1JZHA 1AZUA 2AVFA 4K9JA 3IBOA 2FQFA 4YSUA 3NJIA 1OCOB 3NJMA 4GP4B 1NTDA 4HALA 3CZUB 1V54B 2HX9A 3IE9A 1J9TA 2CBPA 1KBVA 1GW0A 3ABGA 2CAKA 2VW4A 2YAQA 2GI0A 2ZXWB 3EH4B 4W9ZA 1M57B 3CDZA 1JZIA 4DP0X 1JXGA 3MBWB 3FQYA 2XXFA 4QLWA 4G72B 1NWOA 2XUWA 3NP4A 2H47C 1A65A 3S3CB 5B1KA 2IAAC 3T9WA 5I5MA 2BWDA 2UXTA 4MFHA 1IKOP 4AKQA 2XYBA 3SBRA 1ADWA 4HCIA 4WTQA 6PCYA 3AZUA 3FPXA 2CALA 3T6XA 4YSOA 3NJHA 1SFHA 3T71A 4BWWA 2AZAA 1SF5A 1IC0A 4KNUA 2FTAA 3FSZA 1GY1A 4AKOA 1HFUA 4BDVB 6PAZA 4E9QA 2H3XC 3H4HA 2Y69B 1AS7A 1RZQA 5FC9A 3FU7A 2GC4C 4DP7X 3S3DB 1YLBB 4A2DA 5PAZA 1OF0A 2R7EB 1J9RA 2UXVA 4JHVA 2FQEA 2FQDA 2QDVA 2W8CA 3X1BA 2N0MA 3TU6A 1RZPA 1E5YA 4UANA 3FPYA 2XV0A 2VSKB 2BO0A 2PLTA 2EIJB 2BZCA 1L9OA 3TASA 2FJSA 1BQKA 3FU9A 2AFNA 3WG7B 4G7QB 2PPDA 2YAHA 3AG2B 2DY2A 2JKWA 4A2EA 4M3HA 3FSWA 3AG3B 3UAEA 2EILB 2RACA 1KGYE 4JHUA 1J5CA 2IDSA 1MZZA 3BVDB 4GP8B 3TA4D 4HIPA 4BXVA 1GS6X 1ZV2A 2A3TA 3PAVA 2EIMB 1JZFA 2FT7A 1OV8A 2FWLB 4G7RB 3PXLA 3GYRA 5B3SB 1IUZA 4ENZA 2DWSA 5B1JA 2X88A 1JOIA 4E9YA 3S8GB 1BYOA 4YVNA 4AKPA 1SF3A 3WIAA 1CYXA 3AG4B 2QT6A 1OCCB 1WA2X 1GYCA 1QNIA 1AACA 4Q8BA 4DP2X 1B3IA 4A2GA 4DPCX 1AIZA 2R7EA 1NPNA 2E86A 3IN2A 1SNRA 1TEGA 2BW5A 1CURA 1NZRA 4HZ1A 2HLEB 3SBQA 3ABLB 5B1BB 4YSSA 4CSZA 1KDIA 1DYZA 1A4CA 4E9VA 4W1TA 4A2FA 3L45A 2HX8A 5B1AB 3NSCA 5EHFA 4WKXA 2YAEA 3BQVA 3JTBA 1T5KA 1SDDA 1E67A 3NJKA 4N4YB 1EZLA 3N55A 3PCYA 1XMEB 1KDJA 2VM4A 4AZUA 2GHZA 3OD3A 4PAZA 2VMJA 4P5SA 3X1FA 3FT0A 4G7SB 1AG6A 2BP8A 1NINA 4JKNA 2DYSB 4PCYA 1ASPA 1NIEA 3OMIB 1A4AA 1AZBA 2LLNA 3NJNA 5B7EA 5I5JA 1AQ8A 1KBWA 3MX0B 1W6WA 5I6KA 5TK2A 3G5WA 2GB2A 5F7BA 1DZ0A 2DYRB 4EF3A 2IWEA 1PLCA 3DKHA 2FT8A 1CYWA 3NJFA 2PPEA 2OV0A 1E30A 1GY2A 2WO2B 3WI9A 2PP7A 2J57A 4HCFA 2WSDA 2HX7A 1QLEB 3HEIB 1WA0X 3WKQA 3ZBMA 1ILSA 2EIKB 4M4RB 1KYAA 1BXUA 2PPCA 5LDUA 3DIVA 1FWXA 1SHWA 4F2FA 3IEAA 1WS7A 2VSMB 8PAZA 1HAUA 2CUAA 3ASOB 1GS7A 2B08A 1PNCA 5B7MA 1OOWA 2GSMB
chains in the Genus database with same CATH superfamily
2YRBA 5I24A 3CVDA 1KXVA 5HYSA 1N7ML 1SBSH 3HZ3A 3ULVD 3RWJA 5C0JB 3V4PH 1TR7A 2BIOA 4YDJA 2ZYRA 4K71C 4F93B 3KR3H 2XV2A 4MD0A 5C8JB 3OG4B 2J6EL 3MBWA 3TO4D 4EVNB 1D5BA 3VM5A 3MV7E 2QTEA 1P7KB 3KPSD 4YEEA 3LDBB 4KTDH 4U6YB 4HS8L 5F97E 3IWVA 3T8VA 2BP0B 1FNEA 1WIOA 1F90H 4ZZFA 5DRWA 4A66A 3UZEC 5C08A 5C7ZA 3KWUA 3VFSA 1F00I 3IF1A 4HIXH 1AO7D 1XGYL 4MXWH 4XZUA 4BFJA 5FLVA 1SHSA 3IFNL 3WY2A 3D06A 4Q9RH 4YSPA 1BXVA 2ZXBA 4N0YH 4Z7WF 4R9HA 3BHBA 4ZX6A 3BKCH 1T5WA 4XHJC 3ZDYF 4E9SA 3VE0B 1DVTA 5TJWK 2WWKT 4XNQA 5KSAC 1Q72H 1RZGB 2VGLM 3TONA 3SE3C 3IJ7A 4FQHA 2FHBA 3E2HC 3IFLH 3KPQB 4MA8H 4U33A 3IXAA 3OX8B 4XH2A 5MENB 2IVFC 3CE1A 4LMQI 1II4E 1IGJA 5AVSB 1XGPB 1I1AA 5GSVB 3GJFH 1JHKL 4Y1SA 5DI8B 1AZCA 2JK5B 2A4EA 2EKJA 12E8H 5L6YH 4QI3A 4I18B 1TQVA 1DSWA 2OI9C 1OB1A 3DX1A 3TJEH 4WF7A 3TM6A 4H20H 1AGBB 1P7QA 1QEXA 2ZWLT 3CZJA 3O3BA 3PF2A 1YY9D 1QSFD 5C92A 2J56A 3WNIA 2X4PB 2UZXB 3LRSB 4KI5E 4BZ2A 1A25A 4IKIA 2W91A 1JJUA 5D7LA 1CGWA 4UB0H 5C0CA 3ILQD 4PGZA 3IDGA 4KXZH 3VXTA 1QRNE 1EIBA 3QUYC 1QX1A 4G7VL 2ZTBA 1ZS8A 1KCWA 2EUVA 4RZKA 3CN3A 4XXDA 1CD8A 1F4XL 1V05A 5BUGA 5CJOH 4ZPTA 1FZMA 3FQUA 5D1ZD 3LB6D 4ZMYA 3BGMB 2AJXH 1D7CA 1XXDC 4PJCE 2YFNA 1P1ZB 1U8OB 3N41B 4N68A 1J8RA 5KOMC 1MCKA 1W72L 1ZRUA 1KXVC 1MFBL 2EZ0D 3QPXH 1RUAH 5TQ2H 2B4CH 1BBDL 5DO2D 1KZQA 2DQDH 1CE1L 1HEZB 3GZOA 1SJMA 4FTVD 4AEIL 4HVBA 5KSBA 2XN9A 2ZUTA 5CEZH 1P4IH 1IAIM 2R2BA 4X99A 1T0NB 5CCHE 4PJAB 1HN1A 4FYSA 1I7UA 3MRJA 4X5LA 2W60A 3DVGB 5J1SC 4JQVA 4HKXB 1H8OA 4F91B 2OK0H 3CDCA 1S9YA 4OM0L 2LV4A 4PYGA 2VW7A 5E8EB 1JGIA 5AQ0A 3ZQWA 4CADA 3CH8A 1DVFA 3FO2A 4OZIB 4HBCH 5BVJB 5EBGA 2BCKA 5T3XL 1UWEH 1M2VA 4OJCA 4LL9A 4AYBA 1EFXA 1CMOA 4Y16A 1E4KA 4WTWA 4Q9BA 1MXDA 5FO8B 3LIZA 3N42F 1FZOA 3G3LA 3GSUB 3W82A 1OF2B 4FG0A 3BD5A 5CEZE 5LG1A 3W2DH 1FO0A 2B15A 1BZQK 2AJ3A 2HT2D 2NY6D 2OL3A 4KKNA 5CNHA 3V6FA 3VXSB 2BVTA 4IHOB 4U3HA 3TEZA 1U8HA 5D7IA 4P9MH 1PYWB 5FS5A 3TF4A 4OJYA 1J1PH 4XWGH 3KNBB 5LBVA 4K71B 1INQB 1T5XB 3P2TA 1KBPA 1IGTA 4LSPH 3LEVL 2EO1A 4K7PY 3GXFA 2XXMB 4AUYA 1I1AC 1TMCB 2VB5A 3L3JB 4DGIL 2DQUH 4YZFF 4Q4EA 2F15A 3HPLA 1NAKL 2BSTA 2AJVL 1XB6A 1MJJB 3MX0A 1FFNB 1MZYA 3MRBA 2FATL 2ZUXA 3S98A 5AUMB 3L3DB 4PJ6A 3CXDH 3QJSB 3MNVA 3HS9A 3UC2A 3WE1A 1QO3B 4PB0L 1I8MA 4LU5H 1D7DA 2DQ6A 3QIWA 3N1GC 4ZPVB 2APWA 3MNWB 3BFQG 4R8WL 1M9SA 3WIHL 3G6DL 1CDBA 2Y36L 1H6UA 1PZ5A 3MJ8B 3BLBA 3N9GH 4MA3B 1G7IB 2CDFA 3L17A 1CBJA 3ECQA 2CR0A 3QQNA 1PIGA 2XVBA 1NCBH 2YGPA 2Y72A 5CIPB 5KSAB 3E2HB 4JRXA 4M4RA 3LKSB 3LKQB 1D6VL 3TBSA 4UM9B 3BUDA 2YFOA 4XI5D 1ETZA 2WC7A 4JDEA 5K39B 2EH7H 2PCYA 3G6AA 3QO0B 1AG0A 2YR3A 1RZ7L 1T3FB 2AQNA 4JREC 4YGVA 