2H3NA

Crystal structure of a surrogate light chain (lambda5 and vpreb) homodimer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
PVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VpreB protein
publication title Structural insight into pre-B cell receptor function
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 20
structure length 99
sequence length 99
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h3nA00
4ZO7A 1JNNH 2QL1A 3LDBC 4N90D 5IB2B 2O5ZL 3N1QC 1G6RB 1F4WL 3O6MH 1JNLH 2BSSA 4OI7A 4LASL 2ERJC 4GT7A 4JANA 3QRGL 1KB9J 2EDDA 1QLRB 3ZKQD 4LLDA 4YHYC 3BP7B 2FX8H 4F7MB 1KN2L 5KANI 3LKQA 1YEDB 2FIKA 2R2EB 3K46A 3KPSA 3HCVB 3RVWC 1DP0A 3TO4A 4QRRA 2X42A 3NTCH 4YBLC 1X5LA 4RFOH 3GDBA 3LN4B 4YIQB 4IRZL 1FVDA 2VDLH 1LEKB 3WEXA 4KK8D 5IFHH 1A7QL 2W91A 3L95A 1SJVA 3VRLF 1KV3A 2UWEE 5F89B 1BF8A 2XQBL 3UTOA 5BV7H 1S9KC 2DQCL 3FONA 4GRWE 4HV8B 2VN4A 5GJSH 3DGCR 1T21B 4ORGB 3DUSA 1MCIA 5JNYA 1RPQA 2JJSC 1YN6B 5I8KL 1YNLH 2VDRH 1U6AL 4OT1L 3UZEA 5FCUL 2IAMB 4POUB 5JW3H 1FE8H 4LP4A 3QXAA 2IAMD 1A6WH 3CUPA 1OP3K 4I2XE 5DD1L 3B9DA 5F9WB 2QQQA 5L2JB 3HNVL 2LAAA 5EN2A 3RA7H 1TNNA 2VABB 3Q5TA 1DQQA 3RWCA 3EO1B 5HYSA 1T1XB 1JGUH 2ZP0T 4G5ZL 3I6GB 2P5EA 1IJ9A 3BKMH 1QO3A 4XNUH 5CZXD 4LEOA 1TJGL 4ZYKA 1SEQL 4HFWA 3BGFC 4OFKA 5TH2B 1SBBA 1Z5LA 3NZHH 3ZE0F 1P9MA 1VFBA 1BQUA 5LGJB 3GSUA 1WVZA 4BSJA 2JK5B 3PDGA 1QTYT 3LEVL 3MREB 4Q6IA 1WZ1L 3FO2A 1G6RH 4LCCC 1FO0L 1NL0H 3S37H 3DYPA 4APQC 3QWRD 4Q0XL 5GRYA 2UUDK 4UT7H 2FEEI 3D1MC 3OGCB 5DRZA 4S1RH 2WWKT 1A21A 5E2WH 1WT5A 3V7MA 3EJYD 3VFTA 5I1GL 1YECH 1JWMB 5C6PB 3SPVA 3AS2A 5IT2L 1JN6B 4NRZB 3LKRA 3QR2A 4OF5A 1EO8H 4HIJB 5I8OL 3TT3L 2VOTA 5GGRB 5GS1A 4O58H 4MVBD 5EB9A 1EVTC 1JTOA 5DLMH 1CT8A 3TBWB 2H32B 2Z0BA 5C0GA 1CDYA 1RQ5A 3MLWL 1TVDA 2BRQA 5D7LE 1TVHB 1W0YT 1QSEB 3QQ4A 2Z35A 3IXAA 1QFWI 1WCQA 4KRMB 1QSED 3RL2A 2XY2A 1M4KA 4OIIL 1BJ1J 1WEJL 3EOBB 1MFBL 2DWEA 1RV6X 2APBA 5DFVD 5I73C 1DDHA 4HXBH 4CW1A 1FVCB 3GJFK 2HG5A 4XWGH 3HRZB 5AUMA 5E6IA 1FC1A 3ARBA 2I25N 4OLZH 4WI9A 1UWXH 3S36H 3DX6B 1NSNH 1DUZA 2E9WA 1S3KL 1TVBB 4LPTA 4LLVA 1CXKA 1IGCL 3TZVB 1FIEA 2IQAB 3QH3A 3EO9H 4XMKH 5JO5B 1KTLB 3TZVD 4DQOL 4HKJB 1XF3B 5ACLA 3FTGA 3GSRB 2Z31C 3DVFA 1T20A 3AC0A 3UO1H 1RZIB 4DCQB 3TVMC 3QHZL 5B21A 1OTUC 2E6PA 2VZ1A 4PGDB 2YA1A 4P5KB 5C70A 4P59H 3SQOL 4YHZL 4LGPB 3V4VL 1GZQA 3CVIH 5KOVC 2HT4D 4Z0BH 3S35X 3VWJA 2XWJA 4EUPB 5DTFA 4FS0A 4WI8A 1HDMB 2JJTA 4PRHB 3FAWA 5AG9A 2BY0A 4QTHB 3MGTA 4GW1B 1DFBH 3NIDF 2AV7A 3L3DB 2VDPL 5E03A 4PRHD 5KVFL 4U1JB 3ZTJG 3JWDL 3WKMH 4L5FL 4MXWH 4TUKH 5I1DB 2ZG1A 3U6RB 1QA9A 1S7QA 2ZPKH 3VU2A 2NXZB 4EI5C 3SE4A 3GKZA 2EICA 1G9ML 1KN4L 4JPKH 1V8HA 2H32H 3AU1B 1CFQA 1KTKE 2NXZD 4FTVB 4Z9KB 4NO2A 3L5XH 3FFCE 4BSVB 4XC1H 1WWCA 4F9PA 1E4KA 4FTVD 3RAJH 5T5FL 4U0QB 3CMOH 2LV4A 4PJEF 5IHUH 3HZMB 2WANA 3QPQC 2QV2A 3RIFF 1CZ8L 5IB1B 4HWZA 2GTZB 4JFEB 3QG6A 3TC9A 1TQBB 4OCXL 4WGWB 1QHPA 2MOVA 5JIHA 5BV7C 4JFED 3UBXG 1XZ0B 3F12B 5I71B 3MRFB 4PV9A 3K81A 1I3GH 2OR9H 5IVOA 2A6IB 2H2SD 5SWSE 1GOHA 3SKMB 1PY9A 1RHFA 4N1CA 3SE3C 2HMIC 1CGSL 3C5ZB 3S3PA 1TZIA 1P4BH 4HK0B 3C5ZD 4N0FB 1BOYA 2DWDB 3QUZC 1U2CA 2DDQL 3I50L 1YYML 1FPTL 3PE9A 3MXWL 3WNLA 4HPOH 4OZGA 1RHHB 2IADA 4JFHD 1YUHA 3P9LB 1IGML 1RUAH 4K55A 2LU7A 2YD1A 4MNGB 1JMZA 2XICA 2NMSA 3E2HC 2ZKHL 3NZ8B 2XN9B 1XF4B 4EUPH 1BQLL 4FFZL 3KYNA 4YO0A 1G7LB 3FOLB 3K8MA 4XP1H 1DUYB 2XN9D 4FQHB 4L3CB 1YEEH 4GRLA 5IFJA 3T2QA 1LO5A 1OVZA 1U2HA 5D9SA 1QR1B 5CJQH 3TM6A 4G6ML 5CINL 3BRDA 3JTSB 4QYOA 4P46A 2EC8A 4NC1C 3TT1H 4B50A 2GYSA 2DJUA 4PRNB 4WUKH 5HHOA 1QNZH 2DLFL 2YPLE 1T66D 3UCRA 2ZNWA 3VXUB 4OGAD 5C1MB 3ULSA 1BF2A 1CLZH 4EXKA 3VXUD 5JW5A 2I9LA 3QSKB 4LNRB 3VE0B 1ERNA 3WIIL 5HDBF 1CFNB 3MGAA 3NFPB 2NW3B 3DLQR 3SJVE 4KK8C 3V6ZB 3BDYH 4DK3A 1B6UA 5EU5B 1KCUH 1UFUA 4U31A 4FQLH 1KGCE 4PJAE 5KBNC 1J9CT 3T4AA 3GO1L 4OCSH 2BSTA 2X09A 5E6ZA 4UIKL 2WP3T 1PQZA 4HCRL 4PGCA 1MHEB 2EYTA 1IGTA 1IAOA 2VDMH 1A7NH 1N6QH 1AKJB 1XT5A 4N1EA 4WNQB 1UZ6F 5I2IA 1BPVA 3OPZH 5DJAA 3DXAD 4X4XB 5I1IH 3KNBB 5JUEL 1XIWB 1AKJD 3G5YA 1Q9LB 3RWDA 2APVA 3TIEB 2IAMC 2DYPB 2GSGA 1OSPL 1I3VA 3L6FA 2APTA 4RNRB 3MR9B 3OB0K 3S88H 4R9HA 2W60B 2QJDA 3O2DA 4IRSA 1KB9K 2DYPD 3RUGE 5J6GA 3QDGA 5BVPL 4JR9H 5F9WC 4LLWA 5ITBL 3U83A 2A1WL 1F45A 4GO6B 4I3GA 5ILTL 5CZXC 3H42H 4WWKA 1XGYL 1PGRB 4JZJA 4DN4H 3OAUL 4DKFL 4EDXB 4PJXF 1CGVA 4QRTA 5DRNB 3RTQB 3H9SA 4TOYH 2A83B 4PD4J 3ARRA 3BW9B 4O4YL 4X0KB 4OZHA 4X5WB 1MJJA 3F8UB 3RTQD 3X12B 2X4NB 3MRKB 5BCAA 4MZ2A 1ONQB 3AY4C 4RQQB 5KVGH 4Q9RL 4ONGH 5ETUA 4PB9L 2CRMA 1T7VA 3W2DL 3WD5H 3JWOL 1BFOA 1H0DA 4XNQA 1FZOB 1H3XA 4LAQL 4WY7H 1DBML 2DD8L 3EJYC 3AROA 4JRXA 2ATPA 1BFTA 3QIBA 4JN1L 1PLGL 4O2FA 5BMFL 5DC0A 5JOFA 4MSWB 3CD4A 2FHFA 4FZEH 3BZFB 4H20H 1I3RB 4MVBC 4XNYL 2N7BA 3EYUL 2AJYL 3EBAA 1B9ZA 2Q7YB 5EZLB 3NABH 2ZSWB 1EDQA 4L4TE 1I85A 4UU9A 3SCMA 1TENA 2XPGB 1D9KB 3I6KB 3TO2B 7CGTA 4UDTB 1L0QA 5C7XL 5FYKE 1QUNA 2VLRB 2ZUVA 4LGRB 4LCIL 4PJDB 1D9KD 1AGFB 4X7SL 1SJHB 3KDMB 1KLFA 3LKNB 4QXUL 5ESVB 2A6KA 2VLRD 2X4UA 