4PAZA

Oxidized mutant p80a pseudoazurin from a. faecalis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
b'ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTAHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4pazA00
3AW5A 1T5KA 1GW0A 3WG7B 4DP5X 2WSDA 1OF0A 3L45A 1SFHA 1MDAA 2GC4C 2PPAA 5I28A 2XV2A 1ZIAA 1PZBA 1BAWA 3IEAA 2YQBA 1R1CA 1SHWA 1KCBA 5AKRA 1L9PA 2YXWA 3ZIYA 2VW7A 1HAWA 2UXTA 3ABGA 2YAPA 1KYAA 2Y1AA 5I6KA 1W6WA 1OCZB 1X9RA 2TSBA 2PPEA 3FU7A 4JHVA 1ZDQA 1BQ5A 3EF4A 1IUZA 3EH5B 3FT0A 4HIPA 2PP8A 2CALA 3CDZA 2VSMB 4QLWA 4G71B 2HX9A 4G7QB 4G7RB 2OCCB 4WKXA 4L0PB 2XXFA 2VSKB 3SBQA 4JHUA 4AI7A 2XX0A 5EHFA 5I5MA 1AS6A 1PNDA 4DP6X 2HLEB 3BQVA 3QJRB 4AX3A 2VN3A 2TSAA 3ZBMA 2FT8A 2VM3A 3V9CA 4E9TA 3DIVA 7PAZA 3IN2A 2BZ7A 2R7EA 4KO6A 5FC9A 2FTAA 1PLAA 1J5CA 3FYIB 3PAVA 5I6MA 1MG3C 1WS7A 4YVUA 2AANA 2JFCA 3NP4A 1NTDA 3N55A 2B08A 3NSCA 1NIBA 3EH4B 4G70B 1AANA 1OCCB 2X88A 3ERXA 1NICA 3TA4D 1X9UA 4YSSA 3FQ2A 2EIKB 2NRDA 1ZIBA 3JTBA 1AR1B 4F2EA 3ZX1A 3QJQB 2XWZA 1V54B 2GB2A 2HXAA 4KNTA 2IDFA 1ILSA 3MX0B 1NIAA 4TXVB 2QT6A 1EHKB 3FU7B 4NERA 1HAUA 1SF3A 3JT2A 4Q89A 4A2EA 4UANA 2W88A 6PCYA 3OM3B 1A65A 3OMIB 2J56A 2XV3A 4BDVA 4DP1X 4KO5A 3PAUA 1AAJA 1JVLA 2WO2B 1E67A 2YAEA 1JXDA 3PAZA 2UX6A 4YSAA 2Y69B 2BO0A 5I5JA 2P80A 2BP0B 2VMJA 2QDWA 2EINB 1OE2A 3AY2A 4E9QA 2Q5BA 1TEFA 3DTUB 2CJ3A 2PCFA 1OCRB 4DP7X 2EIMB 3NJKA 2XU9A 3WKQA 2HX7A 3GYRA 2Q9OA 4AKQA 2GC7C 2XXGA 4HCIA 1AZBA 1XB6A 1NPJA 4HHGA 4HALA 2FQFA 3UADA 3H4HA 1QHQA 2R7EB 2QDVA 3FU9A 1E5ZA 4YSUA 1CURA 2MRYA 1V10A 2DWSA 2XVBA 4A68A 1BYOA 4KNUA 1DYZA 1PLCA 4BXVA 2ZOOA 5IY5B 2P80D 4FAAB 1AG0A 1L9SA 3NYKA 1WA2X 4ZK8A 4YSCA 2PCYA 3NJHA 2VM4A 2BHFA 2FWLB 4A66A 2GIMA 3AZUA 2CBPA 1AZRA 1KV7A 4G72B 4FA7B 4GP5B 1MZYA 1I53A 2ZONA 3ASOB 3NJMA 4K9JA 3NJNA 1KDIA 5B1JA 5D4HA 1BXVA 4A2HA 1TEGA 2DYSB 3UACA 2UX7A 2ZWNA 2IAAC 5I6LA 2PPFA 1KBWA 2YAFA 3NJGA 1OV8A 2YARA 4DP4X 1M57B 3NJFA 2BWDA 4DP0X 1ET5A 3TBBA 1A8ZA 1IBYA 2AVFA 4HHWA 1JXFA 3UAAA 1AZCA 3NT0A 3AG2B 3X1FA 1GS6X 2EIJB 5B1AB 5ANHA 1AS8A 2IWKA 3BVDB 4YSDA 3S3BB 4A2GA 1M56B 2BWIA 4NAJA 3ABKB 2GI0A 3IN0A 1ASOA 5PAZA 4KO7A 1J9SA 1VLXA 1JVOA 2PPCA 2IH8A 1AQ8A 4W9ZA 3NSYA 1OE1A 2XX1A 3WI9A 4W1TA 1SF5A 3NSFA 3H4FA 2FNWA 4A2DA 1V55B 3UABA 3S8GB 1NIFA 2YAOA 4RH4A 4KNSA 2AFNA 3FYEB 2MTAA 3G5WA 1NZRA 4E9SA 4QKTA 2EILB 2IDUA 2IDTA 4F2FA 3CVCA 2QPDB 1BYPA 2FJSA 1E65A 4F7KA 1AG6A 2VW6A 8PAZA 3AG3B 1J5DA 2I85A 4GP8B 3QJSB 3T6WA 2BZCA 1BQKA 3CG8A 1GSKA 5D4JA 4E9WA 3AG4B 1ET8A 2AZAA 4E9YA 2CCWA 4E9RA 5TK2A 5TK4A 4DPBX 4ENZA 2E86A 2H5UA 1PY0A 4MFHA 1PAZA 4M4RB 4YSTA 5B7MA 1L9RA 5AFAA 1SJMA 2YAHA 1WS8A 3X1NA 3ABLB 4DP2X 2XUWA 4P5SA 1NINA 1BXAA 1ZPUA 1BXUA 4N8UA 2VW4A 3CDZB 3DKHA 3IE9A 1JZEA 1ILUA 3FU8A 2I7OA 1ADWA 2ZXWB 2IWFA 2BW4A 3PPSA 5B7EA 1ZV2A 2HRHA 1F56A 3SQRA 1SFDA 4PAZA 1XB3A 2HX8A 3FQYA 1ET7A 3H56A 2XV0A 1AZNA 1PMYA 4KOBA 2H3XC 4A2FA 1J9TA 1TKWA 3WNIA 1MG2C 2GBAA 5PCYA 2DWTA 3QJTB 3NP3A 3IBOA 3QPKA 3T6ZA 4DPAX 3FSAA 4X4KA 3U25A 3CZUB 1FFTB 2JKWA 4KO9A 3X2QB 1B3IA 4PCYA 1ZDSA 5I5IA 4YSEA 2B3IA 1PZAA 4DP9X 1PF3A 1N68A 3FQ1A 5B1KA 3RYMA 2GHZA 2UXFA 2XYBA 1WA0X 3V9EA 2FT7A 1AS7A 1AIZA 4AZUA 5LDUA 4BXSV 2IDQA 1RZPA 1WA1X 1XMEB 1GS7A 7PCYA 2FQGA 3ABMB 4N4YB 3FSVA 5I26A 1EZLA 2WO3B 1GY2A 1RKRA 1JZGA 1YLBB 3GXUB 1NDTA 3CVBA 1RZQA 2PP9A 3OD3A 1HFUA 1SNRA 3SBRA 4E9VA 4AKOA 1DZ0A 5I6PA 1GR7A 4BDVB 3WNJA 4YL4A 1W6LA 5I6OA 1CYWA 2DV6A 5A7EA 1JXGA 2N0MA 3EH3B 3TASA 4CSZA 3X1GA 3KW7A 1NWOA 2J55A 3T6XA 4YVNA 2IH9A 3N2JA 3NJIA 3S3CB 2J57A 3CVDA 1FA4A 1CYXA 1PCSA 2BP8A 4BWTA 3D12B 1A4CA 4DPCX 2GSMB 1JOIA 3KW8A 3WIAA 1ASPA 1JZFA 2X87A 1AOZA 1UATA 1L9TA 4E9XA 1JZIA 1QNIA 3OMAB 3QQXA 3NSDA 4UF7C 1AZUA 5E9NA 3T71A 3S8FB 2XLLA 5I6NA 4YSOA 3ZDWA 1NIEA 2A3TA 1ETJA 1JZHA 1GY1A 2CAKA 1QLEB 3FPYA 2BP0A 3MBWB 4AKPA 4CSPA 3FSWA 3OMNB 1KCWA 3HB3B 5B7FA 2FT6A 1JZJA 1IC0A 4A67A 2YAQA 1OCOB 2IWEA 3ASNB 5F7AA 2UXGA 1J9RA 1KDJA 4EF3A 1CUOA 4GXFA 1BEXA 1OOWA 1NPNA 9PCYA 2FQEA 4WTQA 4G7SB 4HZ1A 4HCGA 3X1BA 4GP4B 1J9QA 3TU6A 3FPXA 2QPEB 5B1BB 1SHXA 2OV0A 2CUAA 1SDDA 1A4AA 2W8CA 4NB7A 3AG1B 1IBZA 2BW5A 1IKOP 1RCYA 1WAEA 4HAKA 4BWWA 1L9OA 3S3DB 4DP8X 1GS8A 1A4BA 3FSZA 4GY4A 1MZZA 2BP8B 2AZUA 2H47C 4BWUA 1FWXA 4UAHA 3NJLA 3PLYA 5AZUA 3OQRA 4YSRA 3UGEA 3EHBB 3PXLA 1KGYE 2PP7A 1L9QA 4M3HA 2HRGA 5F7BA 3X1EA 1XB8A 2PPDA 4GYBA 1PLBA 2RACA 3FS9A 5B3SB 2UXVA 2YXVA 1E30A 1PNCA 4JKNA 3HEIB 2JXMA 2PLTA 2YAMA 1E5YA 1JERA 1KBVA 3T9WA 1AACA 1ASQA 3C75A 2J5WA 2DYRB 3TBCA 2I7SA 1W8EA 1M9WA 2FQDA 5D4IA 4BK5C 3NJJA 1BQRA 3GDCA 1TU2A 2HZHA 4YSQA 1NWPA 4HCFA 4YSPA 1URIA 4KOCA 1N70A 2DY2A 1OE3A 5B1JC 6PAZA 2OJ1A 1ID2A 2LLNA 3UAEA 1NIDA 1PZCA 3SBPA 4Q8BA 3PCYA 1GYCA 3QJUB 4P5RA 1A3ZA 1CC3A 3QJVB 1SDDB 3T6VA 2IDSA 3WKPA
chains in the Genus database with same CATH superfamily
