4PAZA

Oxidized mutant p80a pseudoazurin from a. faecalis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTAHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer
molecule keywords PSEUDOAZURIN
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4pazA00
5I6LA 4HAKA 1ID2A 4E9VA 2XX0A 1XB6A 2ZOOA 1WS8A 2BP8B 2HX8A 3BQVA 3UAAA 1AOZA 1GYCA 4WTQA 2DY2A 1NDTA 2IDUA 2FT8A 3DIVA 2IDFA 3NJJA 4DP1X 3NJLA 1PNDA 3X1GA 4RH4A 1AG6A 1OCRB 4DP4X 3ABMB 2J5WA 3PPSA 5E9NA 3QJRB 3PAUA 4YVNA 3FT0A 3NJMA 3WNIA 2QT6A 1X9RA 7PAZA 1AR1B 2DWTA 4HCGA 3TA4D 1HAUA 3WG7B 2B3IA 2VSMB 4YSSA 1QNIA 4E9YA 2H3XC 1V10A 3N2JA 4CSZA 2X88A 1ET8A 3NJGA 4AI7A 1ZV2A 2Q9OA 2EILB 2VW6A 5I6KA 4DPCX 1JERA 1JZJA 1JZGA 4PCYA 1WS7A 3FSWA 2A3TA 2MTAA 3DKHA 2YXWA 4KOBA 1HFUA 2YAHA 2YXVA 3SBQA 1BQ5A 4A2FA 4QLWA 3CVDA 2UXGA 3EH5B 1PNCA 4YVUA 1QHQA 3CDZA 3S3BB 3WKQA 2XX1A 2XV3A 4HHGA 3FU7A 5D4IA 1KBVA 1NICA 1RZPA 2JFCA 4A2DA 2UXTA 5AKRA 3FYEB 1ZDQA 3DTUB 4YSPA 4YSCA 1FFTB 3UAEA 3FU8A 3CVCA 1AAJA 3WI9A 1N68A 3PLYA 1I53A 2YQBA 2UXFA 4W1TA 1OOWA 1IBYA 1PCSA 2XXFA 1OF0A 4A2HA 1JVLA 2R7EB 3BVDB 1KV7A 1A65A 2P80D 1SF5A 5D4HA 3AG3B 1JZFA 3OD3A 3CZUB 5TK4A 3D12B 1CYWA 4M4RB 3EH3B 1NZRA 2XUWA 3GYRA 1GS7A 2DV6A 4KNSA 1NIFA 4NAJA 3GXUB 1NIDA 4F2EA 4W9ZA 4QKTA 2AZAA 1MG3C 2TSAA 2XV0A 3IBOA 1JXFA 3QJUB 3T6VA 1UATA 3AW5A 1L9TA 1J5DA 1DZ0A 2J57A 4KO9A 1BXAA 1ADWA 2FQGA 4ENZA 2GSMB 3MBWB 4YSDA 3S8GB 2WSDA 1V55B 1OV8A 1KCBA 3UGEA 1GY2A 1GS6X 3C75A 1PMYA 4JHVA 1PLCA 2AVFA 4AKQA 2BZ7A 2CAKA 1CC3A 4GXFA 1A8ZA 3RYMA 2I7OA 1BXVA 3FS9A 1CUOA 2PCYA 1AS7A 1MZZA 2VW7A 9PCYA 1M57B 5PAZA 4A68A 5I5IA 1J5CA 4YSTA 4BDVA 2Q5BA 1PAZA 1NTDA 2XU9A 2EIJB 1PZAA 3FPYA 5AZUA 2YAPA 1XMEB 4KO6A 5I6PA 3T6ZA 1NWPA 4HCIA 3PCYA 2FQEA 5B7EA 4E9SA 4YSOA 4YSRA 5A7EA 2IDTA 3V9EA 3FSVA 2IWKA 2EIMB 4E9XA 2VN3A 2BZCA 1RZQA 2IWFA 1JXGA 3KW7A 4BWTA 1R1CA 8PAZA 1MG2C 5ANHA 2HZHA 3T71A 4G71B 1TU2A 3MX0B 4G7RB 1JZIA 1NINA 2IH8A 4E9TA 4BWWA 4AKOA 2MRYA 3T9WA 3OMIB 2IH9A 4DP0X 1EHKB 2OCCB 2BP8A 3V9CA 1ZPUA 1BXUA 1J9TA 1HAWA 3EHBB 4CSPA 2FWLB 5AFAA 5D4JA 1SHXA 5B7MA 3OQRA 1OCZB 2CALA 2GI0A 4P5RA 3ZX1A 2XWZA 3TU6A 2I7SA 1GS8A 3N55A 2PPCA 1OCCB 4Q8BA 2CBPA 4BXVA 1SHWA 2AZUA 2PP8A 4N8UA 1KDJA 1J9QA 3FYIB 2XVBA 1AACA 3FPXA 4G7QB 4M3HA 3S8FB 3IE9A 2QPDB 3UACA 4TXVB 1NIAA 4NERA 3CG8A 2ZONA 1V54B 2XLLA 5I5JA 4E9WA 3HEIB 2W88A 1JZEA 2HRHA 1AZCA 1GY1A 3SBPA 2IWEA 2Y69B 4X4KA 2H47C 3NYKA 3H56A 1A4CA 3H4FA 1BAWA 1GR7A 3JTBA 4WKXA 1PZBA 1JVOA 1ETJA 2IDSA 2Y1AA 1L9PA 3S3CB 4YSEA 5F7AA 4DP5X 1L9SA 1J9SA 2WO2B 3ZBMA 1KCWA 3QJQB 1L9RA 2PCFA 1BQKA 1IC0A 2DYSB 3PXLA 2XXGA 4NB7A 4YSAA 4GP5B 2TSBA 3X1EA 3PAZA 5B1AB 1KYAA 1W6LA 2BP0A 5B1KA 3NSCA 3ASOB 1IUZA 2HRGA 1AG0A 1SFHA 4ZK8A 1PY0A 2VSKB 2GB2A 3JT2A 2GHZA 5I28A 6PAZA 2QDVA 2JKWA 1ILSA 3ZDWA 4E9QA 2ZXWB 3NP4A 4F7KA 2NRDA 1AZUA 5I6MA 1FA4A 3IN2A 5B1JA 2BO0A 1QLEB 3FQ1A 1BYOA 1SDDB 4KO7A 3T6WA 4HALA 1A4BA 5LDUA 3NSYA 4N4YB 4A2GA 3FSZA 1JOIA 3OMAB 2FQDA 3QJSB 1W6WA 3NSDA 1AQ8A 3FQYA 5I6OA 4BDVB 1NIBA 1L9QA 2PPAA 6PCYA 1L9OA 1AS6A 1E65A 1A4AA 2H5UA 2ZWNA 2RACA 1M56B 7PCYA 4UAHA 1TKWA 3HB3B 4A2EA 3X2QB 3T6XA 2CCWA 2OV0A 4HIPA 2PLTA 1PF3A 2VMJA 2HX7A 1E5YA 3X1FA 4L0PB 2B08A 1MDAA 3OMNB 4G70B 1AZBA 4KO5A 4EF3A 1WA2X 2UXVA 2HXAA 1RCYA 1BQRA 4HZ1A 1JXDA 4K9JA 2I85A 1SJMA 2PPEA 2BW5A 4HHWA 4UF7C 1ASPA 4GP4B 2DYRB 1MZYA 3TBCA 1NPNA 3ERXA 1XB8A 2J56A 1AIZA 3OM3B 3IN0A 1KBWA 5F7BA 4KOCA 2W8CA 3ABGA 4BWUA 1TEFA 1URIA 1YLBB 2FQFA 4AKPA 2AANA 3AZUA 4G7SB 1AZNA 1OE2A 3NJHA 1SNRA 3GDCA 1DYZA 1F56A 2FT6A 3S3DB 1OE3A 1EZLA 4AZUA 2JXMA 1T5KA 4AX3A 1X9UA 2PP9A 3ABKB 3NJIA 3QPKA 4DPAX 1ASOA 3QJVB 1WA0X 1RKRA 2CJ3A 5EHFA 5FC9A 1SFDA 1WAEA 5B7FA 2PPDA 1AZRA 1ZIAA 3AY2A 3CDZB 4E9RA 1VLXA 2QPEB 3NJNA 1XB3A 3ABLB 3FQ2A 1NWOA 3FU7B 4MFHA 3WNJA 1PLBA 3EH4B 4GP8B 1FWXA 4GYBA 4YSQA 1BYPA 2GC7C 2BWDA 1NPJA 1IKOP 2IAAC 2J55A 2EIKB 2WO3B 3NSFA 4KNTA 2YAQA 4Q89A 1PLAA 3FSAA 2GC4C 2YARA 2LLNA 4GY4A 3NJKA 3FU9A 1E30A 4BXSV 1ET5A 3SBRA 3X1NA 1E67A 2UX7A 3UABA 3AG1B 3NJFA 1W8EA 3H4HA 2VM3A 2VW4A 2AFNA 1A3ZA 1JZHA 3CVBA 5B1JC 4KNUA 4YSUA 2BP0B 2R7EA 1J9RA 2GIMA 1GW0A 5B3SB 3PAVA 4YL4A 3UADA 4A67A 2HX9A 2EINB 3ZIYA 4FA7B 4DP2X 1GSKA 5I5MA 2VM4A 4DP7X 5TK2A 3U25A 2P80A 3AG2B 1KGYE 2BWIA 1AANA 2YAFA 3SQRA 4P5SA 3X1BA 5I26A 2BHFA 2CUAA 3EF4A 4JKNA 3QJTB 1IBZA 2YAEA 3NT0A 4F2FA 2XV2A 2FJSA 1B3IA 3ASNB 2E86A 3KW8A 2UX6A 4A66A 1N70A 1CYXA 2IDQA 2PP7A 5IY5B 2GBAA 1NIEA 1WA1X 4FAAB 2FT7A 4JHUA 4DP9X 1OCOB 3AG4B 4DPBX 1SDDA 5B1BB 3TBBA 5I6NA 2FTAA 2XYBA 3IEAA 1ET7A 3TASA 1PZCA 3WKPA 1ILUA 1AS8A 1ASQA 2FNWA 4PAZA 1TEGA 5PCYA 2HLEB 2QDWA 4BK5C 1SF3A 1E5ZA 2YAOA 1CURA 2BW4A 4DP6X 1OE1A 1KDIA 1BEXA 2PPFA 2DWSA 1M9WA 3QQXA 2YAMA 4UANA 4G72B 3G5WA 1ZDSA 2N0MA 4HCFA 2OJ1A 3L45A 3NP3A 2X87A 4DP8X 1ZIBA 3WIAA
chains in the Genus database with same CATH superfamily
