4QGYA

Camelid (llama) nanobody n25 (vhh) against type 6 secretion system tssm protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGFTFEDYAIGWFRQAPGKEREGVSCISNLDGSTYYPDSVKGRFTASSDKAKNMVYLQMNSLKPEDTAVYYCAAVNAQGIYCTDYIIGPYGMDYWGKGTQVTVSSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nanobody n25, VH domain
publication title Inhibition of Type VI Secretion by an Anti-TssM Llama Nanobody.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 32
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qgyA00
5EU4B 3CXHJ 4H8WL 3BI9X 3TPKA 1OAXH 4XP1H 4X8JB 1FL6B 2AJZA 4IDJH 4GKSA 2UWEB 4M6OH 4Y4FB 5ALBH 3D3VD 1ORSA 4M1GL 2EH8L 3NCBB 1W0VB 5F89A 4CDGC 2XIDA 3C5ZC 3JZ7A 2CJUL 4KJPD 1UWGL 4W68A 2CR6A 5EDXA 4XXDA 5MP6L 2AJSL 4HKBB 5BXFB 1A6TA 4FTVE 1Y0LB 5H37H 4JFXA 3A67H 2DKMA 4WCYL 1U3HB 3H0TB 1FZOA 1GC1C 3KPSD 4S2SA 2DS4A 1YNTB 2ESVE 2FJFB 3DX9A 1AGDA 4GRLC 4X4YA 1AY1H 1TTUA 3UTZB 5ETUB 2H1PH 2GY7B 4JY5H 4P9ML 5KW9H 5DYOB 1UM6L 2YK1H 5FO8B 2D7NA 2QV2A 4K3JL 1TDQA 4YHYC 3L6FB 2R4SH 1VADA 3TWCH 3P2TA 5B8CA 1KJVB 5GIRB 2ED8A 4MAYA 1LGVA 1J1OL 1RZJL 1N64H 3WE6A 1RZGA 2DQIH 2XWJA 3AVEA 4KZDH 2NX5A 4C4KO 4JKPL 3LKSA 4PJAB 3PGFL 5DMYA 1KB9J 2PYEE 2W65B 1F02I 3E6FA 1M7IB 2X7LB 3SDAD 5IMLB 5CBAB 3B3IB 3QQ3A 4WHDA 1KXQE 3N85H 4P3DB 3ROLB 3MRNA 3QIUD 5IFAL 1CE6B 4HPOH 5E6IB 3D3VA 1PEZA 1LK2A 2BP3A 2E27H 1PVHA 1IC7L 5BO1H 2P8MA 1ZKAA 4Y4FD 4P0DA 4KJWD 2OYPA 4ZSOB 3FT3A 4XP9L 1Q1JH 3PP3K 1R5WB 3DHMA 3HI6H 2BVEA 2NLJA 1NUDA 4Z7QE 4YK4B 5LXGH 2PW1B 5KJRL 4FZEL 3TN0B 1GC1L 2P8PB 1ZT7A 3T3PF 3KPSA 3IFNH 1HCVA 1AXTH 1WWCA 1WWBX 1CD9B 4L8DA 2R1YA 2R0KL 1T0NB 4TNWF 3TIDA 5F7HA 2H6PB 1U3HD 2P1YA 3E2HB 2WLZA 4J4PC 1EBAA 3T2OA 5KS9E 1OAQL 1S7XB 3JWDH 1FLRH 3BYTA 3SDXB 4FA8A 5D93B 2R0WL 4QCIA 1LP9A 1G9MH 2AVGA 4PBWD 5EBLA 