4UUJB 2WK2A 2F68X 1A3RH 2C9RA 2AMUA 4H8VA 4I9XA 5EU6E 1BBDL 1KJ2A 4DP5X 4F37F 4D9RE 3FT2A 2YA2A 3FO2B 1EXGA 2WXHA 4JDEA 5CFAA 3EUUA 5LBGA 4TPRL 1P4BH 1MDAA 4HEMA 1I3RA 2AXGA 4HWEL 4OCYL 3TBVB 1CYGA 3POHA 4KK8D 4PRPB 1Z5LA 3H9SD 2JI1A 2O6FA 5EORL 3UOAB 1QFWM 1YNTA 3ZZ1A 1FZJA 5E8PB 5E24E 2KMWA 1SYSB 1QPXA 2YRZA 3MACH 1HILA 4XP1H 3PQYE 5AAPA 4HA1A 2EE0A 2TSBA 2XRAL 4MHHG 5I6XB 1S6NA 1SPDA 3QRGL 5I66A 3HS0A 2ZSWA 2BS71 1EFXA 2EYTA 3LEVL 5K5YA 4ODSH 2PP8A 1HXMB 4Z23A 1TUPA 1BZQK 3G5YB 2W92A 5D1QD 4R96A 5DC2A 3KBPA 3BFQG 5EO1A 3VSUA 4KWUA 2JSFA 3G5VB 5J8OA 3PWVB 4YLQT 3FQWA 5TE4L 4P06A 2NX5B 5INDA 4GAGL 5MP6H 2VSKB 3SBQA 4JHUA 5DVNA 1AD9A 3A4DA 1U0QA 5AKSA 3P77B 2ZKWA 3TV8A 3FZUC 1KELL 5ERWB 3ROLB 1RZFL 1KENL 3BSHA 4P2OC 4PU2A 4RAVB 3PGDB 4UTAA 4B95C 5B38A 1P7KA 2BVPA 4NRYA 1ZLUK 1C8QA 5HJ3B 1Y7VA 1A1MA 4Y4HB 4QHUA 1Z9OA 4U6VH 1KBGH 2VLRD 4WHTB 5AG8A 1FVEA 1Y6KR 5DWUL 3SKNB 1WEJL 2XVLA 4NQTA 1U8LA 5I30H 4S1RL 5IW3A 4NRZA 5I74C 1RULL 2ZXEB 4Z0BL 1I3RB 4KKQA 1SHSA 3BP5B 5HYEA 1C8PA 3L4UA 4JPVL 5CBAA 2IQ9H 3QDMA 2DEYX 4DTGL 4U1NB 4KROC 3SE9L 1NMBH 5JHDA 4WJ5A 5E9DD 5E2UL 2EUZA 1R5VA 1F41A 1HH6A 4JFHE 5HI4C 3JWOC 2QT6A 2VDOL 2Z35B 4NNPH 1EHKB 3GEWB 2YPLB 4LGPB 3IU3A 32C2B 3NFSL 5HYSG 4OCXL 1QTSA 5EBLA 3VD2A 3WEXB 3G6JF 5T1DL 4XX1E 5IK3B 1CGYA 5T1LA 2D7QA 3ATFA 3ULUL 4GQ9H 1EO8L 1YEEH 4L3EA 4W70A 4FXLA 4MXVF 3WSQL 2QGCA 4GBXC 3RAJH 3UPCA 3UZEA 3WN6A 2NY7L 4PW9A 3MRBB 3K6SB 3BRGC 2X9YA 3WN5C 2VXSL 5INDB 1Z3GH 4LDCA 4M48H 3S5LA 1KJ2H 2VZUA 4O02B 3B43A 4P2OD 4NZRH 5ANMB 4D0BA 1H3PH 1RJLB 3QI9C 5DZAA 1MJ8H 4PI2A 1C5DA 2VDPL 2A6JA 5JORA 4OLYL 4MGXA 4RX4D 5HDBB 3BGFC 5E4IA 4PWHA 2Q76A 4A7TA 4AEFA 2A2QT 1R75A 5GS2D 3OF6A 3P54A 4NRYB 3U4EA 4X0NA 1NUDA 3OBAA 2WSKA 4LDOB 1DFBL 1UM5L 3RIKA 3FCTA 4ADGA 1W2KT 2A9ML 5CJQL 3WD5H 3RGBA 1WHOA 5D7SH 5EU7C 5ISZB 3IGLA 5CLTA 5AVVB 3CZJA 2CG9X 1AGEA 1QACA 4K8RL 2DYPB 5EF1A 1J11A 1AGDB 2HFGH 4DKFH 3QNYA 4EVNB 3EYQD 1F13A 4PBVC 4N22A 3PDDA 1W0VA 2QR0A 3KNBA 3QDMB 4HEPA 1KGXA 2EADA 4HOXA 3WY3A 2R0ZH 4FMFA 4MZRA 5HI4D 4F15B 4K9JA 2FB4H 5ILTH 4P05A 3U79A 3C5ZA 1VJSA 5EUOB 1HH6B 2AJYL 3BD3A 2XJLA 2P8MA 4F1SA 4PR5B 1XVSA 4UIKL 4CU6A 2VZSA 3KYAA 4KHTH 1OV8A 4Q74A 4JL1A 1BAFH 4M4RA 2YARA 5FS5A 5IW6A 2CIKA 4GBXD 4B9PA 5FW7A 4LCWE 3APMA 3CVHL 1YEIH 1GA2A 5GZNC 4PJGA 5I16A 1YYCA 4Y8AA 2K7PA 1OF2A 4PS7A 4PV8B 3Q01A 5CGBA 5EEZA 2WLYA 2EIJB 2WD0A 3QI9D 3W81A 1WIUA 1UB6B 3WMQA 1MQ8A 2UV3A 3W39A 1BVLA 1O5DT 2YXMA 3FRUA 2P8LA 2G5RA 2HT4D 4JANA 5GRWA 5JORB 3BP7B 3B3IA 4NCC1 5IFJA 4EIBA 1AJ7L 2B20A 2D3JA 3L3JA 4DZBA 4U1IB 4L9DA 1X5ZA 4XC1L 3FFDA 5TDOB 3U0TA 5D2NA 4F9PA 3WTYA 3SDXF 1EEZB 1OB0A 3VM7A 4ANWA 5I8CA 1SF5A 4G7YL 2G5BB 4LSTH 5C0AB 5JR1L 2DM2A 1S3RA 3FTGB 3RDTB 1GAFL 3DJZA 4KNSA 3QXTA 3SD5A 4Y9FA 3O9WA 1MJJA 4JY5L 2ITCB 4YFDB 2IDUA 5EPMA 5TDNA 1FNSH 4M8QA 1PYWA 1R3JA 1HVXA 1RHHB 4NQUA 1W0VB 2IGFL 2QR0B 2W0FB 4H25B 3P9LB 4KTEL 4XP4L 1J5OH 4K15A 4ES9A 4X6CE 4L8DB 3WIFA 1FZKA 2MWCA 1LM8V 4M5SA 1VFBA 3I6GA 2DLIA 3VWKA 2EEFA 3PJSA 1RK0B 2KH2B 3P30L 4F3FB 4M4RB 2C9VA 5GZND 4JY4A 4XPHL 25C8H 5LBVA 2CIKB 5B7MA 2CGYA 2XT1B 2YWZA 3K3QA 4PRNA 4QLRA 3ZTJG 3VFWA 3MV7E 1RPQA 4NKQB 4DP2X 4AV4A 4CVXB 3ISWA 4LK4A 2NZ9D 3FBKA 3E9UA 1QSFD 2KERA 4YDLB 4X99A 4MQXD 1UURA 4BE6A 3HG1E 5F6IB 1FVCB 3MCYA 5KSBF 1PAMA 1WBZB 1R19A 1NBZA 4KY2A 4NQEE 3RGVA 2P8LB 4U7KA 1OCWL 3QA3B 4TUJA 2GJRA 1QVOA 1B4JH 2VQUA 2VN4A 4JM2D 3P2BA 3ZE1E 4DZBB 5I0DA 3VD9A 1AZNA 3KEDA 1KCRL 5GSRB 2CRMA 2O5NA 4DQOH 3L4WA 1IGCH 1N19A 5I8CB 4HW6A 3OKLB 3WHE1 1G7HB 5LAXA 5H37A 1R5IA 1I7UB 3D8MA 2R29A 2PW2B 3PE9A 4GQQA 3VX0A 5TDNB 1XHHA 4M8QB 1VPOH 3V6FB 3IRPX 3X14A 4MDJB 3ZHKA 4YSEA 4XVSH 5GGRA 1QSZA 1HSBB 1WUNT 3GXMA 3UFIA 1ZS8B 5GGSA 3SCMC 4Y8DC 2XNAA 1ZVNA 1O75A 2X4QA 4N2HA 1U36A 3BVNB 5AG9A 4PJ5E 4Y88A 3GFUA 4OLZH 4M93B 2Z91A 5FO8B 4S2SB 4DKEH 4OGAC 3VWKB 4JPKH 5D5MF 3PJSB 2Y3NA 5HYQB 1VAHA 2WVVB 2YRBA 5EFIB 3LS4H 3MRQB 3JWDC 4EBQH 3CVBA 2NY1B 3U1PA 2AXJA 1U41A 3WNJA 2WKOF 1LE9A 1TVBA 1ETZA 1ML0A 2FATL 3KW7A 3NCMA 1F11A 1CGSL 3QDJE 2PR4L 2QZ5A 3NJIA 1WZLA 4WI0A 3RGVB 3BFWA 1JPSL 4MTMA 4JFWA 4RISL 3NCJH 1PCSA 1BEYL 1IT9L 3QULA 4LRNH 4MKTA 4BWTA 2UY6B 3SYCA 4FTVE 2R0LH 4HFWB 1XAUA 1H0DA 2WCPA 3AM8C 2CKNA 3QUYC 3V4VA 5I71C 3BVWA 4NM4H 1JZIA 3TPUB 1A6VL 4PP1C 3NSDA 4I4WA 1AZUA 3INOA 5D7JB 2P1YA 5C7ZA 3WKYA 5LAXB 2XLLA 2AEOA 1JP5A 2AJUL 4Q6KA 4F27A 5LKNA 2XZCH 2Z31B 3BWUF 1RUAL 3GRGA 3QDGA 4L4VE 5C0GA 3KYMB 3LKNB 3DIDA 3SCMD 3MJ8A 1MRCH 3MBWB 4S1SL 2YMOA 3VD7A 5FKAB 4OZFA 1A25A 2F54B 4KX9A 5SWSA 1ETB1 1J0ZA 1CXEA 2WNKA 2XWDA 2EH7H 1RZJL 2X4QB 1H6FA 4Y4FD 2BFVL 1YNTF 3GXDA 1KB5A 5E99H 3LKPA 2Y06H 1BEXA 1ZHLA 3MYJA 3K5SA 1TNMA 5IESL 3X1BA 4PWEA 5C0DA 4YFEA 1OAUH 1QFWI 4G5AA 4LMQE 4ZTOH 4G9FB 3BZ5A 4TSBH 4AZ8B 2DQUH 3BP6A 2QPEB 1ZANL 5DHXB 1Q9LA 3QXAA 4PYGA 2ZXBA 5I1IL 1GCYA 3S0PA 4YNYA 3TWYA 4WGWB 1RCYA 4JN2B 4POZC 4N0CC 1BD2E 3OKNA 1RP9A 2WIMA 4YPGA 3DC0A 4ODBD 3M46A 4W9EC 2R29H 3HLAA 1EWHA 2BNRE 5HTSA 5KVDE 2A73B 4PJ7F 3SSGA 4AG4L 4ZYKA 5JOEA 5IVXB 3QUYD 2JTYA 2VMEA 3S8WA 3GKWL 3L5IA 4QR7A 3L13A 4HYTB 4JFZL 1LEKA 1H0DB 4AGMA 2JKLA 4O9HL 1IB5A 2PP7A 4PP1D 3G08A 4NKDB 2DQCL 4U05A 3V4VB 4M3HA 4U1HB 2F2HA 3TT3H 5FW8A 2NY6C 4P2RB 3FS9A 