1QEWB 1E27B 3VXNA 2DLIA 5DFVC 3AUVA 4NIKB 3MRJB 2BDNH 4JN2A 4PJFB 1KIRB 2XKNB 4LHUB 5FKPB 1HNFA 2ZNXA 3KR3H 4LHUD 4PLJD 1K6QL 1F3DJ 4YR6B 1P5VA 2NNAA 3QHZH 1S9XA 4ODHL 2VDKH 4UQ3A 2ICEB 3MRCB 1G7QA 5CGYD 1MFDL 4FXLA 4JFPA 2CKNA 1HOCA 2VDOH 1NEZA 3IJHA 3V5DB 4PG9A 2GK0B 1D3CA 1IC7L 2GUOB 3TZVC 4D0BB 5HD8D 1P69B 4M7LT 1CL7H 2VAAB 1T22B 4YHMH 5E94B 2YSSA 5I1AA 2OX5A 3OAYH 2AK1L 3NACH 4JPWH 1OAUH 1E6OH 2AJVH 3TBYA 1R5VA 2RR3A 3G6JA 5BZDA 2E9BA 2HT4C 4OCYH 2ARJQ 4OUUB 5D5MF 1AD9A 1FIGL 3EO0B 4WUUA 3OKKA 1MJ7H 5D7SH 3U9UA 3SKJH 4Y5YA 3P4LA 3GMRA 1BLNB 2VSDA 5DA4A 5DVLA 4URTB 1JF6A 5D1QB 3ULUF 4XPGL 5DQJB 3TCLA 5KVEL 2AW2A 1PYWB 4ZFOL 1FG2A 4OJFL 5F7DB 1UEMA 5D1QD 4I5BA 3TJEH 5HI4D 4UAOB 5LQBH 5JORA 1CYGA 1BJMA 5J7CC 5D7IA 3V0WH 1ZHBA 4NKOA 2UZXB 2EYSA 1Q1JH 1T2QH 1MSPA 3SE9H 2B1HL 2NXZC 4HLJA 2XRAL 1EIBA 3OX8B 5T33H 5CBAB 2V5SA 4TSAL 4OQTH 5MERA 1YMMA 3LQAL 32C2B 2GITA 1C5DA 4PREB 2EDQA 1EV2E 1RIVH 1U95B 2VZ3A 4QWWD 3BWUC 3O6KL 4ZUTB 3FN0L 3TNNA 3RVUD 1CFTB 3G6DH 5DJ2B 1FFOA 4JO4L 2Q86A 4H26A 4NQDD 3HI1A 4TRPL 1TQBC 4NBYB 3QCUH 5GGSY 4OM1H 1MCEA 1FNGA 1DBKL 3EZ8A 3VXRB 3QUXB 2H2SC 4NBXB 2Q8BH 4YHPB 5I71C 2C9AA 4LVHB 4Y2DA 2R0ZH 3VXRD 3QUXD 4U05A 3TESA 5H8DA 3W11D 4JHBA 5BRZB 1QLEL 2VL5A 4XNMA 1X5JA 3C5ZC 4NUJB 1H3VA 3SDXA 3LQZA 2FD6H 1JPTH 4DKAA 3OG6B 1MI5B 1RJZA 5C2BL 1A6VH 4OLYL 5E8NA 1J0YA 1OL0A 1DN0B 3U30B 1GGUA 4EOWL 1UXSA 4G6MH 4JG1L 2LVCA 4HKXA 1OCWL 1UCBH 3JBG7 4KQ4H 1OGTA 4HWBA 1VACA 3O2VL 5HGHB 1WBXB 1AGCA 5HSFA 1AXTL 1BP3B 5D2LA 4ZFFA 1MVUA 3WE6B 3GIZL 2N7AA 3EYVA 3GRWL 1T66C 2FL5A 3MYJA 3H3KA 2HFEB 5SWZB 1OAZL 5EORH 3U48A 2OMBA 1QRNB 4XH2B 2OS7A 5D7JA 5SWZD 2V6HA 5CP3A 1TCRA 1QRND 3QEQB 3GO1H 2CXGA 3RIAF 1JPGA 1QSFD 3UDWC 3MFFA 1I9RH 3O3DA 3QEQD 4XCYB 2IANA 1OGAA 1FBIL 3VFOB 4UUJA 3GHEL 1A9BB 1IQWH 1LK2B 4GKZB 1I1CA 3PXHA 5E70A 2BHZA 3M8OH 2J5LB 3DX9B 4RIRA 2W0LA 1PX4A 1NGPL 2EDOA 2Q3AA 1OSPH 3INUL 4M6OL 2X4SB 1UZ8B 4WU5A 4NP4H 4LNVA 5FFLA 3MUGA 5DF0A 4RZCB 2HVJB 3PNWB 3OKLA 4PRDA 1MLBB 3BE1H 3C60B 2AV1B 1F4HA 1BQHG 3VMPA 5BZWB 1BD2E 5I30H 1F4YL 1SY6L 4J3XA 3C60D 5DSCB 43CAA 3B43A 4C57C 1NFIA 2FX9H 2OXHA 5IBTH 1NLBH 3BKCL 4NNPL 4FZ8H 1NC2B 4Z7UF 2YPVL 2NW2A 1SMOA 2CLRB 1D5MB 1GGCH 1I8KA 1CVSC 1INQA 3MRIA 4ELME 4Q9RH 3BT2L 3B6SA 4MHHG 4XPHL 1KJVA 1ADQL 1YEIL 2AJSH 3QCVH 3O41A 3QWQB 1WF5A 3JWOH 5FO7A 3WDIA 1D7FA 1OTTD 3SGJC 1YEJL 2EDXA 3RTQC 3PDOA 1P4IL 4FQCH 2M2DA 4Y7MA 3C8KB 4JVWA 1KULA 3V5HA 3LN5B 3BP4A 3IETA 3TIDA 4WHYG 5FO8B 5E8EA 3QIWA 2FX7L 4MDJB 3UBXA 5IM7A 4H1LB 2DLGA 5HYJA 4NQEE 2GIYA 4NWTL 3UTTB 3HPJA 1XGPB 1GIGH 4OIAA 4K7PH 4WRLA 2VDQH 1XH3B 5F21B 3UTTD 4YXLL 5KJRL 5E99H 4OD2B 5C7XH 2BK8A 3Q5OA 2G5RA 3QI9A 2I5YL 1E6JL 3GK8L 2HTKD 4M61A 2D9CA 5I1CH 5IJVA 3QP3A 3BN9D 5D7KE 4NRYB 4P3DA 2JJVA 2CGRH 4FP8H 3O3BB 4GW5A 4JFDA 4UNVA 4OZFA 1D9KC 1AO7A 3ARZA 2ZCLH 4JKPH 5D1XB 1EHLL 3RVVD 5MEPB 4JRYB 2HJKA 2X4OA 3OKDB 4JRYD 4GJTB 3U79A 5K59F 4NKIH 4HPYH 3TBTA 1IZJA 5C0BA 4F57L 4PLJC 5AEAA 3U0TB 5F1SA 3N1MC 1WUNT 2J7LA 4XAKD 2DAVA 3HG1E 3PHOB 1AFVL 3R1GL 3WXVL 4ZD3L 3CU7A 4IIQA 2QHRH 1IKFH 4LSRH 4FA8A 25C8L 5HD8C 3ARYA 3ES6B 2VL4A 2Y4SA 5AD0A 1QLFB 1A6TB 4XXCC 1Q9WA 4G6KL 3AS3A 4M1GL 4XVSH 3MLPA 5F7NC 2XA8H 2AKRB 1NFDB 4G7YL 3SHSA 3SKOB 1XGTA 1NUDA 4KROB 3ULVL 3K7UA 4ZNEE 2FYYA 3VJ6B 3CPLA 1FFRA 4BA8A 4KROD 5D1ZB 3WFBL 4Y88A 4IHOB 5J1AB 4LL9A 5IJKC 2XT1B 3FAXA 3NA4A 5GIRB 1P6AB 4P49A 5ANMA 5D1ZD 3HS0B 4H1LH 4R4FH 3Q48A 3O9WB 4F7PB 5B38G 2YHGA 2B1HH 3BXNB 5INCA 1KEML 4LLQB 4N90E 4O9HL 3O9WD 2CR6A 5D1QC 5JHDB 4NC1E 4MAYA 5ADPH 5HI4C 4JFOB 3WIFA 1FHGA 1G7IA 2D31A 2HTLD 3U82B 3S34L 4BZ2L 5HTSA 5JHDD 1F3JA 5C0JB 2Y9RT 1C5BL 4MD5A 5F1OB 1FFPA 2IBGA 4UAOC 4Y19B 5CGTA 1AQDB 3IU4L 5DJ0B 2DB8A 5FXCH 3FN0H 5A2LH 2NY3C 4Y19D 5TE6L 4FABL 1CDUA 3QHFL 5J57B 3RDTB 2DICA 2VDNL 3CSYB 1WWAX 1J11A 5K33A 3U7WH 3FFDA 2ZOKA 3RDTD 4QWWC 4ETQA 1BAFH 1Y6NR 2UWEA 2Q7NA 1L7TH 3FO0H 3TH2T 4UIMA 3BRFA 3RVUC 1PG7H 1NFDF 2OTUB 3LD8B 1KF9B 2A73A 4U6HB 4P4KA 1FZJB 3BHBB 3BQUB 2PTVA 3CDGA 1WWWX 1EJOH 2J12B 1CK0H 5EU6B 3BQUD 3NCBB 1QBML 1MRDH 1UH3A 1OT1A 2BSRB 6FABL 4EXPX 5EU6D 2YMXL 4PV8A 3QUXC 3K0WA 1A4JB 3EIFA 4MMXC 1BGXL 3MUHL 1VGKA 3W11C 4MB3A 1BJ8A 4GKSA 3CJJA 1NCBH 3H9HB 1OCWH 5DHXB 3K2UH 5HYQA 2W1NA 2C4FT 3BN3B 3MCKA 1M1SA 2VQUA 3MZTA 2BNUA 2ZUQB 5KSUA 1RZFL 4UV4H 5J9PA 4YHKH 2VR5A 3HAEB 3SDCB 4LKXA 4WHTB 2AQ3A 2AS5M 2DMKA 3BZ4B 2XQYK 3SDCD 4KZDL 4P2CG 3U30C 2D9QB 1H3UA 3EZJB 1MCFA 2GJZA 5EOCL 1EO7A 5JTWA 3IGAA 4H8WL 4TNVK 4KTEH 3OKMA 4NKQB 2B0SH 4ZFZA 4CN1A 1A6ZA 4IM8A 1CL7I 1RZGA 3RX5A 1GHFH 4MQTB 3LPWA 2R1YA 5EUKA 2A6JB 1S7TB 5JR1L 3LKSA 4ZAKA 5FA3A 1ZLSH 3IDYB 4W4OA 4WJ5B 5E2VH 3BISA 5HHPB 3GMQB 1AD0A 5IEHA 3DSFL 4KKCD 5GGVL 1HCFX 3HI6L 2Q76A 1FBIH 2XZQL 1OP3H 4BKLB 1G0YR 4YAQB 1XF5B 1DE4B 1QR4A 3WFHA 2Z8RA 1UQSA 1KC5L 4WDIA 5I18L 1MH5B 5SX4H 3HC0A 3G6AA 4PY8J 5IK3A 2ADGA 3KLDA 3BH9A 1I1AB 4G43A 2OJZH 5DT1H 3IFLL 5D7LA 2AEPH 2VQ1B 4S0SD 5ID1B 4NJAH 1I1AD 2FBOJ 5TFSH 5CKGA 4MMZC 4GAGL 4L29A 2NZ9D 4YBHA 3LEYL 1JRHH 2J5LC 3QG7H 1B0WA 1QSEE 