3WEOA 5IUCA 2XX0A 1O9ZA 2O93L 3QAZC 4P2OC 1F6AB 4M7LT 5AG9A 4NQSA 5JW3L 4F2MA 2DY2A 5GZND 1RZJH 4CMHB 1Q1JH 5EF2A 3VDCA 2P5EB 3BPNB 2C9RA 3PWLA 1N2RB 3OKNA 4RQQA 1A0QL 1H3UA 2IQAB 2MPAL 3CFCH 4XPTH 4DP4X 2BS71 3FFOA 5L4MA 5AYTA 1DLFH 1RZ8A 2Q10A 4YVNA 2WP3O 4HISA 4WCYL 1CXFA 1E4XI 3VXQA 4NCC1 2DJUA 1OSEA 1MCOL 1BX2B 2YA0A 3L4WA 2WM0A 4A7QA 4ABUA 2VZ1A 3WN5A 5ANMB 5KVMC 4AOFA 5HYJA 3HI6H 4JJ5B 4E36A 4IS6A 1KBBA 3FOMA 5C0BD 1ZE3H 3UO1H 2BOLA 2Y07L 1BPVA 1GPOL 2Q1EA 4L3FA 4DPCX 3V4VL 4PV8B 4LCVA 4ZODA 3TH2T 1PG7X 4PJEE 4DN3L 4ETQB 2MTAA 3DKHA 3DX6B 3ZL2A 4PS3A 2YXVA 1TMQA 3GIZL 4RGND 2JCCE 1DVZA 1ZT4B 2AJSL 4XPBL 4YVUA 3L4XA 2CKBB 1Z3GH 1KN2L 1ZHBA 3ES6A 4HUVB 2JV6A 1FG2B 1I3RB 2E7BA 4UTAH 1NICA 2DWYA 2OMTA 4QLRA 3MJ8B 2UXTA 3V5KA 1FL6A 3UBHA 4MA3A 4W6YB 4GQRA 4X4YB 3PABB 1LO0H 4AYBA 3FFDA 1BFSA 4XNUH 1L6ZA 4C4UA 2Y7QA 1T04B 5K9OA 4RAUA 3MRMB 3PPEA 3VCLA 2YA2A 4UNTA 1MWAB 5FXCH 2ODHA 4NKDB 4ANKA 4PY8J 1ZLSL 5C0AB 3OMZA 4MNGE 2XQBL 4L9DA 1VGEH 1H15A 2R56L 5MI0B 4E41B 4BZ2L 5HPMB 5IGXH 3CH8A 3QEQB 3RUGA 5K33A 1E9OB 2TSAA 3B6SA 4C56D 4NYLA 3MNZA 4YDIH 1N19A 1FIEA 1VFAA 1ZLUK 2D7MA 2X4PB 3RNQB 2ZXQA 1Q9LA 4P2QE 3VXUE 3W9DB 3FL7A 3LSOA 3TC9A 5SV4A 4EI5C 4FQCH 1FNEB 2APVA 5EPMB 3FTYA 3I9AA 5C08A 3OG6B 4PRHE 5HGAA 4HVBA 4PLJD 4YNYA 4OAWA 4XWOD 2HJLA 4ZX6A 1FNFA 4PJ8D 1U9KA 2EUXA 3RQ3A 4P2AA 1KB5H 3DETC 2NXYD 2Z0BA 3FRPA 5F3HA 3T77B 1BA9A 2QL1A 3SE4A 2VO8A 3GJFH 1BFVH 2NW2B 3OJDA 4LDCA 1JGDA 4OLXH 1ZLWK 4KROD 5CBEA 3QDJE 3RIKA 1QTPA 4M61A 1LGVA 1E7VA 5DQDH 4HLEA 3F2LA 1PY4A 4JZJA 4XAWH 2WQSA 1MFCL 5IQMA 2ATPB 1FLRL 5AYUL 2MCPL 4Y2NA 2EIJB 4JK0D 2YAPA 1XMEB 4UNUA 3T6ZA 1COBA 2JI2A 2IGTA 1UD6A 1V27A 1Z0MA 3H0TB 3RDTA 4Y1AB 3G6JB 4UINH 3O2WL 2DH2A 1DR9A 2XCMC 2IWFA 3NMEA 3SDAA 3APDA 4U0QB 3MRFA 4JX0A 4QRPB 2IPUG 1J5IA 3C5XA 3HCVB 3LRSA 3ELQA 1GGCL 1MCWW 1TU2A 3P3SA 4B97A 2YK1L 3VNYA 3HAEH 4BWWA 3ZKNC 2R15A 1I8MA 2DL2A 1FNGB 1IAKA 3FO0H 4J3OC 1ND0B 4MQXD 3MGOB 1X7SA 4PMFA 5T5NG 3ETBF 5C8JB 2X2IA 1MF2L 4JN2B 3N1QC 1A1OB 3GSQB 1UM4L 4UOQA 3ZUCA 1HILB 2BNQB 5TPWL 2QSVA 1T2QH 1WITA 3FH8A 4X5RA 3REWA 3GMRA 4JG1H 4OV6F 1E3XA 2KI6A 2C9XA 3WFEH 4OLUL 4BXVA 3QEUA 3MV9E 3V7AE 3L1GA 3RY6A 2VLKA 3RWHB 5LB1A 3II2A 3ZDYB 1N5AB 4U1LA 1UYWL 1FCCA 3P30L 3S8FB 5FLVA 3MRLB 2JLPA 2EYTA 3D0LA 1XBRA 3WLWD 2WKOF 5JYLA 1TZHA 2Z1KA 3WJLA 5BS0E 3X12B 1BF2A 2DB8A 2VKWA 3G08A 3O3DA 5GSVA 4XE5B 5FEBA 4MA1B 5GS2D 1EBAA 4M02A 2AXWA 2R2HB 3U9PL 3QUXD 4KHXL 5CGYD 4K5NA 3OLIA 1P53A 3DVNB 2WYZA 4JKLA 4XBPB 2E6JA 4NC2B 3SKOB 4PJGF 2W80C 2VLME 3O4LE 1RIHL 3CZJA 4LLYB 1PD6A 5C6PB 4KQ0A 4F57L 4X6BB 5HGHA 3WOVA 5KBPA 4FS0A 3UPCA 2Z7ZA 4AMKL 2IPKA 4YUEH 4K94H 1EHNA 4M8QB 3RFRA 4BFOA 1WG3A 1DSFH 2JELH 2VMCA 3IGFA 4KMQA 2VQ1A 1TNNA 1CXEA 4YSAA 2WLNA 1A47A 1SXZA 4M7JH 1I1YA 3ZYZA 5D7JB 1S7XA 1RJYA 1UOWA 2R9HC 4G9FB 4HIHA 3RIFF 3UAJA 2VQTA 4DQOL 3PL6D 1DJXA 2QADB 1TF4A 3NFPA 1T7WA 4FXKC 4TVPE 4X5XA 2X6AA 3DPDA 3BZ4A 1E27A 3QXAB 3QJXA 4JRXE 3JT2A 2WXMA 3EBGA 5I28A 2WW8A 3P77B 4MHHG 2JKWA 1I85A 4MDJB 4F7PB 5CKAA 5EF1A 3T09A 3D69A 3AT0A 3OB8A 3RTQC 3INUH 1H3VA 1FO0H 3FDWA 3BDYH 3NJVA 1ZEAH 4AM0A 3F58H 1XGRB 4PJAA 1U8PB 1WUZA 2ERJC 1A3RL 4KGLA 2IQ9L 2P8PA 4LSDA 5IB4B 2WGXA 2AV7A 4IRZL 4XMVA 5H94B 3BGMA 2ZTBA 4IDJL 3FSZA 1LLAA 1P5UC 5E70A 1NGXA 3DO7A 1WDAA 3V79C 1Q72H 2QQLL 3FOLB 3NSDA 3UTSD 4F37F 5DS8B 3D48R 1XGQB 4R97B 4MLIA 2F58L 1JNLH 1UT2A 1E28B 4Y7MA 1G9MC 4QO1A 4QRTA 3HHMA 3LN4B 1AD9A 4TVPL 1X4YA 5IQNA 3TXAA 3WD5H 1A4AA 2UWEE 5D1XB 3WNOA 4B6ZA 1CBVH 1H0DB 3PREA 1J05A 2WHVA 35C8H 3FONA 1J5OL 5KTEH 4M7LL 2DMBA 2NXZC 1MDAA 3QI9B 2J20A 2X4OA 2CLRA 4JY5H 5GGTL 5EF0A 1DVFA 1SJHA 4Y5XA 1J10A 2NTSP 3TIDB 5DRWA 3BH8B 4U05A 3WNNA 2DAVA 1JXDA 3LRGA 4YDKL 4ZPTA 3I3BA 3RA7L 4UMGA 5D7LE 3T0AA 1BQUA 3FSOA 3KXFB 4Z3HA 5IT2H 3UJIL 5FB8B 3P11L 4L8SB 4BV1A 2AJZB 1QLEH 3VRJA 9CGTA 1GGBL 2WTRA 3OAZH 4YK4B 5I71C 1EEUA 1CZ8L 1IEAB 3OJMB 1JCVA 3GHEH 4RFNB 2P5WE 3L7FA 4XVTH 4KKBD 2A4EA 3R8BB 1D5MB 1YY9D 4IJ3C 5ADOL 4LEEA 4XP5L 3EJPA 4Z95H 1UD8A 4PWGA 3VFSB 1PQZA 4ALAH 3HPJA 4PJFF 2LVCA 1E42A 1I31A 3WXVH 4JM2A 4CSSA 3QDAA 4LLMA 3QNZB 3QWOA 4DPAX 5DUML 2X9YA 5JMOC 4OD1H 4JCMA 4PRNA 5E94B 2VR5A 2NZ1A 2PPDA 1R4XA 4NGHH 3FB6B 5E6YA 5FDWA 5BXFB 3MTXA 1INQB 4X4XA 5IW1B 1UWYA 3TA3B 4UM9B 4UOZA 3GSVB 5DJ0A 3MREA 2EKJA 4G8GD 3WEMA 2HPTA 2P45B 3QFJA 3ZE2E 4RAVB 1ZHNA 3RVUC 5F70A 2HJFB 3ARWA 1U8IA 2GC7C 5AB0A 4TQPA 1LILA 1XGTB 5EOCJ 1AGBA 1X9QA 2PWGA 1O9VA 3B9KD 4TTGA 2YARA 5MENA 1OK0A 1MW2A 1H6TA 1SYSB 4AEIL 2EUZA 5D7KE 1G9ML 2D3VA 5KSAD 4ZG1A 1TETL 3DC0A 3L9RA 5EEVA 4JFQA 1R3KB 4M1CD 1YEWA 5EZLA 3CQQA 4NM8H 4OD3H 2VISA 5T5FH 1NA8A 1DL7L 3LHAA 5F9WC 2GJZB 1GYWA 1YO4A 2AFNA 1U3YA 4YLQT 2EDBA 3MRIA 3BUBA 4LSVH 5DJ6A 3PP4L 4QTHB 1NBQA 2GIMA 5MEPB 1NGQH 2RBLA 2XWBB 3IFOA 3N43B 4LKXA 3UH8A 2X6VA 3A5VA 5FA3A 5AW8B 1F8TH 4Z7UF 3UADA 1ZJAA 2ZOLB 5A3IC 4HEPG 3L1FA 2VN5A 5DRZA 4ZFGH 3MRHB 4AYMC 2YN3A 2X2HA 4NC0B 1XBDA 2VDKB 2JJUA 2ZE0A 3HRZA 3CMGA 1ZGLA 1CL7H 5KVDL 5BV7L 1TJMA 3TN0B 4Z0XB 4P5SA 4JRYB 2V5YA 2YD2A 5CKGA 1J48A 4EDWL 2DQTH 2YMOA 2YAEA 4HWEH 2OCFD 3ETBJ 4YDVB 3GUFA 4HJ0C 5G2NA 4UV7L 2EEBA 2R2EB 3QS3A 4LLVA 4OKVB 1ADQA 4MNHA 3ARGD 4P23D 2GCYB 4JB9L 