5E9DB 1G9EA 2OI9B 4J8QA 4N0CD 1B0WA 3NACL 4XCYA 1JZ2A 3J07A 2OJ1A 3O11B 5J11C 4FQJH 4WU7A 3KWTA 3L95B 1A7BA 1D7BA 5HDBF 1BREA 2DLHA 1QMUA 5D7JA 2VR8A 1CFNA 1FYTB 4UQBA 4DPBX 4YBQC 1CFSA 5HHMD 3TBCA 1MHEB 4WWKA 3EFOA 1OVZA 3ZDZF 4L37A 5MEQA 4K7FB 3MCG1 4XRCA 3AQYA 1I1YA 4M5TA 2J8UF 3ZDXB 2AQ1A 2FHCA 2IXQA 3EO0B 4XMXA 1DVFC 3UJTH 3W11C 1J1XL 1LP9B 1YYLH 3CSPA 2NY4C 3LKOB 1E4KC 1TEFA 4LRIA 4Y16C 1DJHA 1RUPL 1UVQA 2LAGB 1IQDB 2YXWA 4JJ5A 1OZTG 4JN1H 5IHUH 1MF2H 3U0PB 3MRPB 2COVD 3VGGA 3CLFH 2AXGA 4KPHL 5GGVY 3WDJA 3NTCH 5HYSB 3G7TA 1ZT1A 2X6BA 4ONOA 2OMBA 3RWJB 3ARGA 3CN2A 1AOHA 4WUUD 1T20A 3NGBC 4YDJB 3JXAA 4XVUD 4UM8A 2BNQE 1X5HA 1N10A 1B90A 3D87B 4M02A 2BP5M 4MD0B 2BHUA 3UZQA 2PR4L 3MBWB 2C4XA 1D5BB 4Y8AA 4XC3L 4MZIA 2XXFA 2CNZA 3BLKA 2O1AA 5IQ7H 3VFRA 3NP4A 1MFUA 4MRBA 4ANVA 5I5MA 1FNEB 4TSAL 4GBXD 1NPUA 3MRIA 3RVVD 5DRWB 3QEQE 5C08B 3VFSB 2OZNA 3IF1B 3JUYA 4XZUB 1B2WL 4HCRH 4KQ3L 1IIIA 3DX7A 5I1JH 2WXKA 3NABH 3WKYA 2A2QT 2OQJA 3DX8A 3QNZA 3BHBB 1T5WB 2YWYA 3QUXD 1VCAA 4NHUA 2QQKH 4OM1H 5K93A 5L8KB 5HHQA 4DEUA 4FQHB 1BZ8A 3IXAB 4XH2B 1RZQA 2ICEA 2GC4C 2CPUA 2H0EA 4HZLA 3K5SA 1IGJB 2JQMA 3KPRE 4W6WB 2G0LA 4WSKA 2EUXA 4FQXA 1J9RA 1I9JH 2TAAA 1UOWA 3UPRA 5CM1A 1I1AB 2W8CA 4XP1H 4UOQA 2PO6A 2J8HA 4Y19E 2Q6WA 1CLZH 4OCRH 4GSUA 2IGLA 1OB1B 3CSTA 4HJUA 1TFHA 4U6VH 1OGPA 4NJ9H 1P7QB 3TASA 3O3BB 4WI6A 2PN5A 2EXYC 4MQ7B 5MHSE 3EUDA 3FHQA 4NQQA 3DX4A 5D2LE 5LCVH 5I16A 2MQGA 2ZUYA 3VGAB 3AS3A 1REIA 3EUUA 4B9YA 2IC2A 3OWEA 4WWKC 1HE8A 5I18L 5D7LB 4OF3A 5C0CB 1D3CA 3B7SA 3IDGB 3U82B 1MIML 4FXKC 3VXTB 3MNZA 3VG0H 4XNDA 5FM8A 3T2PA 4WVRA 4HP5A 4XXDB 7FABH 3HZVA 3QCVL 4H0LC 3RHWF 4LRIC 3S35H 1D7FA 2MHAA 3FQUB 3P9MA 5DZNA 3RDTA 5DWUL 3COOA 3DGDA 3WGUB 3WV0A 3UO8B 4JREB 3RQ3A 5GHWH 3VFGH 4F2MA 4ZS7L 4GSDH 2HJFA 2D31A 4M3JA 1CGSH 2E4FA 4CVXA 4UTBA 3DDFA 3ARGC 5J11B 2DIEA 5FGCB 4XMTA 4NM8L 2K6YA 3CDFA 2VQ4A 3OXSA 5KSBB 4GQZA 4N8VG 3IFOA 2XN9B 4OGQC 3GBML 3U1QA 3MODL 1J1OL 4DOHE 2FWOA 2W65A 4X4YA 2R2BB 4X99B 4WFHE 4XNBA 4WFGE 5F8QC 2BW5A 1I7UB 2QSCL 3MRJB 2MFNA 3BXNA 4ATWA 1K6QL 5FXCH 3VACA 2W60B 4EUPA 1Y1UA 3ABLB 3G08A 1S9YB 4CADB 5IVNA 1HQRA 2VLME 1DVFB 3FO2B 2ZYIA 5L2KD 2BCKB 5JYMA 1M2VB 3WYRA 1ZSDA 4UQEA 1EFXB 4F15C 4Y16B 3TWCH 2G5RA 1FZOB 2ZXCA 1UZ8A 4I3SL 2DJSA 1YEFH 3C5JA 4TNWF 1MFCH 2D3VA 4ZO6A 1FO0B 2HTLC 2AJ3B 3D39D 3EDKA 2XWDA 2OL3B 2XA3A 4IRZH 3U9UA 4AGNA 4AZUA 3MLWL 3V6FB 4B9KC 3U1SH 1U8HB 4RNRA 5D7IB 1PDKA 3P77A 1YECH 2D3LA 4AJYV 4FMKA 3INOA 4PJ8D 5BMFH 1IGTB 3MJWA 2WY3B 3MXVL 4ZW5A 5GGVL 3HAEA 4NHCL 1V3LA 1Z1WA 3QXUA 4NAMA 4C56D 2BSEA 2PO6C 2P45B 4P23D 3HPLB 2IADA 2D7TH 2Y2TA 2BSTB 2I26N 3U7WH 5MP6H 1KJ2H 3MX0B 2XQBH 4RRPG 3VI4A 5F7BA 5E5RB 1RZFH 2G75A 1AHKA 3MNVB 2LE9A 1BBJA 3JWNE 4XO3A 4PD4J 1CGXA 4RETB 1I8MB 3ML8A 4FG6C 4EKXA 3QZNA 3N5AA 1A6VH 3O0RH 5CEYA 4KROC 4MNHA 1PZ5B 2PP7A 4QR7A 2CDFB 1LK3L 4KHXH 5DEGA 1A0QL 2P7TA 3ZBMA 2NZIA 4JRXB 4M4RB 4UCFA 1G1YA 3RWEA 3TBSB 4BSWA 4FFWC 4TL4A 4FFTA 3RDTC 1ETZB 4JDEB 2XWCA 3J8F7 3EO1A 4LARH 3G6AB 3ULSA 4ODHH 2WWMC 1OOWA 1WHOA 4YGVB 3O4LE 1ZA3A 5F70A 1F3DH 5I1HL 2MQ0A 3QPQC 2JKRM 4GIOA 3OMNB 1DBAL 5EG6C 4WU7B 1OZUA 1PLBA 3KG5A 5D7JB 1RUMH 1GYVA 1CFNB 2DWXA 4X7SH 5AAWA 3FRPA 1CFSB 2ZNXA 4WWKB 3EFOB 3TA3C 1LTXA 1UKQA 4L37B 5MEQB 4BZ2L 4XRCB 1PZBA 1ET8A 1V5JA 1I1YB 3DHJA 4JRFA 2YAOA 1UUNA 5GISH 4DP1X 1UWXH 3L3OC 2OM5A 5H4ZA 2IXQB 4FXKB 5E8PA 5BCAA 3KWVA 3N40F 1K8DA 5I71B 4KO6A 5AOIA 3ARYA 1SVBA 2RTTA 1CD0A 3BAJA 2OYPA 3FT1A 1UVQB 3QXTA 3WIIH 4JJ5B 5LJYH 3GSWA 2R1YA 4QYAA 4RGND 3IJEA 1KIUA 4LPCA 4G59C 1C1EH 4MAYD 4R26L 3D2UD 5C3TA 2AXGB 1CT8A 4L1TA 4I9WD 3D4YA 1ZT1B 3CVHA 5LXGH 3ARGB 3S36X 2K6ZA 5BV7B 1TZAA 5E9AA 1T20B 1MG3C 3QI9A 3MBXL 4HXBL 1KTJA 4K23L 4XP5H 2Q8AH 4UM8B 1GRWA 3DC0A 3ZHNA 1UA3A 2AK4E 1FN4A 1INEL 4NQCD 4OD3L 3UZQB 2ZXGA 2DMCA 1KENL 5FO9A 1JGLL 1OLZA 3LQZA 2FBJL 4HD9A 4ODXA 1OM3L 2WIIA 3QZPA 3VFRB 1EDQA 4MNQE 1RD6A 1AOZA 1AI1L 3NFSH 4JFZH 3B7TA 2ENJA 2X4OA 3BW9A 1BZEA 3IMVA 1JV2A 3AW5A 3MRIB 4WI3A 3VGFA 2DM2A 1MCIA 4PRHE 2J3SA 4F15B 3M86A 2FX8H 3AY2A 1RV6X 5B7FA 1HYSD 4KJQC 3PABA 5TQ0L 2VCOA 1JNNL 3QGVA 2MCMA 3LIZL 2OQJB 1OE2A 2XPYA 3DX8B 3QNZB 4ZOCA 4MJ5A 4NHUB 1FO0L 4ORZC 2PR9A 4H8VA 2ICWJ 2OL3L 1AZZC 1NCIA 5HHQB 5LQBL 4AYMC 1GA2A 2X41A 5HPOA 2ICEB 2ORBH 3LRGA 1ADQA 3M1BA 4HZLB 3CFIC 1UWFA 2J4WL 1SOQA 4FQXB 1VJSA 2XACC 1KB3A 3UPRB 5LUMA 1KG0A 1N9PA 4NQEE 2Q6WB 2PO6B 3MA9L 4J6RH 4UMGA 3LNHA 1TG8A 3ARSA 3QJQB 1EPFA 5IY5B 3TN0A 5JW3L 2E3VA 2Q2LA 4ZXBD 3GUFA 4L1DA 4DGVH 2VAJA 5I28A 3BP4A 5IFHL 1GZPA 3OV6A 1QYGH 5EFIA 4Q97A 2W92A 2BS71 5F71A 2G2NA 4EPSA 5I16B 5AAWC 3EH5B 5TD4A 3UO1L 4CNIA 2VERA 4MDJA 4V1DA 5DHMC 4OIIL 