2QSTA 3MBEB 3IYLW 5IGXL 3NIDE 3BKCH 5FA4B 3MBED 1P4LB 4HWEH 4Z7QE 5FO9B 1ZVSB 1CXLA 2ZZUT 1L9NA 2IG2L 4U1HA 3SEPA 4NHUB 5IMOA 1KNOA 4CMHB 3C60C 3L3HA 4HUUB 2FJFB 3PHQB 2V7HB 1KB5A 1JHTB 4KAQH 3P0VH 4RAUA 3HAEH 3CVHL 5DD6A 5ALCH 5FYLL 3MPCA 2BCKB 4LSDA 4ZSOB 1VDGA 4UTBH 4MCYB 1J1XL 3LMJL 5DZNA 4MAUH 3MJ9A 4UZGA 1KUMA 3QUYA 1WBYA 4WFGD 5FGRA 1OTTC 1T1YB 1OQOA 2WW8A 3HI5H 1WIPA 5HDQL 5EOCJ 4U6YB 1KPRA 2QKIB 3CX2A 3GB7A 1JZ2A 5C0DA 3P4NA 3OJDB 1J5OL 1R24A 5BXFA 2EO1A 2NYYD 3RY6C 1E6JH 4BQCA 2OQJB 4JY5H 4PRHE 4R4ND 4N9GB 2YUWA 5JW4Q 5C9JA 5EZJB 5CZVL 1KT2B 3ARQA 5JDSA 3LS4H 5D70H 3MJ7B 1INDH 1AP2A 4OV6F 1G9NH 5DMJB 4NZJA 4TPRL 2HTKC 5HJ3A 2EDTA 3GJEA 1XCTA 2UY6A 5DURB 3SDAA 3BN9C 1Q38A 3FB5B 3IAQA 5DURD 2BXZA 3GSOB 3OKOA 4U1SA 4K3DL 5JLZA 4PTTA 4CMMA 4X4YB 4FTVE 43C9A 3FQWA 4RMTA 1ACYL 3QISA 3RVVC 2HFFB 3ZDXF 1JGDA 5DRWA 7FABH 4N8CL 1U92A 4HMEA 3IDIA 4QO1A 4UBDC 3WXVH 1A6UH 4WW1A 3B2VL 4HIXH 4I0PB 4Z7VA 1A7PL 3NAAH 2HFGH 4JFEE 3P30H 2GY5A 3DURA 3RU8L 3LS5H 3MLZH 3R0MA 4I0PD 5LG1A 5SWSA 1KCVH 3MV9B 5ESQA 1S9VB 3VRJA 1QBAA 3E6FA 1X6NA 3O0RH 1ZMYA 1JWSA 3WFBH 5JIPA 5HDBE 1H15A 5FDWB 5J12B 3OV6A 4AG4H 4MX7A 4JFHE 3D0LA 4YHIA 4KJQD 4F58H 3PP4H 2ZCKL 5E5MB 5FB8B 4X80L 5LBSH 4KROC 4OB5H 4YGVA 3MNZB 1TDQA 4U3XA 4U3CA 4MNGE 2VLLB 4JCLA 5D1ZC 2XN9E 4G8IA 2JB5L 3JV0A 2EIZA 1NFKA 3A6OA 3U0WH 3L3JB 2BXYA 1WICA 3O9WC 4BH8A 4L8SA 1YN7A 4WCYH 5E08L 4LCWA 2YPLA 3JVGC 3BZDA 2PYED 3MSPA 2HTLC 8FABA 2OR8A 3WN5B 4YHLH 3CFEB 1MFEL 1LDSA 1BQHA 1T2JA 2CK0L 5LGHL 3VXUE 1T4KA 3KPNB 4YE4H 4G3YH 3SDDC 4JO3L 5CD3A 2Y5EA 1IBGH 4ONHA 3HZVA 3SJVA 4S1SL 4EVNA 1KYOJ 5EBLA 3RDTC 1UXWA 4D9QD 1CLYH 4PJAA 3ZKMD 1YY8B 1OW0C 4LARL 2DL9A 1MCPH 3LD8C 3S7GA 5CEXB 2D0HA 1NGYB 5H2BA 5BS0B 3V8OA 1HXMA 3BQUC 4GSDH 2IMNA 2Z92A 4NT6B 4NN6C 1M71A 3S5LA 3TYGL 3VFWA 3DXAE 2F5BL 3C5JA 5EULV 5FKAA 3RWHB 3I9GL 2ZCHH 1IAMA 2W0FB 2C3XA 2A74A 1JCKA 3BMVA 5T3XL 3C08H 3HZYA 1N59B 1W8OA 2QADB 3ZL4H 1TLKA 3O2DL 3RUGA 2XZCL 3VXOA 5K9JL 1A14L 2QADD 2VXTL 1X5KA 2ZUQC 3EJJX 3WSQH 2EKSB 4LDEB 5JXED 2R2HB 3LSOB 2H26A 4JLRA 5JR1H 1A1OB 3CCHB 1FRGH 1D5BB 4X7TB 1NMCB 4N0RA 5GS0L 3TP4A 4GS7B 2CLVB 1W72A 3HI6H 1XAUA 1S7XA 3ILPB 4JAMB 3NCFB 4G9DA 3UZVB 3V8CA 4PB0L 5B4MD 3LEXA 5HY9A 4PJIB 3IFPA 4JHWL 1Y18B 3CLFH 3V95A 4KKCC 3DGGB 4AYFA 3IDYC 2J6EH 1FL5B 2DTSA 4OAWA 5I9QB 5DQDL 5L7XL 4ZTPL 3TBVB 4WEBH 1NUGA 1CFBA 1FAIL 2PETA 4OZIB 4UV7L 2YWZA 2RAMA 5IEKA 4UMGA 3VD5A 1CU4L 1ED3B 4A6YB 1G9NC 5I19H 2PW2A 4XBGB 4L4TA 1TQCB 1D5IH 4M6ML 1K4DB 4O51A 3MV7B 1I1AC 4EDWH 3LY6A 4NO5B 4QRPB 1FL3A 1KJMB 4NQCB 3MV7D 1B90A 3W39B 3VFVB 5CIPA 5EIVA 3EDKA 3ESVF 1UVQB 1K8DA 2VZTA 4NQCD 1TETL 2VLRE 4ODWB 3FO9B 4PJDE 4YDIH 3MLTA 1B0RA 4YDVB 3VRIA 3CVHH 3MBEC 4Z5RB 5C0EB 2EE3A 4XX1E 3VFNA 3CNKA 1CTOA 2ADFH 2X9XA 2EECA 1NGQH 2DM4A 2VISA 4PJFE 1GJIA 1JNHA 4JDZA 4HULB 2JELL 1U3ZA 1G1CA 3MV8B 3HNSH 4CMHC 2WQRA 2X4QA 3D87B 3MV8D 2CJUH 2R4SL 4QKXB 4HGWB 4J12A 5ALBL 1BBJA 4NQSB 3UYPA 5KTEH 5DQ9A 1OP5K 2V7NB 4JFFB 4J6RL 4KU1A 1J12A 5EBGA 3IVKB 1CGUA 3QUMB 3NFNA 4GQPH 2GFBB 1II4E 2PYFB 1RZ7L 2H8PB 3QPXH 4Z7NF 4ODSL 4ZG1A 1P1ZA 5DI8B 4WGVB 2X2YA 3OZ9H 2R4RL 4QY8B 4RWYL 1WIOA 2XFXA 3EFDH 1F97A 4HXAL 3BIAX 1F11A 1GAFH 1ZA6B 1QKZH 1EEUA 2APWA 1A4KA 1FLRH 4WHCA 4R4NC 5B3JE 5F93C 3NVQA 3QIUB 4GG8B 3D85B 2Y07L 5A16B 1FO0B 4JFYA 3QIUD 3CH8A 1XR9B 4NM8H 1FGVH 5IHZA 5HDOA 4QHMB 4E0RB 3NMEA 2PTTA 4ELKA 3O8XA 2A2QT 4A6YH 5L6YL 5C2UB 3J8F7 1EBAA 4ZOEA 5BOZG 3FO1B 1NUNB 4TSBL 4YBQD 4RDQF 1CR9H 4OGXH 5AZEL 4X6CB 5FECA 1XEDA 5EIIA 5SX4I 2MMXA 4ZUVA 5JIKA 1A7OL 4ONFH 2H9GA 3S96B 3O6LL 1J10A 4YPGA 4QF1B 2OM5A 1BJ1H 3C8DA 5KSBB 4JGUA 3UYRL 4YEEA 1TNMA 3QO1A 3DETD 1I1YA 2EDHA 3U4BH 3U7AA 1MRFH 4UILL 5TDNA 1LE5A 4EUPG 4NQDE 3GBMH 1OARL 3RL1A 4I0PC 1UM5H 3BSZH 4M93C 4Z78A 1T6VN 3VMOA 1JRHI 3K2MC 3O2WH 4KMTH 2JJSA 5FV1L 2Y25A 5TF0A 3QQ9D 1JK8A 4Z7WB 3VXRE 3DVIA 4I4WB 4Q2ZA 5JXAL 1A7RL 3N1FC 2FATH 4P9MH 1R0AL 5DJDA 2X1XR 3MQIA 3BEVB 3EJZD 1HEZA 5DD5H 1HE7A 4XMPL 4HW6A 2UYLB 1MUJB 4HHAA 3T0VA 1FH5L 5I1EH 4UINL 3QUMH 3O3AB 5HGBB 4K3HA 2J8UA 4HC1A 4KJQC 4PGJA 5J12C 1RK0B 2YD4A 3VGFA 4R7DB 2VH5L 4F7EA 3KYAA 4OLVL 4G8GB 5DUBA 1HYRC 3MOAL 4PR5A 4X6CF 5GISL 3QJHA 3LRSA 1R5WA 4M43L 1KXVC 4G8GD 3FT4A 4EN3B 2R2BA 1IM9B 1SVZA 5SV3A 5KSBF 2PKDA 2XY1A 5JQ6L 3KXFB 4LCCA 4L8DA 4EN3D 3O3EB 3R0NA 1IM9D 3CFBB 2I24N 2RQ8A 3NN8A 4APQA 2LU4A 3V0VB 4I3SL 3RHWK 3KXFD 4X8JA 1CE6A 4YXKL 1MPAH 4FXKB 4HBQA 5AYQA 2A77L 3WN5C 2G5BA 4MQ7B 4Q9BA 4EI6B 2P24B 5SWZE 4Z7WF 2FZ3B 1PKQA 1P2CA 1AJ7L 4MJ6A 1QRNE 4FQ1L 3W9EB 1YDPB 1QSFE 1F8TH 2ILLA 3QEQE 1I7TB 2DQGL 2FB4H 3GSWA 3VFGH 3QNZB 3GMNA 4HDIB 2DBLL 3OKNA 4KVNL 3G5VB 3ZKMC 5FM5O 3TYGH 2DQEH 4G8EB 1KTRL 3ZHLA 4CDHA 2XWBB 2PR4L 3V4PL 3BP5A 3STLB 1ODAA 3PGFH 4C55A 3T0DA 4YDJA 5JIIA 1RIHL 2H3NA 1VADA 3D5OF 1NCCL 4Y16A 1ZVYA 3PWPB 3VDAA 4JG0L 4BFIA 5E2TH 4ZS7H 2OK0H 1RY7B 3PWPD 5HHMB 2AQ1A 3P9WB 5FUCC 4J1UA 3WIHA 4NC2B 2BRRH 3T2NL 1NCWH 4YDKL 4FQPA 1SYSA 5HHMD 2QSQA 2SEBA 2J88H 2QADC 4RAVB 1KG0A 1FFNB 4FQ2H 1P7QB 2HH0H 1FNFA 4KUZL 