2DBLL 5F89B 5IJVA 3HC2A 1QMUA 5D55A 4AM0Q 1AGDA 4G1MB 3OXSA 4WV1A 5IBLC 1YQVL 3TIEA 1UM6L 2FEDC 3T2NH 4UTBA 1WQVT 1XD1A 4X8XA 2J8UB 3NZ8B 3QZMA 1J1XL 2F54D 2MOQA 2PWFA 4HKZB 2FNWA 4HUUB 4ZI8A 2DTMH 5PCYA 3ZZQA 1HZLA 1PIGA 4Y2DB 4EE2A 1EXGA 4HG4J 4FLHA 5A43C 3CNKA 1JRHL 4K3DH 2C7FA 4ZSOB 1OSZA 3AMLA 4HCFA 3IFLL 1Z5YD 5E9DE 3R1GL 3RWGB 1P4LB 1YECH 4L9LB 3EH1A 2ESVD 3QWNA 4DP8X 4O58H 3W38A 4CNIA 2R69L 2YRPA 5C3IA 1EHAA 1U58B 2BP8B 4TYUA 1IBDA 4DKEH 1AOZA 1GYCA 4GG6E 1CE6B 3ZW3A 4UUJA 2GSGA 3LPFA 4PMEA 4OY9A 3AU1A 3ZZLA 3BEWA 1NGPH 4IMLA 4QOKD 1A5FH 3Q9QA 4NJ9L 1KLUA 2EEXA 4DFHA 2V7HB 5AKTA 3KBFA 1N5YL 1VFBB 3RBSA 4IYKA 1E5CA 3OB0K 4AQ8A 4WW2C 3O2DH 3TA4D 3LKSA 3MA9H 4D3CH 3T0EA 3MLRH 3ESUF 3V0VA 4EIZC 4DEPC 4KTDL 4YXHL 1A4JA 3SY6A 4NKMA 1MRFL 1S46A 5AYQA 1P6WA 4OTXH 1KUMA 2A9ML 3NFSH 3PHQB 5CEYA 4YQXH 2V2TB 5DK3A 4N2DA 1ZWIB 5I6KA 3AAZA 1N8ZB 3ECQA 1MCPH 1KN4H 1OCWL 1RXLA 2DLFH 4N1EA 2AGJL 2NY0C 4NO2B 3WIHH 1I1RA 1OAZH 1ODUA 2KKQA 4PRAB 4MZRA 4RZCB 4D9LH 3KPQA 3EADA 4QD2E 2BOBA 4XVUC 3SBQA 2X9ZA 1AD0B 5IBTH 2FR4A 1DBJL 1GXEA 1WISA 4FI6A 4H88L 4OCSH 1OD9A 1TMCB 4DO4A 3HE7B 2WYTA 2DQDH 1NGYB 4XPFL 3QW9A 1ACYH 2Q7YA 1QRKA 4LDOB 1SDYA 1PSKH 1YN7A 3CUPB 4LNRA 2EDHA 4HAGA 4G3YL 3MRNA 3OG4B 4GSUA 5I0VA 2B1HL 1A7QH 3CBJB 3T8MA 3UC0L 4QKXB 3B56A 3K6DA 3SJVB 5FOBB 1OOWA 1DUZB 5HYQA 1V05A 2XXFA 1TVHA 3FT1A 3DUSA 4Z76B 3U0WH 3L3DB 1FL3B 4HUMB 4I3RL 5EZPA 2X53A 2CHXA 1CF8L 4MXWH 2R7EB 5E03A 4ZFFB 2ADIB 3SPHA 5D2NA 2A83A 3GS4A 4I85A 1H8SA 3M1CA 4ORGB 4LGRB 5F1SA 5K9KB 1UWEL 3ARBD 4JFXB 4I1RA 1CN4A 4HPYH 1RZFL 1MG3C 2X2YA 3MKKA 4PBDA 4MD5B 3G3LA 1AGFB 4LMQI 3JV6A 3K6SA 4TM9A 4BD4A 1UATA 3MCYA 2F74B 2J4WL 4BA8A 4ENZA 3TL5A 1RHHB 2VDPH 4YSDA 4E41E 3LZFH 1KTDA 1NFDA 4PP1D 3MUJA 2GT9A 3Q3GA 4HZAA 1ZKAA 1SXSA 4UI2A 4Y4KB 2NQ3A 4LCYB 3GK8L 1BWWA 1HCVA 1HWWA 2AVFA 2EDFA 2VLRB 4OLZH 1M7DB 3E9UA 3VG0L 4J3SA 1L4IA 5FOJA 2LFGA 3VWJD 4EZJA 5BRZE 3QULA 4YL9A 1FFOB 1MZZA 1FZKB 5BMFH 3Q13A 1QSEE 4CKVX 1FH2A 1TJGL 5DZPA 1MW3A 2XU9A 4NZRL 3FPYA 1R9FA 5KBLA 5H37A 5D6CA 1LE5A 2R0KH 4BINA 1YMMB 2RIKA 3VD1A 2ZXCA 4B96A 3ZTEA 1SM3H 1Q1PA 1F4HA 4P99A 3A4FA 3RWDA 4AH2B 3FSVA 1UWXK 1DQKA 4NQEA 3SY0A 2BZCA 4W4NA 1H9DA 1QNZH 1H3WM 4QXGH 2QGCA 4YHKH 1IAOA 3W82A 4XODA 4FKHA 1SEBB 4NQSB 3HG0A 3ZSSA 3T71A 3EHBD 1NJ9A 1SN0A 2XTSA 4CGUB 4IGBA 3VGHA 1A6UL 3P1VA 3PWLB 4HHAB 4Y1AE 4E68A 4ZFOL 4RQQB 2OZ4A 4A7UA 1QI4A 3V6OE 3U7YH 4XMWA 4N5ED 1MVFA 2N01B 3UTTE 2BS9A 1KCSH 4GQ9H 1RZ7H 4TTDC 1RZ8B 5EU4A 3RVVD 4CSPA 1NBVL 1QYGL 3LKPA 3RJOA 3X14B 4FOMA 2WVSA 1PD0A 3BUIA 4YHZL 1L5GA 2GI0A 4FRWA 1BMZA 3S5LG 3S36H 5AAWA 3O11B 4I5BB 3MVSA 2PWEA 2I7SA 5HYJB 1E6JH 1JPGB 2ZYIA 1OP5K 3CBKB 3HZKA 4IS6B 4JS7A 2HB0A 4XH2A 3ZKXC 3LNFA 1KDJA 4HP5A 2SEBA 4XNYH 2IGLA 5AB1A 2OXGA 3F64A 2ZWKA 4N8PA 4WGKA 3SOBL 5FUOH 4M3HA 5KBNC 1A21A 1UZ8A 4P2CG 2BNQE 2CBTA 2HN7B 4PRPD 3MRPB 3A6OA 1ZHKB 2PO6C 2XLLA 4Z3JA 3D07A 2HRHA 5EORH 3CSYB 1TZIA 3AQXA 1ZHBB 2ZZUT 1WFJA 2XN1A 4F91B 2CK0H 2KDYA 2OM5A 2XN9A 3W0WE 2OMTB 3V5KB 3IM1A 1FL6B 1PZBA 5J4MA 4XP6L 1U3HA 2BSEA 5EN3A 3CFIC 3SKNA 3UG5A 4FFZL 5BQDA 1IM9D 3H2PA 2Y6SD 4ICWA 4NSKB 2X3BA 3VXMB 1RP8A 3IYLW 2Y7QB 4MZIA 5K9OB 4RAUB 1FNSL 4FC3E 5EOCH 4Z0BL 2PCFA 3QP3A 3KPRA 4BHUI 4JFDD 4XZUA 3CN0A 1OSYA 3DHPA 3IDXL 4PUBL 2YQGA 4NZUH 4LE8A 4ANWA 3O6ML 1FGNH 4LFHG 3RB7A 5LXGH 4RMBA 4DW2L 3FZUD 1KIQB 1FAIH 4IJTA 3RUGB 3NTCH 4J6IA 3B6SB 1U0QA 2GFBB 4YHMH 4NYLB 3MNZB 5CUSH 3U7WH 4AL8C 1VFAB 4M4RA 3TO4B 3OAUL 5C0GA 3S5ZA 5AB9A 1ILSA 3ABZA 3LSOB 3U7AA 4J8RB 4G9FE 1IAIM 3FUIA 3SD2A 3BP5A 4MJID 5HGAB 4YNYB 1NCWH 4OAWB 4XRCA 1Z5LA 2J1WA 4DVBB 4QRAA 4L1LA 5EO9B 3C09C 3O3AA 5EH1A 5F3HB 1EDQA 4LSTH 2UZIL 2O6DA 3OJDB 5C0IA 5B8CA 2LE9A 5IKCA 3BDBA 3RZCC 5CBEB 4M61B 4JRLA 3WS6A 1HHJA 4JZJB 3IDUA 4HUWA 3QCVL 3O6LH 1XDTT 2ICCA 1MRDL 4JE4B 3PHSA 5I30L 4JY6B 1M56B 4GUQA 4KHTH 5SWZA 3MV7A 4UAHA 3SO3C 4GI8A 4LVOC 1EHXA 3RDTB 1WE5A 1R0AL 2MKWA 1E5YA 3CZSA 4L4TA 4JPWL 3HE6B 3RVWC 3DSFL 4AUJA 5FDYA 4M48L 4A6YA 2WUCH 3GSNL 3LRSB 4DGYL 1RCYA 1TU2B 1AR1C 4QTIL 4XB8A 4UF7C 4HEMA 1B2YA 1CFNA 2E5EA 1I8MB 1IAKB 2VE6A 4XBGA 4AXWB 1HINL 2MNWA 3HZMA 2QLVB 3ZO0A 2BVEA 4JFZL 5E4AA 3V55A 4HQQH 4WI4A 4G7YH 4NC1E 4N22A 4R0LA 3MODH 3LEXA 2P8LB 1VFOA 5TD4A 5D2LA 2F5BL 2OSLB 4BBWA 2QSQA 3GHBL 1KGWA 3LZPA 3GMRB 1XMWA 3I6KA 3ZRSA 4DESA 1M2VA 4GI6A 5JNYB 2FT6A 1VEOA 3PWJA 4JM4H 3WMPA 1CICC 3WFCH 3TT3H 2YRBA 1X9UA 2VLKB 3ABKB 1UA7A 1L0QA 4KKAC 3RILA 4L1BA 4AL8L 5KSUB 1EFQA 4I7ZC 2OS7A 5BO0D 3FFCB 1BFTA 1Q9KB 2EDEA 3D4GA 1BM3H 2EYTB 3D0LB 4ZTPL 1T7VA 4HPOL 4X7SH 1TZHB 1F90L 2P3YA 2X12A 3G08B 3O3DB 5GSVB 5GGSY 3FQ2A 3PFQA 4MAYD 4UNIA 5IG7A 1EWHA 3QWRD 4MFHA 4AG4H 1U8NA 3CCHB 2KERA 1FWXA 5C0BA 4UQDA 3D51A 3A6BL 3B2UD 1BYPA 1V5JA 4HXAH 4PW4A 1MCDA 4OCYH 5JOFB 3BRGC 4UOJA 2GC4C 4PFEA 2W65A 4GEJA 4GY4A 4AV4A 4O9HH 4ZUSA 1TTBA 4PLKC 5J12B 3BSZL 3C5ZC 4BXSV 1SZNA 3AJ7A 2E7CA 3G6DL 1KB5A 5DHVB 2DQUH 2VXTL 3NEOA 3QIBD 4CVUA 5E5MA 4LCCA 3H4HA 1UGKA 3GJFA 3B2XA 1I1YB 1ZTXL 3E1F1 2P52A 1RJYB 4XNQA 1WAAF 