4IKKA 3R8QA 1KFAL 3SBWA 2WVTA 2IH9A 2RCSL 4JY4A 4LCVA 5I6OA 5JR1H 2DL9A 3WIFA 3QFJA 1VZGA 1CF8L 3MNZB 4UINH 3MRKA 3V4UH 2WJ7A 1SXCA 3U1PA 4MX7A 2AJUH 3HZVB 2YSSA 3SEPA 2PETA 2MHAB 3RDTB 3P9MB 1JWMA 5IJDC 1MCHA 3HNSL 2HB0A 2P80D 3OKKA 4L3ED 1LVEA 3EJPA 4P2QE 4OLYL 4F2MB 2ZCKL 1XX9C 2DJUA 2HJFB 1G7MA 2D31B 5ID0A 3VQLA 2X87A 4CVXB 3D1MC 2F5BH 5IROC 2FX9H 5B1CA 5FB8A 4M8UA 1W0YT 3LPFA 3QI9C 1H6EA 2K3HA 3OXSB 3IFOB 4LKXA 1U36A 4UT7L 1BGXL 3QJTB 2FWOB 2W65B 3VYPA 4X4YB 1TTRA 2ZUQB 3FXIC 4BRVA 3VWJC 2OCJA 5AVQB 1CXHA 1OPOA 3BXNB 5AL0A 4EUPB 5JPNA 2OMNA 2DQJH 2WKLA 2NYYC 3G08B 4NQTA 2VDQB 1U2HA 1U8NA 2PP8A 5CGMA 1NCJA 1HQRB 1KELH 3UTSA 4L1BA 4AX3A 5IOKA 2HRPL 1ZSDB 1G9NH 1OAYL 1E3FA 4XCNA 3EFDH 1UZ8B 4JO1L 5IMOB 1OGTA 3C5JB 2XSKA 3BP7A 4ETYA 1NCUA 2A6DA 4LPYA 3U9UB 5TE4H 5ILTH 4Y4FD 3G5XA 4PJEB 4RNRB 4QUOA 4I13B 1PDKB 3P77B 4XN7A 3SOTA 4K2UH 3KXFE 3E6HA 4QHKI 3SKMA 1TZGL 3RA7H 3ATAA 3B2UD 5BV7L 3HC2A 2AABL 2FNWA 5BZWA 5ITBL 1MNUL 2IH3A 3HAEB 3RVTC 1QNZL 3O6KL 1KF9B 3L9BA 4L4VE 2IADB 2EC9T 2XG4A 3OLEA 3TN0C 3VI4B 1DO5A 2G75B 3GMOA 2LT9A 4HJ0D 4PJGF 4RAVA 1XQ4A 3ELQA 1BBJB 2FBRA 3K2MC 2F7OA 4Y7MA 4OZHA 4A7GF 4NN6B 4G8GE 3LH8A 4MNHB 5E2WH 4U1HA 3SBWC 5T1DL 2FYYA 3DOHA 5DEGB 2P7TB 2CMRH 4FTVA 3Q43A 5F2FA 2CO4A 4LSVL 1FAIL 2EDWA 3RWEB 3SQRA 4BSWB 1GVIA 3TO4C 4HFWA 5GJTH 3WFCL 1MI5E 5L8JB 3EO1B 3V8OA 3X3GL 5FFLA 2R2HA 2R9HD 2VKWA 2WD0A 3QUZD 2AVFA 2VMCA 4K9JA 4KK9D 1ZA3B 4N2CA 5ETUA 3ZL2A 1GPOH 3IDYC 1OAZH 1LE5A 4FZEH 4KKAD 4MASA 4GAYA 3TT3L 4Y4KD 3ECVA 5F96L 2B3RA 3HPJA 4B95C 3B5GA 1ZT7B 3D0VA 2EKSA 5B3JF 5L8LB 1UHVA 5CILH 1KTBA 3FRPB 5JDJA 2H2SD 2EDYA 2WAHA 3AVEA 1R19A 2FK9A 5GQBA 2YPVH 2BSBA 3T09A 2VUKA 5E8PB 2R0ZL 2UVFA 5HI3D 1K8DB 4MFHA 4YLQT 2J71A 1F0LA 4JFVA 1IKOP 1LLAA 1ADWA 1TEYA 4N6QA 2CIIA 4FQIL 3VX1A 4DUWA 1R3IH 1CR9L 1XCXA 3GSWB 2R1YB 4HUKB 4UV7H 3ZL1A 3IJEB 1KIUB 2VDNB 2W9LA 4KDTA 5E6ZA 1WEJL 3BH4A 2VUYA 1YY9C 1QFPA 3KPPA 1CT8B 4I4WA 5GXBB 4D8PA 5IHBA 4I0PD 4YHLH 3CVHB 4TQEL 3NEXA 3QS3A 5D5MA 1R46A 3QI9B 4CGUB 3FU7A 4UTBL 4KY2A 2WNWA 5FM4A 1A7QL 3UG4A 3F3HA 1JN6A 1FN4B 4PIRF 3ZTCC 1IT9L 3NZUA 3ILQC 5FO9B 4QRAA 1UWYA 3LQZB 2CJUL 2FQDA 4HJ1A 4ODXB 2WIIB 1DJXA 4BHUI 5KVEL 2MEJB 4JN2A 4N86A 2X4OB 3BW9B 1JV2B 1ERNA 5DLMH 2VDQL 1JMZA 4ZTPH 4K3EH 4JNXA 3DXAD 4LPWA 1RP8A 5EU6E 2NQDA 2P47B 3K5RA 4U4BA 2VXQA 4MJ5B 5DO2C 1RLWA 1M7XA 1C16A 3SY0A 1FC2D 1P6FA 2XWRA 4DK6A 4AVKA 2R56L 3M1BB 4YE0A 4QNPF 5CN3A 1D2PA 1SDAB 3H54A 4LSTL 1IAIH 5FGBC 2RBLA 3FB5A 5CCJA 4FQ1H 3GYRA 1KG0B 5HHXL 4DGYH 3SYOA 4AYSA 4U3SA 1J0HA 1KB5H 4MJ6A 1CICD 3TN0B 1DL7H 1GOHA 3BP4B 2ZX9A 4LPXA 1GZPB 2FGWL 3PUUA 1HZHL 5EFIB 2R2CA 1RJYA 3IJ9A 4OGXH 4AWJC 4JM2F 3L5XL 1IE4A 1UUSA 1YHPA 2P5WD 2HT2C 4DPCX 1DBKH 2CK0L 2F7QA 4CNIB 4MDJB 4PLOB 2DMBA 3CFJA 3HG1E 4N20A 4V1DB 4OF0A 4A6YA 4GW4A 2Q7YA 4HWNA 4JY4B 3KWWA 3SBQA 3WIFB 3QFJB 3MRKB 4G5AA 4CSZA 2E8ZA 1A4CA 1BFVH 4A2FA 4QHPA 1OB0A 4IOFD 4MX7B 3BSZA 2YSSB 4EBQH 1BXXA 4KMTL 1JWMB 3OKKB 5EZOH 4LLAA 1SVZA 2R51A 1AR1C 3LXAA 4ZW8A 4K94H 4KDTC 4X8CA 25C8L 5DS8A 4C55A 5J12B 4IMLA 1U8PA 1JRHL 5GS1A 3ZTNH 1G7MB 3IDYB 3PP3K 4GAGL 4HS6A 4ZTOL 5ID0B 4P5SA 5K9JH 3L8QA 3VVWA 5FLUA 1JZ5A 2HG5A 5FB8B 3WFBH 3BRDA 4PJDE 1T83A 4OCXH 4PJIA 4CJ1A 2VXVL 4LEBA 1IAOA 4QTIL 4ONFH 3NA4A 4GIAA 2HFTA 4LKXB 4WFFE 3DX6A 1CF1A 4NGHL 5JPNB 3KH4A 2W0KA 3ZW3A 4HOZA 2PCPA 2KKQA 1FCGA 5E2TH 2FRGP 3UTSB 5CP7A 4PUBL 2APFA 3B9KA 4C83B 4D3CL 1EEUA 2IWEA 2W07A 3LZFL 4XCNB 5IT2L 1PLCA 3V52L 1JXJA 1OGTB 2EH8L 1HHGA 1JV5A 3QQDB 4K5LA 4ODSH 3WMSA 4M5SA 3BP7B 5ESAA 1IM9D 1E30A 4XO4A 2VDPH 2L8AA 2A6DB 2ESVE 3K2IA 5F44A 2J57A 4W4NA 3G5XB 4ZNEA 2VDNL 1AFVH 4JFEE 3UYOD 1AKJD 4MXQD 4WQOA 5H35A 2QGEA 1M2OA 3E6HB 5FYLL 1OD9A 3SKMB 3CVHL 2I5YH 1SHWA 3DSNA 1FIGH 5BZWB 1EEYA 2IH3B 4GAJL 5FV2A 1ZT4A 2WWKO 3VGEA 3FQ4A 3E3QE 5B7MA 1QFHA 2UY6A 4IGBA 3JT0A 2XG4B 4FFYH 1TSHA 4OD1L 5JZ7D 1W15A 1XWVA 1QP1A 4YL9A 3GMOB 3UTQA 2J1YA 2J25A 4RAVB 2E47A 2ZKHL 5GSRA 1Z7JA 3II1A 5CHNA 4OZHB 4ZI8A 4J1UA 4TSBH 4NUGH 4U1HB 5T5FH 4HT1H 1WH0A 2FYYB 3RIFF 1RCYA 4XVUC 4FTVB 3RP1A 3WDHA 5AB0A 3F58L 4EEEA 1ZLVK 5KJ4A 3V4VA 4HFWB 2VDOB 4PIBA 4XPGH 1ADQL 2IGFH 4F1SA 4KKLD 5DC0A 2WGXA 1MVYA 5EU7C 5ETUB 4AMWA 2FEJA 3SODB 4WFED 3RVVC 3PP4L 4XP6H 2CE6A 5ELIA 1LE5B 2CKBA 3B4NA 4GAYB 1YNLL 4MS8D 1DHKA 3HHRB 5E70A 1T83C 3HPJB 3OQ3B 1AQDA 4GRLD 1LO3H 1A1OA 3D0VB 1CVRA 1JUFA 2JCWA 3D39A 2APBA 2EE0A 1KBGH 5DMIH 2JJSC 1DCLA 2IPUG 1ZIAA 2K45A 5L2KA 4YSRA 2H1PH 5CF3A 3CPUA 3LH2L 2YAPA 2EEFA 1U41A 5IBTL 3UX9B 3F65A 2NNCA 5ALBH 1F8TL 1MEXL 1GOGA 3B9KC 4Z7OB 3OB0K 4HF5L 3VSQA 5CLYA 1AY1H 3IAQA 1XZ0A 3RY6A 5E2JA 2J21A 4QOKE 2CIIB 3UAJA 3B8SA 2CM5A 3FMGL 1FBIH 