4ELMA 5JXEC 3DRTB 4GUPA 3MA7B 1P7QD 4QXGL 4BSWA 2Z31A 3MLYL 1UWEL 2NY5L 3TVMA 1OB1B 1S5IL 3H8NA 1KYOK 3H2WA 5GGTA 2NY0B 3W5NA 4OV5A 1NMCC 1B0GB 5IQ9A 2DQTL 1X9QA 4GS7C 3BGMA 5DZOA 3LAFA 1FLTX 3DJ9A 3MUZ1 3FOMA 4XPBH 5B4MC 2NY0D 4NZUL 5F7MC 3FKUS 4XCNB 1M05A 2OSLB 3QDHA 2FWOB 3DVNB 5DDHA 1U8KB 4JM2B 4PJHB 1EEZB 2AXFA 5EBWA 1I7UB 2NLJA 5K59E 5CWSB 2E7MA 4AK1A 2I9TB 1IEBB 1QBLH 4NQEA 4CNIB 5C0CB 3OJMB 3K4ZA 4YGAB 5TF1H 2DI7A 4U1NB 1B2WL 1F5WA 1UB5A 4MNHB 5EWIL 1SM3L 4LDOB 5DD0H 5C0CD 2QQKL 4G8FB 3N1GC 3UTTE 3MRNB 3P4OA 4CVXB 3UTSB 5I9QC 4DN3H 2YN3A 3P11H 3UJTL 4EI5A 2BP3A 2VC2H 2DKMA 4NYLA 1MFCH 3UTSD 3G08A 4NZTH 3NPZB 2AGJH 2D0GA 4NN5C 3PWJB 5E8DL 3KYMA 3IDMB 2P49B 1TQCC 1UM4L 4XI5D 4OGYL 4X6DF 4HIEA 2BHYA 4Y5XB 5F6HJ 1G7MA 3LKPA 3TBSA 3PHSA 5HVGB 3VFPA 1BVKB 1E4WL 4FFWD 1OP9A 1SBSL 4HH9B 2JB6B 1FJ1B 3VXQB 3PQYD 4KZEL 1LWRA 3L7EB 2R4SH 4JRYE 4PS4L 5ADOL 1ZGLM 3GMLB 2RIKA 4PJ5B 5EZOL 4JM2F 5IW1B 4DGYH 4J6RH 5HYFA 4R96B 1LO4H 4YQXH 1K8IA 2GJJA 4XAKE 4HLZH 3HG1A 1JGLL 3TV3H 3WL9B 2W9LA 3SE3A 1H3TA 4ENED 4K9EH 1S7UA 3OAZK 5C09B 1OD7A 3CC5A 4XRCB 3VW3L 5C09D 3QUZA 2NZIA 5F88B 2MJWA 4HXAH 3SOBH 5DK0A 4JVPA 3HR5B 4XT1C 2J8HA 1HQRA 2A0LD 1U8IA 5EU3A 1U8NA 4ZNEA 1O0VA 1AE6L 3HZKB 4PRBB 2EH7L 2D2OA 2VIRA 1OF2B 5FUOL 4MLIA 2CMRL 1BFVH 3MRQB 1FNEB 4RFNB 4AIOA 3K4AA 4LSVH 3CGTA 1DQTA 5L0QC 2YEZB 3F6IA 3DNKA 2C4XA 3BPNB 1LEIB 1RJCA 4XX1G 2C7UA 5HHXH 4NO3A 1DBJL 4NJ9L 4C54A 4TULH 4GG6F 4LHUG 1LDPL 3QIUC 3V5KB 3F7YB 1G6RA 4AT6A 5JHDE 2Q8AH 5KN5B 4UQ2A 1J7VR 2FHBA 1QLRA 4YHNA 3T65B 4Y19E 4F7MA 1IMHC 2Y06L 1YEDA 1ZK9A 1QFUL 1J0ZA 2AAVA 4U33A 1NMBL 4AH2B 1MOEA 5DS8B 3LN4A 1J1OH 4YIQA 4PGBB 3P77B 3HRPA 4C59B 2DTML 3GSVB 4X6FB 3NGBB 3KWWB 3CH1A 3DETC 2WUCL 1A6AB 5F89A 4AQ1B 1FGNL 4IBLT 2VXSH 2ZOLB 3G5ZA 1A1NB 4V2BA 3OB8A 5A3ID 4HV8A 3Q1SH 3CFKB 5LCVH 3MYZA 3EDFA 2GJ6B 2EDEA 4ORGA 1FV1B 3VXMB 5EU6E 3QQ9C 3L9RB 2YRPA 4OCRH 5CUSH 3WNKA 2MPAH 3VXMD 4E5XB 3F58L 3ZSSA 2IAMA 2VO5A 3EJZC 1JF5A 2P1YA 3TLRA 5L2KB 1YMHB 4LSPH 3I3EA 1ZTXH 1JZ8A 5F70A 5L2JA 1Q0XH 3OR6B 3JTTA 4DVRL 5GGSB 2VABA 3MMEB 3EO1A 1H5BB 1T1XA 3GSNB 3HNTH 4Z95H 1N7MH 1X5FA 3I6GA 4YWGH 3ARUA 4FXGB 4P4RB 5DC4B 3QUKB 5GRJH 3FQRB 3KHQA 4G42A 5TH2A 1N4XH 2P7TA 4OLUH 2AJUL 3DYMA 4TNVF 4AENB 1A1MB 5E24E 1H3WM 4M62H 2JK5A 5FK9A 3T4YA 3H3BC 4DUWA 2A6DB 3MREA 5E2JA 4W6XB 3QWRA 3KLHD 1T89C 4NGHL 5CHNB 2EIBA 2K7PA 2F8XC 4MDIB 3MJ8B 3WHE0 3OGCA 2QR0B 5I1HL 3GI9L 1TZHA 4M8VA 5DJYB 3ZDZF 4KY1H 1UB6A 3REWB 1B3JA 1KLUB 1KPVB 4HIJA 1F13A 2V17H 4XMLL 5E9DB 5GGRA 3A6BL 2CIIB 3FN3A 4N9OB 5E9DD 1CBVL 2H32A 4S10A 3ZTJH 4IMKC 1TVHA 5IMMB 2KUTA 1QSEA 3V9FA 1HHJB 3FB7B 5IFAH 5I66B 2XOTA 4GBXC 3NCJH 4NFBA 4KI1A 3EOBA 1CFVL 5CILH 1FVCA 5DRXA 4AY0A 2IFFL 4P2OC 1F4AA 2HKFL 4QXGH 3HRZA 1A02N 1LD9A 3MLYH 5DMKB 1L4IA 4LKCB 1S5IH 5AYUL 1MCWM 3LOWA 4JPVL 3MLVL 1OAKH 4K8RL 3QWOA 3VD9A 3DX6A 2DQIL 4HUVB 5IF0B 4HJJH 5CBEB 1TVBA 4I77H 3TZVA 4K9EC 3GSNH 1AXSA 2IQAA 5J6HA 2ITCA 4ZSOE 5JO5A 1KTLA 4KHTL 4UT6L 1XF3A 3TH4T 3GSRA 1NDGB 4W81A 3DX7B 1RZIA 4DCQA 4WFGE 2AVGA 3H7BB 4PGDA 4H88H 5FUZH 4P23B 2BC4A 1EFXA 2R0LL 2FJGB 4GXVL 4OSUH 4OKVA 1VKXB 1ITCA 3ZE2F 4DW2H 4P23D 2DN7A 3J7HA 4P2RB 4AL8H 4QOKA 1V05A 3KPOB 1A3LL 4Y4FB 4A2LA 1LO0H 5F44A 1HDMA 4P2RD 5I6XB 3HC4L 4GW1A 2NX5A 4MCZB 3X14B 2X05A 3L3DA 1AR1D 4X9FA 5HPMB 4Y4FD 2DQHH 1OLZA 4U1JA 4JFXA 2QSCH 4DKEL 4GQ9L 4LF3B 5KW9H 5CJ8A 5I1DA 3IDNB 3U6RA 4LLMB 1T5WB 1X7QB 4U3HA 5HYIA 4HEME 1JF1B 2WUBH 5C86A 3Q3GB 4I13B 4O5LH 4PTUB 3WFCH 3WNMA 4UB0H 4KV5F 3U46B 1IFHL 5LAXB 3AU1A 4N68A 4JHAL 4PJ7F 2E9JA 4PS4H 1RZJH 4FTVA 5KOMC 1DANT 4HIHB 3QHTC 3L1OL 3MRBA 4BSVA 4JFZH 1JZ3A 1VESA 3UMTA 1FL6B 2HWZL 3E6HB 2Y36L 4Y5XC 4FFWC 1YNTB 4MWFA 3KS0J 3RPIA 3HZMA 1TTUA 5IB1A 2D7TL 3QDMA 2FO4B 2GTZA 4JFEA 4R97B 4MA7H 2NTFB 4U1IB 2W0PA 4G6JL 1GGYA 4Q7DA 3M17A 4FG6D 1XZ0A 4H1LG 3MRFA 2ICES 4D0DB 3GM8A 4N1HB 1JPSL 4ENEC 5I16B 3SKMA 4G80B 1CXHA 3QXDB 4WO4D 3C5ZA 4U1GB 3N85L 3MBXL 1RU9L 3KYKL 4X6EB 4D0CB 2O5XL 1LO2L 1IM3B 1NUFA 2CDFB 2DWDA 3EGSB 1EMTH 1H8SA 3P0YL 4D3CL 4Z8FH 4FQIH 1RHHA 4Q97A 4MNQB 1HH9A 1DCLA 3P9LA 2R1WA 3OHXA 1LP9F 4UTAL 1J0JA 4XNXL 1JYXA 1GZPB 5ERWB 2XN9A 1XF4A 2CO6B 4RFNC 1G7LA 3FOLA 2G60H 4EBQL 4M9PA 1DUYA 3BGAA 4FQHA 4U6VH 1T7YA 3BPNC 1QR1A 5GJTL 2DQFA 2PYEE 5BJTB 2CXKA 2PCPB 4PJCF 4Z0XB 5L9DL 3V52H 4U6XB 4NWUH 3VXUA 1U8QB 2FDBP 3DROA 3L3KA 4IEFB 4XCCH 3QFDB 4CVZA 1DQDH 3A6CH 4JO1H 2X9WA 4LNRA 1MHPL 4P3CH 2EIDA 4LSUL 1CFNA 3ZMRA 2R9HD 1HQ4B 3NFPA 2NW3A 1RZ8B 4D9QE 2CLZB 4GMSH 4WFFD 3I3BA 3WFDL 1R3LA 3HC3L 3M1BB 4MA8H 3S98A 4GW4B 5DEZA 1BX2A 3IF1A 4OCWH 3ZKND 3HKFA 1T3FB 3FJTA 1MHEA 2B39A 4KVCL 5GRXG 3DXAA 3AS0A 5C0FB 1AKJA 4G7VH 1F42A 5DD3L 1LEGB 1V3JA 3MRPA 4LLUB 3FQXB 2E7LC 4ODTL 4RISL 4WIQA 5J11B 5J89A 5FUCE 3OQ3B 2FBJL 1Q9LA 1NLDL 3TIEA 1R3IL 3S97C 1UACH 2DYPA 3I3DA 4Z77B 3TCXA 3I02B 3MR9A 3MACL 3WO4B 5EPMB 5CJOH 2W60A 3JUZA 5B3NA 4PJGB 4S2SA 1OAYL 4OD3H 1R3JA 4LPUA 1I7RB 1NBVL 1A5FL 1C5CL 1J8HB 1H5BC 1W72L 1L7IH 2VITB 2WV3A 2ZUXA 3H7LA 5F1NB 3SGJA 1OAXH 4EDXA 1J8HD 