4O2FA 5DEGB 4ZZFA 4AJYV 4PGDA 1WH0A 1UVQB 4OZ4A 2BNRD 3NFPB 2YSSB 1H8OA 3N9GH 5FO7A 2CQVA 4P5TC 1JK9A 4A67A 1E27B 3KGTA 1UOVA 2CLZA 3QDHA 2YBRB 4K8RC 1MLCB 1E4JA 4KXZI 2X4NA 4JG0H 1D9KB 4A7SA 5LBSH 5C6TL 1BIIA 4X6CF 4Z7NE 1ACZA 3O8XD 3EGSA 4PJAB 5DF0A 3NT0A 4HD9A 4YE4L 4HETA 1P7HL 3CXHK 3EH2A 1REIA 1U8HA 2P8PB 2E86A 5D5MA 5D71L 4ANVA 2AV7B 3HAEA 3ULSB 3OAYK 4C56A 5KVGH 3BGFB 1UCBL 1C1EH 2FH8A 1OSPL 3L5WA 5FV1L 4X8CA 5AVXB 3VDBA 4HGWA 1NGXB 1OY3B 4JRYE 3DO7B 3N85L 4DP9X 2FBRA 3VFGL 3TZVC 1HVXA 4QRTB 3QHZH 3T4YA 4AQ1B 5JZ7D 5DD6A 4HDIB 3P9WB 2QLYA 1ASQA 4PJ8A 5C97A 3PWPD 4PD4K 2E4TA 3VACA 1J05B 4PJ5B 2MTPA 4KI5C 1BBJA 1DQIA 3FONB 4KFMA 3GS7A 5LGYA 4FI7A 2PYEB 4WUUD 3QH3A 4NUGL 3BSHA 2CH8A 1TNMA 2DWSA 4FCAA 5SWSD 3HHSB 3LQZA 4Q58C 1AFVL 2GTWB 1T0OA 1DVFB 2Z64C 3MCLL 1J0KA 4F5CE 1W0VB 2CHNA 3BP7B 5CJBA 5DRWB 5I6LA 2A74A 2NY6C 3JSSA 1XB6A 1DBBH 4KK6D 4F9LA 3UO8B 3V0IA 1JPTH 3C60D 3MUHL 4HJTA 4J4PC 1S5HA 3MJ9L 4JREB 3Q8EA 5AAMC 4XMKH 4NP9A 2OL3L 1IV8A 1S8DB 4BK5A 4KXZH 2CR3A 5CEZE 1S7UA 4CL7A 1B4JL 1D3CA 3DO3A 1MHEA 2YGOA 3ABMB 5CZKA 5I6XB 1RK1A 5E95B 5E9NA 4LSUL 3FT0A 1E8ZA 5FYJD 1LHZA 1KBKA 1G5AA 3ZL4H 3MRDA 7PAZA 4WFFE 4HCGA 2V9RA 5BVPL 4QYOA 4JM2B 1VKXA 2VSMB 5DU7A 3QGVA 2H3XC 4K8RL 4ONHA 5AVRB 2DMGA 1TQBC 3NJGA 4KI5E 1F4XL 5HI4D 3BN3B 4PRNB 3H9YA 3J2PA 2HKFL 4BFGA 4S0SD 4JFFB 5FDWB 2BIMA 1LK3H 3L3OC 5CJ8A 2APWA 3DTDA 3QIUB 3IMTA 4TRPH 4YHIA 2FX8L 4J7RA 5DJ0B 2HFTA 2VDLB 1U8CA 3MREB 1EXUA 1JMZA 2ITFA 4TVUA 1EX0A 3QFJB 3ZDXB 5JIHA 5CEZL 1ZHNB 3ATFA 5AZ2L 3FO9A 3D39B 4LSRH 5DQJA 5DR5H 3BHBA 2XX1A 2C9SA 4J1UA 5D4IA 2AJYL 2W81C 3VFTA 3BAJA 4XMZA 1AGBB 4F8QA 4F7MA 2NY2C 2UWEF 3UXFA 4N0FA 4RSYA 2Q0ZX 5MENB 2OJZH 1B6DA 4JO1L 4N0YL 5HTSA 1C5BH 1J8HA 3L95B 5F96L 4BYHA 1SYVA 3DV6B 1DQML 3QT2A 3U0PA 1P7BA 3LKRA 3QUXA 2N0KA 2OTUA 4OFYA 5BOPA 5EZLB 5K9JH 1ECYA 3HZVA 1F86A 4GMSL 4W9CC 1NH6A 1LO4L 1U36A 1T1WA 3MRBA 4PYGA 5CILH 5DJ6B 1MUJA 5E99L 4DEUA 3OV6A 5KUKA 4OZGA 2WC7A 5E8NA 1R5VA 3BVDB 5CLXA 4LKXB 3IFOB 4NFCA 5AG8A 2ICEB 2JB5L 3GWJA 4ZO9A 3OLEA 3QPQD 2ZUSA 1M4KA 1KJVA 1ZA6A 2CE6A 4L2YA 1CYWA 3VFWB 3MLYH 3QNYA 2V2XA 3KGUA 1IO4C 1KB9J 4N5UA 5DRZB 5CXPA 1NIFA 3OJVC 1IEHA 5F3BA 4BFRA 4FXGC 4JO3H 1JPST 1ZGLB 5C2BH 5L6YL 2XV0A 1U2HA 2I07A 4FJYA 4KJPC 4WO4B 4FABH 1ZVNA 1G1KA 2F7IA 5ITBL 3OXRA 3O0RL 3PL6A 3B8SA 4ZXBB 4QCIA 2GSMB 2A9DA 4L0YA 4LFHD 1FSKB 2DJSA 25C8H 3R19A 4FZ8H 2AQSA 4MNHB 3TYGH 1GY2A 5IJVB 4X83A 2JNZA 4ZPVB 3SE3A 3Q1SH 1PLCA 3C5JA 3DYPA 4WV1B 4N8VA 3TIEB 3V0GA 1U42A 4NBXB 2V5RA 4KJWC 2PCYA 5AOKA 5AALA 3IAGC 3FU3A 3CU7A 2IAMD 1KFAH 1L0PA 1SBSL 1OTUD 2ZG1A 4A68A 3WE1A 1JP5A 3MNVA 4EN3C 2D3JA 2K1MA 5KJRL 5AZUA 3OGCB 5FF6A 2I60L 1VB9A 4LVEA 5CP7A 2J72A 5EEZA 1HYRC 5DDHA 4E9SA 2XA3A 1OSZB 4HIJB 4KK8C 3UTSA 1IAIL 3PQYE 5EBLA 2Y3AA 5EUOE 3K8LA 4FHKA 3G5XA 5EZIL 1N6VA 4CNIB 4D0CA 3WN5C 1R46A 1W72B 4G6KL 1IT9H 3WS3A 4UUJB 2GSGB 4I13B 4JY4A 2IG2H 3U36A 2CDGA 5FGCB 2IH9A 5E1AA 4BJLA 3A47A 5ACZA 3CHQA 5KANI 1P7QD 5EOTB 1BXUA 2WIIA 4JFTA 2FWLB 4Z7OF 2RQ8A 4NAMA 4F2ME 4KXDA 3BT0A 3TFKD 3DOHA 3UCRA 2BIOA 2GJJA 3CLWA 4UV4H 1RD6A 3T0EB 1A6WL 4RWYH 1S5IH 4PVMA 3TT1L 4EXPX 1S7WA 5E2UL 5BV7B 1HHGA 1TDQA 3BT2L 1A4JB 5TH2B 4M7KL 2X44D 4DKAA 3X3GL 3CZGA 2KLRA 5E00B 5T5FA 4LPWA 2RJMA 4I77H 4IJ3B 4PTUA 1BYNA 4JO2H 5T8IA 5IVXB 1QAWA 3KLHC 1B3JA 2DIJA 3KPQB 3BZEA 2BMKA 2HUEA 3G5ZB 2FR4B 3WHXB 1KJ3H 3HG4A 1U8OB 5CCGE 5HYJE 1T7ZA 4PJ7A 3S34L 4NKQB 2QR0A 2JK5A 3C08L 3MN8A 3BN9C 4M6NH 1OALA 4JR9L 4YWGL 3PNWB 4MQSB 4NKOB 3WTSA 3ESVF 3LN5A 5C0CA 3QXWA 4ODVL 1NANH 1YN7B 4ZQKA 1EGJH 4M6OH 1INDL 1L9PA 3HMXL 4G8GA 3I9PA 1SGKA 2EVIA 1FLTX 4HA1A 4H26B 1YRKA 2YSTA 4ONFL 1JBJA 2WWKO 2JI1A 5SX5H 3GXTA 4XMLL 3ZBMA 1YEJL 5L8KB 3B9KA 4H0GA 1VSCA 2XXGA 3FMGH 3TCTA 1FYTA 2IWGA 5KSAA 1W6LA 3IMVA 5E6ID 2Y72A 3NSCA 3FQNB 3ASOB 2YUZA 2X4RB 3SE4C 1HJCA 4HJIA 3UERA 2LU7A 3VJ6A 1B4LA 1C12B 3MO1A 3BZ5A 3TPKA 3CFJA 5DEFA 1N64L 1SUJA 2DH3A 4X9IA 3HN8A 2DI7A 4KUZL 2Y06L 1N0XH 5DYOA 2DPKA 3KPTA 5ID0A 1LMIA 2NY7H 4OKDA 1ETB1 1KTDB 1NFDB 3Q3GB 1JZDC 1F3DJ 1D5BB 1IM3D 2AVGA 2LU3A 3RUGE 2ZX6A 4BQ9A 5KZCB 3GSOA 1FA4A 2J3SA 3SDYH 5CBAB 2QZ5A 1DN0A 5J1AA 2AC0A 3FQ1A 3SDAC 4B9GA 1KCKA 5AKVA 2H9GB 3QULB 1EQWA 4Y5VB 4XVJH 3TBWA 4KXAA 2ALWA 3QJSB 5C08E 3ZIMA 1BREA 2EP6A 4DGVL 3R8QA 6PCYA 1HKLL 2XQYK 2DMCA 4QF1A 32C2A 3PWUA 3ARGA 5ALBH 4KJYA 3BUTA 3U6XA 3HOGA 5D6CB 1D6EA 1QPXA 2UZYB 3DRTA 2PNDA 4G2AA 3PGFL 1MY7A 2WUBL 1YC8A 3VMOA 3RPBA 3X1FA 5T1LD 4NQEB 3WY1A 2XWRA 3SY0B 2F54A 4EF3A 3WE6B 2A9AA 2VDMB 2W0FA 4G5AA 2UXVA 2E59A 4F8PA 5KVEE 1OAUH 3QB7C 1DJIA 3DO4A 2HTKD 1CGSL 1NJ9B 2ALAA 1FNLA 1YG9A 1TCMA 3SPVA 3L2MA 4UILH 1G6RL 5LXVA 4Q97A 3STLA 4OCNC 3WJLC 3B4NA 3CXFA 2ESVA 2HWZL 1I9EA 4W81A 5D8JL 3LH2L 1V7NL 1MJUL 4B9CA 1CU4L 1OE2A 1L5GB 1WIPA 2NYKA 4IRJD 1HDMA 5J6SA 2JJTA 3EYVB 4OF0A 4QOKA 1UC6A 5EN2A 5IK3A 3TF4A 1EXHA 3HZKB 4FEMA 4I0PD 1T5KA 1U8MB 1A8JH 1YNKH 4PB0L 1JWUA 4XH2B 4AX3A 3GO1L 2OXGB 2FECI 2YC1A 4FLSA 2OK0H 2DQMA 2H3NA 4CJ0A 2R0WH 2BRRH 5D7SL 4FQLH 3UZEC 