3MUY1 3OAZH 1AR1B 5A2AA 3C9NA 1H3PH 5JW4N 3KPPB 1PX8A 3ERXA 3HIZA 3D48R 1S9XA 2AQQA 4D8PB 5E51A 4JQIA 4PS4H 2JXMA 3TYFA 1TZHA 4ODTL 2DDQH 4M62L 2DAVA 1JGVH 2ZD0A 4I48A 3AXHA 4ISVA 3I9GH 4U3CA 5D5MB 2AAVA 5FK9A 2CZNA 4YPJA 4DW2H 3FU7B 5I5RA 3S37X 5I19H 1JN6B 4AQEB 1RURL 4RFEA 4NIYE 4XVTH 2DLEA 5AKVA 3D34A 2Y6SC 2NY0D 4PJBF 5CZKA 2Z7UA 1EHAA 4IGBC 3FRUA 1FPTL 5SX4H 4JN2B 1UA7A 2QSQA 2IWGA 2PCXA 5D70L 2CUIA 1WD9A 5SV4A 5DGQA 5JIPA 3HOGA 2VXSL 5KYUA 2ZOWA 2BWIA 2VXTL 4DQAA 2P5EE 1A6WH 5L88L 1Y0LA 1EAPA 1DTUA 5A7EA 2R29H 1E5BA 5C86A 3SGDH 3D4ZA 2X0WA 1QLEH 1AZNA 5AENA 5LBSA 1MPAL 5SWZD 5C0AD 2A9NH 1C16B 1EGJA 3MXWH 3SY0B 3HN5A 1MUJA 4Z6AT 3NIDB 4Y2NA 2ZKWA 1RJLA 2YMTA 2JWYA 1PPIA 4F2EA 1E50A 1S7TA 3W3BA 1RIVL 1XIWD 4NZUL 3FB5B 2A9DA 5JUEH 3NAAL 2WBJA 4U3SB 3RGBA 2F19L 4D0DA 2J43A 1FHNA 1PD0A 1NMCC 4MJ6B 4PGEA 2BZ7A 3K2UL 4OJFH 1F86A 3LNDA 5HDQH 4ZSOE 1AHMA 3UZVA 3VI3F 1RJYB 4GH7B 4RDBA 2EIEA 2DI9A 2XBZA 3BAEH 4MAYA 4NKQB 1S7SA 3AT9A 5DJAA 3CFJB 4Y9FA 1GIGL 4PY8J 3V9FA 2IANA 4A6YB 4KOCA 4GW4B 2Q7YB 4HEMA 3BFOA 3KWWB 1IGFL 4PJ8C 1KEML 3SKJH 2P1YA 2R0WL 3NCFB 4OGYL 2NUTA 3OJ2C 3ZE2B 1HINH 2V3FA 3ES6A 1JPTH 5KVGL 4NQVA 3BN3B 3RY6C 3MLZL 1QBAA 1DDTA 1JNHA 4L8SA 3WUWB 3J2PA 5DZLA 4QRTA 3UAJC 2XRAH 2VDOL 1X3DA 4KVCH 4P06A 4U1MA 5DS8B 3PAYA 3CSYA 3PQYE 4Z95L 4Y1AE 4IMLB 5C0NC 5GS1B 5IMKA 2HFGL 2VSDA 4HS6B 2F54D 1Z6JT 3OXRA 2HG5B 4PJIB 2R23A 2X4RA 1IAOB 1V55B 4L4TA 4IYKA 2WNKA 2G5BA 3P3SA 1E3ZA 3SO5A 3T6ZA 4TKWA 3DX6B 1CJYA 3LKPA 3MJ9A 3M8OL 3CC1A 1L0PA 1IVLA 1VENA 3V55A 5HYJE 3IMBA 5DGRA 3A67H 3D05A 3PWLA 4LHQB 2PCPB 4YHKL 3BKYH 3ZYJA 4OFYD 3ARFA 4CUCA 1EO7A 1G7HA 2YMXL 3EYSL 5CP7B 4ADJA 2CK2A 3B9KB 4TPRL 2HT3C 3P0YL 3QZMA 4WHTA 4OCSH 2W07B 3FYEB 4M93C 1NIBA 3BZ5A 4HBQA 2X2IA 3I84A 3DJTA 1G7QA 1HHGB 1JV5B 5KVFL 2ROYA 5ESAB 3D6GA 4ZXBA 2EDLA 1RIUH 1OQOA 1FORH 2VSCA 2RA1A 4L23A 4I87A 5KEZA 3A6BL 2QFPA 2IV9A 5H35B 3O6FD 4D9RD 2EEXA 1NDTA 4HULB 1FRGL 4J3VA 1P53A 3IDXL 2J88H 4M43H 2NSXA 3DSNB 1KV3A 2NQCA 1U91A 1EEYB 3IBEA 4AW7A 1M3IA 1EHXA 1UM5H 1JZHA 1ZT4B 4AQ8A 2WBJC 4B9CA 1AZUA 2UY6B 4IGBB 3GMPA 3HG5A 1CCZA 4GKOA 3AWGA 4PG9A 4Z7UE 1ZS2A 2AERT 3RB7A 4QRQA 1A14H 1U3ZA 1V54B 3HCVA 4R2GC 3OWRA 5ECJE 1EUTA 3UTQB 2FO1A 1NMAL 2KC0A 4NC1C 2CAKA 4NN5C 5GSRB 4B5ZA 5K9OA 4MAYC 4KH9A 5CHNB 3PHQA 3WS3A 4LBAA 4FNPA 4NFCA 1O6TA 4ZD3L 2O4EA 1YYMH 5C0FA 1IFHL 4J1UB 3KYKH 2KZBA 3RTLA 1GZQA 4QLWA 4HSCX 4LOFA 3K91A 2VXQL 3SE9L 3CJJA 5CFHA 1GSMA 2EVFA 1AQKL 1KTDA 4QO1A 3FTYA 4HMEA 3V4VB 3EXJA 2FJUB 4XMWA 1U0QA 5FCUL 3SKOA 3ULVF 3WD5L 1FLRH 4XBEL 2GFBA 6PCYA 3FPXA 2CALA 2B9BA 1HCFX 4GRWH 4YJZL 3E1F1 1NMCB 1CXKA 2W9EH 2AZAA 4KNUA 2CKBB 2Y7QA 4UOZA 3ESUF 5F3FA 2WBKA 2X40A 3CNKA 4MA7H 5F7WC 4ELKA 3QWRD 1P84J 1UM6H 3CBKB 4NNXA 4PJFE 1AQDB 3DI2B 3K3QA 4KRMB 4OTXL 2BMKA 3H4HA 4Z5RA 1A1OB 1IBBA 1EZUA 4FP8L 2VZVA 1JUFB 4EDWL 3D39B 4IBYA 1YA5A 2AITA 3TFKD 1S8DA 4OF7A 4Y4FA 5A2CA 2WLHA 4CVWA 1IC1A 3KJ6L 1D5MA 4IRSA 1NCAH 1X4ZA 4UZSA 3C87A 3X1BA 2N0MA 3V7MA 4QGTA 1H15A 2XWBA 3HKFA 4KHTH 4LSRH 4GRWE 5DEJA 5HHOE 2G3XA 4A6YL 43CAA 4N87A 4RBPH 1F1GA 4JQXC 2J6EH 2WXNA 1RQ5A 4OZGA 5JQ6L 1XZ0B 4C56B 2F1EA 1MCQA 4JZOA 3MSPA 1MQKH 3BSZL 4HS8H 5CD3A 5KBPA 1X5AA 1XMWA 3NCMA 3FSWA 3HLKA 4XPHH 4ZXBC 3C9NB 4NM4H 2ZKYA 4AYFA 3IRPX 1JHLH 2M83A 1DJIA 3R7RA 1S9XB 4N90E 3TYFB 1KYUA 2JXMB 1TZHB 1TO4A 1XGYH 1WVZA 3BVDB 4I48B 1OO2A 2XOTA 2WQRA 2N3JA 4ISVB 5FK9B 4CC1A 5H94A 2OMYA 4EIUA 1DEDA 3GINA 4JFYA 1UGNA 2KMWA 3EH1A 4RFEB 4JFFA 4ECNA 4DIXA 1CK0L 3ZYZA 1BQSA 1OHZA 3W5MA 5KUKA 4NSKA 1RZJH 1PGRB 3NEEA 1TFPA 2BS9A 2NDGA 3FRUB 4MD4A 4U2YA 2W9DH 4JFOA 1TENA 3VQMA 5JPMA 5IBLC 5LN8A 2I27N 5KYUB 1BIIA 1L7IL 2JIXD 4M93B 3NH7L 1WLHA 3QDGD 1Y0LB 1EAPB 1ESOA 4NXSA 5CUSH 5EC1A 2CBTA 1TYJA 4X6CE 4P46D 3UPCA 2WTPA 4WCYL 1MUJB 5CXPA 2EXSA 4KX8A 2X2HA 3BFWA 3ECWA 3T0ED 4NC2B 2CHDA 1RJLB 2ITEA 1J0IA 1AYOA 1S7TB 4TNEA 4WW2F 1R24A 3PL6D 1WFJA 4WI0A 5DLLA 1D5ZA 2XG5A 3VRLE 1FFRA 5A3IC 5JORA 4POUB 1HHJA 2OR8A 2WBJB 1ODAA 1SDDA 4PRPD 4D0DB 4J3OC 2OCFD 4U7SA 4PGEB 5I1KL 4CMMA 3RGVA 2GHZA 1EJ8A 1ZA6A 3FN3A 4PAZA 4HQQL 5CZRA 3VH8G 5C09A 4AK1A 3VXRE 1FFOA 2XV6B 1XF3A 4R2GB 3OLDA 3UZVB 1EV2E 1Y18A 3QXWA 1JF6A 2HKHL 3V0FA 4NN5B 1CDHA 1E2ZA 1QBML 4R4FL 4XN5A 4MAYB 5DR5H 1S7SB 5DJAB 1B0GA 1CQKA 1NIEA 4Y4FC 4J3WA 1GKEA 4L18A 1BBDH 2IANB 1CE1H 3R8BB 1NEPA 1ZEAL 3C08L 2YK1L 1G6RA 2C9QA 4WI9A 4NCC2 1EX0A 1DQML 2NUTB 4O00A 3EG9A 1XTLA 2NX5A 3ES6B 4ZOEA 4NQVB 1DZ0A 3IPFA 3ZTJH 1E3XA 1JNHB 4L8SB 3V4VL 4PLJD 3ZUNC 1I85A 4GEIA 1W16A 4QRTB 3MNDA 5GGSA 5K59F 3QAZC 1DDHA 4U1MB 4AIOA 1IB5A 3CSYB 1QSZA 5DJ0A 3OB8A 5IMKB 2ZXDA 4P8QA 5T3XH 3C2AH 4Z7VF 1JG9A 4HJ0C 3OXRB 5JHMA 