1VFAA 5DRNA 3RTQA 5MEOB 2A83A 1RJLB 4GAYB 2IQ9L 3BW9A 4S1QH 4X0KA 4CJ1A 4X5WA 2X4NA 1EO5A 4XP5L 4RQQA 4POYA 2FEEL 4JB9L 4WU7B 3KLHC 1HIML 4PJIE 3A67H 5TPWL 3BZEA 1IQDB 2C26A 5E4EB 3U2SB 1C08B 4RA3A 1KENL 1NCDH 1S9YA 1TJHH 2VQTA 3UROR 4GKOA 4KDTC 1FZOA 2X70A 1RAMA 5H37G 2MCPL 2B2XL 2Y5TA 4ZNCD 3QEGH 4UT9H 2HAZA 5FM4A 4HK3N 3IS1X 1YEKL 5FHBL 2H1PH 4KUCF 4MSWA 3BZFA 4Y4HD 1H8OA 3N06B 1S8DB 1I3RA 4OZIE 3RIFK 2EDBA 3HAEG 4QRRB 3IDJA 4ALAH 2ZSWA 1IL1B 5FYKL 1QFWL 1RUMH 4PJGF 3MV7E 3TO2A 4UDTA 2VLRA 1RZJC 4NQCE 1SYVB 4PJDA 4HEPG 1SJHA 3KDMA 3LKNA 5ESVA 3ULVF 4BFGA 1QEWA 1E27A 5GRUL 4KGLA 4N0CD 4BZYA 4P5MB 2VXUH 2DJSA 4KRLB 3W0WB 4PJFA 1KIRA 4N0YL 5IHLB 5DUPH 3B8YA 2XKNA 3MA9H 1LGVA 4LHUA 3T09A 1GOGA 1DLFH 5FKPA 3W0WD 5JNYB 4UT6H 3V2AR 4YR6A 3V0AC 4GKNB 4KTDL 2ICEA 2YKLL 3MV8E 3QXAB 2BFVH 4R6UA 5GS2D 3NH7L 3F5WB 1MFAH 2GK0A 3V5DA 4EIZC 4XXCA 4KMLB 1BM3H 4DZBB 3SDYL 3RWCB 2R0WH 2A9MH 5HYSB 4XB7A 2VLJA 4KFZC 1MF2L 1Q0YH 1IAIM 1CLOL 1T22A 2VAAA 5BQ7A 3LB6D 2E5EA 2V9QA 4XP9H 1F4XH 1OSZB 2YWYA 1YEHH 4QRUA 1Z5LB 4WI3A 4M4PA 1BOGB 2HVKA 4P23C 2CRIA 5IJKA 5KG9B 4OUUA 1YEFL 3EO0A 2VLKB 3QEHB 4G9FB 4HJGB 2X1WL 4ZMAT 1GGBH 1AR1C 4Y4FC 1EJ6A 3FB6A 3DIFA 2VLKD 1BLNA 4G9FD 2OZ4H 5DJCB 5HGAB 1SHMA 3NOIA 3D2UD 3RVTD 4NSKA 1OP5H 4M5YL 5F7DA 5DRZB 3OMZA 1BBDL 2XKSA 4MGXA 3O45A 1FZMB 2HWZH 3OF6D 4FQXB 3RBGA 2XXMB 3ZLQC 1YQVH 2DQUH 1EAJA 3PIQA 1JP5A 4LPYA 2HRPL 3HUJA 4KKNA 4FQXD 5GS1B 3OX8A 3IJYA 5CBAA 4PG2C 3ZSTA 3WJJC 1CT8B 4OM0L 5C0GB 1A0QL 4G6JH 5JQHC 4PREA 4X6CE 4BQ9A 4AEHH 2OP4L 5E1HB 2G75B 2FH6A 3DUUA 4M3KB 5KAQF 1RFDL 4JO2L 1U95A 5T1DH 4ZUTA 3UPRB 1XGUA 1CFTA 4NQDA 1DTUA 1Z9OA 1CDGA 2MWCA 4ZFGL 1DDHB 4FG6C 3UXFA 1G7PB 1T80A 3MNWB 3VXRA 2HG5B 4LRNH 2W9EH 1VB9A 3QUXA 3ZZ1A 1Q9KB 4NOBA 5AUMB 3ARWA 5E6IB 4YHPA 5GS2H 3ARBB 3VXTB 4Z7WE 4WO4C 4M8QB 5E6ID 1VCAA 2KZWA 4U1GC 4NUJA 5KSVA 1I7ZB 1C16B 5F97E 3CK0L 3KYOB 5GGUA 1O7VA 5C0RL 2GK2A 3QH3B 5FHAH 4EBQH 3B9EA 5DMIL 1VSCA 1UYWH 3DARA 3LPGA 5KS9B 1DN0A 3IB4A 1BECA 5EOQL 2EXWD 1J1PL 3GSXB 2Z93B 1PKOA 2F53B 1HZHL 2WMPA 3R4DA 5MP6H 1GZQB 4G8GE 4L8CB 2F53D 4NKDB 5HGHA 1WBXA 1VA9A 4OF3A 3P73B 1S78D 4LCUA 3WE6A 2X10A 4R4BB 3KXFE 3WNPA 1FZKB 1G0XA 4YFEA 4QXTB 4R2GB 1UKQA 2HFEA 1QRNA 4XH2A 3O81A 4X98B 1S7QB 4BFBD 5F7UA 4OLXL 1QSFA 4M3JA 2I07B 1FCCA 3QEQA 1INEH 2R9HC 2QQNL 5CCKH 1U8OB 4XCYA 5EO1A 3T8XA 2WLZA 3HE6A 1UKSA 4FNLL 3WV0A 1PEZA 1A9BA 1LK2A 1KJ3L 4GKZA 5B38B 3KLAA 4RA0C 4UDUB 5EH1A 3WXWH 3EOTL 2AJXL 3DX9A 1RMFL 3D9AL 1KBGL 3NPSB 2FBJH 3ZKNC 1K85A 3VFMA 4RGNB 3RNQB 2D3VA 3QG6B 3DVGB 1PX3A 2H2PD 2X4SA 1UZ8A 2W9DH 4RGND 2IGFL 1CN4A 3ZDYF 4GOSA 5DVKA 1OPGL 3PNWA 5TE4L 2O5YL 1IKNC 1OAYH 1MLBA 3PWPE 3RKDD 4AEIL 4Y89A 3C60A 1X5IA 3OBAA 2JCCB 1EUUA 5HHME 3RGVB 5DMGD 3GHBH 5HYEA 5JOEA 5EZIL 3RGVD 3T0EB 5CSBA 3AAZB 5E2UL 2ED8A 2CUMA 2CLRA 3G5XB 1D5MA 5D93B 3T0ED 2IADB 5GGTL 4NKMA 4Y5VB 1PBYA 2BVUA 3QULA 5JHLH 2APXA 4KMQA 4WTWA 2HN7B 1J0HA 3KG5A 2B2XH 3C8KA 4GRLB 1GOFA 1YC7A 5TQ2H 2H45A 1M6OB 3LN5A 3E8UL 3G04B 3MCLL 5D9SB 4PJHE 3I6LD 4JDVB 5FO8A 4MDJA 5EC1A 4GRLD 4QYOB 4H1LA 1Z0NA 3UJJL 5E4EC 3UTTA 2M1KA 5C0CE 1QYGH 5HHOB 5CAYB 2IBBA 1JNNL 1JPFB 3UZQA 1XH3A 4JZNB 4XVJH 3ULSB 2XWTB 3MRMB 3O6ML 1JNLL 5HHOD 4CAGA 4OD2A 5DUML 4Y4HC 3UTSE 3FRPG 2OCFD 2FX8L 1R6VA 4K3JH 1D5XA 5GHWH 4NRYA 5IB3B 3F6LA 1Z3GH 4HS8H 3NTCL 4OI9A 4RFOL 2R29H 4HKBA 2VDLL 4BK4A 1IT9L 2ESVB 5IFHL 2BSTB 1R3KB 5MEPA 4JRYA 3PQYE 4N0CC 5M94B 3VGDA 2ESVD 5BV7L 1Y6MR 1U8JB 4PGCB 3OKDA 4ERSH 2AXJA 1GGIH 1N0XH 1M7DB 1U42A 1ZT1B 3CDCA 5F96H 5GJSL 5I2IB 5E7FA 3U0TA 15C8H 4O2EB 1YNLL 2VDRL 1LNUB 1N26A 4K7FB 3RWDB 1KEGH 4BH7B 3PHOA 5JW3L 1I3UA 2GSGB 1EGJH 3H0TB 4UNTA 5C09E 1FE8L 4GXUN 4IRSB 1NCAH 1A6WL 3R06A 3ES6A 2LQRA 2HLFC 2ADIA 1QLFA 1A6TA 5ID0B 3MFGB 3RA7L 2MHAA 3LB6C 4WWKB 4LLAA 2AKRA 3SKOA 1JGUL 4K3EH 5HI5D 4WWKD 3RWJA 3BKML 4XNUL 3B83A 4QRTB 4IMLA 5D1ZA 4DEPB 3NZHL 4IHOA 5J1AA 1UJ3B 2ICWB 3KPMA 5GIRA 1H3PH 4TN9A 3HS0A 4J7RA 5EA0L 3DYOA 3O9WA 1JZ7A 5ETUB 2BOBA 5D8JH 2F58H 2HRPH 3OAZH 3BXNA 3JVGA 1ORQB 3JUYA 4Z7OF 4M00A 1TZGH 1JTPA 1G6RL 5JHDA 1YPZB 1NL0L 3M07A 3S37L 5LXGL 1V3MA 2OI9B 4UT7L 2P4AB 3V4UH 1NGXB 5C0JA 3SDDA 4S1RL 4O2FB 2WM0A 2XTLA 5E2WL 2VZVA 1AQDA 5AZ2H 5JOFB 1BWWA 4RDQG 5DJ0A 1YECL 4FQXC 4P57A 1EO8L 4OFDA 2R23B 5GZOD 4TUOB 4O58L 3RDTA 5DLML 4R8WL 3CSYA 2P5WB 3VXSB 3FT3A 3N9GH 5IV2B 1OHQA 2DIBA 3T3PF 2P5WD 4E41A 3VXSD 1OW0A 2OTUA 3K80A 1XFPA 2A6KB 4DVBA 2X4UB 1FZJA 3BQUA 4HJ0D 3VXNB 4ISVB 5JW4M 3IFOB 1BD2D 5E00B 5EU6A 1TPXB 4OZHF 1AIFB 2BSRA 3PWVB 2FO1A 4HXBL 2MFNA 5FGCB 3VXME 1ZEAH 4XWGL 5J1TC 1A4JA 5E6IC 1T03H 2J4WH 4OLZL 2R39A 2EEAA 3H9HA 3DI3B 3HA0A 3S36L 3WFEH 4XGZB 2X40A 4ZPVB 3DO3A 1MQKH 1NSNL 4PG9B 5DZLA 2YZ1A 3HAEA 1ROWA 2AERT 3CFDB 4PBXA 3EO9L 3BZ4A 2EXWC 1URLA 3CZFB 1DZBA 3UO1L 1KOAA 1F90H 2HKHH 2YXMA 4KGJA 5T1LB 1HYSD 4F33A 2PUQT 4P59L 3S4SA 1A64A 3HE7C 5LJYH 1G9EA 4PBWD 1AD9B 5T1LD 4WUUB 1S78C 2BVOA 1ZWIA 4Z0BL 4Y5YB 3GMRB 4HAFA 5F8QC 4WUUD 4WJ5A 5HHPA 5T5NG 3GMQA 1DFBL 2YUXA 3EYFA 2AI0H 3CXHJ 4JY6A 1FG2B 4YAQA 3WKML 