4NJ9L 3V7AG 1AIFB 3D4GA 1NGYA 5EZIH 5KOMC 3S34H 2H45A 3UBXA 4M1CC 3RPIB 1I85A 1FVDB 5HDRA 1T5WA 4JCMA 4ZX3A 2QKIC 3VFTB 3HVDA 3MJ8B 3HC4H 1IIKA 4IGBD 4EXPX 1FIGH 2I7SA 3KXFE 3NZHL 3ZT6A 1CGXA 1FBIL 3LZRA 5EC2B 1NUFA 4U7MA 3NFPA 1A7NL 1GW6A 2VWEC 1KIPA 3FO1B 1UC6A 2IFFH 3U4BL 4QXGH 2H8PA 4I87A 2BY2A 4HPOL 2WINB 3K72B 1ZV9A 1PZCA 4LCIL 4LCWD 4YE4L 4JO3H 4HIHA 3NH7L 1JPGA 4WHYG 3IDUA 3V4VH 2X4SA 3BP6B 4YHPA 2EQDA 5LNEA 4FCHA 3MVSA 5FHAL 4N0CD 3QCUH 1DQMH 4PY7B 3GBDA 5DC9B 3JWDL 1D6EA 3T04D 3OKNB 5EBWA 4AIXA 5T1MB 3WDIA 1UA6L 5L9DL 4NQCE 4HUXA 2GQHA 5IQMA 1Q0YH 5IIEB 2VERN 2WCGA 3SBWA 3VD4A 2FJGA 4JFQA 4S1QH 5IVZA 4LAQH 3CH1A 4LLUA 4N8CL 4PUBL 4OZFH 4G42A 2NY6D 4BGLA 4D3CL 4ABWA 2VXTH 2OM5A 2YXWA 5C0BA 5A1AA 1KB5H 2DD8H 1TZGL 2KZKA 4W81A 2L8AA 3P4MA 4PWIA 5DMGC 1OCZB 3FU7A 3FQ4A 4NO0B 3N9GL 3UBXB 4DGYL 4QYAA 5EDSA 3ZO9A 5CUSL 5T1JA 2DQGH 1T5WB 4PJAA 2B0SH 2XBZA 1XFPA 1FPTH 1I9JL 3CDZA 3LZFH 3SGDI 4G6JH 4MQ7B 4BFEA 3SN6N 5J9PA 3HKZA 4ZMQA 4RESB 3WEMA 3QR0A 3MLTB 4G6FD 3TZVA 3VXRA 5KTEH 3NFPB 4H5SA 5JXEA 2C4FT 5AAMC 3FJTA 5CZVH 3OGOE 1LP9F 3WHE0 3MI6A 3RX7A 1X7QB 3B34A 4CKVX 4CMMA 2GUOB 3ESOA 4TYUA 4EN3B 1CE1H 4HIHB 1NSNL 1M3JA 2FTAA 3QUKA 5CCGE 5I9QC 2X4SB 2O6CA 2ZPKH 5MENB 1AY1H 1BMZA 2P5EB 4H0LC 4PJGF 3UTSA 1Q9OA 3CSYB 3N55A 4MCNA 4LCYA 2BS9A 5D8JH 1D6EB 1ZGLA 1N64L 2P24A 3MTXA 2IADB 4FKEA 5EBWB 4ZTPL 3RILA 4AVKA 4ZMYA 3U36A 1U4EA 1JWMA 4HUXB 1MAJA 1T22A 3RVWC 1L0PA 3VQ2C 2FRGP 4LHQB 1J5HA 4J8RB 4JFQB 5IVZB 4O2FA 3CH1B 1N12A 1F00I 4G42B 4U1MA 1YQVH 3Q8EA 1P9MC 4XZ4A 5LNDA 4N90D 5E6SB 1Q9WA 2IDFA 3D48R 5C0BB 3L5WA 3N0AA 2V2TB 4MA7H 2YBRB 5FFOA 4XPTL 3P4MB 3D9AH 1NKOA 2QHRH 5AVTB 4G5ZL 3FU7B 1TMCB 5TQ0L 4Q56A 3L4CA 3GK8H 1JZ7A 5CJBA 5DURD 1RJYB 4PJAB 4F93B 3IM1A 4M5YL 5J11C 2AV7B 1VGKA 1JXDA 5J9PB 4OSUH 3UBHA 2Y69B 5GJTL 1CGWA 2F7RA 3D3VE 4HS3A 4PRDB 1YPZE 3BLBA 3VXRB 3JV6B 2X6CA 4XAKE 1IZKA 4QJ3B 5EA0H 1RL1A 3TJHC 5IHHA 1F18A 4WK4B 4N24A 4DP7X 1O7SA 4GRWF 4IIZA 5EEWA 1AZBA 4Y9GA 4CMMB 3MLYL 1WZAA 4KQ3H 4CDHA 4MHHI 3FU9A 2W65A 2XWEA 3DOIA 3QUXC 5LXGL 2E8YA 1N6UA 4KKRA 5DUPH 1MWAL 4X7SH 4WW1A 4XP9L 4BXVA 1NC2D 2VDLB 4IRZL 2HVJA 4OQTA 1OP5K 1M2VA 4JFTA 4ZZFA 1IGYA 3CCHA 2ZSVA 3KLAA 2P24B 4HMEA 2X4RB 2X4OA 4DOHE 2O30A 5JXAL 5F8RC 3FMGL 1TOXA 4A66A 3QXUA 4TVPD 5MEQA 4TRPH 3RFRA 3MNZA 5FYJE 5IBUB 2CBPA 1M71B 1Q0XH 1Q72L 4HHAB 5CIPA 4G1MA 2IJ0C 2W9EH 3ASOB 4PEEA 1Q9WB 4NQVB 1SJEA 4X5WA 3IFPA 3O8XB 1RQ5A 5EMYA 3NIFF 3DETC 4OZIE 3ZKQD 5C8JA 1NOAA 3EFFA 3EO0A 1Z3RA 4IJTA 3FTSA 1K9TA 1KGIA 2J44A 4WI7A 1LEIA 3IFNH 2L4OA 2DQHL 3TBBA 2YKKA 2AVFA 4WKZA 3INUL 3B4NA 4QMEA 4PG9A 2DJUA 3ELQA 4ZS6C 1IAKB 3TJHD 1AZCA 3NT0A 3VO0A 1F4HA 4XCCL 4HPYL 3RI5F 2VDLH 4XCEB 3MRJB 2CRYA 4RMQA 1EA9C 2AQ2A 4XBPA 3GTVA 2H6UA 4FLOA 4Z78A 4JRYB 1E27A 4N2NA 3DV6A 5B3JF 2HFFB 3B2MA 4C83B 2BS8A 4HD5A 5IHZA 3QUXD 4ZQKA 4PB0L 3SJVB 1MCWW 4QWWC 5ICXA 2X70A 4DGWC 5HDOA 3KPNA 1HWGB 3AS0A 1U8MA 15C8H 1GKEA 1S7RA 1MHCA 1DANT 1SM3L 2ZSVB 3KLAB 1NZRA 3IJYA 4ZXBB 4ZMVA 4X5LA 5FDWA 1UYWH 5FUCC 1MFDH 4V1DB 4JPSA 1YEJL 3ZU8A 1PY9A 3L81A 3RVUD 4AK1A 5MEQB 1T0NA 1B3JA 1S7WB 4JFPB 4RZCB 5CIPB 3EDJA 3IGUA 2XWTA 4LESA 2BVQA 4KDTC 1FL6B 1AH1A 2B5IC 1SJEB 1WV7T 3DETD 4YK4C 3IFPB 5FWRA 1YYML 4QF1A 4M7JL 1GXEA 4FHJA 3F5WA 2ORBH 1N2RA 2XTJC 3EYSH 4PS4H 4U2YA 3SOBL 4TVPL 1GIGH 4EDXB 5KVEE 4HLJA 1I9RH 3O6LL 5IB3A 4DO6A 3VI3F 2AF2A 5FYKL 4CN4A 4XCNA 2ZYRA 4ZS6D 4WWKD 4LPVA 4FFZA 4WKZB 4KZEL 2DQDL 2I9LA 3HW7A 2GTZA 1ZPUA 5LGHL 4N8UA 4NZUH 3VMOA 4DEWA 2BXYA 4KRNA 4P3DA 5KJ7E 3FU8A 1E4XI 3Q1EA 4YZWA 1ADWA 1SOSA 5HXMA 4OQTH 1T0MA 1NOLA 3S36H 3RIFF 3VXMB 1KNOA 5JW3L 3H9ZA 4W6XB 1G7IA 4BH8B 1F56A 1XIWD 2HAZA 4NX0A 3CIQA 1GOFA 1KPRA 3FQYA 1D2OA 3IDXL 4QWWD 3LRHA 1DVZA 1X5FA 3ZDYF 5A2CA 3RFZA 4J39A 1WZ1L 2DJMA 5CIPH 4OD3L 3OKDA 4X9IA 2QVTA 1E6JH 4XPGH 2X70B 3QUZD 5ICXB 2ISDA 4A2FA 3GI9H 4JFEE 5HVHC 1F86A 3B9VA 4D7BA 2R4SH 3QJTB 2AJSH 1UFGA 1UD5A 1N67A 3BLKA 4JGNA 1S78C 4JG9A 4L3CA 3R7RA 3F6LA 2FHBA 2JKWA 3RL2B 5BS0A 4WFFE 4NN7B 4E41A 5I1DB 4F92B 3MMEB 4NBYB 1IU1A 5HGDA 2DI8A 3NVQA 4OH2A 3UG3A 3CFEB 2CA3A 2BVQB 4HDIA 1FZMA 2XXMB 3IGAA 4XZUB 3ROOB 5I2IA 1H6UA 3QQDA 7PCYA 1L6ZA 4FI8A 1DJIA 2ICEB 1NC4A 4GRLC 5T3ZH 5HGHB 3DX1A 5AW1B 4L4TD 4UZUA 4ZMZA 5TE6L 3P1VA 1L7IH 3ARXA 4H8HA 3B9KC 4BELD 1CMOA 3P3UA 4AKOA 1ANUA 2VL5A 4WI4A 4P07A 2GTZB 4YL4A 1T1WA 3SDAA 1I1AC 1JXGA 4IBVA 5J6GB 4P3DB 3VSTA 3CUPA 4U0RB 3LHAA 2R39A 2W81C 4QKXB 2ZX8A 5F71A 3EGDB 3X12B 1T0MB 1X4XA 1JK8B 4GUOA 1YMMA 4I48A 1G7IB 1IV8A 3GKZA 3B37A 2BP8A 1DBAH 1RZ7H 3D12B 2V3DA 3IMWA 4KU1A 3TN0C 3SKJH 5HPMA 3OKEB 1REIA 1YG9A 3GM8A 4AW4A 4NI6A 1MW1A 2ZD0A 3WIAA 4DUXA 4M1DL 5FUOL 3WENA 1S5IH 1SLXA 3MLXL 3HCVA 1QZ1A 4KAQL 1S78D 3T71A 5E9NA 2HP4A 4FL4B 3NOIA 4JGJA 3TVMC 3TEYA 1OXYA 1U33A 2WXPA 1JZ6A 5EWIH 2AQ3A 5LN8A 3EJTA 3ULVH 2DL2A 1MCFA 1KCWA 4NJAL 2CH8A 4E41B 3DURB 3VQLA 2I07B 4A67A 1TENA 1U8CA 2VRQA 4Y19B 4XN4A 3LZPA 3BMWA 4GRLD 1QNZL 1MCOL 4TNWF 1NPNA 4TVUA 2GKIA 5AW2B 3B9KD 3HNTH 3VXUB 4GUPB 1DDHA 3VFMA 3WY4A 