4KRPB 1E8WA 4LVHC 3DXAA 4WGVB 1ILSA 2QLYA 2QL1A 2R23B 2X4RB 3FTSA 2CKBL 4RMVA 1GCYA 1O7DE 2VWEE 3ZTEA 4L4TB 4ILDA 4O5LH 1HX0A 3QDMD 2B1HH 2G5BB 2QGDA 5JMRA 2E7LA 1FIEA 1H3GA 5CBEA 3LKPB 4HWBA 3BD4A 2GJJA 2FHFA 4D94A 4BRJA 1VGEL 4WO0A 3L54A 4F8LA 3LNFA 3PWLB 3CQPA 4WTZA 3KJ4C 5ANME 1YRKA 3ARFB 3LEVH 1PX4A 4APXA 4HAKA 1G7HB 3ARXA 4OU3A 4R6UA 5T3XE 1NC4D 1KC5L 3K2KA 4P0DA 4WHTB 1ZDSA 4XOCA 4GQ9H 4ZFZA 4OIBA 2IPUK 3QUZC 2FDBP 2CNYA 3ZDWA 1DSFH 4KK9C 4KNTA 5KVDH 1G7QB 4FX5A 4I1NB 3PY9A 4KKAC 2NW3A 3ZE1F 3D08A 3FH7A 2FATH 4ZXBB 5IIEA 3C60A 3VAEA 1RK7A 2RMNA 1UADC 4N22A 2BIMA 2HWZL 4PB0H 3GZPA 1KB9J 3RZWA 1CZ8L 3MV8E 5DJ6A 5JO5A 3JTTA 4JQIL 2H2SC 2WNXA 3VXNA 3NK4A 1NGXA 5L9DH 2Y36H 1LMIA 5H37A 2XVKA 1ZD6A 2R0KL 3ILDA 4O2CB 3SD5A 2ZT9C 2AV1A 5KVDE 1MG2C 1OTTD 3GMPB 5HI3C 1T03H 4PRDA 2QPDB 4PG9B 4ZO9A 2N01B 1CG9A 4QRQB 4BDVA 2YXFA 3HCVB 5DJCA 2CDGA 4OW6A 2Z9TA 5K9OB 1X9UA 1YJDC 2WXRA 4G8IA 2B1AL 3PHQB 3WS3B 4YSEA 3AY4A 4FLRA 4ADGA 4YDIH 2F61A 2ZKMX 3U6XA 4F27A 2XWXA 2AEIT 1GZQB 4YR6B 3CIAA 4MBRA 3S48A 5CJ8A 3DLQR 1OP5H 5LBSL 4J27A 1KTDB 2UUDK 1EGJL 2VLRD 1UH4A 2FUTA 4QO1B 2A1WH 4QHNA 1EZSA 3F7YA 5TE6L 5GS2D 3SKOB 5A2FA 1Z9NA 1ZVYA 5AG8A 1WAAA 1AR2A 2BWQA 1I85C 2GFBB 3WXVL 3Q5OA 2WLKA 2Z8WC 3VUAA 3OZ9L 5HPMA 1N8ZA 1WBZA 2XTJD 3V6OA 3D25A 4ZAKD 1J1XH 5I30H 2EVGA 1FG9C 2ICES 4JG1H 3EKCA 2Y7QB 4APQA 4ELKB 2EVIA 2HUHA 1H9VA 4NNXB 1RUPH 2KPWA 3N50A 3WTYA 1LNUA 3FN0L 4X7CC 4CU6A 2BMKB 5D71H 4Z5RB 4W4OC 1HNGA 1JIBA 3RHWK 7PAZA 4KPHH 2E7LC 3AXLA 1S8DB 3GO1L 3TLRA 1UT1A 3HMXH 3C2SA 3LXBA 4Y4FB 1Z0MA 4IJTA 4TVPD 5IP4A 1Z3GL 2DM4A 1D5MB 1JK8B 3DTXA 3CU7A 4IRSB 5IGXL 4BWUA 1ZK5A 5DXWA 1H15B 2X9ZA 2XWBB 2LU3A 3QARA 3B5TA 2NCMA 1LD9A 43CAB 2PR4H 2VLJD 4PJ7F 5IQNA 4OZGB 4XC3H 3BWZA 2DTML 3DARA 4JZOB 5LAPA 3WY1A 4IEFA 5CD3B 1CICC 5DYFA 1ML0A 3MLUH 3D85D 4OCYL 1C8PA 1E65A 4AYFB 3C60C 2Z8VC 3B1UA 3FQNA 4Q9CA 2DPKA 3GD1C 1DLFL 4KX7A 4YFLI 5H94B 2OMYB 1T1WA 3B7UX 4MWFA 4BFIA 1QRNA 4XPAH 3O3AA 4ZZKA 4B50A 4F57L 4JFYB 1IC7H 3FCSA 4OLUH 4JFFB 4TNWK 1TPXC 4NSKB 5IW6A 2BVPA 5I74C 4JY5L 2IFGA 4DKTA 1B0IA 3UTZA 3MJ9L 4MD4B 2YKKA 3KJ4B 4JFOB 4UNUA 2D7QA 3PLYA 4A1RA 4AMKH 5JPMB 1X6NA 5LG6A 1X5IA 4AV4A 4F9PA 2FCBA 2YA1A 3RPKA 1G9MC 1BIIB 2ZE0A 4OBSA 4RH4A 5BRZE 2Z93A 2X4UA 4BE6A 5CMAA 3BUYA 4K7PH 4RMUA 3HW7A 4UQIM 1NBVL 3JZ7A 1BXAA 4RWYH 5EC1B 5SWSD 4BQCA 2HKAA 3Q01A 2DQIH 4QRPE 2X6MA 3U30C 3VXSE 5I75C 2H0FA 1Z5HA 2OMWA 2P48B 2J5WA 3QHTC 2MCPH 3S2CA 1R24B 3NA9H 1UZ6E 2HRHA 4WI0B 1D5ZB 2XG5B 5JORB 4ORGA 2ZX8A 1HHJB 1W6LA 4XAKE 2DBLH 1SDDB 1QW8A 3BT2H 3V6OC 5C1MB 4CMMB 1CLOL 2DEXX 1IKFL 1ZA6B 2D03H 4KV5F 4R5TA 4APQC 2IG2L 5C09B 4GT7A 2HUEA 4X7FC 1FFOB 5DWUH 1XF3B 2Z4TA 1Y18B 2R69A 5I0DA 4HJTA 1WZKA 4QMEA 4XWOC 1KTLA 1QLRA 1I9IL 3JV5A 2WQSA 4DETA 1AE6L 1B0GB 1X5JA 2YA0A 3FTGA 4HK3N 5T3ZD 1WFIA 3PWVA 1PG7H 5DURD 4MXQC 5ISZE 3MLXL 4OFPA 2CA3A 1T0PB 2JELL 3G9VA 5AZ2L 1DBMH 2ZXEB 1G6RB 1VIWA 2XV3A 3ZSSA 1CLYL 1CQYA 1J1OH 2H26B 5H2BA 3UYPA 3VTAA 2Y7OA 3B83A 2BINA 3CG8A 5IFJA 2Y25A 3EG9B 2NX5B 5GGSY 3UP1A 2EC9U 2OTWA 4O9HL 4XN2A 4UDUA 3ATFA 5GGSB 4F7TA 1DDHB 3OHXC 3U4KA 3X1GA 2EINB 1MRDL 3FUKA 3HE7A 5DJ0B 1PAZA 4IBLT 3WFEH 1WP6A 2EYTA 3DXAB 4I3SH 2AI0L 2X0VA 4GT0A 2GBAA 1BV8A 1J0ZA 2OR9L 1KCUL 5AOZA 3FCBA 3FUEA 3ZT7A 1FYTE 2ZOLA 3EBHA 5CBEB 5C0AA 4JO4L 2HMID 1E9PA 3QNXA 2R4SL 4IK7A 4BA8A 1CGUA 4N3TA 3UBXA 3C5ZA 4D0BA 4R7DA 3VJ6A 1NEZA 3SE8L 4APXB 3MXVH 3NJIA 1L9MA 5B38G 5GGVH 4NHCH 2KH2B 4ZFZB 3TH3T 2XT1B 4KKLC 3V7AE 4F9PC 1J10A 4GKLA 1FE8H 3ABGA 5DVMA 2VW4A 1VZIA 4AUUA 4KKBD 4UQAA 1HOCA 3F7VA 1PIFA 2ZXWB 2NW3B 2EVHA 1JZIA 1E4WH 5IIEB 1KT2A 3QA3A 3C60B 2WYZA 3TGXA 4GRLC 3CZKA 4O4YL 4YWGL 3HE6D 1HCVA 1YAIA 1Q90A 4G6KL 1G1KA 1S2EA 3JTTB 5JO5B 3SQOL 1O75A 3VXNB 1NGXB 1BD2E 1CIDA 3M7FB 5FA4A 4FL4C 5AAMA 3DYMA 4CU7A 1LK3H 4TLKA 1YEWA 5GRYA 4BFKA 4YQXL 1A0QH 3JWOL 4DKEL 4J39A 1WFTA 1F4AA 2B4CC 1TQSA 1B9ZA 2AV1B 5I74B 3PDDA 3WEXA 2VN6A 4JHZA 1U95A 4PRDB 4J6IA 4IBZA 3U0TA 5GRUL 1CG9B 5AVRB 4BDVB 5DJCB 5CLWA 2CDGB 4MJID 1J7VR 1H8SA 4G8IB 2O6EA 3Q5TA 1UD2A 1YLBB 4UNTA 4W70A 4LAJH 1DBAH 1UD8A 4HJIA 2BNQA 1YEIL 2CUMA 5AW8B 4ANXA 5AD0A 5IVOA 1UH2A 4G6JL 4JMXA 3U30B 5AW3B 1OT2A 5DUPL 3MRHA 1LE9A 5FA3A 5C2BH 3MKGA 4M7ZC 2A9MH 4QHNB 3M6DA 3F7YB 3TJPA 4BZ2H 3PREA 4TV3A 5JA8B 5D7EA 2AVGA 3T3MF 3CZGA 5HPMB 1X7QA 1N8ZB 4GG6A 1WBZB 3AG3B 3NCJL 4RSVA 1KIRB 3D25B 3HE7C 4XN8A 5E95B 2AJZA 5D7KE 4APQB 1JWSA 2RACA 4JGUA 5I8KL 3HC0A 3A22A 1LNUB 1X5GA 1QTPA 3VQ2C 2X1XR 2GCYA 4LLUB 1R3LA 2YRLA 1N64L 2FT7A 1UD6A 1LO0L 5C0BD 5E4AA 4F80A 5GGRA 2E9BA 4TUKL 3DTXB 2X4SA 1KIPA 3H9SE 3O6FA 3MBXH 3WLBA 4JG5A 1DUZA 3DUUA 2XYCA 5I76A 5C0CE 4Y19A 4NCC1 