2OQJA 3HZYB 1T6WA 4K94C 3GJFA 5DMIH 4HS3A 5EZJA 1H3UA 4ZYKA 4OGYL 1R3HB 2JJWA 4UTBL 2F15A 1OD7A 3DV6B 3WKNA 4ESKA 1A4JB 3T4AA 4HC1L 1I1CA 1CD1A 2OLDA 3IKCB 5FDWB 1UENA 3LEVH 2VABB 3N1MC 4OQTH 4UBDD 1IGYA 2J4WH 4S1DC 2AJXL 1I7ZA 4Y1AB 5B39G 5E70A 5EU4A 3JTTB 1UWEL 3QIUA 3GBMH 4Z95H 2HLAB 2NNAB 3RUGE 5L2KE 2QHRL 4XAKD 3G5ZB 3BH9B 4NNXB 3BE1H 4NRYB 2BSRB 3WIIL 1DFBL 1N5YL 3B9EA 4S11A 3NMEA 1CFVL 3RZWA 2GEEA 4Y4FA 3WLWC 5JDSB 3SO3C 4I3RH 3LKOB 3U9PL 4YBQC 1UQSB 2PR4H 4XP6L 3RP1A 1W0VA 4XAWL 2DQTL 4M43L 1SY6A 1YYLL 5JHLL 4HKBA 4NN5C 4PGBB 5BXFA 4OZ4B 4TSAL 4P2CG 5FUZL 1FFNB 1Y0LA 5ESAB 2QSCH 3OB8A 1U3HA 3H0TA 4HMCA 3W81A 3F6LA 3LMJH 3UTZA 5ETUA 1YEIL 1J87A 4HUNB 4K94L 5DYOA 1HOCB 5FO8A 1TTGA 3L6FA 1EEUA 3STLB 4U3HA 5D7LB 2CRZA 3E8UH 1KJVA 3TESA 3VFUB 4EVNB 5DMGC 5GIRA 4LCWB 4PJ9B 2X4TA 1HH9B 3CFCL 2D31B 4U6HB 4PBXA 2EIEA 2OXGA 5BZDA 4FXGB 3MRJB 3SY0A 3TT3H 3SGDH 3H7BB 4UT6L 5I30H 3RKDD 3EFFB 2W65A 1J1PH 3WUWB 1RUML 1M7IA 2X7LA 4OCRL 1NMAL 5T3XE 2AJUL 3REVB 1CDJA 3P0VL 5CJ5A 3PDDA 5JZ7D 1YPZF 2QQNL 3QEGH 1FIEA 1V3LA 1HHKB 4WUKL 1IAKB 1FFQA 2GJ6E 5IIEB 5E6IA 3VWKB 4PJDE 1ULVA 2WUBH 4ELMB 1KOAA 2A6JB 4U2ZA 3AU1B 1SMAA 1MEXH 4LU5L 3V8CA 4O9HH 1X5ZA 2NY6C 4WEUD 4ZSOA 5SV3A 3JTSB 3O0RH 1R5WA 4HV8B 2VO5A 4P99A 4QRSB 5H8DA 1JPFB 1VKXB 2J6EL 4RFEB 4OZFH 3ZZ1A 2PW1A 4RGNE 3ULVF 3IYLW 3CK0L 2D7PA 2P8PA 3EYUH 2NW3B 2V5SA 2VAAB 5JOPD 2I5YL 5D7IB 3NABL 3H2WA 4LNVA 2VDRL 4XPTL 4M4RA 2H6PA 1BFVL 3MX0A 4KJQC 4TUKL 1GGCH 4DKFL 1CGSL 5SX5H 4AEIH 4BQ9A 1S7XA 4C54A 3SDXA 5E2VL 4JFZH 2HKHH 3HZYA 1PQZA 1MF2H 2N7BA 2H26A 1ADQL 2YD2A 3KYMB 1R3HA 3CFJA 1A6WL 4X7SL 3V6OE 1SBSH 5C09D 1AR1D 5HDBE 5DJDA 1NUNB 3RX7A 3DV6A 5E6IC 4XC1L 2EIDA 5D7LD 2B2XH 2O5YH 5CD3B 1GSMA 4LCWD 4PJ9D 3UTSE 3IKCA 3QCTH 5FDWA 5J4MA 4L4VB 2UZYB 5DQDH 