3D2UD 5HI5C 5GS0C 4I4WB 2E27L 4ONGH 2VLKE 3TV8A 3JWOC 3QJOA 4N0CD 1TZIB 4P3DA 3LAFA 1SUHA 4DK6A 1IJNA 1NPUA 1AP2A 5CS7A 4XMPH 4Y1TA 1H6EA 2RMNA 3DARA 2JJSA 2WZ6A 4HOMA 2EIKB 1DQDH 1U3HB 2J25A 4Y19D 1DJWA 1OB1A 2DICA 1HX0A 2BHUA 4K9EH 5E5LA 5DWPA 5DSCA 4EJ1C 4RBPK 4Z3GA 4P3WA 5T1KD 4OZHF 4R4NC 2VWEC 4GMTL 1ET5A 1CXKA 1KXVC 3L3JA 1CWVA 2CJUL 2QFRA 3NDZE 4LBAA 4XZUB 3NJFA 3MJ6A 4I1NB 3GZKA 4Z3EA 4XNDA 5KSBA 4JCLA 4GAJH 2OR7A 4M5SA 3CN2A 1JPSL 1UA6L 5GGVY 3SGEH 3RGVD 4KJQC 4GBXA 1MJJB 3G6JF 1ZRUA 1OTTD 1WAPA 2Z8RA 2JVUA 5CZRA 4ABWA 3IJYB 4OJFL 5L2JA 1F1AA 3S35X 1G87A 4KKCC 4XWGL 5C0NC 3OR7A 4KY1L 5I1HL 4WEUD 3IDNB 1RU9L 1TTRA 2XWJB 1Z9PA 4FQ2H 3BP5B 2D7PA 1BLNB 1Z5LB 2R4SL 4F2FA 4LU5L 2NQCA 5DVNA 5GJSH 3U1SL 3ARBA 5EEUA 4PG2A 2P24A 1KLGA 3QRGL 4ZOCA 3O3AB 5DZOA 1CG9A 2OI9C 1QLRB 3H1ZA 1KYOJ 2VWEE 3HMWH 2KT6A 2WZPD 3TVMD 2CUIA 4Q7DA 5FKPB 5C0IB 3JVGA 3KWTA 4BZYA 4JPQA 4MKMA 4WW1A 3VI4B 1C16A 1DBKH 1RURL 4LSQH 4ODWB 2PW2A 5TDNB 4K3JH 3W39A 5TE7H 3P69A 3KPMB 1E3ZA 3VYOA 1OAXL 5GGUB 1PZCA 3LMJL 2LLGA 3ZU8A 3ZDYF 5JTWA 3P0GB 5GS0L 4HF5L 5SWZB 2BIQA 3VWJA 2VXQH 5DC0A 1E5ZA 1LDPH 4G42A 3FQUA 5CZVH 2ZT9C 3ZL1A 1DSWA 1N7MH 4L4TB 4G72B 4DZ8A 1XEUA 3GMLA 3OL2A 4PGEB 2WWOA 4A6YB 3TS8A 2A0LD 2CO1A 3ZHKA 3E3QC 5E0QA 1OGTB 3V4UH 1DVUA 3BKCL 2VAAB 4E9VA 4KKLC 4QMEA 1CFNB 3V9FA 3FUKA 4WTQA 4XBGB 3HZMB 3DIVA 2FLMA 1GGTA 1F6LL 3BO8B 2JKNA 2X6CA 3TESA 4R0LB 4RH4A 4HWBH 3U48A 5KYNA 1S4IA 2VITA 3NZHH 2AW2A 3QA3A 4ZD3L 3BWZA 4GXVL 3SGKA 4NJAH 4LIQE 3E6FA 5FYLL 3HS0C 4DUVA 1MFNA 1QBAA 4N6RB 3PWJB 4L1HA 4MYWB 1URLA 4YSSA 4J39A 1Z9LA 1OL0A 3E1ZA 1DEEA 1ZLVK 2Q9OA 3X17A 3MYJA 3WTVA 4PCTA 4WFEE 3R4RA 2ITEA 5BZZA 2ZCKL 1MFBL 2CBQA 4OJDH 2A6IA 4HULB 5IG7B 4M6AA 2E9WA 3E3QE 3IGAB 4GEIA 4O2EA 2QSTA 3O2VL 1A3LL 4GQQA 2YKLH 4WK4B 3FB5A 4F3FA 2FVNA 4B41A 3DI3B 4JQVA 1BQLL 2K7PA 1VENA 2O5ZH 3KM1A 5JPNA 4PRPA 1A64A 1RZPA 1N3NA 1S3RA 4LIQL 5EBMA 3RLSA 4BRVA 3CMOL 3SDXA 1JXJA 3HRZC 3F5WA 4X0KA 4C4KO 1J8RA 3DA0A 5EO1A 3QFJE 4N90E 3HC4H 3ZDXE 3PLYA 3MAWA 2ZAGA 2UXFA 2V3FA 5E5MB 3NCJH 5D72L 3EYUH 1VA9A 2Y5TA 1KULA 1ZS2A 4KX8A 2OMBA 5MENE 4O2FB 5D7IF 3EGXA 1UKQA 4PGDB 3PDOA 1IM9A 4L3EA 3DJRA 3BH9A 1QRND 5SX4I 1JK9B 3BP4B 2E0PA 4K71C 5HBBA 2CLZB 1IEBA 3AT9A 5DMIH 3EYOB 1IGYA 3IK2A 4IK7A 1GYAA 4JFDA 5F2FA 3ATBA 4BHUA 4QKTA 4ZW6A 1F58H 4JZOA 2ZF8A 4JO4L 2EUVA 3VG9C 1FCGA 3F7PC 3OGOE 1ZV5A 2C9VA 4FQXC 4XVSH 1TLKA 3IDYB 4PG9B 3ETTA 2GVYA 4TMPA 3UJTL 2WKOA 1U8HB 5A40E 4Y4FC 3HC3L 4BH8A 3VW3L 5D5MB 1CFTA 1OV8A 5EBWB 1B0IA 1T20B 4JN1H 4UZGA 1DVTA 5J6HA 4AYDC 3U6RB 4PJIB 1YEIL 3L5WB 2E8ZA 2ZG3A 4JZNA 4HGWB 2NQDA 2ZIDA 3QSKB 3KGRA 2QGDA 3QXTA 3ESNA 4MJIA 5EZOH 3KLDA 4PJGA 3WLBA 4GRWF 1U92A 3APFA 1HYSD 3T4YB 3B9EA 5DD6B 1KIPA 4N2GA 4IU3A 4LQFH 3MLZH 5IESH 4ETYA 1BEYH 2GKIA 4KRMB 2PTVA 2WLIB 2FWOA 3QH3B 2OR8A 3RZCB 3CLFH 4NNPL 4YHLL 1AE6L 3PG2A 3JUYA 4E5XG 3MKGA 2ZX5A 5CFAA 2YO3A 1T6WA 4MCZB 4RRPM 1CS6A 3Q8BA 2WKLA 3SDCC 1AXSB 5FO9A 4MA7H 1S5HB 1EO8L 2EECA 5EUKA 5AOIA 1MCCA 2ENYA 2Z35A 4FMFA 5I15L 2IH8A 2P9RA 2YD6A 4OZFG 1JGUH 4ZYKB 2OCCB 3DJ9A 1KTKE 1MHEB 4OT1H 2F8XC 1HIML 4OR1A 5IQ9B 5ALCL 3IF1A 4OSUH 1D7DA 2O61A 2RHEA 1E5UI 3KL3A 1X3DA 4IIQC 3NIGB 3MRDB 1J0JA 1D6VL 4MAUL 4GOSA 3VDAA 5B4MC 1VKXB 2XKNA 3MXVH 4GKZA 2PR4H 3D52A 3UTZA 2YPKA 3OSKA 1DBAH 4NN7B 4ONHB 2PPCA 1GC1C 1OCCB 1KJ2L 2VXSL 1NL0L 5FW8A 2ENJA 3M88A 3SKJL 1BVKA 5H35A 4NI6A 2E4FA 1FVCA 5CCKL 3GI9H 1PLGH 2N7BA 1NCIA 3WNKA 2HTLD 1L7IL 4A7VA 1GCFA 1NIAA 4U6YA 3P0VL 1PZUB 3KL5A 1EXUB 2V2WB 2ZONA 4P2RD 2CKNA 4DOHE 1V54B 1OIOA 2X7LA 2D03L 3BHBB 1AZCA 1KELH 1MHHA 2IGFL 2IPUK 5DUBB 4J1UB 1OM3L 2PYFB 1V8HA 5D2NC 3SZKC 3CVHH 2IH3A 2VC2B 3BLKA 4F7MB 2WPGA 4WEMB 5I1JH 5K69A 2OYPA 4N0FB 1BQSA 3B37A 3GSWA 1T22A 2B9AA 3JWNG 3LRLA 4MAYA 5DYFA 4JMXA 2AK4A 3CHXA 1SYVB 3QWRA 5D93C 1QATA 4UT9H 1ZOXA 3QUZC 3LKRB 3QUXB 1RUPL 2OTUB 1AQKL 4KZEL 3EJZD 3QDGE 5DMKB 5D1QA 1QO3A 3J27A 2J8UF 4OGQC 4LCIL 1WLHA 3LX9A 3MRBB 1SLWA 4XP4H 3QISA 1KGXA 5E8NB 2CHWA 4NXSA 5HYSG 1R5VB 4N8CL 3EYFA 1YJDH 5FM4A 3SE6A 3D1MC 1MPAH 1KCUH 1ZA6B 2B15A 2F1BA 2IALA 4G7VH 1WHOA 2BHYA 4AGOA 4MXVE 5B1KA 1RQ5A 4GLRI 4W6XB 4JJOA 5F3BB 4PJFA 3QIBA 4NOFA 2XA8H 1YUHA 1FN4A 4UNVA 2I07B 2GB2A 1R5WA 1V7ML 2VMDA 1BD2B 1YNLH 3OLDA 5A16A 1F3RB 3OXRB 4K7PH 2XHNA 5LNEA 2VL4A 1HHKA 5D2NE 5EU6E 2BNRA 3WUZA 1FZJA 3GQFA 3ZQXA 2HSIA 4S2SA 4RMQA 4LPUA 1PPIA 5LWYL 3FUHA 4R2GD 2FSDA 1WFNA 3GBNH 4WI7A 3LH9A 4EKJA 3RX7A 4IBWA 5B1JA 1LO2L 1QLEB 3DECA 1P4BL 1GC1L 4LCWD 4HU2A 1JNHA 1NMCB 3DVGB 3MLUL 3NSYA 2BVTA 5J9PB 1AMYA 2WINA 1IX2A 1N6QH 4GS7B 4GRLA 2ZSWA 1NFDE 5TDPA 3OKEA 1IFHH 3PIQA 3Q8CA 4IGBC 1TOXA 1MAML 3MNVB 5IOPA 1AS6A 3GM0A 3LYRA 1CPUA 5FF6B 5CP7B 1AKPA 1OTSC 2DWDA 2ZJSL 4L1TA 2X38A 4MS8D 1OOAA 4A2EA 3GMMA 1PIFA 3GPEA 3N1PC 5L0QC 1F45A 1UUSA 3G5XB 4NENB 5AAWC 6CGTA 3PWPA 2YZ8A 3H9SD 4XNAA 3FBQA 3S3PA 1RVFH 5SV3A 2BY1A 3MACH 4YDJA 4WUUA 4JY4B 4Z7UA 4JDTH 1F4WL 4KH2A 5HHXL 5SWSA 4P3CL 1MZYA 4X50A 3LN9A 1XB8A 5ACZB 4NQEE 5IOKA 1OQXA 1KBWA 3BXNB 1KCRL 3K6NA 