1EJ8A 1OARH 1RUKH 3FTUA 2NOYA 5DMJB 1I1AD 1QPPA 2RCSL 2ZUQB 5T3XD 3SQOH 3GLZA 1SHXA 1CXLA 2F5AH 1CB4A 3P73B 1G6RB 3SPHA 1A4AA 4XAKD 2D7TH 2ZX7A 2DBLL 5T5NG 5HHNB 3CUPB 2NYKA 5CBEA 1RU9L 4UM8B 3AITA 4UQ9A 2DICA 1YMMB 2AJVL 4I48B 3F85A 4NFBA 3TN0D 3U30B 5E6IA 3U2SB 2O93L 4X9YA 4AEIL 2BP8B 2EZ0C 1E7VA 1MXGA 3EZJB 4RFOH 2J1ZA 2PYFB 4YSRA 3UEZA 5FPIA 4GEJA 3WJLC 1KGYE 2CO7A 3GMQB 4JO5A 3TVMD 1XSJA 1INDL 3ARRA 4WO4A 5DFWH 3CFBA 5HHOE 2ICWI 1CDUA 2ZXDA 4YXKH 2QLYA 5C2UB 4OZGF 5J5EA 2YEQA 2P42B 2P5WA 3KZ8A 4I1RA 3EO1A 4LU5H 4MLSA 3BDXA 3THMH 2ED8A 1E5BA 1JNNH 2ZOLB 3FO0H 4JRXD 4GW5A 4XO5A 3C08L 2EP6A 1SXBA 4XMLH 2H1LM 2DQ6A 2JKTM 3ARGA 4PYHA 7FABL 2WHVA 2H26B 1NWPA 4U6HA 3K2UL 1UXWB 2ARJQ 4LIQH 3HTLX 1O9WA 5GRXG 1A7RH 5A6LA 3N91A 1MNUL 1UHVA 5B1JC 4TUKL 3SGEI 1CR9H 5ALBL 5EC1B 2OJ1A 5E4EB 5KVGH 3BPNC 4TUOB 2AJ3B 5HGBA 1A7PL 4PRIB 5DJXA 3SBPA 1CLOL 4NHCH 1D5IH 2KS0A 3O4LE 2J7LA 3HNVH 1C08B 3EJSA 4N8VA 3EOBA 4CADA 5AD0B 1CTOA 4Y5YB 1UD4A 3EOYG 4JQXC 1Z6JT 3AW5A 3RNQB 2R59A 2BMKA 1D7CA 1FORL 1UEYA 2KUTA 5CBEB 5BQDA 4LSRL 2WSDA 3WOVA 3ZTNH 1AKPA 2EZ0D 1IBGH 5C3IA 4R7LA 4AL8C 1W16A 3OJVC 4L3FA 1AO7A 1YQ2A 4X80L 4EPSA 3BUBA 3UEQA 5F9OL 4YR6A 2ADIA 4PMFA 3BE1H 1YUKB 3E2HB 4WO4B 1JZ2A 1G9MC 4FXGA 4BINA 1U95B 2H0EA 4WUUB 3T5WA 2K6WA 1G7PA 2DQFB 1X4ZA 2GABA 2VLLA 1BZOA 5ECGA 4FQXB 1O7VA 1O9VA 3KVPA 3BWAA 5IUCA 5C3LD 3U9UA 3ULUE 3IKCB 3GHBL 5FGBC 2BCKA 2J1XA 3DMMA 3FCSB 2JMRA 3T0EC 4U6HB 3P0VH 3BUYA 3T0BA 4PH8A 1B6DA 3R06B 4ISVA 5I5MA 1AS6A 3EFOB 4TULL 1NANH 1KCSH 4YHYB 4W9JC 3FHAA 3NIDB 2E6QA 1ZXKA 2VM3A 3V9CA 3PWPD 3ECQA 5C2BH 1I3GL 1BIIA 1MFAL 2ZYIA 4FLSA 4J4PC 1Z0MA 2R7EA 2YRPA 1SUHA 3MJ7B 4ONFL 3HUJA 1EEQA 2EKSA 1F8TH 1K5NA 1PLAA 5BZDA 2GAZB 3I9GH 2Z0BA 1OP4A 2HRPH 3IMVA 4TLTA 1ZLVH 1YN6A 2BOLA 2M2DA 2VXQA 3MPCA 2SEBA 2BMKB 3PF2A 3PNWB 4K5LA 3N0PB 5A3ID 4RGMB 2DF3A 2GCYB 3RWIB 1OCCB 1HHIA 5SWZA 4BHUI 4MQTB 1OAKH 4QRPB 5BZWA 3KDMA 2ZYSA 3FOMA 3U1SH 4ATWA 2P9RA 1BQLH 4M6OH 1AO7B 5B39A 1EO7A 1J0YA 3OKOA 3LSOB 1ILSA 3UTTE 1CGVA 3OLGA 4J12A 3VH8A 2XQBH 4I18C 3PWJA 3HFML 1DBMH 3D0AA 1ZVSB 2E6JA 2X7LA 5D7LA 2H32B 3G5ZB 3OGCB 4L1HA 4PVLA 4DNLA 2VLJA 2WXKA 4WFFD 3DPDA 3DNKA 4NYLA 3PU7A 3T0ED 5JLZA 2Y07H 1Z66A 3EBGA 3L3IA 5E2VH 1DVYA 2X2JA 5BO1H 4PTTB 3D5OF 3FN9A 3II3A 1W72L 3NIGF 2BY3A 4IBSA 3B56A 4Y16B 4L5FL 5DD1H 1DL7L 3O3UN 5EOTB 2NTFB 3QZBA 4OUUA 1E9OB 1RZGA 1S7UB 5DLML 4J4PD 1Y6NR 4MX7A 5I18H 4KMLB 2A83A 3C12A 3MO1A 3QXDA 5J6SA 3GSVB 4FQJH 3TOPA 3VDBA 1B9ZA 1CFQB 4BK8A 2R7EB 5E2WH 4LVOB 2ADGA 3F58H 1G43A 3HUJB 2JELL 4U1KA 3K6DA 4JDTH 3K8LA 1K5NB 3GC3A 5J06A 3ULVF 1KEGH 3MC0A 5DQDH 3SDDC 1OAXL 1WT5C 4PG2C 3REWA 2G9HA 1FNFA 2WLKA 5I1EL 3ZXAC 3EFDH 4FAAB 3FFOA 1A7OH 4HKBA 4GSUA 1MI5D 3C8DA 1UUNA 2H32H 4IDJH 3WL9B 1HHIB 3UC0L 1N5YH 1WA2X 1EGJL 3TS8A 4LSQL 4PJBB 4FZ8H 4XP6H 2GIMA 3OHXA 4LKCA 5D1XE 3FOMB 1FYTE 5DTFA 4G72B 2K9FB 4PLKC 5B39B 4KQ4H 1YEKL 3QDHA 3FN3A 3QEUA 2VDNB 4Y2DD 2Y4SA 1LLAA 4BRJA 5CHNA 4MNQE 3NA4A 3QG6A 4OIFA 5HD8C 1NMAH 2DYSB 3KPSE 1A1OA 1A7QL 4TF4A 4CN6A 5B22A 1EJOL 3GD1C 3RZCD 2AK1L 5TE7L 3ME0B 4C56E 2GJ6E 2WNGA 5AAWA 2VLJB 5KVFL 2AEPL 4KI5F 1DQJA 1DANU 4XNZC 3ZUCA 1G9ML 2OJZL 2GBUA 3DBXB 1LO2L 4ZQTA 1WH0A 1L7TH 3WEBA 3RY5A 4N2DA 2VXQH 1GS6X 2QQLH 3QSKB 3I50L 2GFBA 1KF9B 1OB1A 2MH4A 3BVDB 4LQ1A 1BX2B 2F1AA 2JCCF 3TA3B 4S0HA 2O5YL 5A2AA 4EO5A 5JQHC 1ASOA 1INQB 2MOVA 1FG9C 4N0UA 5T1KA 3B2DC 3ZRSA 2UVEA 1VLXA 3MO1B 3RIAF 1V27A 1OTTC 4UOW1 5JQIB 2VAAB 1U3NA 3SDDD 1JGVH 2LU4A 4X4ZA 3NSYA 2ADGB 3A5VA 4PJDB 4AM0Q 1K72A 2YD5A 2CQVA 4W1TA 4OV6F 1JG9A 3OPUA 1UD3A 4QXWA 2DTMH 2VDNH 4X0KA 1NCWL 3REWB 2IAMB 2G9HB 5AOLA 5FV2A 2ADFL 3UMNA 4RH4A 3I3BA 4HKBB 3MRKB 4NN6B 3VGFA 4WV1A 5DHVB 1P6AB 3D85A 4XAWH 1AR2A 2EDLA 3C87A 5IJBC 4PLKD 3WTSA 4LKCB 4A63A 1E65A 1AG6A 1RPKA 2PO6A 5DTFB 5JA9A 5CGTA 3L9RA 3V4UL 4ZZKA 2K8QA 3CG8A 4N6RA 4PJ9A 5HHOD 3V0JA 4F7CA 4PRAB 4E9RA 5TK2A 2NR6A 2Q8BL 3QQNA 3QG6B 2Y36L 5D7IF 1KFAH 3VFVB 4ENZA 1J1OL 3HR5A 5DD0L 2DIBA 1P5UC 4LLWA 2B4CH 4HS6A 3EO9H 2OTUB 2E7LC 3KPRE 3U0PA 1WS8A 2AXFB 2BHYA 1G1CA 2CKBB 5IJVA 3P4OA 4IBQA 4UT7H 5DRZB 3TIEB 5CKAA 2CLVB 4NBZB 3B7SA 2VR8A 4Z7UB 4OCNC 2FX7L 2H41A 5IBLC 4LCCA 4W9CC 4N26A 5HDLA 4KK5C 4BA8A 2Y7SA 1OTTD 1TT6A 5E6ZA 4UM9A 2V3FA 3TTYA 5C6TL 4LMQI 3VI4A 3T3PE 2BVTA 2NY5H 3ZMEA 1XGQB 5E2TH 5ITFB 1T7YA 1JRHL 1M1XA 4X0KB 2WWKT 1DUZB 1VACA 3MRGA 2PYEA 4R7NB 3DJSA 1FH2A 5HJDA 3NZ8B 2LTQB 3G6DH 1RIVH 3QS2A 2BVOA 4L23A 5D93C 1CL7L 1MQKL 3MYZA 2P3YA 1B3IA 4MJIE 3V0WH 2UUDH 4K7PY 1Z9NA 3KWUA 1EH9A 1FIEA 3BRDA 4FG6C 2FJHA 4I3RH 3SDCC 4FNPA 2RTTA 2VDQL 4QO1B 2OL3A 4M56A 2BVUA 2IMNA 3BT0A 4Q9QH 3BSZL 1MLCB 1SMAA 5C08E 1AYOA 3QC5X 3T4YA 3HNSH 2XA8H 3ILEA 4AOFA 4M02A 1PEZA 2WANA 1NPUA 3CK0L 1NCDL 5E8DL 5JPNA 1YLBB 1UM4L 1GJUA 3SBRA 3TPKA 4E9VA 3KD4A 1HI6A 2X1XR 5IBTL 1Y1DA 3U4AA 3P4OB 3ZKSD 1SMDA 4BFIA 1AE6L 5IBLD 2RD0A 3PY9A 3TNNA 4APQC 1QQDA 1LO4H 3CHSA 1JGEB 4WAFA 4KK5D 2UZIL 1XZ0B 1PLGH 5AVWB 5KAQF 3W3BA 5GGUB 1U6AL 3LHPL 5A16A 3PWNB 3MRMB 3BOVA 2VDKB 2ARWA 