4E9YA 2NT1A 1MJUL 4KFZC 3SQBA 3WIAA 1G6RL 1JGLH 3BKML 1OM3H 3LXCA 1B3IA 4IEFB 3OHXB 3RZCD 1RVFL 4LCIL 3BMWA 2DH3A 4JKPL 4L4JA 5HHNA 4G9FD 3F64A 5TQ0H 3MUUA 1T6WA 2WVSA 1JNNH 1J5OL 5FGCE 1T1WB 3LIZH 4MWFB 1S3KL 4BFIB 1QRNB 2AK1H 2IMMA 4MJHA 2RHEA 3O3AB 5AAMC 3FCSB 2WN2A 4KTYA 3RAJL 3RGHA 1FO0H 2MNWA 2OL3H 5ALCL 5F93C 3JTBA 1NL0H 2BVPB 5IW6B 5EIIA 3UTZB 4HWBL 4LGPB 3SPJA 3NIGF 2AMGA 1SVCP 5JHDE 2X9XA 2Z8RA 3OD3A 3F7LA 2LU5A 2DMHA 1N26A 1KN2L 3CZNA 1NBCA 1N19A 1VDGA 4I7ZC 4NNPL 3ASWA 3DJSA 2Z93B 2X4UB 2LVEA 1TETL 1L0XA 1TLMA 2Q76A 4G7YL 5CMAB 1ZSHA 3U4BL 4GPVA 5IFHH 1XH0A 1O6VA 2B8OT 4GRLB 1QG3A 5TTRA 4NI6A 2P8MA 2OMWB 3QZBA 3DX2A 1YEEH 1F4WL 3KHQA 2CH8A 4KUZH 3APDA 3MRMA 5GRZA 1OKEA 1YPZE 1KFAH 4CSSA 5AAPA 1QSED 1R47A 4FL4B 4P4KA 4ORGB 1GAFL 3MLVL 1IC4H 4GRMA 3E38A 1KCLA 1UXSA 4N0UA 3DRQA 1HZKA 4EAEA 2V8MA 2HAZA 5C07E 2OYKA 1LP9F 2WKOA 3IMTA 5DO8A 4DH2A 5FEBA 2F58H 1MCLA 1KIQA 3HZYA 3HNSH 3W56A 3KAAA 1UT9A 2EEBA 3GEWB 4LVOC 4KVPA 4DWHA 3CBJB 1KTLB 1IQWL 4POZD 1KYAA 1QLRB 5LDUA 2ZCKH 1FC1A 3VFUA 3GLDA 4I88A 4P2RD 1G9ML 1X9QA 3FTGB 4DTGH 4M1GH 3PWVB 3LVEA 2CUAA 3R7QA 4H2CA 2VN5A 1P7BA 3O6FC 3UC0L 4HETA 4YE4L 5IB1A 1TJGL 4UT7H 5H2BB 3UYPB 2L7UA 3BWUC 3DTUB 1E6OL 3HB3B 3QEGL 3X1EA 4M7ZB 4S1RL 5IFJB 4TQ8A 2OTWB 3T2LA 4X80L 4XE5B 2BVOA 4WJ5A 4NO0D 4UDUB 1R1CA 4KJWC 4Y9EA 3ATDA 4OY9A 2YD0A 4F7TB 2BHFA 4FAAB 1YSOA 5IUCA 1SBSL 3HE7B 1MH5A 4O51A 1E7UA 3ABMB 3S97C 3OAYK 1OAYH 4LE8A 3SE4C 7PCYA 5EBWA 2JIXA 5E94A 2EYTB 3KW7A 4JO1H 3HJ0A 4OT1H 3VRJA 5C3IA 1E4JA 3NSFA 4NYLA 1DVXA 2Z1PA 2YKLL 4B27A 4K3DH 1KJ2A 1HL4A 2ZOLB 3E0GA 5C0AB 3KCPA 4YHYC 3Q2WA 1E9PB 2ZWYA 2BK8A 3QNXB 2ZXAA 4GSXA 3T0AA 3NSDA 2EIBA 3C5ZB 1IC5L 4R7DB 3UBXB 3VJ6B 1TZGH 5CJQL 4D0BB 1F90L 3O8XD 4IK6A 4JHAH 3UTTE 4YS4A 7TAAA 3CZFA 3O4LA 1QUNA 1UKSA 1EXGA 3T3PE 3Q8AA 1EVTC 1VFAA 1XR8A 4XNMA 4AIEA 5SX5K 4Q9RL 1GMEA 4DP5X 2LGNA 1HOCB 1OCRB 2PXYD 1PL3A 3F7VB 3QISA 4N0YL 3I6SA 3BKCL 1BVKA 3R0MA 4RMRA 1KT2B 3VFMA 4F8TA 3QA3B 1Q72L 5KUMA 3BZEA 5I0YA 4A37A 4GXUN 1TQWA 4J4PD 1I7RA 1SXNA 3TFKC 4CN6A 1SUHA 5AKSA 2J20A 3LS5H 3BJ91 4ZT1A 5FA4B 4LPUA 4QAMB 5L6YL 12E8L 4LHUA 3BPOC 3BVUA 5ADPH 1IM3A 1HQ4A 1CTNA 3MFFA 3BH9A 3TJEL 1CFVH 1GJUA 2XC8A 1E5UI 1QEWB 4G3YL 3WEXB 3WLWD 1U95B 1FAIH 2G2RA 3HG0A 4RWHA 1BP3B 1DQQA 1IKNC 3U0TB 3IMWA 1NKRA 3PWUA 4AQ8C 5EEUA 3H3KA 2RFXA 3NJGA 2GT9A 1TTUA 4UF7C 3X3GH 3BRGC 5KSVA 4PRID 1IMHC 2A0LD 1LWRA 3VMPA 2M2DA 2JTDA 1HHHA 4GJTB 3TT3H 5F21B 3WKPA 2BNQB 3NJXA 3UIYA 2VH5L 5F96H 2AK4A 1T21A 3RILA 4F8NA 5AD0B 4CC4A 4D9QE 4RSYA 1TQBC 3QDMA 5KSBF 5AW9B 3MRHB 1LE9B 5FA3B 1X9LA 2Q7AA 5CJOL 4HG4K 2DMGA 1A4JA 1L9TA 1WYJA 3QJVB 2DRUA 2C1OA 3DMMA 3K8LA 4PJ9D 2JCCF 4B9FA 2NZ1A 4PRHA 1ROCA 3JWNC 2DI7A 5D4IA 2IDQA 2ZSWA 4GG6B 1SFDA 1MFDH 3ROLA 1RUAL 3FL7A 2AJZB 4M7JH 3VGBA 2B4CL 1JWSB 2IAMA 5E00A 3HC0B 1OXYA 3IGUA 1CR9H 5T1MA 4LVOB 4UNIA 1P4IL 5CEZL 4V33A 4ABWA 2GCYB 3QT2A 1R3LB 4FN0A 3U7AA 4C58B 3EH3B 2F1BA 2R69L 3L5HA 2W88A 3D2TA 3X2QB 5GGRB 2PWEA 3CPLA 2F8OA 4P46C 4TQEH 5D7IF 5AVWB 2X4SB 1KIPB 3O6FB 3WLBB 3K6OA 4TVUA 2JJWA 4UTBH 1DUZB 3DUUB 5I76B 4HBCL 4NQEA 4Y19B 4NQUA 4N2KA 4N2NA 4OJEH 4WV1A 3ARTA 4BFRA 3SQBB 1R75A 4XAWH 1XF1A 1BFOA 5KVEH 1I82A 4NFBA 4XZ4A 5J56B 4UU9B 1QKZL 5KAQF 5EEXA 4P9ML 1J1PL 5HHNB 1MCPH 2EDFA 2P3YA 2JLLA 2D0HA 4U05A 3FSVA 1PEZA 3LNEA 5I0XA 3GM8A 4HW6A 3TBVB 1R9FA 3RBGA 1J87A 2ILLA 1YNKL 4S10A 1HXMA 5EIIB 5DMGD 2VXUH 2VLRA 3ZZSA 3ULUF 4P2QA 3CXDL 4G42A 4NZDA 5ERWA 1B6UA 1SEQL 1JNJA 5CEXA 1ILUA 4OH2A 1QHOA 4LU5L 5HHXH 4PTTA 4G43A 2BXZA 1T4WA 1TTAA 3SGEH 3HAEH 3P9LA 3UBGA 3EJYC 2IWKA 2XZAH 3QDJD 3RJDA 2Q76B 3N9GL 2UYLB 4DOHB 1AIFA 4OFKA 1NCBL 3JTSA 1R4XA 3A6CH 4Y9BA 3L5XH 2P8MB 1NSNH 4PJEE 2CK0H 2YN5A 5CJXC 1N59A 3MRMB 1KGCE 3OMAB 5D93B 3FQRA 3R18A 3DMMC 4P4KB 1FUNA 1KY6A 3BPOB 3V0EA 1RP9A 1Z3RA 4LDOB 4UV4L 4GRMB 4EZJA 1UXSB 2BZDA 4N0UB 4E41E 1HNFA 3DRQB 4KK6D 4KO7A 1ZVNA 3TCXA 4FQJL 2XQYG 4D7PA 3RIFK 2H3KA 1OK0A 2IAMC 3NPZB 4B9IA 4KVNL 3QBTB 1KIQB 3HZYB 2ZOKA 4AUJA 1O9WA 1VGKA 2ZWSA 4XOAA 1JRHH 1P5UA 3KXFA 3MV7D 2MQCA 4R84A 3VFUB 4Z7QE 3BVWA 2NY2B 2GPZA 4GAFB 4FNQA 3K4DA 3WN5A 5DK0A 2WAQA 2B59A 3UJTL 3B2PA 1TQBB 3QG6A 5IB1B 3IGLA 4H0GA 4L4VA 4WRLA 1URLA 4MDIA 4HALA 4WV1C 5DFVD 3TL5A 4ANUA 4HOXA 2BOLA 4W9KC 4GUQA 2EE3A 4JN1L 4UQ3A 4NGHH 2BVOB 4WJ5B 5IHUL 3SDAA 4YEFA 5IB5A 5ICYA 2GI0A 5AW5B 1JTOA 5C6TL 1KYFA 3ZE0F 4ZUVA 1UWGL 1JD7A 1MH5B 1RERA 4O51B 4R5VA 1UA6H 4G8GA 4PJ5E 1QACA 5IT2H 1ZVSA 3PNRB 5EBWB 2JIXB 5E94B 3MTRA 4LDEB 5AVXB 3VRJB 1URZA 1EERB 1I75A 4NYLB 1WITA 4N2BA 4XCEA 4P05A 4H1LH 1IVTA 5SWSA 2ALWA 1KJ2B 3IU4H 5IQ7L 3KCPB 3QCUH 3QVAA 4NRYA 2NMSA 2X53A 2Z65C 5FYLH 1MI5A 2V9RA 4KKQA 