3KR3H 4KOCA 2GUYA 1XGUB 4WI9A 1URIA 1C8QA 1KENH 2C8NA 2F61A 3C60A 2VDRB 4F8NA 4GW1A 1XF1A 1WZMA 4LHJB 4WJKB 3MROA 4MJ6B 1M1XA 1S7WB 3BKJH 4Q6YA 2CM6A 2GBUA 3NCBB 4NN6C 3QO1A 3S3DB 2FHBA 3K1KC 5I9QB 4IBLT 4DKFH 5JYMA 5IF0A 1JV5A 3IDIA 4JUTA 2CSPA 2OW6A 3LEYL 2AXFB 1QEWA 2J12B 4XCEB 5E2TL 2BMKB 2CPCA 4AUUA 3HNTH 3QDMB 3CLEL 3F7KA 2J88L 3OLGA 4PJ7B 2QR0B 3GINA 2JK5B 2OMNA 3NCXA 4TUKL 4XPGL 4TUUA 5BCAA 4LLQA 3NBNA 1E4WH 3VTAA 2G5BB 5F9JB 1DEDA 1FVEA 1WBYA 4HMCA 3DX1A 5H2BB 4ZQKB 1NPJA 1IKOP 3L1OH 4MMXA 2XG4A 4AC4A 1PLAA 4G8GB 5IVZA 3D7PA 4F33A 3QORD 2P49B 1AKJD 4YFDB 4F24A 4QRBA 3Q6GL 3IVKA 4YO0A 3D0AA 1TENA 2H45A 2BNUA 3ULUF 2XN9E 3QIWB 2WLYA 4A2LA 5F7UA 2X6MA 4FLOA 2EH8H 3CSFA 1XAKA 3B9KB 1G7IB 1S7TA 4PW3A 3C2SA 4GFXA 1N0LA 1RZJC 1RJLB 1IC7H 5C0AD 5KSAB 5LUMA 5B3SB 2DWXA 5E8PA 1MFDL 3BQUB 3I3EA 1OWWA 4OGYL 1NCUA 2N59A 4FDWA 3RWJB 3BWUC 2EDQA 5B8CC 3PV7A 3VJ6B 2B8OT 1T0NA 3KPRE 3MO1B 3WS6C 4AWJC 4FA7B 1UZ6E 2I69A 4U1NA 3CFJB 5EU5A 5L7XL 5JDSA 4BFKA 2YRLA 6FABL 2CM5A 1ZANL 3QUML 3GFUA 5LAXB 3FB8A 5E1GA 2QPSA 3DIDA 3X1BA 1XZ0B 2BHFA 4X6EB 3A67L 5EF3A 2P48B 3B5GA 2CKBH 3QJTB 1IBZA 3O4OC 4HKXA 4J12A 2XV2A 3IKCB 4TSBL 3J8F7 5D1ZC 1EHLH 2DQGH 4FFWC 5DD5L 4ZTEA 3S37H 3HLAA 1LQBC 2DM7A 4A66A 2EH7L 2QHRL 1N70A 3DDGA 3TBWB 4L4VD 4CJ1A 2IDQA 3CFMA 3H53A 1B4TA 2GBAA 3VI3E 1A9BA 3V8CA 5HHPA 4QRQA 2FLBT 1MIEH 4H20L 4KWUA 4P23B 4PS4L 3PWUB 4QF1B 4FTVB 1ZJBA 2F19L 5CSGA 5L9DL 4E2OA 2EXYD 2A77L 1D6EB 3IB4A 1QFUL 1MWAH 2AJ3A 4K5MA 5IIEA 1MEXH 3CK0H 4LZKA 1E5AA 4MA8H 1MCSA 2WNXA 2ILLA 2DD8L 2YPLD 2YAMA 4I0KA 4ZW7A 4GSDL 3LTVA 4K2UH 5BOZG 2OJ1A 2BSBA 1D5IH 3Q8AA 3QRBA 2W0FB 5FGRA 4EN3B 4FA6A 1L7TH 4HBQA 3KPOA 5SWZE 3MV7E 3LH8A 4FL4B 4OIAA 2QVIA 4PWHA 2DQIL 3K80A 4L1DA 1ROCA 4YXKH 3SPVB 4HOXA 1PYWA 4FZEL 5B1CA 2G75A 1I1CA 1I8KB 3STLB 5C7XL 1JNNH 2X4SA 2ESVB 1IBBA 3LD8B 1HCZA 1E9PA 3WY4A 4UT6A 4ORZC 5J7CC 1DVQA 3NN8A 1WC7A 2E7LC 1RZJL 3QJRB 1Q1JL 1DFXA 3U2SB 4WSKA 4Z7VA 5FHAL 4HEME 5JIQA 3BAYA 4LVNB 1GTNA 1HDMB 1HQ4A 2Q3AA 4G8FA 4PI2A 4CA4A 4PV9B 5IK3B 4FG6C 2EICA 3CFCL 3EO9H 2VOTA 1HEZA 5GGRY 4BZ1H 1PKQB 5DEJA 3MV01 1P7QA 2YC1B 3QCUH 4JPVH 1UADC 5D2LE 3ML8A 1JIBA 3RUGF 2H3NB 5IVNA 1TR7A 4KRNA 3LNGA 4U0RB 4AQEA 1EVTC 3EZJB 3LIZA 2FL5A 1KYUA 3L2LA 5IEKA 4BH7A 3GTNA 3HI6L 1NDGB 2X6UA 5I73B 4Y88A 4KITB 1EPFA 3UO1L 5AENA 2OMWB 3BYYA 2BS8A 2VGLM 4NO0D 1N26A 3QUYC 1KGUA 4G8AC 1AP2B 2F5AL 3UIZA 3A4EA 4HHGA 4P46D 3VGAC 4V1DD 1ROWA 4OF6A 2Y36H 3P4OA 5JHLL 4FFVC 4A2DA 2QBWA 4KV5E 2KC0A 4BCXA 2VLJD 4DVRH 5I17A 3FU8A 4WK0B 2UY6A 5C0BE 1ZCRA 3TNNA 4FXLA 1I53A 3TWCH 4UTAL 1JHTB 3VA6A 3RPIA 1WIOA 1KC5L 1I7ZA 1QBBA 4OF8A 3VXRE 2MQ3A 3NPSB 4LNVA 5KSBB 2XZQH 1T4WA 4RGNE 3CWGA 1LO0L 2EYRB 2HPOA 4GAFB 4IOSD 2X10A 5DS2A 3WGVB 5ICZB 4EZMA 1ZK5A 4JG5A 1OT4A 3CSBA 3GKWL 4NKIH 4NN5C 5ID1A 5AVVB 1VZIA 2LV4A 1ZXQA 4W9HC 4XWOC 3OR7B 1IB5A 4U7MA 5IHZA 3OKDB 2V37A 1E4HA 3CTTA 3EKCA 4PJ8C 3UJJL 3FH7A 2WSKA 4RESB 5E6IA 4IDLA 1PEZA 5F44A 2NXYC 2KH2B 3BLBA 4S1SL 4MMZB 3AS1A 1RIUH 2BC4B 2AEQL 2AQQA 3ARBB 4FHBD 1YPZB 4KROC 4MD4A 1CG9B 4NZTL 5GRVL 3GTVA 4PJCA 3IJSB 1MCIA 2G5RA 3SGDI 4FMVA 4WAFA 12E8H 4FQCL 4WNQB 4ODXA 1C16B 4R4FH 5I1AA 2PW2B 3B7YA 3W39B 3T5WA 4MB5A 5DA0B 3E0GA 3Q6FA 5I76A 2VW7A 1TKWB 1IM3A 5CGBA 3QJFB 5SWQA 5I5IA 4NBZB 1A9EA 4C56E 1UACH 1AZVA 2J7LA 3FCTA 4NRZA 4JFYA 3ZE0B 1BFVL 1PZAA 4OLXL 4KTYA 1GIGH 3FQUB 4G42B 5I6PA 1P4IL 4RFOH 1BJ1J 4DZ8B 1G94A 1G4MA 3GMLB 3V4PB 2HFFA 4XAWL 4K94C 3VMNA 3S36X 1VADB 1X5YA 2AQTA 1U8QA 2XRAH 4E9XA 3DUHA 5CIPA 4MQXC 3MA7A 1PGRB 1E2ZA 4BWTA 2WXNA 4NPJA 4MAZA 3KD4A 3R7QA 4QRFA 3MBEC 4E0RB 2G9KA 2HT4D 2VCOA 3PP3K 5T1LA 4B95C 4QRSA 4C57C 2I5YH 4PP2A 5H8DA 4NO5B 1ZHLA 4J2QA 2AEOA 2JMRA 1MY5A 5I2IB 2EC8A 2CG9X 5I1IH 3QA3B 1HSBA 2YMXL 3CFKA 3EHBB 1IKNC 3ARDC 5AFAA 1R3IH 3IKKA 3FO0L 4FNQA 4GUOA 1FZMA 2FJUB 4WNJA 1EV2E 3SGDH 2WNGA 1NUDA 3WUWG 4OFIA 4XOCA 3WJMA 1YN6B 4F80A 3VO0A 5I1KH 1DEEB 1WT5C 4FFYA 4POZC 4Q0XH 4QIRA 1HC1A 5HVWA 4N85A 3MYJB 4GKOA 2H26A 3D87B 3FB7A 4KVCH 1T2QL 5CGYC 4EUPG 2CUHA 1U3ZA 2XWEA 4HH8A 5I82A 1H3PH 2A6IB 4JG1L 4IRJA 4QYAA 4R6UA 3ZGIA 2CNZA 1WZ1H 2JKRM 3LKOB 4O2EB 3LNHA 2ADJB 2F8OA 4I0PA 1EUTA 1GAFL 1KT2A 1XIWD 1ZMYA 4F3FB 2IBBA 5DTFB 3Q2VA 4PJAF 4I48A 1VACB 4QUOA 2H47C 3NYKA 4QY8A 1R5IB 1XH0A 5IB1A 2A1WH 4CKQA 2X4TA 2YGPA 1N3NB 4G6ML 3N50A 4Z7QF 5EBMB 3D2UA 1HH9B 3FTGA 1JWMB 2VNCA 2BINA 3SDXB 4X0KB 2R59A 4HGMA 4KQ3L 5EO1B 1P84K 3V0EA 1S9KC 2XYCA 1IE5A 2R2CA 1GGIH 1ECZA 3OZLA 3IU4H 5FGSA 3CZFA 2VKXA 5F0MB 5E0FA 1CGWA 1J9SA 2TRHA 5F9DC 3WAJA 2Y5TB 3ATEA 3GSUB 4Y19A 1IC0A 4H0HB 4NB7A 4YUEL 1J8HE 4K94L 3EGXB 5ESAB 4DUWA 5AW4B 3PDOB 3FQXA 4IBYA 3VRIA 3SE3C 5T1KA 3TTSA 1DSFL 3BH9B 4GRWH 2JELL 1KYAA 3PYCA 3TH4T 4ZQTA 4TQHA 4M8UA 1IEBB 3ZT5A 3HG2A 4W4OC 4YZWA 5ENWB 4F27A 3ZTCC 2IANA 3M6DA 4M7JL 1DJSA 4TS6A 3AACA 3TN0D 2ZUQC 4OZGE 2ZYSA 4PGBB 1M05A 3JYBA 4CAGA 1SHSA 4XP1H 4ALAC 1QUNA 1MREH 1A7BA 1KPVB 4WLCA 3RGVA 2HT3D 3QK0A 5DK2A 4E9QA 3IPEA 2O5XL 2YD7A 3LV3A 2NR6D 1CDIA 2ZXWB 3HTLX 4TSCL 2AMUA 3TTYA 