5J1AA 3ATBA 4UM9B 5K69A 3Q48A 1N59A 3VI4B 3IJSB 1SOQA 3AGVA 2DJSA 3QIBC 4BH7A 4UB0H 4PIBA 5CWSA 2BJML 4E9XA 5A2JH 3FN0L 5FAAA 3QQXA 1WCBA 2CDFA 2FSEB 4JQVA 4YWGH 4Y1AB 2HYMA 3FQNB 3RUGA 5IP4A 3BKMH 4HJEA 3O2VH 3MRHA 1OLLA 2CO4A 2NY0B 4HK3J 4AQAA 3VRIB 1N6QL 4FG6D 3QC6X 4GKNA 1WJ3A 4ORGB 3RWHB 3FSWA 1IL1B 1G9NC 3OMNB 3SDCD 3UJIL 3ZTDC 4AC4A 3VDAA 1CDJA 2FT6A 3GHEL 3UP6A 3UYRL 1PG7X 1UKQA 3MGAA 1UACH 4Z3FA 1RK1B 2IWEA 1MCPL 2QMKA 2F61A 1WFUA 5CR8A 3FRPG 4HUKB 5I8OL 2XWBA 4R4FH 3SO3B 4OT1H 4ZFFB 5C07B 4MVBC 1MEXH 4OLWL 5I0ZA 2VDKH 2JQAA 1WIPA 4TNEA 5DDHA 1TF4A 3DXAA 4JW3A 5SV4A 4DGUA 4QJ5B 1RIUH 2H3KA 1G1OA 1HI6B 1MJ7L 2V5RA 4APQD 4C55A 4YQXL 1CLZL 1F6AA 1X5GA 3DV4A 4QY8A 5D72H 4YX2L 4MSWA 3VG9C 3H2PA 4M62L 1VZGA 4EI5B 4IRSA 1IBZA 2E47A 1KIRA 2DAVA 1WAEA 4A04A 1QQDB 3RP1A 4N8PA 4RDQF 3MV8D 5EU5A 5G4OA 2VITA 5DO2D 4GI9A 4LHUA 2YUWA 2YLHA 1ECZA 3TBSB 4K3EL 5J1AB 1MZZA 3MN8A 5IMOA 1PG7W 2AZUA 3QIBD 5D6DC 4R2GC 5AZUA 5JW5B 4XWGH 1CPUA 2ESVE 1L9QA 3L3OC 2B1AH 3IETB 4Y4KA 2HRGA 2OL3H 5TDPA 1IM3D 4AMXA 1R3IL 3QG7H 3N42B 4Q6IA 5IJDC 1MLBB 3ZDZF 4N1EA 3ORJA 3MRHB 3ALXA 3X3FL 3D2UB 4ELKA 1PKQE 1XO8A 3DYOA 1VDGA 3E8VA 5D96C 1FYTD 3DOSA 4MBRA 1W8EA 3ARFA 4JRLA 1QLRB 5BVJB 2XBDA 2YKLH 2VL4A 4QHLB 5EZPA 5FGSA 1MHPL 3G5XB 3O0RH 1D5RA 4MVBD 4OF3A 3KPSD 3QHFL 4PJIE 5C0CB 4HKZB 2FR4A 2DY2A 4C56D 3WGUB 3H9SA 3GSNL 3BQUC 2CM6A 3V0DA 4P5KA 5DDHB 3DXAB 4X9GA 2DQJL 1AZVA 3U6XS 4N5EC 4R83A 3PCYA 1GYCA 1LD9B 4XPBH 3ARBB 2D2OA 4H1LG 4TQEH 1A3ZA 1M2OA 3MOQA 4WEUD 4MSWB 1WAAE 2IEPA 5HYFA 3AS3A 1LK2A 2EDRA 3TBTB 4OIIH 5HYJA 2E3VA 4MDIA 5EU5B 1V7NL 2ATAA 3VG0L 1QASA 3TXAA 4FA6A 1HH9A 1TITA 3BCDA 3GT6A 4FF9A 4R2GD 5D1QA 1G9EA 1E3ZA 5JO5A 3BIKB 3DX2A 2X38A 3MLSL 2C3VA 2XVGA 4QOKD 5HGAA 2ZUXA 4LARL 4K94H 4MS8C 2E4FA 2WW8A 5AKRA 3IMUA 2F7OA 3ULSB 2P26A 4A7QA 5BRZB 4Y4KB 4OFVA 4WK0B 2NW2A 2MCG1 1VGEL 2KKQA 1NMCC 1IKFH 1RZIA 2EO7A 2N1TE 1JAEA 2ZCHL 3KEHA 3MGTA 5F3FA 1DUYB 4Q6IB 1KXQE 1AFVH 1ZLWH 3U82B 5GS0L 3F00A 1BQ5A 3BMVA 1QPKA 5LG1A 4LSPH 4ELKB 1E9QA 1ACYH 3KPPA 2C8NA 2YGOA 1QRNA 1A9BA 3LQZB 1AI1H 5LB1A 1SXAA 4F2ME 1A3QA 1AXIB 1FNEA 2WZPD 2VLRA 1OVZA 2C7UA 3ARFB 4OW6A 1CTMA 1OQXA 2GJPA 4X4YB 3DVIA 3IGKA 4DO4A 3FT4B 2NX5E 4Y5VC 3HS9A 3SGDH 3LJ3A 5FYJU 1PNDA 3BQUD 4NWTL 3TBWA 1G9NL 4XGZB 3IXAA 1RUPL 5MEPA 2VN3A 3O4OB 2XOTA 4LOUC 3LKRA 4CJ0A 1YUHB 4X7TB 4JG1H 5E9DA 2Z1PA 2EDOA 5FC9A 4N0RA 3AB0B 4ZPVA 3FQXA 5AENA 2WJ7A 1MAKA 5F89A 4FGMA 2X42A 1NBVL 4ZD3H 1LK2B 2DDQH 2HH0L 3L6FA 3T1WA 5JA8B 5HYJB 1NIBA 4Z3GA 3ASWA 2G3MA 3MV9A 1HH9B 3TA4D 2WWNA 2C9QA 5JO5B 3MCKA 2HT2C 3FQ2A 5T33L 1KTLA 1OM3H 4MS8D 2CJSA 1A6WH 2RB8A 4X98A 4X8JB 3SPJA 3WS6C 2WUBL 2C3VB 1XGUA 5HGAB 2E9IA 3FTWA 4P2OA 3TEZA 3CLFL 3JVGC 4MJ5B 4XCFH 1C7SA 4GG6A 1RZIB 4Y1TA 5FECB 4TXVB 4ZSOB 1HZHL 1UASA 4GPVA 1Y0LB 4RX4A 4XN5A 5E00B 5GS1A 5KWYC 5D2LE 1ZHBA 2XV3A 3MROA 5HYSA 3DJTA 3MSPA 1QRNB 2WO2B 1A9BB 3P3YA 4HXBL 3PGCA 3T8XA 3UPRA 5KYWA 1QLEL 5I5JA 3D0VB 4M7ZC 3RWEA 3T65A 1RI8A 5K9QG 1OE2A 5EN2B 5IB5A 1MCWM 4PGDB 3O2DL 2V7HA 3VYNA 5HDQH 4ELMB 4LOUD 5C0IB 1R5WA 2Q9OA 1XB6A 3DVGB 1EMTL 3LKRB 4EXKA 1U9KA 2P5PA 2WMPA 3V79C 5I23A 3VTTA 4XNMA 3T0XA 2Y1VA 4WUKL 1F6FB 4XBEL 3WIIH 3IVKA 2QVFB 3W0WD 5C09D 3FQXB 4FKKA 4FEIA 3QFJD 4BZ1A 2P47B 3SQBA 4W9GC 3LPPA 4BQ6A 4N68A 2AQNA 4NO3A 5CCKH 4X5RA 1KXTB 2HT2D 1EJFA 1WBYA 3MV9B 2R4RL 2IPTL 2Y7NA 1UXSB 2BHFA 2OTWA 3MCKB 5JOPE 1J8HB 1GGYA 3PABB 5CILH 3W11C 4NQDD 2R2EA 3OSVA 1KV7A 3TT1L 3GRWH 3O3AA 3QI9A 4QXTA 3LDBB 5KS9E 5EUKA 1TJHH 1AVAA 2W91A 3O3BA 5E1AB 2GPZA 2VRAA 5D4HA 4DIXA 2LR4A 5IFHH 1ORQB 1SDAB 2O5ZH 1AQMA 3GLEA 5GS1B 1X6LA 1YA5A 1U8JB 1PZ3A 1B0GA 5DMIL 3WEAA 3VQMA 2JXMB 2R1WB 3SY0B 5D7EA 4R8WH 2K0RA 5DHDA 4F91B 1WFJA 4KQ0A 3NIFB 5SX4H 4DH2A 1L0QA 2NXZD 3T8XB 1R34A 3QS3A 5E5MB 3UXFA 2A9AA 5CSZB 1U3HC 1FLRL 3EGXA 1CFSA 1NCAL 4YLCA 3VFNB 5E0FA 2Z3FA 1FP5A 1R5WB 2ZUWA 3RKPA 1JPST 5BVPL 4XH2B 4OB5L 4OZHE 1L5GA 3GSOA 1WQVT 2Q1EA 2WMPB 1AQ8A 3VMNA 2MQ3A 1ZT1A 1XF2A 2AV1B 4MNGB 1BWMA 5MEOB 2G0LA 1YEGL 3VU2A 2QMJA 3SB3A 5C0AE 5FYLH 3CZGA 3SQBB 3RTQA 4PJEE 4QRBA 3MHZA 5GZNA 4ACPA 5GS2H 1E9PA 1S8DB 2DLFH 3UJTL 3W11D 2ZF9A 3GMRA 3KLLA 4JDZB 1KLFA 2IH3B 5A43C 1QSFA 5F0MB 2FBRA 3QUMA 1BZ9A 4Y2LA 1CIDA 4Z7WE 3WXVL 1VSCA 4KVNL 1GC1H 3N04A 3CSFA 5CZXC 1IQWL 3QEGH 2CCWA 3O3BB 2J20A 1PPIA 1JV5B 3H6AA 3QWOB 4F9LC 3R8BB 4V33A 3FB8A 4GQRA 2AMGA 3DROB 4JM2A 2QELA 3O6FB 3RUGF 3ILPA 1B0GB 2KLRA 4W6YB 1H3WM 2HKFH 4PVNA 4DVBA 3JWOH 2FEEL 4KH9A 3S36X 4MD4A 5EU6A 2OJEA 3HAEB 4QGYA 5LLIC 4L3AA 1SYVA 1U3HD 2CUIA 3L4XA 1BXAA 1QLFA 3F2LA 4P99A 1OAZH 3DKHA 4MZ2A 3VI3B 1DSFH 5I5RA 4FLHA 2I7OA 5FDYA 1G4MA 1XH2A 5IHWA 4ZFGL 4FQ1L 1LMKA 2NSQA 4PB9L 4UT6H 4WEMB 5A2LH 5CJOH 2HKHL 2GTWB 3GUTA 2VZOA 1QFOA 1TYJA 1L5GB 1E4XH 2XV0A 4KKCC 2QADD 3D7PA 4KOBA 4ZMPA 4DZ8B 3QZLA 2R23A 1JPTL 5EZLA 1XF2B 1CL7I 3ATEA 4AV0A 4YC2B 4G8GB 1TKWA 4NNXB 2GBAA 1FL5A 4Y4HC 1TCRB 3M07A 2FWOA 3DA0A 5ESAA 6TAAA 5DZPA 4ZFOB 3RTQB 3AWFA 4HP5A 1U2CA 2W1NA 3L3GA 2A74B 4ZFQA 5KBDA 3CFKB 4PRPD 