5C0IB 4CNIB 4WEMB 4JEGB 3V4PH 4JFDE 3U82B 4PUBH 5HHNB 1IGFH 2Z4QA 5C9JB 3TNMB 4YK4C 5L0QB 3JTTA 3JWOH 2AJVH 4V2BA 4HULB 2DMKA 2HLAA 2NNAA 3KPTA 3G5ZA 3BH9A 4NNXA 3BHBB 3TN0C 1AJ7H 2QKIB 4W6YB 4NRYA 2J2ZA 1PG7H 3VFMB 4LLUB 1WAAA 1NQBA 1HDMB 3VWKD 3E2HC 5JDSA 1YEFL 3LKOA 1QFWL 4C56E 2EC8A 3JV5A 1DBKH 4J8RA 3G6JB 2P5EB 3EYQC 1FHGA 3HNSL 1HZHH 4QRTB 3NIGF 4YBLB 4UT9L 3TBWA 4OZ4A 5LGKA 1KIRB 4CRPA 4PJBE 4P2OB 1FFNA 1RVFL 2E6QA 3A0OA 3VI3E 3UAJC 1MFAH 1QLRB 4NO2A 5ESAA 1BIIB 1SMOA 1YQVH 4HUMB 1NL0L 1IC5L 2UYLA 2IEPA 3EOTL 4HEPG 1HOCA 3MJ8B 2V5YA 1FN4B 3OKMA 1RUAH 2RGSA 4HGMA 4OCXH 5M95B 3LVEA 5C09A 4U05A 2XRAH 1F45A 2X4PB 4HK3N 3STLA 5D7LA 3QQNA 4MDJA 4OFKA 4M6AA 5CJ8A 1AXSB 3VFUA 2WV3A 4CVXB 4EVNA 5FYLE 4LCWA 4PJ9A 1F6LL 3VGAC 5TF0A 1HH9A 3F12B 4PY8I 2D31A 5KOVC 5JOEA 4U6HA 1BZQK 4ZUTA 5AWNH 4LLMA 5E4EB 4FXGA 3MRJA 4LASH 4F15B 3E1F1 5FHBH 3EFFA 3QUZB 3WUWA 3IGAB 3NCCB 3QO0B 1F3RB 3REVA 2OSLB 3F5WB 2E6PA 1U8QB 1AKJB 1YEKH 3I6KB 4WI5A 1HHKA 3BUTA 1A2YB 1IAKA 4N0CD 1NGZB 1KLUB 2FH6A 3U0PB 3VWKA 3DSNA 4JFEE 5IHZB 4H88H 4OB5L 4ELMA 5ISZD 2A6JA 3IT8D 5CUSL 2NPLX 1G9NC 3WFCH 2WLYA 1T2XA 5CEZH 1HXYB 4NDMB 1ES0B 4YUEL 1H3PH 3JTSA 2JTDA 4HV8A 4M9PA 4QRSA 1JPFA 1QBLL 1VKXA 2CLZB 1YNLL 4JPKH 4RFEA 1HXMB 1A6VL 2GAZB 4PR5B 5IW1B 4F3FA 1NAML 4KFZC 3NPSC 1GPOL 3LQMA 3T77A 5EUOB 3QJFB 2NW3A 2VAAA 4QT5A 5D7IA 2X9XA 1XF1A 1R5VB 2NY7H 4TULL 1MCKA 1UKTA 4K7PY 5HVWA 1JL8A 4GSDL 3ZHKA 3BP6B 4NRZB 4ZFGL 5I9QB 2Q8BL 4G6JH 3HMXL 3C6SB 2KQNA 4TVPL 2DQDL 3KYMA 5D1ZC 2L4OA 1N6QL 2BJML 4MVBC 1R6VA 4GAFB 5F8RC 4K71B 3NFPB 2GQHA 1OP3H 3W0WD 4H8WH 5GGVY 5CD3A 4YWGL 1LD9B 8CGTA 4L4VA 4P2QB 1T7ZA 2BY2A 3BQUD 4MXWL 4G80B 4M1GH 2EH8H 4PBVC 4NFDA 5DVMA 5HHNA 2HP4A 5D2NB 5HGDB 1E4JA 5C9JA 1VESA 3TNMA 2CJUH 5B21A 1UWGH 2D7QA 5MP6H 3BHBA 