4UBDD 1YAIA 2G2PA 2PR9A 1L3WA 1FO0L 4O51A 3LQAH 3IFNL 3JTTB 3MUY1 3BDYL 1ZEAL 3F58L 3NIDB 4HWBA 4PJGB 3IU3A 4B27A 4J3OF 4JM2F 1U92B 2H3KA 4MXQD 4H25B 1W6WA 4ZUTA 4I3SH 1RUQH 1LNUB 1KIPB 2BH0A 4LBEB 3TBVA 1A1NB 4IU3B 2H2SC 1UZGA 4Y2DD 3VXPA 3I6LE 4E42A 3EYQD 2D31A 5ETUB 2F9BT 2WZPA 3TVMA 2ZWNA 5ICXB 4FNSA 3MOAL 1Q72L 5CSBA 4P9HH 1ZLUH 4WFGD 2F18A 2VT0A 3X2QB 2OV0A 4GKSA 3TBTA 2OQJA 4OGZA 2X89D 3GKZA 2AAVA 4DK3A 1MJ8H 1WAAA 3TCLA 5DT1H 2VDKH 4PVLA 5EUKB 3BEVB 2Z35B 4R7LA 2XTJD 5FIEA 3PGDA 3UTSE 3ARFB 1R3HB 3Q05A 2LTQB 3FU5A 1NPNA 5AW3B 4JRWA 2EXWD 5E2VH 1AIZA 2R8SH 1ZLWH 3N1MC 4Q4IA 2OAAA 4MGXA 3JTSB 4CW1A 3N0AA 2O61B 1K3IA 2AS5M 3ZY7A 3ZTNH 5IT2L 1S6NA 2QZQA 3QQ9C 3F6LA 2NCEA 4X6CA 1R33A 4G7SB 2AP2A 2PMZA 3CPUA 3PWNA 1DFBH 2FH6A 2VDOB 3NQIA 4GKZB 4KPHH 5DJYA 4X4ME 1NLDH 4TNGA 5E6SB 3UTZB 3VFRB 1ORSB 3BCDA 3GHEL 5H35B 4WTWA 2WLHA 1A7PH 3CDFA 3GRWA 3I9GH 3WYRA 3NGBC 3VYPA 4X7DC 4UQ3A 3QJVB 1JDCA 4Y4HD 2WBJB 4JO5A 1MFAL 3HS9A 1SFDA 4PQXA 5FC9A 3FTSA 3ZYOA 4ALAL 4CVWA 2OXHB 3WXVL 4DGWC 4U6YB 1GOGA 2FATH 4QNPE 2L3BA 4MX7B 1C5DB 2FO4A 4I89A 2NY3C 4XVOA 2X7LB 4I87A 4OD1L 5C70A 1HS6A 5KG9A 4HFWA 3GPSA 3CHPA 5A1AA 4NGHL 4U1SA 3W81A 1S9YA 2FX7H 3FN0H 1YMHB 3GSWB 3K2MC 4MAYB 5K1JA 3BUPA 2H0FA 3WKYA 2AMGA 2BVOA 4EIUA 5AW1B 4PJ7E 3SJVD 4WGWB 5B3NA 1RMFH 3EFDL 2GJ6D 1QO3B 3RNKB 4O2CA 2WXJA 4XP9H 5C0CE 4IHOA 1U41A 2OMXA 3P73B 2OMUB 2IV8A 1U91B 4G8GE 5HHOB 1J9RA 1NLBL 4JMNA 2N56A 5J1SC 3PAVA 4OQ1A 1OXYA 2VDNH 2GUOB 1X44A 2ZKXA 4PJFB 3QIBB 5EO0B 3S48A 1JDAA 4F7CA 1X9LA 4LSVL 1FN4B 4PJXF 3KJ4C 3V6ZB 5J13B 2KZWA 5FM8A 1NGQL 4QXTA 1FYTE 1AY1L 1JGVH 1KFGA 2KQMA 3ARGC 4JKMA 5ESQB 5I18H 2BNRB 1E8WA 1FZJB 1SQMA 1MQKL 4JKWA 2YMTA 2MSPA 4J3WA 1OW0A 3VD2A 3E6HA 3M1BB 4ZFGL 3Q0HA 4JKNA 2V5MA 1KJ2B 1SEQH 4NZJA 4GO9A 4R84A 2K6WA 2RFXB 3SCMC 5I16A 2G3MA 2VLRD 1CL7L 2IOMA 4WWID 3HZYA 3ASNB 1NMAH 1XTMA 1OLZA 1JNHB 3K7UA 4FQ1H 3O6FD 2JTYA 2NTFA 3HPLA 1CYXA 3HUJF 5I0YA 2F8IA 3BMVA 3O8XB 4HWEL 2ZSWB 5KW9L 3V7AG 5TDPB 3P2TA 3OKEB 2W9DL 2OTPA 2VDQL 3ZE1E 1RULH 5GGSB 3RAJH 2DQFB 3IEAA 5IOPB 4NZDA 1CQKA 5EEWA 2XZCH 2XN0A 1HHHA 3BIKB 5CFHA 5KYYA 2H2PC 2WVUA 2OFQA 3T2NL 1K2DA 1TTUA 5IVXF 4WHYG 2D9CA 5KJ7E 1OE1A 3QEGH 3D25B 3NCEB 3UYOD 5HVHC 2CMRH 2WQRA 4DAGH 1ZVHA 3UG3A 4LAQH 4YSCA 4HAKA 1ID2A 5I8OH 3CX5K 4WWOA 4J3OG 4H8UA 4N9GA 4YDJB 4WUUB 4Z7UB 4X42A 3NCFB 1BJ1H 3FTXA 5SWSB 4ZNEA 3K4AA 2BIHA 5JW4Q 1YECL 3VXSA 4O58L 2GSIB 2F54E 3MLTA 5TDOA 4M1DL 4OZIF 1HQRA 3BLPX 3BZFB 3CVHA 4KUCF 4OU3A 4AJ0A 1RUMH 2EDDA 4M7ZC 2FIKA 3PPSA 3C60B 1B0RA 5E08L 4JE0A 4O02B 4UT9A 2L4OA 4PRID 4U3HA 4FYSA 3S98A 1X9RA 1A5FL 3WIIL 3R7RA 1NAML 3QO1B 4GW5B 5F7WC 4OI8A 2ESVE 3QUKA 3EFFA 2OMZB 5DD3L 1QR4A 4P2YA 3D6GA 3ULUH 5DD0H 2ARWA 5IF0B 4AI7A 1RZKH 2VRQA 1ANUA 4YLBA 4OGAD 3O2DL 4M4PA 1CXIA 4JJHA 3MA9L 2AEIT 3MLRL 4PCKA 1WS7A 3L3HA 1KPRA 2A3TA 2WXRA 4QOKE 4KOBA 3NFSL 2M2DA 4YGVA 1K6QH 2E6QA 4APXA 4YQXL 5JO5A 4Y2LA 2AXGA 2CO3A 2EACA 4MVBD 1KN4L 3WIHL 1CDGA 4L48A 1FVEB 2XV6B 4DKDC 1OAZL 2XV3A 2X5PA 1CE1H 5GRVK 4GBXC 4TNWK 1FL5A 2XG4B 1FFNA 4MQTB 3S5LB 2F7RA 1P5VA 4KBPA 4A55A 4P2RA 4H8WH 2EJ1A 4KTEH 4N0UB 1YDPA 4V2CB 5FYKH 3VXMD 3U4EA 3IETB 3IVKB 5CSZA 2BNUB 2DQDL 4D9RE 3X13A 3DVFA 1NFKA 5MEQA 2PXYD 4ZT1A 1PSKL 1IRAY 5MP6H 2GABA 2Y1YA 3ZR5A 1N0LB 1LWJA 1A7QL 5HI3D 1KV7A 5E8PB 3E38A 2OLDA 5JQHC 1X5FA 3WAKA 1PZ5A 1JZ6A 5TK4A 4HSQA 2DMKA 4O00A 3U0WL 2JCWA 2Y22A 1T0NB 4UDTA 2XUWA 3TJPA 2XDHA 5EU5B 3TO4D 4CVZA 4W9JC 4QPEA 4F2EA 4HS3A 2AI0H 3VB9A 3IXTA 43C9B 3CDGB 2NX5D 2EAEA 3DX7A 3T6VA 5E2WH 3QEHB 4AC2A 2AKRA 3VWJC 1YY8A 1ZA3A 1A6PA 1L9TA 1S78D 2FJFA 4IOFD 2CK2A 4HKXB 2MHAB 2FQGA 3CDCA 4X99A 1BQHG 3STBA 2A6JA 4U1HB 3HLAB 4LLUA 4J3VA 3MRCA 1PMYA 4JHVA 1KLFB 4N2CA 4NWUH 5CJOH 1LK2A 1A9BB 1OGPA 2VDPL 1BXVA 4QRQB 1AS7A 1XVSA 2BDNH 2WY3B 4PWEA 4PLNC 4OLZL 2Y5EA 1I7TA 5JQ6L 4FEIA 5T1JA 2E47A 3OC8A 3IS1X 1JGLL 5IR1A 2AJ3B 4U1GB 3OPZH 4LCWA 3HW7A 2B59A 2OW7A 2X2UA 3NVQA 4LMQE 1EAPA 5JW3H 5DK0A 3RFZB 1NWPA 3VWKD 2IAMB 3F7LA 5HJ3B 3HE6D 3SGKC 1GYUA 4F9PA 5K39A 1O7DC 4K5OA 4JFPB 1MQ8A 2H32A 3CVIL 2N1TE 1G7QA 4ILDA 3MJWA 3GXNA 2R0KL 1LEKA 4NP4H 4W70A 3RIAK 4KXCA 4G83A 1R1CA 2I24N 3DOSA 1PYWB 2G75B 2CA3A 2FWSA 1WSST 1IKFH 1NINA 2B0SH 1A6ZA 2MRYA 4K15A 1E9PB 4F8OA 2FZ3B 4P2OD 4YHKL 2ADYA 4N1HB 3H9SA 3NN8B 1WC7B 2A6DB 4OCLC 2Y07H 1GPOH 4Z7VB 3MOQA 3V4VH 5D70L 2ZP0T 4L37B 1BVOA 3KVQA 3TEUA 3ECUA 3EDFA 3P4MB 2IQAA 3U7YL 4P5RA 4OH2A 1KCSL 1IIKA 1TQTA 2X9XA 2BVUA 2ZXDA 4GQ9L 3GIZH 1P7QB 4W68A 1QZ1A 3QS2A 2Y3NA 4ZO6A 3FFCD 5EBGA 1D7CA 1MI5B 4UDUB 3FHQA 3T2OA 1CLZH 4BFBD 4PWJA 3S36L 4TSAH 3QZPA 1JVKA 3K5RA 4AQEB 3BPOB 1NCDH 4EIGB 5ANMA 3UACA 4R5VA 4JJ5A 1ONQB 4DTGH 1RFDH 3EOAB 4XNYL 4E9WA 1KIRA 5FUOL 2KZBA 3SBPA 3VFUB 3EXJA 4LPVA 4X4KA 4YGAB 3H4FA 4FNLH 4KVNH 3P4OB 1BAWA 2J8HA 4I18C 3K0WA 3MUGA 3NOIA 3MGAA 4WKXA 3OB0H 1ZT4A 4HK0B 1GRWA 1NFIA 2VMEA 3ARPA 4ZBJA 5I17B 3QAQA 2UY6B 5EORL 2CKBA 3V2AR 4P2QD 3VI4F 3ROLB 2WXKA 2AHIA 4F58H 3P3RA 3QVAA 1AXIB 5F7AA 5IREA 3QXDA 3B3BA 4PRHD 4U2YA 4XCFL 