3JV0A 4NUQA 2OSWA 1KLFB 3WU1A 3ZYIA 3HAEH 2BLFA 3GLAA 2VUOA 3I02B 3QUMB 1BZ9B 1UT1A 4UV7H 4ILDA 1WD8A 3Q2NA 4GAJL 3CBKB 1IAIM 4ZUTB 4P9HL 1ADQL 1WA1X 3L95A 3QUGA 1Z9LA 3TJPA 3GSUB 3IJEB 1JHTA 1MXDA 2WO3B 3OG4B 3ENEA 2A6DA 2F5BL 3CFJB 2W0KA 1HE7A 4DVBB 4K7PH 4KMQA 2ICWA 1WVZA 1DZ0A 5EU6B 1WFMA 2OJEB 1MF2H 1DBJL 2NYZA 2WXQA 3C2AL 4MA1C 5AW0B 5KJRL 1SYVB 1A3RL 1W6LA 1QLFB 5BPPA 1MCQA 2NX5D 3EH3B 4FQ2H 4WO0A 12E8H 4X4XA 2X6BA 2KQMA 2E46A 1JHKH 2BZDA 4X5XA 1P4BL 4F8LA 5AVXB 4QRQA 3SCMA 5IB4A 1CZ8H 4KUCD 5GS3A 3W56A 1LILA 1RMFH 2F9BT 3MAWA 4LVEA 3RG1C 2DOCA 5JMRA 2KLTA 3GUTB 3PQYB 1MFBL 4Y4FA 3MACL 3GNML 4XP1L 3KW8A 3D87B 3QUMH 4Y4HD 1U8QA 5IV2A 1TTGA 3GBNH 1TFHA 5IJCC 3QYMA 4NQQA 5FF6B 4YSOA 1HCFX 4HAGA 3KMDA 3PWUA 1JZHA 1E6OH 1WHPA 3B8SA 2QBWA 3UTQA 1N10A 1WFTA 3ET9F 5BQ7B 1VADA 3L3GB 3NZUA 1ZA6A 3CHRA 2Q7AA 3MLWL 3T3ME 4L1DA 3ZTJH 4R0LB 1PEWA 1L0XA 3SZ6A 5MP6L 3PP4H 2F54E 1NFAA 5GPRA 2LLGA 3WKNA 1Y1UA 5FR3A 5F7AA 2WBXA 2UXGA 5ICUA 1FNAA 4GXFA 4IHOA 3QCTH 4F15C 2EXSA 1XXDC 2Q6WB 1NCTA 3AM8A 3IDMB 4IMLB 4G1EB 3QUYA 2YPLD 4RRPA 3CN1A 4DFHA 3FB5A 3IWUA 5I1KL 2K45A 5ES4B 4QRRB 3QUHA 2D0GA 4OJDH 2QQNH 2Z1KA 3Q43A 2MOQA 4KTDH 4U6VL 3V6ZA 1MOEA 1TVHB 2DW5A 3EYOA 1KBGL 1NFDE 1CBVH 1HQRA 2QZQA 2WQUA 2B15A 5B4MC 2KYIA 1EUTA 4X5XB 1IGJA 4X6DA 2CR3A 2DH3A 2EIDA 4M61A 4QRQB 1ZTXE 4IOFC 1OO2A 4IGBA 2IQ9L 4XRCA 5I1LA 3TYFA 4BWUA 4PWKA 1NMBL 1B0IA 4HIEA 2NUTB 4E0RB 3EBIA 3KLHD 3VE0B 2B8OT 4PLNC 1T7ZA 5BJTB 2D31A 5F7BA 3PFUA 2PPDA 1NEZB 4NNPL 2A6KB 3TJEH 5ISZD 3BEWA 4GKZA 3MFFA 4WSJA 1LQSR 2MCMA 4BDVB 1IEBB 3VXOA 2YAMA 2DYPD 4LCWA 3BVUA 1KBVA 4XXDA 3KWWB 4ZOBA 3RWDB 3MNWA 3CHOA 3UTQB 4I1PA 1VEPA 4GQ9L 4HXAH 4WHCA 1YEEL 4KHXH 1I4FA 3AROA 3F3HA 3RAJL 4ZUVA 3QDMD 2QGEA 1OGAE 2XKUA 4O51A 3BPOB 4M48L 1KJ2L 2HZHA 1T1XB 4NZRL 4BHUA 1H3PL 3ARDB 3GMOA 1MJ8L 5FO7A 4IHOB 5GZOC 3D09A 4IU3B 4GG6F 1RSYA 3C5ZC 4OV5A 3Q2CA 2PWDA 1K8IB 1ID2A 1N9PA 4YPJA 4N0FB 1JF1A 2ZXAA 5CJ5A 4P59L 1N3NA 3O6MH 4JJ5B 3V6ZB 3EYOB 3IT8D 5BNXD 3WD5L 4P4RA 5D7SL 4AQ1B 1TJIH 3SGEH 4DGVH 2IG2L 3AT9A 5KJ4A 4KY1H 2QKIA 2PF6A 1WZMA 4IOFD 2HFGL 3VFOB 4DKFL 4YDLC 2IWGA 3MOAL 5F6IC 1KACB 1C5CH 1IGJB 2BDNH 4OVUA 1WLHA 4LF3B 4MQSB 5CN2A 4X6CA 1H6TA 3SE8L 5I1LB 2A38A 4N0YH 4ZAKB 2J25A 2OPCA 3NPSB 5F1OB 4HIEB 3EKCA 1AGFA 1S2EA 2FB4L 5ILTL 1JBJA 4F9PC 5D2NC 5C0AD 5DXWA 1F4XL 2CUMA 3C5XA 3RDTD 2YAPA 2I9TA 2FD6H 4I3SL 4KHTL 1OGSA 3KLKA 4JHVA 1BAFL 3VXOB 1QA9A 1YO4A 4AGQA 4UTAL 4XXDB 2AABH 5GGQL 3FHQA 3VXQB 4GO8A 2FWUA 1ZLUH 1YEIL 3OXRA 3O9WC 2MNWA 3TTSA 1HU8A 4XHJC 4ZNEA 2Q7YA 4G71B 5GZOD 3WY2A 2OCCB 1N5AB 5L6YL 4R90H 5HI3C 1JCKA 1UUSA 5E8NB 4AI7A 3GMOB 4UILL 1S46A 5FO7B 2W80C 1BZ7B 3PAYA 2LGNA 3U0WH 4M93C 2FYYA 3VWKC 2XBTA 4PI0A 1FUNA 2LU5A 3PXHA 4XO9A 1W9XA 4KJQC 5L4IA 4LSTL 1IC7H 5DQJA 4AE1A 2NY1C 1I31A 2ICES 3F7YA 5AB2A 4GO6B 3TURA 5DK0B 4NKMB 5EBMA 3SYQA 4KX7A 1QW8A 4WU7B 2B08A 5CLWA 4G70B 1FNSL 3ZE0E 1F3JA 4HJJL 3IFLH 5ADPL 1MIEH 2WO4A 3I6SA 2C3WA 5GSVA 1J5OL 3RGVC 1J8KA 3U9PH 1YEWA 4HF5L 5AAMA 2IXQA 3VSQA 5EF3A 1AGFB 2IGTA 4O4YL 4ONHA 3TCXA 1FO0A 2WZ5A 3A47A 1NKGA 1IC5H 4XNUH 1KPVA 4ZUSB 4KFMA 1A6TA 1GKOA 2LHAA 4LASH 1PKOA 4NERA 1HAUA 4A2EA 2HA1A 3MV7B 4FJ6A 4P2QE 3FOLA 3LH2H 4XHJD 2WWOA 2AEWA 4J8QA 4UQCA 5KVFE 3PAUA 2Z31C 1U92A 2CE6A 1E67A 3HG1B 3OZLA 1S9XA 4EAEA 4WHYH 2N01B 5HI3D 2BO0A 4CU7A 1QBML 4NQEB 2AQPA 3UYOD 2E7DA 1CU4H 1I8IA 3SE3A 2MNUA 1TEFA 3DTUB 3QZWB 3VWKD 4K3JH 3ZE1B 3GI8L 1B4JL 3QWRD 5F9WB 2FO4A 4FOMA 4KJQD 4AYFA 4IBUA 4YFLI 4DQOL 4JM2F 1M6UA 2NY1D 1XF5A 1IGCL 3OZ9H 3H4HA 3WE6A 3AU1A 5K39B 1RJZB 4I9WE 2V2WB 5DQJB 1AQDB 2AGJH 2BNQE 4UAOB 3F7YB 1OOAA 3SPCA 4L4VA 1NOFA 4IK7A 5EBMB 3V0HA 5IY5B 1A4KA 1YY9D 4XC3H 3DO4A 1OWRM 3AREA 2DQTH 3RGVD 1F3JB 1VPOL 3DUSA 4C59B 3FFCB 4YSCA 4BK4A 1CJYA 4XVSL 1H8NA 2X9XA 1QMUA 3HRPA 1N8OE 5E4OA 4PJ5B 3PREA 1AZRA 3MCLH 1T1ZB 4K9EH 3DSFL 2R0WH 4ONHB 3QEQE 1JE6A 1B2YA 2ZONA 4LVNC 3QFGA 2EEXA 1KDIA 3OJDB 4LSVH 5D7JD 3MRDA 1VERA 1G7LB 4HGWA 2P4AB 2UYLB 2HVKA 3ZKNC 3LS4L 3QUXA 2ZWNA 3S48A 4WY7H 4YIQA 1FNHA 2Z31D 4EBQL 4R4BB 2YAFA 5IW1A 1UWEH 1FGNH 1J12A 2EYSB 2B1OA 2GW5A 3IDJA 3JT0A 4D0DB 1ET5A 3US9A 1UCBH 1A8ZA 4JFDE 2F54D 5IQ7H 3QDJB 4ZMWA 1G7JB 1KXVC 2OYPA 3ZMRA 2K6ZA 2FX9H 4ZFZA 1AOHA 4FTVB 3NCJL 4JFVA 3BESR 4LRNL 2AERT 2R0LL 4GG8A 1LJMA 1RUQH 2ROXA 4G9FD 1A9EA 4HCRH 1XF5B 2HUHA 2BIHA 2IIJA 5AZ2H 3EW3B 3AU1B 4NM4L 3QYCA 4W9ZA 1IAII 3UGXA 3GSWA 2RHEA 4QJ4B 4L4VB 2VDML 2XZCL 5KVMC 4Z1PA 5GRVL 3CDFA 3VSVA 3ZJAA 1GGBH 4ZW6A 3ZQWA 1RZ8B 1FFOB 3AREB 4HAFA 3KXFA 1QBLH 1MRCL 4WWKA 5K9QI 4AQZA 3ARUA 3LMJH 1BYPA 3BUQA 4ES8A 1MDTA 2EH7L 2X9WA 5EB9A 4WWNA 1K4CB 4OLVL 4GP8B 5DD3H 3L9YA 3WKMH 4UOJA 1H19A 2Y06L 4QYOB 3BYTA 1UH3A 1KPUB 2FEEI 3OXSB 4P2RD 3ZKND 1OP9A 5TK4A 3KM1A 1XIWA 4HGWB 1Y18A 1HEJC 3HI1A 1OAUL 2H5UA 1DCEA 5E94A 2Y5TB 4ZTOL 4WFGE 2XTSA 4TSBL 4OF7A 2DQUL 3TO2B 3E6HA 4G8IA 3QUZA 5D7IB 1I85C 1QABA 3X1NA 5F44A 1P4LB 5AOJA 2H6PA 3B1UA 4JREB 1BD2B 1IAOB 3A6OA 4UQDA 2P43B 2G4EA 4OKVA 4H0HB 4QHKJ 4BE5A 3IE9A 3I3EA 5CD3A 