1KOAA 5I1CH 5HBBA 4XGZA 3US9A 4AIXA 3CZFB 3O4LB 3MTXA 1QUNB 3RTQD 2DQCH 3I6LD 1XR8B 3F83A 4XNMB 1JZ7A 1UOKA 1AS7A 3GRBA 3H2PA 5EUOE 5I1JL 1ED3A 1ID5I 2XTJC 3TBTA 1SN0A 4JKMA 2D2CC 5PAZA 4MQXD 1BVKB 4M1CD 3VFMB 2QQKL 4OM1L 1UJ3C 3BZEB 3NRPA 2H3NA 4N2FA 1NUFA 4PP1D 2J1KA 4CN1A 2NZ9D 3DTDA 2YRPA 1I7RB 1ZLUK 3GXTA 1S78D 2CD0A 4Z1PA 1F4YH 2XWEA 4RRPA 1YDPA 4LHUB 1MDTA 1IM3B 1HQ4B 4OCRL 5FFOA 3SDDA 3CFEA 3MFFB 3BH9B 5J3HD 4I0KA 4U6VL 2ENPA 2O26U 3VFVA 2G2RB 3DX3A 1DQQB 4BQ8A 2RFXB 3VXUE 2GT9B 3ZY7A 3UROR 5KSVB 2YPVA 1Q38A 4OF6A 1KLGA 2CRMA 3CFMA 1DFBH 1HHHB 4W9EC 3P9WB 1ZGLA 3BZ4A 3GSNH 4NZ8A 4XPBH 4Z3GA 2NXZB 2AK4B 5EA0L 1T21B 2VRAA 3VCLA 1BM3H 3MREA 3VD4A 3VG0L 5BRQA 1D6EA 4LGSB 1BEYH 3QDMB 2W5PA 2WANA 3AFLA 2KZKA 1SXAA 2BVQA 2DL2A 3S35L 5D6DA 4AV5A 1CYXA 1BAFH 3AG4B 3QB7C 4TLUA 1OCCB 3P4NA 1ACYH 3WELA 1A4JB 1E0OB 1AACA 2D7MA 2C1OB 2IALA 3DMMB 4IU2A 3SDAC 5IBTH 4PRHB 1A7OH 5GHWL 2Y7SA 4GSDL 3VFGL 3KYAA 4IIQA 1F8TH 2ZSWB 2O30A 1LHZA 1J88A 1I7TB 3ROLB 1TJHH 3L4CA 2BY0A 2IAMB 1NZRA 2M26A 1TYEB 5E00B 4Q4IA 4ODBD 3N1QC 1KMGA 5GGQL 3SCMA 3LPWA 5T1MB 2B0SH 5KYXA 2IEPA 3KE0A 3SO3B 1ND0A 1NGZB 2XZCL 4M4PA 2X3BA 3H1ZA 1EH9A 2BRQA 3VNZA 5EHFA 4ODTH 1N8OE 3CPLB 1HZLA 1QD0A 4RISH 5DD1H 4QYOA 4C4KT 2YO3A 1T5KA 3AREA 3ULVE 2V4LA 3DROA 5DJXB 1RHHA 2E5EA 4NQEB 1QQDA 1JI1A 4AITA 4WV1B 1AMYA 4NQDD 4MB4A 4OB5H 1BFOB 5DK2A 3WEOA 1VB9A 3D5OF 1WUNT 1U21A 4IRZL 5HDWA 2EJ1A 4TUOA 2QQNH 2YEZA 3KPSE 1TJIH 3AQZA 3OMIB 5D70H 2Z7ZA 3T77A 3U1SL 5F1SA 3VI4F 4TOYH 4JJHA 3NJNA 3HG1A 4Q6YA 2VXSH 2GBTA 5C7XH 4G80A 2VXTH 1PS3A 2Y2WA 4MJIA 1USQA 1CTOA 1OSZA 3CU1A 4BINA 5J6GA 3KLQA 1D5RA 5L4FA 1KB5A 4U4IA 2D7TL 1HXMB 3U7WL 2Z1KA 1KJ2L 2XQBL 4JFWA 3A4EA 2QHRH 2VLRB 4MCZA 3WTWA 1P4UA 4P2QB 4NZUH 4G42B 1GGTA 5ERWB 5F6HJ 4LCWD 1DUYA 5CEXB 1D9KD 3NCCB 3HEIB 4OZFH 4PTTB 4G43B 3H55A 2F19H 2VJXA 3O0RL 3O4OC 3P9LB 4NPJA 4PJDA 4JZJA 2A77H 2XTJB 1FWXA 2WK2A 1WD8A 4IMKC 3FT3A 4YHZH 5BZZA 2QEJA 4NRXA 5TH2A 4KHXL 1AIFB 4G6FD 4DVBA 3JTSB 2CBQA 4Z77A 3ASOB 4Y5YA 3Q05A 1CIUA 2NQ3A 3MOBL 4Z3TA 3FSOA 1B9KA 4PS3A 1QSFE 4OVUA 4HH9A 4GO6B 2A9CA 1N59B 5BVPL 2YGQA 4PBWD 2QVIA 3RWCA 5BZXA 2HMIC 3D18A 3DVIA 3FQRB 4WY7H 5ID1B 4LARL 3QRGL 4ODHL 1F02I 1GR7A 3E7JA 3V4LA 1IGFH 2EXWD 1KEMH 2YAMA 4H4NA 4IIQC 4Y2OA 2CHXA 5E9NA 4J3SA 2XVGA 2JMRA 3GDBA 4WDIA 4YN3A 2ESVA 3MKKA 2ITFA 2ZOKB 3GSQA 3FUDA 3SCMC 1ROWA 3IRCA 2I9LA 1PSKL 2VDOH 2ZYSA 4G9DA 4TULH 1LK2A 2YD4A 4JFEA 1VGKB 4J3BA 3KXFB 1P5UB 3RVXD 4YLCA 4PSPA 4Q6IA 4PLKD 4XPFL 1X4XA 3HE6C 5GISL 3L9RA 2TSBA 4LSQH 4G9FA 3KYOA 1WZ1H 3AREC 3WN5B 4JKWA 4UQ9A 3QEQD 4AIZA 2B59B 3QG6B 1TUPA 4OQTA 1HL8A 4FTVE 4R7XA 4MDIB 1NCDL 4TTDD 3M8OH 4UUJA 2R8SL 2V7HA 4JO2L 3ZKSD 4MB5A 4R96A 3POHA 5EIQA 5IB5B 3SDAB 2P46B 3C6LA 5ICYB 3FUIA 3OQRA 3OKEA 2YMXH 3EYSH 4ZUVB 3QORA 4ZMTA 5F9AC 4DGWC 1QWNA 1A1MA 3KW8A 5LXGL 2D0FA 1EZVY 4G8GB 1N6VA 1ZVSB 2YQBA 3U2JA 2Q8AL 3GXUB 1BEXA 3WHXA 4ODUA 5KYNA 4XCEB 1UT2A 5SWSB 1ACCA 4MA1C 4L9LC 4BFGA 1H8NA 3OZKA 2IMNA 1GL4B 4NRYB 3ZIMA 2PCFA 2ICWA 2I07A 5JIIA 1MI5B 2WYIA 4JFZL 1WWWX 1FHGA 5EBLA 5A6MA 4XGZB 3U25A 3I9PA 5IUSA 3P4LA 3DHUA 2N1KA 1Y6NR 3FO0L 4R83A 1YCSA 3T4AA 1VSCA 5T5FA 1RLBA 4GYBA 1ED3B 4JZJC 1UKTA 1LEKA 3TBTB 4CBZA 3ZIYA 3QSKB 2KERA 2GTWA 4PJXE 2Z64C 3LEYL 2YBGA 3ZLQC 4Y5YC 2H3NB 3PRZA 2F74B 1J11A 1AC0A 4MB1A 5AVVB 2R39A 4ZD3H 4P2RA 4TYUA 2Y4SA 3KM2A 3G5ZA 1NIDA 1B4JH 3BPLC 2MCAA 1T7VA 3MAWA 1YDPB 2QPEB 4J6RL 3CFEB 4KKZA 3ETSA 3L3IA 4YDLC 1B2YA 3D0LA 1AQKH 3BIKA 3OL2A 5E0QA 4QOKA 4JM4H 4PGBA 3VFVB 2H2PD 1J18A 2XX0A 4E9RA 1E5CA 1ETJA 1QYGL 3WD5H 1CDIA 4PY8I 1BG9A 4FCHA 5I73C 1BVNT 4XBEH 1L7TH 1H3TA 4PRBA 4YBLB 3KPLA 4AOFA 4ZMOA 1PEWA 4R90H 4ZO8A 5JYLA 1KLGB 1H6FA 1ZGLB 3BZ4B 4Q6IC 4TQPA 4NERA 4FG2A 3EFFA 3APCA 3IJSA 3VCLB 3MREB 4GQPH 3UCQA 4UINL 6CGTA 1C12A 1D6EB 3V4UL 2Y6TE 1GJIA 1MHCA 4Y5XC 4EDWH 2EDJA 2AJUL 3SN6N 2X42A 1PF3A 1OSEA 2BVQB 3IU3B 4JPSA 3RPIA 5ITFA 1GTFA 3P4NB 5HHME 3UTPD 2IALB 4IU2B 1NGYA 3QQXA 3C6LC 3OPZH 4KI1A 3O8XA 4IIQB 1K5NA 1MRCL 2P5EA 5IHHA 3QORC 2A9AA 2Z8SA 2F5BL 1IBGH 2FX9L 1G87A 4OUOA 2J7LA 4HPYH 5FYKD 4N8UA 4P3WA 3SCMB 4A39A 3QYNA 1FNSH 5KYXB 1KYDA 1ND0B 4ZMXA 2QFRA 4P2AA 3Q2LA 3TT1H 4HKZA 1GZHC 2XQYK 3FSAA 4FQLL 2DQJL 3LAFA 5ABAA 4DHLA 4K0OA 4QYOB 3AREB 1GGBH 3DROB 1L3WA 1RHHB 4WUUE 2LR4A 5JQIB 1QQDB 3EZJB 4E9WA 3EFDL 1CK0H 1AD9A 5I8EA 3T4AC 1WE5A 4ZSOA 3D09A 4Z7WA 4NWUH 1K8IA 4TUOB 5TE4L 1EUUA 3D51A 1HAWA 2NSMA 2YEZB 5ILTL 3IKCA 4MXVE 3CFDA 5F0PB 3T77B 4EQ2A 1Z0NA 4IBVA 2E75C 3HG1B 4K2UL 5K9KB 2EYRA 4ODWA 4G80B 4PRIA 4MJIB 2ISDA 3NH7H 1OSZB 3RA7L 4AW4A 1A3LL 1F5WA 2H32A 4WHYH 5J6GB 1PJWA 4OZHF 2CO6A 1KB5B 3L4ZA 1NPJA 3QC6X 3RVUC 2CGRH 