1XF5A 3D39A 3S35H 4LBEB 4MXWL 4M02A 3C5SB 3X3FH 4TUKL 5JORB 1MNUH 1DE4A 2BZDA 4IOSD 5D7IB 1RMFH 2ZPKL 1MH5A 1KBGH 2EYSB 2BMKB 4D9LH 3SE4C 2X4RB 3ZT5A 1DQMH 5E9DE 4JPKL 1I1AA 1YMMB 1I4FB 1UA6H 1HXYB 2VQ1A 2ADJB 2GITB 5ID1A 2O5YH 5DJXA 5AAWA 4KJYA 3L5XL 1YMMD 4CDGC 1SMAA 5K9QG 3RAJL 2J1KA 4HBCL 4LPXA 3CMOL 2DRUA 3NPSC 5IHUL 2H2PC 3MBEA 1W2KT 3G6JF 4RGNC 1N3NB 1MJ8H 1KXQE 2YBRB 2WBKA 2X7LA 1O7SA 3MLUH 5FA4A 3RBSA 1JV5B 1KFAH 1P4LA 1KLGA 5FO9A 1WITA 3OXSB 1ZVSA 1XCQB 2YA2A 4I9WD 3RKDC 4XBPB 2F19H 1I3GL 1Y0LB 2OR9L 3ABZA 4JQVA 3RWEB 4NHUA 1VFOA 4TVPD 5DMGC 4HUUA 1P7KB 2FJFA 3PHQA 5DXWA 2E7BA 2V7HA 2BY1A 2DQJH 1JHTA 4PP2B 5C0ND 3CMGA 3RGVC 1MAML 4LHJB 3NCMA 1FDLH 4KV5E 3SDXB 3FQNB 2BCKA 1ZHLB 4ZSOA 3RZCB 4GAJH 1P4BL 5D7IF 1RJZB 3T0EC 4WENB 3BVNA 3NA9H 4MCYA 4ORZC 3RZCD 1CD0A 4HPOL 3C8HA 4Y5VC 5DJZA 1RUAL 4L3EB 3WFZA 1KIQB 3HB3D 4U6YA 4L3ED 2QKIA 1VACB 4XPTH 5EU4B 3OJDA 5DUMH 2DJ4A 4P2RE 4XP1L 3FRUB 4GRLC 1YEEL 4JQXC 4PYGA 5D2LB 2OQJA 4ZFFB 1MVUB 3OGOE 4YFLI 1J18A 5CJQL 5DVMA 4N9GA 5JOPD 5CLWA 4PJ8B 4JKLA 1KT2A 5EZJA 1ZT7B 2FL5B 1H8NA 4PJBA 3TT1L 3MJ7A 4G6AD 3GSQB 4WUKL 1U3HB 1QNZL 4PJ8D 5D7JB 2VXQH 4HLZG 4DOHB 1U3HD 1CLZL 1IT9H 3QO0A 5D7JD 3GMOB 1JPGB 4MHHI 5T1KB 4F37F 3O3DB 2F5AH 4PYHA 2IANB 3FB5A 5T1KD 2C3WA 4M7JH 4L4VB 3BAEH 3SDXF 3BOVA 1QQDA 2DLEA 3GSOA 5FYJU 2IAND 4JKMA 2D4FA 4L4VD 3BDYL 3D69B 1JUFA 1H3GA 1KCUL 2Q87A 4LQFH 1Y6KR 2HFFA 4FQLL 2RJMA 2AJZA 1HILB 5DA0B 2E6QA 5ITFB 4OCSL 4KWUA 3VWKB 4I0PA 5M7QA 2ORBH 4TVPH 3CU1A 3FN9A 4YPJA 5C07B 3VWKD 4M1DH 3OKLB 1AQKH 4PRDB 3S8WA 2KKQA 2VDML 1N6QL 1A7NL 5SX5K 5D2LF 5C07D 5C8JA 1S9VA 3ESUF 3LIZH 3OPZL 5I1IL 2FR4A 1EAPA 1UWGL 3DMMB 1YYLH 3V79C 3S88L 3JV4A 3HTLX 4P0DA 3DMMD 2NW2B 4U6TA 5I1KL 2EYRB 5FDWA 4IRJB 4ZPTB 4JR9L 2IC2A 5IW6B 1CI5A 1KJ2B 4HF5H 5EA0H 3B6SB 4GMTH 4IRJD 5E5MA 4LSQH 5HI5C 4WWKC 5FB8A 3H42L 3GNMH 3O41B 5IHBA 3I2CH 4DN4L 4HWBH 4LVEA 3MGOB 5LXGH 3MNZA 1V5JA 3PDOB 4TOYL 4DEPC 5EUOA 3Q2CA 3T08A 5TQ0H 3C6LB 5HHQB 1UJ3C 3ARGB 4TVSa 4JDTH 1B6DA 2PYEA 3QIWB 3SY0A 1FNSH 3EYOA 3L3JA 3TWCH 5CEZD 3C6LD 5KVGL 4ONGL 3U9PH 3GUTB 2DIAA 1S7WB 3ARGD 5DEGB 5F9AC 3HPJB 5F7YC 3WN5A 3WD5L 4MB5A 4R8WH 3CFEA 4RMSA 2J6EA 4WY7L 2OI9C 1BHGA 4WV1C 3KPNA 3NBNA 2KZ1B 5GZOC 4M61B 5IOPB 4FZEL 4H20L 2VKXA 4D94A 4NPYA 4OUOA 1I9JH 4WFFE 2QSVA 1IARB 3EDDA 4HUWB 3NABL 4TNWK 4MJ5B 4JFDB 5EFIA 1CVRA 2R8SL 1AO7B 1NMAH 4JFDD 5SV4A 4HJ0C 2NPLX 2WNGA 1AO7D 3DTXB 3QQ3A 1CD9B 5CEXA 3MLRH 1GGTA 2CRZA 1NGYA 4O2CB 1P53A 3IDXH 4NT6A 5F7WC 2BDNL 1TPXC 4NNYB 4U7KA 5IVZB 3CVHA 3RWHA 3VG9B 5J06A 2W0FA 3KR3L 2C4FU 4CKVX 4PJEB 3D0VA 4AMKH 2VDKL 4XC3H 2ZUTA 3S3JA 3FRPA 1KJ2H 5ENWB 5JXEA 1DBAH 4J23A 2VDOL 3T1FA 2XQYG 3CFCH 4JPIA 2R2HA 3LSOA 4PJGE 1A1OA 4RBPH 1D5BA 4NQXB 1FYHB 2Q1EA 4X7TA 4WEUD 1CL7L 2VUYA 1JGEB 1Z9MA 2E27L 4YHML 1J8HE 1HYSC 4HKZB 3CPLB 4QTIH 3ILPA 4JAMA 5CEZH 3NACL 4JPWL 1OAUL 3D18B 1E6OL 2AJVL 2XZAH 1U36A 4OCYL 1PW3A 5ANMB 3HFMH 4PJIA 3CX5J 4ZUWA 1MJ7L 1Y18A 5D7SL 1V7NH 1VFMA 4Y5YC 3SKJL 2MNUA 1E0OB 3C9NB 1N64H 2X4TB 5EBMB 1MCCA 3WIFB 2D31B 2BNQA 4H0IA 5B39G 2DI8A 5IMLA 2B4CH 1F3JB 1G7JB 3TBVA 5IQ7H 1E28B 3TJEL 1FFPB 2HT2D 1MCJA 5LQBL 4OZIA 4HBCH 3V0WL 4WFED 1VGEH 4A6YA 1Q1JL 1T2QL 3STBA 4XBGA 3SE9L 2DS4A 1MQ8A 1M7IA 5T33L 1K4DA 3MV7A 1CF8H 2AQ2A 4QRRE 4NO5A 5JPMB 4OQTL 1ZGLB 1OAQH 3FFDB 4KK5D 2ZOKB 5E8PB 1KJMA 5INDB 4NQCA 3W39A 2LABA 1RIVL 2CKBB 5L8LB 1FQ9C 2F8VA 4GRWB 2A73B 4ODWA 2X9YA 3JXAA 4QHKI 4P4KB 2BJMH 1RURH 1MAMH 2E8YA 3G6DL 4YDVA 1G7HB 4Z5RA 5T3ZD 1X44A 4P4KD 5C0EA 3W0WE 3U7YH 3QCUL 4OM1L 3E1F1 4KRPB 3WS6C 3MRGB 1BQSA 2Q8BL 3MV8A 2YD8A 1P84K 4RRPG 3RX8A 2R0ZL 4KRPD 5IBUB 1JYNA 3QEUA 5C0NC 5E56A 5CSZA 1Z9SA 1UEYA 4HGWA 1UG9A 3MCKB 4NQSA 5KSUB 2V7NA 2FD6L 1JPTL 3RZCC 1BMGA 2EZ0D 4NUGH 3WJLA 1A6VL 3QUMA 3L7FA 3BUTA 2GFBA 1JHKH 2PYFA 2H8PA 4J3VA 3O4OB 4PRPB 3HB3C 2V9RA 1AHWB 2W65B 4QY8A 4PRPD 4ZFZB 1UCBL 3WUWB 5DYOB 4TTDD 1RZGB 4KQ4L 1E4XH 1FC2D 4Y4KB 5EUKB 1ZA6A 1DBBH 2FLBT 5D71H 2Z8SA 2Q3ZA 2VLKE 3LKSB 4GRWF 4G9FE 4X99B 5FA3B 3W9DB 2ICWI 4Y4KD 5T1MB 1GSMA 3QIUA 4GG8A 4GRMB 5A16A 4G6AC 1F6AB 1YNKH 1WSST 4PJ8C 1DEEB 3KVQA 4AQOA 1PY4A 4PJXB 4QHMA 1U3HC 1V7MH 5EORL 4E0RA 3WFHB 4D8PA 2P8LB 5D7JC 4LEXH 4YC2B 4LIQH 5I0ZA 3RNKA 1NBZB 1I9RL 2JIXB 4X6CA 1SJEB 1BIHA 3NIGE 1ORSB 4YX2H 1I1RA 2CPCA 2CKBH 3DOSA 2JIXD 1IQWL 2YD3A 1ZS8A 3CFIC 5T3ZH 3ECBA 4YXHH 4ODVH 2IH1A 2V2WA 3M8OL 1NEUA 4HUNB 3CZJA 1MEXH 1UWGH 3BUYB 1I8MB 3ZHDA 1N5AB 3MRLB 1P5UA 5IMKB 1XIWD 3VWKC 1RJYA 4NM4H 3GMMB 1S5HB 4AEFA 5FEBA 5IVXA 3PGCB 4NP4L 4X9IA 5I1KH 2QHLA 2JJUA 4JJHA 4I4WA 3BE1L 4HH8A 1J0IA 3BEVA 1KB5B 5I30L 2H41A 2MQ3A 3DMMC 2UYLA 1MUJA 3ZTNH 3VI3E 3B3IA 2FX9L 5IBTL 1NLBL 4XBEH 3O3AA 5ESAA 4FZ8L 5HGBA 3C2AH 1EHNA 4IRJC 4YH6A 1RK0A 1KCLA 1GGCL 2MSPA 4QHUB 5KS9E 1EK3A 4RGOL 1JWUB 1WBYB 2AJSL 3QCVL 4G8GA 4XVUD 3TGXA 2F53E 2VAJA 1MREH 5C6WH 2JF1A 1IM9A 2WBWB 3MNVB 4FQCL 3L3IB 5E8OA 3W81A 3ZDYE 3C6LC 5IG7B 4BZ1H 4PRIA 1JPST 1T89A 3ARGC 3O3EA 3X3GH 1IC5H 4X5LA 1NJ9B 2WAHA 3V0VA 1P7HL 3H9ZA 4JZOA 5GQBA 4MQ7A 4C4KO 2P24A 