4P04A 4FG0A 2BNRB 3Q3GA 2GHWB 5FFGA 2R29L 4J2QA 4QRTB 3PHOB 2EUVA 4ZFZB 2IWFA 1OAQH 1T03H 5JIMA 1XH0A 3KGSA 1B4RA 2V2XB 4GG8B 1SN5A 1SFDA 4F7MA 1YYLH 1A9EB 3K4ZA 5E1GA 4EN3C 2VKXA 2Q3ZA 3TT3L 2J8OA 1KBKA 5FO9A 5DJDB 3ESVF 1BBJB 3D30A 1XCQA 5PCYA 1IGIH 4Q4EA 4W93A 5EZIL 3S34L 1MVYA 4L4TA 2OX5B 4FFTA 1U91A 2EH8H 2XN2A 3LNIA 1SJHA 3KXFB 4KV5F 4WNQB 3HC4L 3Q8FA 2YQ3A 4X6DF 3S7GA 3W82A 1FIGL 3EGSA 5IQNA 1ZDSA 1H8SA 3PHQB 3SBWC 4ODTH 3VTMA 3KH3A 3DO7A 1G0DA 4MCZA 1BW8A 5KYNA 2IFFL 5C9JA 5KVDH 1UZ8B 3V4PB 4HIIA 4L48A 4Z0XA 3UAJC 1N8ZA 3BUIA 4NO0D 2VO5A 3MODH 4UQ3A 5H4ZA 4JO3L 1ZJBA 3VFUB 5I1GH 3TV3H 1RK7A 5L88H 1XQ4A 3T6QC 3CHXA 3CMOL 3CX5J 1XR9A 4GSDH 3V4VL 1Y07A 1HFUA 1WUZA 4PJXA 2ZICA 3K1DA 1HWWA 4OF8A 3QCUL 1DQML 2ZP9A 4O2CA 4P3CH 1GR7A 1VEOA 1KCUH 5IWLA 1JYXA 5DUBA 1YZZA 2VDRH 1CYWA 2NDFA 2QSCH 3TYGH 1T4KA 4NQCB 1CVRA 1SEQH 3VNZA 5E23A 4D2NA 3TZVC 4GKSA 5HHPA 1CI5A 3TBYA 4YVNA 3VXTA 1Q0YL 1YJDC 5JXEC 3LQAH 1XTMA 1KEMH 3QVAA 3S3CB 3VRLE 4WF7A 4L1TA 2TRYA 4S1QL 4LAQL 5DUJA 4EN3D 1JFQL 1KN2H 4CW1A 4AJWA 2VXTL 5C0EA 2X3BA 5J1TC 2OZ4H 3B1TA 4JVPA 3LIZA 4DCQB 2I69A 4HJ1A 1D6VL 1QUPA 3HRZA 1KB5L 2DD8L 5MEND 1NJ9A 2OSLA 2P5ED 2OMYA 4NI3A 4AITA 1ZLDA 3V4PH 3B9KA 1VFMA 3HN3A 4N2MA 3OJMB 4IDLA 1AC6A 4IQHA 1AQHA 1I3VA 2XZAH 3HVNA 2A3TA 1R3LB 2DQGL 2AC0A 4OI8A 1JNHA 1CD0A 1FPTL 1PJ9A 4LQFH 5D70H 1I1AA 5TD4A 4W9IC 2WB1A 1E7UA 5KTEL 2JK5B 2UZPA 3OV6A 3DO7B 3UAJD 3H3BC 2V9QA 4N2IA 4PJFF 5G4NA 5CZVL 5C0BD 1ULVA 4EF3A 3GSXB 3ATAA 2FE0A 2KL6A 4HIIB 4PJHA 1CFNB 4WTQA 1E4WH 3GGWA 5IVOA 2OA9A 1YEHL 1LVEA 1XR9B 4MWFA 3TU6A 2YQGA 5DFTA 1DE4A 2ZPKL 2E74C 3ETSA 2EDTA 1AY1L 3FQTA 3TVMA 1P69B 3LPFA 1JSYA 4O2CB 4N28A 4RNRA 4XNXH 3VXRD 5DJ8B 1WFIA 1U8OA 4H4NA 5D8JL 4B7IA 3VVWA 5DYOA 4R26H 4Y5XA 1NAKH 5JXED 1GZQA 3FT1A 4GKSB 5HHPB 2F1EA 5DRWA 2ALAA 1C16A 3TBYB 3VXTB 4JRXA 3TWCH 2D7PA 4Z7VE 1PU0A 1I8AA 1KCVH 4KZDH 1QP1A 2H1XA 4L8SB 1UWXK 4OIBA 5L2JB 1YQVL 2CR6A 3C09B 1DSWA 3D4CA 1QKZH 2CJUH 2XPGB 4ANXA 3IS1X 2VM9A 4OZIA 4MA7L 4CSTA 1P2CA 3D9AL 2QHRL 3WUZA 3UCQA 1D5MB 1TZIB 3B9AA 2K6YA 4IKNA 4TUUA 4LLVA 3GK8L 4NNYB 4GXUM 1WWAX 1JNHB 3D3VB 4OUOA 2CJTA 2F08A 3FBQA 3MR9A 4OFYA 4ZXBC 1YPZB 4OSUL 3RA7H 2HPTA 3SPVA 3ZTEA 1BLIA 1S9YB 3HC0A 5ITBH 5I82A 1F42A 4TNGA 3PL6B 4F7PB 5EA0L 1TU2A 4G82A 3V0IA 1A5FL 1TJXA 3BUPA 3GBLA 4YSPA 3O8XD 4XMKH 3L17A 5AUMA 5JOFB 1DQTA 3PIQA 2XKNA 1SDYA 1SLVA 3WJLA 4NO2A 5CP7A 3VGDA 2ITEA 3NRQA 2OMZB 43C9A 4RAHA 1OLZA 1V3MA 4H8QA 4KQ3L 2WOYA 1XF3A 2A9NH 3J07A 4PRIE 4PD4J 1DE4B 3LIZH 4HWBA 4H88H 5DUPL 4RNRB 3QNZA 3QJVB 1TETH 5K59F 2FSDA 4Y5XB 4OCMC 5I8KL 4M5TA 3V7MA 5DRWB 1C16B 3WTVA 4JRYD 4EZLA 2OR7A 1TXKA 4TRPL 2CU9A 4PREB 1ZIAA 4E42A 1Q0XL 2P7TB 3SJVD 4KNQA 5DJYB 2YQBA 5J0BA 1EJ6A 3FONA 3U7AA 4OZIB 1XSKA 3OAYK 3ABGA 3GMMA 1Q0EA 4LLVB 4J3UA 3V6OE 1ZDQA 1PS3A 4ZXBD 4DN4H 3IFNL 4V1DD 4JG0H 1M1SA 1CG9A 2JJSC 1CFMA 4JQXA 3SPVB 3IRCA 1MFUA 3HC0B 4A7VA 4CRPA 5EIQA 4KPHH 5DVOA 2VDLL 1S7SB 4FQQA 4G7QB 4NN7C 4G7RB 1KJMA 5TPWH 3TONA 4ADJA 2XXFA 2ZIDA 2C1OA 3AACA 3KWXA 3NA9H 1HNGA 1WTGT 1CICB 5AUMB 4RMTA 1E8YA 2XKNB 3PIQB 4P46B 1MIMH 5GGVH 4ANVA 1QTPA 3LRGA 4ODHH 3STLB 4E9TA 1JN6B 4JFEA 2BZ7A 1A3LH 4TMPA 2UZYB 2B16A 3LRKA 4GQPH 4IKIA 4KO6A 4PY8I 4R4NC 3BX7C 1P7QA 3IS0X 3LKOB 15C8L 3QNZB 4TQIA 3VCLB 4OD1H 2W60B 3KVQA 3QJOA 5FYKU 5JIIA 4J3OC 5EU3B 4QRSB 3VXMD 1UYWL 2E7BA 1MFDL 4U0RC 1LWRA 1ZSHA 5T3ZD 3T0EA 5C97A 3RNKB 4BFKA 1ID5I 1AMYA 5C0RH 4E42B 4R7DA 3ETTA 1AR1B 4YBHA 1XL6A 1PZ5B 1WZKA 5D6CA 1H5BB 2X4TA 3VRJB 4MD0B 3T4AA 3LZLA 1FI8C 4U1SB 4XXWA 1X5AA 1P84K 4J4PA 4NGHH 2ORBL 3EYSL 4PS4L 3C9NA 1GIGL 2XN9E 1I9RL 3B7RL 4FL4C 3BKJH 3OM3B 1NCHA 2L3BA 3UO8B 4BDVA 4LEEA 4X6FA 4J3OG 4NDMA 4DKTA 4NKIH 3STZA 1EEYA 2YAEA 4HWBH 2IH1B 2DIEA 2W59A 2QDWA 4OQTL 2EINB 1KJMB 1MI5A 1GGCH 1OP5H 3BJLA 2J8UB 1OL0A 3G6JE 4PQXA 1CLYH 4OCLC 2BSSB 4B9FA 1ZEAH 4MXVE 5E5LA 4LB8A 5CEZE 2QTVA 4JFEB 2UY7A 1E6JL 2FLBT 1QHQA 1VCBC 4J6RH 4Y2DA 5C0FB 4X6EA 3CFCH 3GI9L 1P7QB 1OWWA 2E9BA 2X6MA 4J3OD 3JTTB 4RA3A 5T8IA 5KVEH 2ZUQC 5DI8A 2R4SL 1BYOA 2AJSL 3EJCA 1PLCA 2XQ0A 3RZCA 4EZKA 1UGNA 3TC9A 4F58H 1A66A 5CMAB 1WCQA 2XZQH 2ITDB 1AGBA 3NYKA 2DWEA 3ZGHA 3NJHA 4E5XG 3PDOB 3U30C 2KT6A 2V5TA 4I88A 1KLUA 3S35X 3H42H 1MRDH 3CHPA 4U1LA 1QD0A 4G8EB 5FKPA 5IB2A 3T4AB 2HJFA 3LOWA 2DI9A 1KGCD 2LU7A 5T3ZL 4C57C 1IEAA 2UX7A 1I8LC 5C1MB 3BAIA 4PG2A 3CC5B 3ETBF 3RB7A 4C4KT 4NDMB 4TLSA 2YD6A 1R24A 1EEYB 4E41D 1K4DA 1X5IA 3NCXA 2ZCZA 1E90A 3WGVB 3UYPB 4Y19D 1I7ZA 4P23B 5E8OB 1KTCA 2VR9A 3UDWA 1Z1WA 1M05B 2VN5A 1QEXA 1DBAL 3VXUD 4GI6A 4JEGB 3Q6GH 3SKJL 3ZOAA 3KE0A 1D5XB 3OQ3B 3WLWC 4MJHA 3OKKB 4TN9A 5DVPA 2UY7B 5E4EC 5HHOA 4AW7A 1S5IL 3CZNA 2NT1A 3L7FB 3I74A 3M1OA 4RETB 1CGUA 1RXLA 4PJDE 4PJXF 3WI9A 5LXVA 3TF4A 2VMDA 1JUFB 4U33A 1JIBA 4K55A 4K3DL 4U3XA 1YNKH 4Y5YC 5EWIL 1UGKA 1YMMD 2MTAA 5AVQB 3SDXE 4H26A 4XCYA 3I3DA 1D9KB 5GIRB 4QKTA 3ULVL 2C9SA 3V0AC 2Z92A 2DWEB 4RAUA 4FFZL 1OZTG 3HHSA 4ZMOA 1U8HB 3C6LB 8PAZA 3O3DB 2WLLA 3JUZA 2HJFB 1SOKA 4MBOA 2ZCLH 2DWXA 5DHYA 4FI6A 