3HVDA 3MJ8A 1VEPA 2COQA 1VHPA 4BZ2H 2YHGA 1BGXL 4PRPE 4EZKA 2VR3A 4X4YA 2IOIA 3U30C 2ZKYA 1UD2A 1FFRA 3QORA 1AKJA 2Q3ZA 3SDXE 4XC3H 1NEPA 3PAZA 3C6EA 4N2MA 5DMYA 3U1PA 3ZQWA 1MJ7H 5EOCL 3MZGB 5IQ7L 2YPVL 1IUZA 1JZ8A 5KYXA 4XPAH 1SFHA 3VGFA 3RL2B 1FVDA 3UBFA 4FMKA 2WOBA 5IHZB 5BRQA 4NZUL 5GS3A 1D9KD 5C0AA 4LCUB 3DMMC 3MCG1 4NUJA 1FGNL 4G6JL 4L3EE 1M3IA 4R7VA 1MN4A 5EFIB 5LXGL 4FYQA 2P46B 2Z8WC 3ZPDA 4YAQA 4KY2A 2X05A 3CC5B 3NTCL 3LZQA 4YHML 4P9ML 1P6AB 3T3MB 2Z31C 3A6CL 5CUSL 2HFGH 4JFDE 3RNQA 4PJCB 1AZUA 1CGTA 5B3JF 3CN1A 1F6FB 2Q6WB 3W9DA 1B6UA 4ZW5A 2G60H 1BYOA 1FNEA 2H0JA 1QHPA 1A4BA 3OAZK 5I1AB 4X7TA 2IH1B 5DHEA 5I76B 1IM3B 5KOVC 2M26A 1M71A 1UH3A 3LS4L 5I6OA 5F6IC 5SWQB 1A9EB 3UDWC 1XR8B 1L9QA 3HS8A 4PJ5D 1NC4D 5DHVH 4NRZB 4U31A 4LSTL 4JFYB 3T77A 1TQWA 3CXHJ 2PYED 4WRLA 4QDGA 4OZHA 5GZOA 1MCRA 4L4VA 5GQBA 4ZTOH 1RJZA 2YK1H 5HDLA 3HB3B 4MJIE 3S3JA 4PJGE 2ZICA 5FS5A 1J1PH 4GSRA 2FNBA 3O6LL 5EEYA 4YX2H 5CIPB 1CT8B 1BW8A 4IRSC 4KHTL 4BFFA 2WXIA 1MCJA 3H0TA 4NQCE 4PEEA 1UM4H 2EZ0C 2ZXEB 4PD4J 4XCCH 3WMQA 1LQSR 2PPEA 3FU0A 2YPLA 1ASPA 5J8OA 4GP4B 4I2XB 3TBCA 3ARUA 4F92B 1ZHLB 1NKRA 2WUCL 4PJDF 4OLUH 1J0IA 1HK6A 4B9YA 1VIWA 1QFWI 4MB4A 3CFKB 2W8CA 3L4VA 3SQOL 3ZKND 3GHPA 1UYWH 2GAZB 3VH8G 4BEIA 4J3OD 5J06A 2VZOA 4U3CA 4N28A 4HD5A 1ND0A 3MNDA 2CRYA 4G7YL 4HQQL 2WQUA 3MGOA 3QQNA 5FLUA 5C8JA 2NY1B 4JN2A 4E5XA 1EZLA 2E75C 3GSQA 4XN1A 1EBPA 3MI6A 3VRLF 1FJ1B 1UWXH 3DX9B 3FB7B 3D85D 2B16A 3QIUD 3UIYA 4XO9A 1PZDA 5EHFA 4YHYC 3AGWA 5LN8A 5D1QC 4IRJB 1RIHH 5CR8A 5C1MB 5DMGC 1ZIAA 3CDZB 3MPCA 3RWHA 3T3PB 1TUPA 4NOBA 4JVWA 3NESA 4ZDHB 2H0EA 4I48B 1I8LA 2AJXH 4TVPD 1Q94A 4X7SL 5DC9B 2MCG1 5LGJA 3X12A 2X4TB 5D5MF 5C0JA 2LQRA 3MZTA 5IHWA 4G8EB 4PJIF 5AVTB 2YAQA 4W9FC 2WWNA 4A38A 1G0XA 4AG4L 3RWEA 4JHAH 4ZMQA 2GTQA 4JPKH 5F3FA 4X7EC 4XBPA 4HXAL 3GGWA 1OP5H 5JHDB 1PG7W 2X0WA 2XJKA 4R9HA 4P46A 2XKUA 4EDXA 4X6BA 1UGNA 1QFWH 3MFFA 3VU2A 1S7RB 2KHAA 2AK4E 4O9HL 4LK4A 4M8QA 3FQXB 3VRIB 1JZHA 3ENEA 1UURA 5B1JC 2F53B 4KNUA 5JORA 5ADPH 5HDWA 5KSVA 5KVGE 3L17A 5D1QE 5F88B 2NNFA 3IJ9A 1G7HB 4KZDH 3U46A 3VFNB 1KBGL 1ULVA 2X9WA 4GRLC 2IQ9H 1M05B 2R9HD 4P0DA 2V9TA 3WEAA 2EDWA 4DP7X 4IRZH 1QUNB 4MCMA 3N9GL 2VDLH 3RGVB 4YDNA 5DK2B 1XHHA 2JKSA 2XVGA 2NZ9C 2APSA 1JGEB 5CLWA 3L9EA 2MOVA 2QQLH 4R90H 2VAJA 4PJFE 1Y1DA 3RBGA 4MDJA 2CXGA 4F7PA 4AW7A 1ZS8B 3RTQD 4JG0L 5FA4A 1KXQA 5LBSL 1U30A 1MNUL 4O51B 5D7LD 3NIGF 2GYSA 5DMJB 4BQBA 4DF9A 2EABA 2PP7A 3VXNA 1RZGB 2VM9A 4JHUA 3RVTC 4M7LH 3Q44A 2XC8A 4RDQF 5IB4A 4CBPA 5KVGL 1F5WA 5LLIC 5CP3H 3T8XB 5GGTH 3VXPB 5H94A 4DGIL 4E42B 1C1EL 3R06A 2P5WD 5EB9A 2IV9A 3GMQA 4IBSA 4Q56A 3BVTA 1PKOA 4KK6C 1SF3A 3P9LB 3FOLA 1BAFH 5DS8A 1JI2A 4EPSA 1XGQA 4GKSB 3UJIH 3P11H 3QZLA 3ROOA 2WWMC 2YWYA 4TNFA 3QQXA 3LN4A 2E7MA 4M5YL 5D1XA 3WKMH 1IGFH 1TTAA 1OHQA 4LAJH 4WU5A 5D7IA 3TCLB 4XO3A 3LRKA 3L4TA 4ZO7A 2AJUH 1FFPB 2WO4A 3ILPB 2MCAA 1HESA 2RQEA 4U7SA 2YGVA 4UB0H 2QKIA 3PGDB 1F0LA 5G4MA 3GXDA 4L5FE 1CTMA 2APBA 4FP8H 1OAYH 3FW6A 3TIDA 3BH8A 4L8DA 2VR9A 1DBBL 3IPBA 1IBHA 3PWPE 3K4ZA 1JPTL 4DGUA 5IQOA 4WWKB 5DUMH 1ADQH 3W5MA 3GT6A 5FB8A 4L8SA 4XMKL 1IGJA 4WUUE 4Z7UE 3PWNB 4HLZH 2VSDA 3JZYA 4MRBA 5SWSE 5DJYB 5DVMA 4UTBH 3WG7B 1IEAA 1Q9OB 1J0HA 4MMXC 2R39A 4GT7A 3KYNB 1D5MA 1I4FB 1YEDA 5HYIA 4K7FA 1XZWA 3ZL4L 2Q2EB 1S7SA 2VW6A 4R7NA 1JNJA 2A9CA 2X42A 1Y0LA 3QNZA 2BVPB 3FSWA 4M5ZH 1PBYA 3QRLA 3FO2A 3SOTA 5E94A 2TAAA 1D2PA 1TETH 4U1SB 1LK3L 5FYJE 4LVHC 5BXFA 1W72H 1PX8A 4TRPL 1INQA 2GTZA 1P4UA 5IW1A 1EIBA 4M43H 3CX2A 3SEPA 1IQDA 1DL7H 1K5NB 3VX1A 2BVOB 5AW9B 4KUCD 2VUYA 4AV5A 4RAVA 1BJMA 3DTUB 3RVUD 2QV4A 2Y25A 1XIWA 4OI9A 4NT6B 5DR5L 4X8JB 1LP9B 2HJFA 4M00A 3C6LC 4O2CB 1AVAA 1CDUA 1RJCA 3FK3A 4E9LA 4IHOB 2OJZL 5HSFA 3K46A 1C5BL 2OMXB 3D05A 2COVD 5IVOA 1EERB 5BV7H 1R3KA 5K9JL 5KVDH 3LXUX 3STZA 3FNKA 3AG3B 5T33H 4UIMA 3BPCB 3THMH 2O1AA 4F7CB 5CILL 1DQJB 1RSYA 1GS7A 4R5TA 4QXTB 3D33A 2XWBA 3ALPA 5EIIG 4FG4A 4JB9H 2DBLH 4AQOA 3LRHA 3H8NA 2DWEB 3UG4A 3TF7C 3KPPA 1QRNB 3CFUA 4K07A 4UYPA 5A3ID 1F1DA 2ZOLA 4B7IA 1BBDH 2K78A 2YEZB 5E9DD 5KZCD 5E5RB 3J7HA 4JO3L 5DVKA 5I16B 4IKLA 2Y2WA 3MV8B 4X80H 5CCJA 2Y7OA 1ES0A 4XNZC 3TN0A 43CAB 4Z0XA 3WENA 4FABL 1I1AB 1ETZA 1LEGA 3VM7A 2NTFB 1XSKA 3HPLB 1JV2A 4AKQA 5MEOB 3UFIA 3VQMA 2LR4A 2O5YH 1FDLH 1R17A 1B90A 1RPQA 3FS9A 1CK0H 4YDVA 3REVA 25C8L 3KCPA 2DI9A 3LKNB 5F7MC 3IFLH 2ATKA 2GCYA 3R1GH 2AJVL 1J5CA 4APQB 1HHHB 5KYYB 5IBLD 3F62A 2FEDD 1XEDA 1IC5H 3F7VA 3UYPA 1K72A 1XF4A 3LZRA 2J8UA 2XY1A 1KFAL 3EOYG 1EJOH 4HKZA 5GIRA 3B9AA 3IDJA 3QQ4A 4S1DD 4OJEH 4HUUA 4ODTL 2ZOUA 1E6OL 2IPTH 3OSVA 4QJ3B 4Y2DA 5EZJA 3L54A 4N9GB 4MJHA 4IW4C 3O41A 3OAYH 4WHCA 2ARJA 4RDQG 3T1FB 2QQNL 5JR1H 4WKZA 4QHPA 1U95B 4L9LA 3QFDA 3ATAA 4NQUA 1HQRB 4L29A 4LPCA 4DP0X 2FRGP 2X89A 1GKOA 1WCBB 3IGKA 1U58A 2BP8A 2FJHB 2FIKB 1IT9L 4X7FC 4Q14A 1XT5A 5DJCB 4JFSA 3V9CA 4KFZC 1VZGA 3AY4A 3K74B 2A38A 4NI3A 2IG2L 3N41B 4OW6A 4P4RA 1SVCP 2NNAA 3VE0B 4NDMB 1U8KB 4QEGA 5IFAH 3IWVA 5IJDC 1DBJH 2CBPA 1VFBA 2VB5A 4OLYL 3FYIB 2XVBA