4GXFA 2F7PA 2L7QA 1J9CT 1JDAA 3ISWA 4G8AC 4MCZB 3QR2A 1LEIA 3PQYA 4Y1AA 1DUYB 3UJIL 1AAJA 3ECBA 2WQWA 3LSOA 3QQ9D 4HEPG 1XHHA 1QFWH 3EJQA 2JKJA 4JZJB 4PJDB 3ZZQA 5I1KH 3FT3B 5C3LD 1T1YA 4P2OD 4NRXB 5TH2B 1KNOA 2G4EA 2PABA 4DVBB 4Z77B 2CMRL 3GXMA 4Y5YB 1P7HL 2HKHH 1C08A 4HH9B 1QBMH 5HYSG 1KBKA 2IQAA 5HYJA 3BQUD 3NJMA 2AMUA 2ODHA 3RWCB 3D18B 3CD4A 1N0LA 2YLKA 4QHMA 3V0WH 1QWHA 1U42A 4X0KA 3WN6A 3BDYH 3O8XC 1OW0A 1OAZL 4Y2OB 4YDLB 5EDXA 4L29A 1JXGA 4Q52A 5FO7A 2AW2A 1X5KA 4WDIB 1E7VA 4G72B 5IKCA 3BUIA 3P54A 3V4VH 5I73B 5JQHC 1R17A 4LCCC 3GSQB 2I9LB 1T0OA 1T2XA 4G9DB 2N7BA 5CILL 1LK2B 4JFEB 5DTFA 3R19A 3ISYA 3EAKA 2MQ3A 4Q6IB 5C71A 2YPVL 1L6PA 3SDCD 4WTQA 3L9RB 4KJPD 4TNFA 4XR8C 5KW9L 4G9FB 4J4PC 3AZUA 3KYOB 1FSKB 4Z7NB 4G1MA 5D5MF 1ICTA 4AIZB 4WI7A 2CRIA 4IQHA 5CKAA 1YO4A 4Z7UA 1G4MA 2WB7A 2V7HB 1R3IL 4UV7L 1P4BL 2DM7A 1H6TA 2H3XC 3Q9PA 4R96B 5D1QD 3C6LB 3U6XS 3BWSA 1QTYT 3OKEB 3OKNA 4LLMA 4H0IA 3T0BA 1KXHA 3QORB 4YHLL 1DCEA 4LAQH 1A1MB 3Q1SH 5L2KE 1XTMA 3MJGX 3BESR 1RZPA 4EN3A 3L3KA 2WTOA 4S1SH 4XCCL 4FS0A 3WHXB 4ODUB 2BZCA 1L9OA 1MY7A 5GS0D 3D39E 4FERA 4PN6A 2HWZH 3MGTA 4WWID 1CZ8H 2PCFB 2I07B 3NIDF 5EBLB 4DKDC 1GGYA 2IDCA 5DLML 1DJWA 4ZTPL 4GEJA 3CSFA 3KBFA 1QA9A 2R0KH 4GP8B 1XR9A 3B9VA 3T4AB 3CQQA 5IQLA 4F3FA 4TLSA 4BXVA 4PJFA 1LEKB 4OJAA 4BM7A 4C56E 1XCWA 1VESA 1B6DA 1JZFA 2FWLB 2GTWB 5HGGS 4CDHA 5DCCA 3LEXB 1ZLWH 2X05A 1MCSA 4IKNA 2A74A 2RR3A 1AGEA 1RFDH 4RX4D 5C9JA 1A7PL 5I1GL 4KNQA 4P2RB 4CDGC 4AKPA 3BAKA 1R5VB 3G5ZB 4FQ1L 4XMKH 5FIEA 3V79C 3PYCA 4N5UA 4DGYL 4Q8BA 3ZU8A 2WMPB 1UGKA 1KB5L 5LBSH 5F89B 3D0LB 3BIKB 4G2AA 2O6FA 2R7EA 4QOKB 1EGJH 1SUJA 4PGBB 3ZE2F 3IN2A 4M61A 3UCRA 4ZRGA 2VLKD 2Q3ZA 2B20A 2GAZA 4U1IA 4Y9CA 1WV7T 4JZNA 2PNDA 3NK3A 1T22A 5FKAA 1T66D 3G5YA 1T2JA 3Q2NA 1DBKL 5DRNA 4PRBB 1KDIA 3KPLB 3LH9A 1NQBA 3H2WA 2G9KA 4U2ZA 5B1AB 2AQ3A 2J8UA 4P5TA 3EFFB 1HKLH 4X9YA 4BZ1H 1P0SE 3IJSB 3FN0H 5G4OA 3QQ4A 4Z76A 4PJIF 1C12B 1EZLA 3V10A 1MHCB 3ETBF 5FPIA 4EBQL 3RPIB 3W0WD 5ITFB 1Z3GH 2WQXA 3FT0A 1VEOA 2DOCA 1NGYB 4LQFL 2BNUA 4K94L 4ZMNA 5DMGC 3CHXA 4NP4H 3NRFA 2HJLA 4JHBA 1G9HA 3A24A 3O8XB 1K5NB 1MCJA 2P5EB 3CX5K 3SHSA 1ZLEA 5FECA 1BSIA 3RTQA 3BE1H 2GITA 3RDJA 4OCXL 5FYJD 3JYBA 1OP3H 5J13B 5I5JA 4ONFL 1ONQA 5KAQG 2BC4A 1CB4A 2NY7H 1XGTA 1L5GA 4X6CA 3L13A 1W6WA 1FFPA 1A3QA 4FMFA 4OCYH 3MLYL 1NGPL 4RGNE 4HKZB 1DLFH 4I9WE 1ZTXL 2AQTA 3O3UN 2BLFA 4HAFA 3ZRCC 5E2TL 2PPEA 2X1WL 4GSRA 1FNAA 4HEME 2WO2B 2ATPA 4FCAA 1QLEB 5E2UL 1AD9B 1WA0X 5I8EB 3WKQA 4NQCE 3ZHKA 1K9TA 4OQTL 4JY5H 4Z18A 3VXRA 4ODSL 4ZSOB 4Z7WB 3MJ9H 3TV8A 3ZUCA 2ED9A 2APTA 2B2XL 3DIVA 2W0PA 1K8IB 2F18A 2EDHA 4RDQF 4F7PA 1L0QA 4JPKH 3IKCB 5K1JA 3CFDB 1AFVL 2SODB 2KQMA 3CFUA 3QJZA 3TVMA 1PNCA 2EYRB 5F9JA 4ODWB 4PRIB 2DS4A 4YDKH 2M8XA 2I5YL 2IBZX 2H32B 2NY1C 1A7RH 2ZF8A 3F62A 3WS6A 4XO9A 2CO6B 2NY5C 3M45A 4WK4B 4K8RD 4Y4HA 1WZLA 1BQRA 4XHQA 3O2WH 1T2QH 4H8WH 4WEBL 4BSVB 1I8KA 4BQ6A 4XMZA 5EU5A 4B53A 4FFYL 1N2RA 1CFMA 1QBLH 5JMOC 1JNLH 5DFVC 4LDLB 1WCQA 3S5YA 4LCYA 1ZJAA 2DB8A 4I9XA 4MJ2A 3H3PH 3PQYB 2LHAA 5TFSH 4Y1AB 1LEIB 1NFDE 1T89A 4HHWA 3ECBB 3VD0A 1O5PA 2OCCB 3LSOB 2EDQA 1MFEH 1RUKL 1VFOA 2F7RA 3GLEA 3VW3H 2H6OA 1T1YB 2EC8A 5JXEA 5T5FL 4BCZA 4ZBJA 1KNOB 4P5TC 4HT1L 1YC8A 4Y2DA 5JIMA 5FOBA 3PFQA 1IV8A 3W9EA 1INDH 4Q56A 3LMJH 4XX1E 5JDSA 1C08B 3V5HA 4D8OA 1I9IH 4UOJA 5HYJB 2BNRD 2IQAB 1Z9LA 2MH4A 1CC3A 4TUUA 1U8QA 4UYPA 4E42A 4XPGL 5ANMA 3AG1B 3GBLA 3NIGE 4QRUA 5K9QG 4QRFA 3MV01 2XWTA 5F9WC 1N0LB 4QHMB 1NDMA 1YQVL 1GS8A 2A6KA 2X0UA 3EYUH 4X0KB 4JRYD 3NSJA 1CLYH 1EEZA 1PLGH 4Z9KB 4WZ9A 5DMYA 4L29B 5FO7B 3RTQC 4K7PX 5KOVC 3S96A 1TQCC 2XJLA 4O9HH 5IKCB 1LO3L 4QXVA 4N2HA 4FA7B 3KGUA 3UACA 1RZJC 3ZHDA 8CGTA 5DMIL 4L3EE 4MQXC 2VISA 1JTTA 1MRDH 3MV8A 5D72H 4X8XA 5DTFB 2Y0SA 5C0JA 2VDLH 5GRVL 1UM4L 3QZWA 4J3OH 1WAEA 4PP1C 3TNNA 1NGQL 2VL4A 3RY5A 1L9RA 2L4OA 1OWWA 2D4DA 2BRRH 4G1MB 5ALBL 3FDWA 4PS7A 2OR9H 1AY1L 3FCUB 3N42B 4AL8C 3MA7A 2ZCLL 4Z7UB 2K70A 1AQMA 5K9QI 5T1KD 1FBIL 2GUOA 1H3PL 2DD8L 3OKNB 3T1FA 4LLMB 3VA2C 2P8LA 1MCWW 4OAWA 2CHZA 1UCBL 3NJJA 3I9GL 2Z91A 4EN3B 5L4JA 1RZIA 4HLEA 5E5MA 3D33A 4A2LA 3WS6C 4G8FA 4DPAX 3CVIH 5HSFA 5GRXG 3EF4A 1A1NA 3OC5A 4ATTA 3BMVA 1AGFA 3EDEA 4L0ZA 3MGTB 1FFTB 3LRHA 3VXMD 2Z7WA 2DKMA 4OZ4A 3BGFC 1FV1A 3HLAB 5ESQA 3SOBL 3RURA 2CCWA 4Q0XL 2BVEA 1QA9B 1T89C 1HCZA 5T1LA 4F3FB 2NY3C 3CAFA 2R29L 4PJFB 4KRLB 2B3IA 5D96C 1VEPA 1QLEL 1O7DC 2VWEC 5LGYA 4N24A 4N1CA 5DVPA 3GWJA 5GRUH 5LAXA 4Y2DC 3MXWL 5C0DA 2WJ5A 3HBZA 4A68A 2P9RA 3ILPA 4M9OA 4MQSB 2A74B 5CN1A 1AGEB 5C9JB 3KVQA 3F00A 4U1KA 5INCA 2NY1B 5EUKA 4GRWB 5E56A 2ARJA 3B37A 1WFNA 4GKSA 1BVLA 4JL2A 4C57C 4XC1H 5EZJA 2YPLA