1R0AH 1OSPL 2AJSH 1I85A 4GW1B 4PJ7F 4I9WD 3VFMA 3N50A 5J6HB 4Y4HD 1A64A 1G9NL 5FGCB 5ITFB 4NGHL 1HDMA 3DSFL 1KCUL 5F8QC 3N1PC 4WCYH 3MRIB 2H2PD 1QQDB 4ONGL 4QRTA 4X9IA 2CKBL 4P9MH 4QHKJ 1P9MA 1UM6H 4RGOL 1KIRA 1FDLL 1DBAL 3BEWA 3SN6N 4K3JH 4JFFD 1QLRA 1SM3L 3HN3A 1IQWL 4UDUA 3T08A 2VDNL 3O3BB 2C4FT 1KJMB 5CIPH 1MH5B 2AJ3A 3C08L 1J1OH 1RZJH 4NC1C 1E27B 2X1WL 1C7TA 3MJ8A 5A2IH 1F00I 1FN4A 3NACL 1H5BA 3VXNA 4JKPH 4JRYD 1L9MA 1B9ZA 2D0GA 1WLHA 3PGFH 4X6FB 2X4PA 1NLBL 3QDMB 1OM3L 3W0WA 4OCNC 4OV6F 4RQQB 2X40A 2FD6L 4LMQI 4CVXA 1AXSA 5ACZB 3F12A 3SQBA 4ZOCA 1ACZA 3BQUA 1UXSB 4GKNA 1IVLA 4P48A 5E94B 1ROWA 4KK5C 1IC7H 4P2QD 1A6AB 3QUZA 3IGAA 4H1LH 4YBLC 3QO0A 3VXUE 1YC7A 4H0IA 3F5WA 2R15A 1W2KT 4XP9H 5ENWB 1NH6A 1U8QA 1G6VK 2JE8A 1CCZA 1YN7B 4P2OC 3I6KA 4CJ0A 1A2YA 4Y4HA 1XT5A 3U0PA 2ZUWA 4ZUVB 4PRNB 3RX8A 2EYTB 4KQ4L 3U9UB 4JVPA 3RA7L 5I1KL 3VRLF 5KJRH 2Z31C 4FZEH 1GC1H 2X4SA 1HXYA 4NDMA 2R0KH 3LN5B 3GRWA 4KK8C 3GSRB 5F9JB 5CJOL 4PLNC 1OAQH 2XN9E 5C71A 2CLZA 1HXMA 2GAZA 4PR5A 3QBTB 2R0WH 5KSBA 3WHE0 2EZ0D 5D1QC 4G6FD 2V7HB 3QJFA 2VLKE 5F88B 3QXWA 4OGYH 4WHTB 5I71B 4WGVB 3SBWC 4UTBH 1R5VA 4DTGL 3RZCB 5ITBL 1XGTB 4XNYL 4F15C 4HC1H 1RV6X 1RY7B 3UJTL 1OWRM 1W72L 3GMNB 4GG6F 3DNKA 4NRZA 3QUZC 4KHXL 1SVZA 3MRGA 4ZAKD 5I0ZA 4MA3A 4E5XA 3DMMD 1JK8B 5C07B 4UNVA 2EXWD 4TUOB 3SDCB 2AJXH 4JY6B 3GSXB 3GMMB 1AGBB 3NFPA 2DTML 1V3KA 1UWEH 1UZ6E 2QHRH 4AQOA 2KL6A 3IDYB 1LD9A 1PYWB 3WIIH 1N5YH 1DFBH 1NANI 2BRRL 1CFVH 1K2DB 4M03A 4P2QA 2ZOLB 4NQSA 2YEZB 5I1AB 1WITA 1TPXC 4XP6H 5HGDA 4XAWH 1I8LC 2DQTH 2H32H 4M43H 3W39B 1P7HL 1EJOL 1YYLH 5T3ZE 5JHLH 3STBA 1DSFH 4XTRD 3OR6B 5J6HA 4U7MA 4TSAH 5ITFA 3WHXB 1OW0C 3SJVD 5I9QC 4D0CA 3D9AL 4UDTB 3V2AR 1PY9A 2YRLA 3VA2C 3HRPA 1YEIH 4K94H 4G9DB 1FCGA 2F9BT 3R06B 5CSGA 2WMPA 4GUPB 2ZCLL 