1GIGL 4ZQKB 1AP2B 4K7PL 5MENB 2R8SH 2VDQL 1ZLWK 2EEBA 2VB5A 4F7TB 4OQ1A 3W9EA 1IGIH 5D5MB 1YDPA 3DI2B 5E99L 5HJ3B 5MEND 2B4CC 1ZV5A 1F6LL 4KKAD 5AAMA 4K23L 4Y0GA 5JPNB 1I7TA 3QNZA 5I1CL 1T04A 3ALWA 4LOUD 4IMKA 3G5VA 3IJSB 2CGRL 4PTTB 1R5IA 43C9B 4FP8L 3ULUD 4DGVH 2XWBA 4U49A 3VA2C 3MODH 1U58B 5CP7B 4HS3B 4HIIB 1OWRM 1C12B 1OM3H 1QHOA 1PSKH 4GBXA 2ZCLL 4JKPL 3MO1A 3VH8B 3T77B 4XAWH 4Q74A 4LCYB 4RGNE 4Z7VB 4P2OA 2KBGA 3PWPA 1HWGB 4NKIL 4HPYL 1N2RA 5F7EH 5F9JA 1U9KA 4M6NH 3VRJB 3VG9C 3MOBH 2E27H 2JCCE 2VWEC 4LLYA 4RAVA 3DHJA 1P7QA 1NGZB 4YNYA 12E8H 1U0QA 1IKFL 2QHRL 3DRTA 4LSRL 3MJ9H 4XZUB 1AC0A 3T0EE 3MA7A 1O5DT 4DFHA 1OB1A 3PL6A 4CN6A 4XVSL 1K2DB 2IF7A 2XA8L 4G6FB 5KSAB 2AXGA 1J88A 4G6FD 4XCNA 1JNJA 2OSLA 5KSAD 3KHOA 2FWOA 3X11B 2I60H 2IPTH 1U8KA 4PJHA 2FSEB 3I6LE 1I7UA 4NC0B 5H35B 5CWSA 4MQXD 1IEBA 4R4FL 3WS3B 4CNIA 2VTFA 5C0CA 4BH8B 4L8SB 1N5YH 4LCWB 1MWAB 4ZTOH 4Z7VF 3LKOA 4G8FA 4LCWD 4KDWA 3TNMA 5ADPL 3MRNA 5HHOE 2HT2C 1BZ7A 4CVXA 1RUKL 1IGFH 4X7CC 4CU7A 3D3VB 4CN4A 4CADB 4ONHB 5IVNA 2MKWA 1NH6A 3DPBA 3QAZB 3ULUH 2DM3A 3D3VD 3PWUA 3PWJA 4EVNB 3T3ME 5EBLB 3IDMA 4KK5C 1UXWB 4EKXA 4I48B 3F65A 4Y5XA 4MXQD 2VERN 3WLBA 3U7WL 1BAFL 1MCSA 1BVKA 1MCDA 1L7TL 3PQYA 3FO0L 4M7KH 4XB8A 3QNYA 5F6HI 4LRIC 4HH9A 1PG7L 2ESVE 3KJ6H 5ICXB 1FJ1A 2HFTA 3VXQA 3ILQD 3WNOA 3L7EA 4R7NA 1KELH 2P44B 4P4KC 1ZAGA 1UH2A 3GMLA 1LO3H 4N0UB 1BEYH 4Z7OE 1FYTB 1MHHB 1EJOL 2VUOA 1CK0L 5IW1A 2L7JA 1YEGH 5B22A 5BRZD 1MRDL 4M48L 3OR7B 4R96A 3C5JB 1FYTD 4HQQH 5F3HB 3WL9A 4KRPC 3MRRA 3EFFB 1MI5D 2BOCB 5D2NB 5C09A 3NCYP 1NCBL 3VXOB 4PY7B 4XRCA 3K2UL 3AS1A 5F88A 4MYWB 1WAAE 2EZ0C 1A3RH 2RFXA 1FSKB 4UV4L 3BFOA 3HR5A 4JLRB 4YHKL 3TPUB 4Q9CA 5C08B 4K3GA 4PRBA 3T3PE 3TN0B 3O6FB 1OF2A 2EE9A 2O93L 3O4OC 3BIKB 3MRQA 4XP6H 5C08D 2EO9A 4TTDC 3TN0D 4DUVA 3O6FD 4G9DB 1AHWC 4MXVE 4PJAF 4OGAC 2YEZA 4KTEL 2B0SL 1HN1A 5HY9B 1JL8A 1GHFL 4Z7UB 1LEIA 2HJFA 4Y4KC 1RI8A 1MWAH 5FF6A 1ZLSL 3VXPB 3H3PL 5E2VL 3V5KA 2PXYB 4V1DB 4LGSB 3QXVA 5JZ7D 1YPZE 2K7QA 2PXYD 4V1DD 3QCTL 4M7LH 1XF2A 2YR3A 3N50A 2ARJB 3UEZA 3WDHA 5C9KA 3HPLB 1D6VH 5F6IB 3RKPA 5E6YA 4YC2C 5IEKB 1BIIB 4ZOCA 2NTSP 4B7LA 4AH2A 1XR8A 5HYSG 2OJZL 5KAQG 1ZT4B 4PGBA 5DT1L 1KTDB 2AEPL 2K1MA 1EZVX 4X6FA 2P5WE 4NJAL 1F58H 3VXSE 5DEFB 5TFSL 1WCBB 2P48B 1ZSDB 1A6AA 1K8DB 5K9OA 5TGBB 1J0KA 1JRHL 3QG7L 2ZOLA 4QHLB 3MLTB 1A1NA 1XIWC 3O4LA 4FHBD 4P9HH 3OAYK 4S0TD 3CFKA 3RWFA 5D72L 3VFNB 1DQLH 3LHPH 1FV1A 4IDJH 4WTZG 2E7LA 4CL7A 4HWEL 1AH1A 5I76B 4NZDA 2VR4A 1NC2D 5FGCE 1VEMA 4X9HA 4RGOH 1YMHA 2OL3B 1IEAB 2WSKA 5DHYB 3I75B 5I8EB 3IAPA 5C3LD 2AEIT 1S7VA 4KAQL 3P0VL 1UKTA 1CDBA 3DRQA 5ALCL 3MCG1 3OR6A 1MY7A 5GGSA 4UTBL 3MMEA 2HT3D 1H5BA 3GSNA 2HJLA 3NFNB 3RFZC 4XVUC 4MAUL 3DECA 5ACMA 4P4RA 4K2UL 3QUKA 3FQRA 4RWHA 3MLSH 3BH8B 5B8CA 1A1MA 2XFXB 3HI5L 4P5TB 5HHNA 5DWUH 1RK1A 2LFGA 5DMYA 2MCG1 1A4KB 3BPCA 4P5TD 4WUUE 3QZWB 3E3QC 4ZUSB 3RWGA 3UJIH 3MX0A 2R69H 4JY5L 4K23H 1EXUB 4KDTA 4R26H 5CHNA 1E4XI 4JFYB 3KPQB 1DL7H 1V3KA 3MJ8A 4MDIA 5IBLD 4CVWA 2ZG3A 1CD1B 2QR0A 3EYQD 3C2SA 3LS4L 2OXGA 2L0DA 5D70L 1MAJA 1WTLA 1INDL 2PTTB 5DJYA 5F7LB 1TTFA 4ELKB 1CXEA 3O8XB 4AJ0A 1G9NL 1G0DA 1KLUA 4KKAC 3ZYOA 2NY7H 5D7IE 5AWNH 5E9DA 3O8XD 5L88H 1C1EH 4YBLB 2CIIA 4LOUC 5D1XD 4PD4K 4RX4D 4TUJB 3GKWH 3ULUC 1S7SB 4ZUVB 4C83B 1YMME 5CS7A 4LU5H 4I18B 4NCDA 5IMMA 3CXDH 1B4JH 1HHJA 3GI8H 3FB7A 2XKUA 5F1IB 1Q72H 1S9WA 1LQSR 3T2PA 7FABL 5EU7C 5HHVL 3K3QA 5CGYC 2BVQB 2GW5A 1PG7W 1UM6L 2R1XB 1A6UL 4HIXL 8CGTA 3NAAL 2HFGL 4I9WE 3P30L 2QQLH 3WYRA 4AIZA 3LS5L 3MLZL 4O02H 1AY1H 5DMKA 1KCVL 4Q2ZB 4TVPE 2OL3H 4LKCA 2CIKB 2LE9A 4MJIB 1TJIH 1HEZB 4CVUA 3VRLE 3Q5YA 4HUVA 3UPCA 3O0RL 4MJID 4OTXH 5CBEA 1QRKA 3OKEB 3SDXE 3RI5K 2J8UB 2X89D 4HUMB 1ZHNA 2IBZX 4E9LA 4YHOH 4HK3J 4AG4L 1NDGA 3DX7A 3AXLB 3BDXA 4F58L 3PP4L 3BRGC 3OG4B 2UZIH 5LBSL 4PR5B 5FYJD 4P23A 4LSSH 2FJGA 4L3EE 4OLWH 1C7SA 4ONOA 5GPRA 5KSAC 1VKXA 3Q6FA 4OB5L 4D2NA 3AM8C 1RUKH 4P2RA 3TPKA 3GBNL 4MQXC 4NO0A 4Y4FA 5JMRA 4U1MB 1IGJB 5JOPE 3U0WL 5HPMA 1A47A 5D2LE 5C3TA 1AC6A 4WCYL 2FLRT 2CDEB 2GTWB 4LF3A 3IDNA 4P48A 4YHLL 4LLMA 1T5WA 1X7QA 3TH3T 1PKQB 4IOIB 1JF1A 4WW2B 3U36A 3Q3GA 1DSFH 4PTUA 4YE4L 3ZE0E 4G3YL 4EZMA 4DOHE 4U2YA 4KI5D 4FFYH 1IBGL 2IPUK 2P45B 4PG2A 3WJJA 3VA6A 3QAZC 3ROLB 5LWYH 4TQEH 2WINB 4XHJD 2IANE 2IWGA 4L4VE 2J8UF 4MXQC 4C4KT 4M48H 3W5MA 1CE1H 1CLYL 3BP5B 4DFIA 3IDGB 1YNTA 3PGDB 5C0IB 3MTRA 1CCZA 3ILQC 4LVHC 3U1SH 2FO4A 1MCPL 1EHXA 4Y16B 4I2XA 4U1IA 1ES0A 2BNRB 5CMAB 4U1LA 3H6JA 4OF7A 4GSDL 1QVOB 4Y16D 2BNRD 5C07E 2EIEA 4P9HC 4D0DA 4WO4A 1K3IA 1IAIH 3T0BA 1NPUA 4NCC1 1KCKA 2ZCHL 4I3RH 4RMRA 1T0MB 3QXDA 1SYSB 2YUVA 1I9EA 3C08L 4NRXA 4X6EA 4D0CA 5D2NC 1W8NA 3ZL4L 4HC1H 1IM3A 2FECI 4RAHA 2A9NH 2H6PA 4KI5F 4WW2F 4GUPB 1FAKT 1IC4H 2Z31B 4FQQB 3WSQL 3TVMB 1FSKC 1MRCH 3GJFB 2B7DT 3GEWB 2PW1B 1ETZB 4HGKC 5F9OH 5CKAA 1FRGL 2Z31D 3H3PH 5IQ9B 3TN0C 3BGMB 3O6FC 4F2MB 5ERWA 3HLAB 5HBBA 3QCTH 5AG8A 5SX5H 4R90H 3BPLB 5CEZE 4C56B 4KPHH 2R56H 3CLFL 4HFUH 3ISWA 3MXVH 2GCYB 2PCPA 3L5IA 3TYFA 4C56D 5JZ7C 1A9EB 