2Y7OA 3E1ZA 3VXNA 1DVQA 3U7YL 3E2HC 3POCA 4WO4C 4HLEA 2OK0H 4OM0H 3O4LA 1CN4A 1OARL 1RUKL 5DZNA 1A22B 1CBJA 3SQOL 3NEEA 2P8PB 3T1FB 2F5AL 2ED6A 3ESMA 1OANA 2F53E 4FQXC 4GMSL 4MYPA 4WIQA 1XL4A 2D7TL 1Z2KA 1UD6A 4FABH 4BUHA 2P45B 1I7ZB 3L4ZA 1HCVA 1XGPB 3P9WB 1QI4A 4BJLA 5DJ6A 1XGYL 2ZXWB 3BKYH 4YMPA 4Z95H 3WLWD 5C0NC 4PJHF 4RFOL 4D0CB 4FHBD 5DJ0A 4BZ2A 2GITA 3JUYA 1E4KC 4PRID 3AY4C 2HX8A 4G8FA 4Q58C 1T5XA 3H56A 4M7LL 2AK4E 4FC3E 3ZDXF 2WV3A 3GBMH 4Y9CA 2JIXB 2E9JA 3QXVA 3LZOA 1J1PL 1QSEB 3L3KB 1P5UA 1O6SA 4YXKL 1S9WA 4QXVA 5EIIG 4WU5A 1T04A 2VLKE 2E7LA 1VFOA 5J12B 2DWTA 1ED3A 3G9VA 1NAMA 4FXKB 4LU5L 2EYRA 2OP4H 2D3NA 4KRPC 1BFOB 2VISA 3B3BA 3P02A 1JNNL 2WLIB 2NSMA 3FO0L 5E03A 4RGMC 3OC5A 1KJ3L 5K33A 1UENA 5IG7A 4XMLL 3HHSB 3GSQA 1IO4C 2B3IA 2NQCA 4KJPD 1XBDA 3ZRFC 4DESA 1UOVA 4LIQL 5L4MA 3FQ1A 4ZMNA 2Z93B 1DVXA 1M7IB 2D9CA 1A7RL 2ZOKA 1INEL 4WO4D 3LB6C 4K7PX 3D51A 4WUUD 1CR9L 4W9DC 2Y7QA 4BSVB 1URLA 1GS7A 1TEYA 4Z7QF 3VW3H 3O4LB 3ECUA 4NHCL 4FQXD 3WO3B 2GSIB 1ZHNA 1M42A 1NDTA 4ZDHB 5B3NA 3HNVL 3I6LE 5E51A 4BD4A 2Q86A 1DP0A 3FQRA 3UC2A 2WAQA 4LEOA 5D5ME 4CA4A 5I1HL 4RWYH 4HUVB 4YO0B 3VB8A 5M7QA 4GS7C 3LEVH 5KBLA 3ZTNL 4CSZA 3DMMC 4JQIA 3OKMA 2J55A 2K70A 4ZX6A 1IBGL 4Y16C 1K3IA 2J57A 3VAEA 3ZRCC 1S5HA 2DKMA 2GK0B 2PCFB 2WCSA 5H94B 1B0RB 4Y7OC 4WEBH 1N0LB 2VDOB 4AENA 4R97B 5HDWA 3W2DH 4OI7A 4GH7B 4LVOC 4X6BB 4YDJA 1RFDL 3V8CA 2EECA 4OLEA 1T6WA 4F1ZA 1ED3B 1NAMB 5FLVA 2JH2A 3NN8B 4NPYB 4H40A 5I0YA 1GL4B 3PV6B 3VD1A 4APQA 1DLFH 4QRPD 2BP0A 1UQSB 1R46A 1CTNA 1PGRB 5HPOA 3GSQB 1AO7D 1OY3B 3HB3B 4S1RH 2UWEA 3LB6D 3MV8A 3OG6B 3C5SA 4U31A 2H3NA 1SXCA 1KDJA 3FRPA 4Z7IA 1KCSL 3HZVA 4D9QE 1ZS2A 5IGXH 2BVYA 2Y6TE 2Y7QB 3QIBA 3MDJA 1X5JA 4PTUB 5C07E 5C2BL 3SE9H 1DFXA 2J1YA 2NYYD 1R3HA 3UBXI 1N7MH 3V0FA 4BZ2H 1DZBA 2F15A 4FQCL 5AYTA 5E2UH 1F8TL 3DX0A 3I9GL 1IM3A 1FG2B 2HRPL 2Q86B 2C1PB 4DN3H 1YEDB 5E56A 4LRIA 4NRXA 5B1BB 5IMLA 4WCYH 3JWNE 1KB9J 3NFSH 1RAMA 3FT9A 3H55A 4KMTL 4Y16D 2WIIB 1NAMH 1L9OA 3MRCA 5CEYA 3S3DB 4DP8X 1YNLH 3WNKA 1FYTA 1OAKL 2NY7H 5LJYH 3TA3C 1HHKA 2XWXA 3ESPA 5FA4A 4AYDC 2CBTA 4ZTEA 4M6OL 5C86A 4MNQA 4UDTA 3UTTB 5AB9A 4HJGB 2B4CC 2YEZA 3KPSA 4OFIA 1QWNA 2C7FA 1UVQB 3E0GA 1JK9A 4YDJB 1QHPA 4G9DB 5F2FA 4C56A 4PJ7E 5I73B 2GJ6A 3BDYH 5EOQH 3SPGA 2RACA 1DBML 1TQBB 4KKLC 4HU2A 5EBGA 3KYKH 4JKNA 3ZHLA 2YUXA 1ORSA 2HRLA 5SWQA 4EIGB 3T9WA 3M17A 3M7FB 4NN6C 5DGRA 3TNMA 1ASQA 2KI6A 4JKLA 2Y07L 5IOPA 2LOEA 5E2VL 5BO1L 1PDKA 4FI7A 3KLSA 2VABA 1NCCH 4LZKA 2WN2A 3M7OA 3OHXC 4F8PA 2K78A 4CBZA 2NY5C 4ALAH 1X5LA 4GQZA 4BSJA 5DD1L 1QEWA 4B3EA 1BV8A 3GXTA 5D6DA 4JQIH 3FRPB 5GRZA 4LBAA 3VWJB 3LNEA 2IANB 2LT9A 3L3OA 4X5QA 4JCLA 2VLJD 1GYUA 4QOKA 5E2WL 1AMXA 4KTGA 3WFHA 4JDTL 5JHDE 1JCVA 2LE9A 1KEGL 1JTPA 2G2PA 1S7QA 2NNAA 1MCKA 4H1LA 3HZKA 4W4NA 5TH2B 4UIKH 1H3UA 1QBBA 3CLEH 3EFDL 5A2KH 1A7OL 2O5XH 2OMBA 4IDJL 5SV3A 3S97C 1HQ4A 5DEFA 5D1XB 3N3EA 3TA3D 3WJMB 4B9KC 4EI6A 3RHWF 1E3XA 3IDNA 3E80A 4NQSA 4BQCA 1SUJA 1FSKC 2B77A 2XG4B 1YDPB 4FZ8L 1C1EH 2WQRA 1CF8H 4M8RA 4L3EE 4XP6L 3KPLA 2WZPA 5I74B 3SGJA 2QQKH 5I8EB 4PLJC 5L2KE 4MNQB 4UDTB 3B5GA 2D9QB 3CGTA 3O41B 4N1CA 1R1CA 4KKLD 1FV1A 2RGSA 1T0OA 1L9PA 1JK9B 2IAMD 4KROB 1HXYA 3I9IA 4M8UA 5FK9A 2GJ6B 5MERB 4MJ6A 1KTKE 2JJTC 3GIVB 2WXNA 3WS3B 1WG3A 2CZNA 1N18A 1X9RA 2VLME 3KPRA 3MUJA 4EOWL 3AUWB 1ORSB 2QVKA 1IUZA 1QO3A 2AQTA 5SWQB 1MCRA 4KI1A 3P9MA 4G7YH 2CNZA 4H2AA 3S37X 4HUNB 2LTQC 5IOPB 5JR1H 3P3TA 1L7TL 1ZY9A 5F70A 2VXQL 2QQLL 3ARQA 2AI0H 2VRKA 2HX9A 2XKSA 4HV8A 4L0YA 4HUUB 3BO8A 4JY5H 4WKXA 3EYFA 2WBWB 4FP8L 1QEWB 1S7XA 3D34A 5KBMA 1MCLA 1FFNB 3QJRB 3NCBB 3QWQB 3MLZH 1KWGA 3CPUA 2TSAA 1LEGB 2RIKA 3KPTA 4I0KA 5JHLA 1FRGH 5KW9H 4JN1L 2D2CC 3MRFA 2VDNL 1S7QB 2DTML 2EXTA 1LP9E 1R33A 2PXYB 4XBGB 4MA8H 1FE8H 3VGHA 4AJ0A 3MU3A 5GRVK 1MG3C 1D7BA 3DX9B 4ODUB 3GINA 1BF5A 3H9YA 1FDLH 4XPHH 3D50A 3MJ9A 4MJIA 3OKYA 1TZOA 2Z8SA 4MJ4A 5TFSH 4NQSB 4FULA 1TQSA 4PLJD 2DLEA 1NDMA 4PJGE 2WGXA 4EQ2A 4F33B 5J56B 5DJ2A 4JFSA 1D5ZB 2EIKB 3M6DA 4Y5VA 3JTBA 3A21A 1NA8A 1J7VR 1ODAA 4N25A 3CD4A 2ZAHA 4LL4A 5C08A 3DWTA 3KVDD 3QW9A 2OMUB 4LP5A 1KFAL 4NC2B 3OPZL 3MX0B 3L9EA 3X11A 3KPRB 1G4RA 5IM7A 2B4CL 5IMKB 5E8EA 3EO9L 2N7BA 3GZOA 4NKOA 5D4QA 1A65A 2J56A 1TJGH 3BAJA 4UT7L 3TEUA 3LAFA 5C09A 2L7EA 3HI5L 2NY0C 1ZSDB 4GKOA 4H1LH 5EV7A 3B7YA 3QFJA 1NGQH 3D18A 2X89D 4YSAA 1GPOH 3FUMA 3JV4A 1CD1A 4HV8B 2VMJA 4A7GA 1J0IA 3BO8B 1OT4A 5CLZA 3UTOA 4E9QA 4UOQA 2Q5BA 3HS8A 4JJHA 1KCKA 1BJ8A 4PJCF 2F8OA 3BZ4B 3SO3C 3RI5K 4NZJA 1AHWA 4HCIA 4NQDA 2NY5L 2CO6B 3VNYA 1CGTA 5E2TL 4QT5A 3KYOA 3TO4B 2IQAA 3H7BA 1UB5B 2FUTA 4FYRA 5IF0A 4MD5A 1NUNB 3G7TA 4ONOA 2WSPA 2X4PB 4GRWE 4N2EA 4A68A 6CGTA 3SYAA 3ECBB 4M6NH 1HL5A 3BAEL 4EI5C 1E4JA 4XE0A 1FLTX 2CGZA 3G6DL 1RIVL 4MJIB 2VE6A 5HY9B 3MRPA 4XMZA 4FA8A 4QNPF 5FM5M 4AK2A 2KZBA 4AIZA 3V0WL 4UM9D 3EYUH 3QHZH 1NLBH 1BF2A 4PLOB 4AWJC 5DEGA 3AZUA 1WYJA 3L1OH 1FNGA 3MBEB 5HHME 1VF5C 5C08B 3UG5A 4QRUA 4Q9QL 3V5KB 2A4CA 3FCUB 1BEYH 4MXQC 4KJWC 3F04A 3K80A 3QRLA 4Y1AD 4QRAA