2J6EL 2XYCA 4U6XA 2PXYC 3LPFA 2F54B 4L9LB 4NZRH 3LH2H 2V2TB 1RVFH 5GZND 4WEBL 2F54D 2YK1H 2WP3O 4F15B 4FOMA 2JJWA 2R0KL 2VZUA 5F6IC 1D5ZA 4LPCA 5I19L 1HQ4A 4DK6A 3KYMB 1RZ8A 2UUDH 5D72H 2CLZA 1D5IL 4ELMF 35C8H 4JQIH 4EDWL 4TNWF 1G7MB 3LKPB 1IILE 5H37H 4MS8D 4JFDE 1WZKA 3VFPB 3AGVA 4GW4A 4UOW0 1AO7E 1HSBB 1YQ2A 2CRYA 3GMPB 1CDHA 4XNZB 4YDIL 2EEDA 5BV7B 4OKDA 4KXZH 2EH8H 1IKNA 4YUEH 4PLNC 1ZGLP 3ZYJA 5ECJE 4KTYA 3WIHH 5C0FA 1LEGA 2ADFL 1NGQL 2GT9A 3UC0H 1K8IB 1TTGA 2AEQH 2QTEA 3DHMA 1ZANH 3FQXA 4LLUA 1OQXA 4AEEA 2XNAB 4QGTA 5D6CB 3HNSL 4Z77A 4K2UH 3HMXH 3I02A 5GGVY 3CC5B 2VWEE 5EPMA 4PJEE 5TE7H 2CJUL 2RHEA 3QUZB 4HX1B 2CDGB 4OF6A 5KTEL 3GJFH 4PJGA 3ZHKA 2HT3C 1T83C 3QUZD 5EU3B 1I7RA 4QCIA 1J8HA 3Q6GH 2VITA 5GSRA 1AGDB 3E2HB 1NCUA 1WZLA 2Z4QA 3QPXL 5F1NA 2B20A 5GGQH 5MEOA 1RJLA 1FN4B 5FGBC 4UI2A 1MIEH 3OZ9L 4L8BB 5F71A 5J4MA 4P5TC 3EFDL 4KQ3H 3WCYA 1RIUH 2X1PA 5ANME 4F9LC 1GAFL 1QKZL 1RZKL 3GIVB 1IQDA 4LSTH 1FLRL 1C08A 4OD1H 1I1FA 4LAJH 4GH7B 4HUXB 5IBLC 1PFCA 2YRZA 3EYQC 4LVNB 2OZ4A 3EYSH 4AT6B 1U8MB 3FFCA 4WI5A 1MCBA 4N8VB 4UQ2B 4NM8L 1FGVL 4Y4HA 4KRNA 5DR5H 5CFHA 5CZKA 4JJ5B 1FORH 1U8PB 4WFEE 4YHNB 3O8XC 5D6DC 3STZB 4A6YL 1S8DA 1FNLA 1NEZG 5D1XC 5HHVH 1EERB 1UM6H 4BK5A 1CR9L 4JHZA 4LIQE 5IESL 1IL1A 5K9KB 1EEYB 4OGXL 2F74A 1T7ZA 3WLWD 1JGVH 2AABL 4ONFL 3CH1B 4I18C 1SYVA 3B5TA 3K74B 3G5ZB 1FNHA 4DTGL 4ZUUA 3MV9D 3U4BL 3SE8H 4P5MA 5T3ZE 1MRFL 1NDMA 4XCEB 5FGSA 4NCC2 1MVFA 3W0WA 1IGYB 4E42B 3GBML 1UM5L 3BSZL 4PLKD 3O2WL 4KMTL 4DAGH 4Q9QH 2K9UA 1LHZA 1UADC 1REIA 2RCSH 4GKNA 2C3VB 4FQJH 2FATL 4P9ML 3BKJH 3WHXB 1VPOH 1ND0A 2LAGB 2BVTA 5DD5L 1PVHA 4PUBH 3F5WA 1CG9A 1U3YA 4HT1H 3JTTB 2WQ8A 3GBNH 5I1EL 1XGRB 3ETBF 1W0WB 4DZBA 3QUML 5JMOC 1QD0A 4C58B 4J8RB 1UCTA 1RULH 5C6TH 1WISA 1UZ6E 1OSZA 1QPXA 4G42B 2P7TB 3MLXL 2X4PB 4PRPE 1BOGA 3VGHA 5KG9A 1U93B 1RUQH 1YZZA 2ZSVA 2BY3A 2VLKA 3QEHA 4G9FA 5FK9B 1W0VB 3SBWC 3T4YB 4HJGA 1L0YA 2AXHA 3FHQA 5IB4B 3D2UA 4WTZA 5E95B 4KH2A 4TSCH 5DJCA 5HGAA 2P8PB 4U1KB 3BO8B 1MPAL 3OF6A 1TZHB 4NDMA 5J8OA 1FZMA 4PJXE 1UB6B 3DX8B 4FQXA 4KI5C 4WW2C 3VDBA 3PWNA 1HINH 2VXVL 1F8TL 4XHJC 4EJ1C 2EE2A 1DANU 4CRPA 5I17A 4MLSA 1WV7T 2FB4L 1QOKA 3VFGL 1CGWA 2AJ3A 5BS0D 3FZUD 2B1AH 1ZXQA 5SWQA 2DQEL 2G75A 5D96B 4QRQA 3PGFL 1OWWA 3UPRA 1RUPH 1U8LB 4HS6B 4OIBA 2YPKB 1NAMB 4LVOB 4ZO9A 1F02I 3PABB 4Y16C 4XPFH 1UT9A 1G7PA 3MNWA 5DRXB 3KPRB 2NXYB 5C0AB 1Q9KA 1LD9B 3CSGA 4RCAA 1QP1A 5E2TL 1FP5A 3CFJA 3CLEH 3KPRD 3VXTA 2NXYD 4ZS7L 5C0AD 3SDCC 2OK0L 3V6OC 2R15A 4M8QA 3QWOB 2Q6WA 2BRRL 3ROOA 1NCWL 2FGWH 4JCMA 1KCRH 3P9MA 1I7ZA 1C16A 2J88L 3KYOA 4FQ2L 1AXSB 2HP4A 3PWLA 2OTWA 2HH0L 5J6HB 2ITCB 2W92A 3D48R 2F15A 5KS9A 1X5GA 4XVTH 3NFSH 3VG0H 1NCTA 3GSXA 2Z93A 5CEYB 2F53A 5E5UB 2BC4B 1EFXB 3HE7A 3ARDB 3OB0H 4QT5A 4OKVB 1WBZB 5HGGS 4L8CA 2EXYD 4XPBL 3VD7A 1EFXD 4EEEA 3ARDD 4NKDA 4QOKB 3EHBD 1G6VK 3P73A 5HGDA 1PJ9A 3LN9A 2NX5B 4BELD 4QOKD 3SGKA 3E3QE 3BPLC 3SQBA 2R0KH 1CGXA 4R4BA 4H5SB 1QBLL 1HSAB 4HGMA 4JFXB 1FZKA 2NX5D 4Z7QF 5TF1L 5CD5D 4QXTA 2NCMA 3B9KB 1JYWA 5DD0L 1KCSH 2VJXA 3QJFA 5GZNC 3GGWA 1BZ9A 1J05A 4X98A 3F62A 4L9LC 4X6BA 1K4CB 3B9KD 1PZ5A 2I07A 4DN3L 5MENE 2NZ9C 4MJ2A 3P11L 4M5ZH 4QRPD 2VC2L 5D5ME 1MFCL 3VFSA 3P40A 4F15C 4NZTL 1U8OA 1KIUA 1HKLH 2AGJL 2FH8A 1IEHA 4CGTA 3MRBB 1X4YA 4MS8C 4TYUA 5B38A 3ULUE 4UDUA 4XPAH 3P0GB 3NCYS 5DJ8A 4MWFB 3RPIB 1JHLH 1NAMH 2MKLC 1T7XA 4FMKA 3QDMB 3DO7B 4CU6A 3RNQA 5EU7E 1X3DA 1T0NA 3VD4A 3DVGA 3E0GA 4OFPA 4XNZC 3DBXA 3QDMD 4L1HA 4Z7VE 1ZLWH 3EDEA 3M17B 4DGYL 3BD4A 5IWLC 3FQTB 1LO4L 4YQXL 3C09B 2JCCA 3TV3L 3L3GB 4JFFD 3RGVA 2JE8A 4K9EL 1I9IL 1JE6A 4LFHG 1MHCA 5JW4R 1NANI 4MQSB 3T0EA 1IAII 1EGJA 3AAZA 2YD7A 3G5XA 4LHQB 2NYYC 2VLMD 2ZUUA 1YJDH 5TDPB 1HH9B 3SOBL 3ALXA 1RZKH 4Y5VA 1D6EA 2R1WB 3OHXB 2X41A 1LK3L 3VCLA 3DV6B 1KXTB 4OZFG 2HN7A 4KK9D 2O5ZH 1CICB 5L8JB 1F4WH 3PV6A 3RZWA 1BFVL 4LASH 2DF3A 3MUJA 3D85D 4LSVL 3QRGH 1CICD 5J13B 4JQXA 1M6OA 1WIUA 3G04A 4WI2A 4JDVA 1F2XK 1KN2H 1XGQB 2XG4A 5FOBB 5HHXL 2DQFB 4H0HB 4TULL 5DHVB 4LCWE 5IESH 1JPFA 4IRZH 1DQJB 4LVNC 4JZNA 3DROB 3L3KB 2XWTA 3MRMA 2Q8AL 4FN0A 4CVZB 4KJWD 1A7QH 2AABH 3UPAA 1WFNA 1DLHB 2XQBH 3V6FB 3D3VE 4DTGH 2DQCH 4QNPF 1X5XA 5GS3A 3MROB 5IB3A 4ZDHB 2X44D 4NOFA 4NNXB 5GXBB 3KJ4B 3WLWC 1J1OL 3BI9X 3CIQA 1R3LB 3VFUB 5I8CB 5I8KH 1U6AH 2ESVA 4OT1H 5FCUH 2BSED 1R3KA 2XG5A 3ARFB 2CR3A 5TDOB 1BX2B 3IF1B 2VXSL 3ARFD 1U8JA 5DK3A 5DD1H 1M7DA 3DXAB 1ZT1A 3Q1SL 3HNVH 5BRZE 5LCVL 2P47B 4PLKC 4N0UE 1FYTE 3MRPB 1KACB 3FQUB 4OCRL 5CUSL 2XACC 1HI6A 4G5ZH 1MI5E 5E1AA 2MPAL 4O2EA 5H94B 4K7FA 1LNUA 4KXZI 4BH7A 1MLCB 1TJGH 3H0TA 1NBYB 1SEQH 4P2YA 3QFJB 4F7CB 3L3OB 3MLXH 4LSPL 1WAAA 5D2NE 3S37X 1ZTXL 3QFJD 4ZS6D 4S2SB 1Q0XL 1R3JB 5ID0A 3LEVH 1WZ1H 2ICCA 3PJSB 4BUHA 1FO0H 3HNTL 4Z95L 1N7ML 4XHQA 3QDJB 5C08E 3IKKA 4Q0XH 4YWGL 1VFAB 4OLEA 5GRJL 2C1OB 3QDJD 1JYVA 1N4XL 4OLUL 2YC1B 1UJ3A 5I1GH 2ICWA 2ED7A 3H9YA 2GEEA 3VFRB 5IT2H 1HHKB 4M62L 4KHXL 5I8OH 3EOAB 3WUZA 4LP5A 3BZEB 5DHVH 5FIEA 3TT3H 3T2OA 3IFNL 4Z7UE 2VXVH 2VR9A 1ORQA 1HKFA 2GSIB 5GSVB 1S9YB