4MB5A 5DD6B 2ZUQC 1HYSD 1KJMA 4OZGB 4Y8AA 4NQVB 1MH5A 2VZ1A 3CFCH 4ZAKA 3VJ6B 5D2NC 2UY7A 1F3DH 4UT6H 4X6FA 1SJEB 3QDMA 2ZOKB 5C07D 4OCRH 2JJSC 1NMAH 4Z7UA 3SDCD 1NMBL 5IBUG 4N0UB 1ED3B 2V9QA 2NYYD 3HI5L 1OHQA 1NJ9B 4Y4KC 2QQNH 1D5IL 4GMTL 4WUKH 4NHCL 1UXSA 1E4XL 1VEPA 5E94A 2FR4B 1K8DB 3EW3B 4OTXL 5ICXB 1A6AA 4LU5H 3QUML 3RWFB 4G6AD 4D0BA 1T21B 2VDOL 4Y89A 1YN7A 2HFTA 3IJSB 4KWUA 2CQVA 1WSST 3SJVA 4ZUVA 2VYRE 4PRNA 2EYTA 4RWHA 1U8KB 4KUCF 1HH6B 3BPNB 3CK0H 1A3LL 2C4XA 1A1OB 5CZXC 3F7PC 2LAGB 3RVUC 2I5YH 3QIWC 3NABH 5J89A 2VDRH 4XBPB 3GSRA 4XPTH 5F9JA 2J1KA 3L7EB 4TUKH 3U36B 4DKFH 1CGSH 5C0BE 3LIZL 5E2VH 4DJMA 4NJ9L 1VENA 2YXFA 2GJZB 4HIEB 3ALPA 1X4XA 4EN3B 4KI5C 1ADQH 5F88A 1QOKA 5GRVL 5A3IC 1A6WH 4X7SH 2IMMA 3RZCA 4PJEE 4XC1H 2FECL 4HS6B 4WDIA 4HHAB 1V5JA 4AH2B 1A0QL 1AD9A 4QY8B 1T22B 1ONQA 1EIBA 5A2KH 2Z8SA 3OB0K 1DCLA 2E7MA 1S9WA 3K4DA 1TENA 5C07A 4TUOA 3SDCA 1A6UL 4DKDC 4JY6A 5EORL 5ICYB 3GSXA 3GMMA 1AGBA 2IBGA 4OZIF 1I9RL 1KPRA 4TYUA 3ZT5A 3CIQA 3RIFF 4MMZC 1UCBL 4KRPD 4D94A 4LPXA 2CUHA 4O4YL 1PYWA 2EDDA 4EUPH 4GJTB 1K2DA 2ZOLA 2YEZA 1YEFH 1QFWH 4X6BB 5C9KA 3TBVB 2K3TA 4NRXB 3W39A 3HNSH 3ARPA 3CSBA 2KBGA 3ZLQC 3GMQA 4HUVB 4UT9H 5IWLC 2BZDA 3OR6A 3QUXD 4RAHA 4GLRI 1HYSC 2VXUL 3S36L 3WHXA 3RZCC 1JRHI 4X6DA 5DHVH 1KJ2L 1RVFH 1MREL 2CRYA 3C09C 4QXGL 1GGIL 3KJ6L 4UDTA 4R4ND 4NPYB 5C1MB 1IC5H 2A83B 1INDL 3EOTH 1ZAGA 4G9DA 1KENL 4PJXB 2AK4B 3R06A 4J3VA 1JF6A 1P5UA 3OKLB 4GUPA 4EN3D 2BVUA 2NY3C 3GSQB 4K8RC 5DD6A 2HT3D 3ZKMC 2VR4A 4OZGA 2O5XL 3RWGA 3N9GL 1WZ1L 4NQVA 5C0GB 5I6XB 1JGEB 3MCKB 3VJ6A 3CH8A 1W8OA 4PJHF 5CZVL 1F3JB 4L3EB 4AT6B 4WJ5B 4R0LC 3GMRB 1SJEA 3S36X 2ZOKA 1UA6L 2BNQB 4BSWB 2FX9L 3GM0A 4HUUA 3QULB 2GCYA 1NJ9A 3MJ9A 1IGTB 2XZCL 5E8DL 3T2QA 1K6QL 3DI2B 4LHQB 3MBEC 4OB5H 5DD0L 3VXSE 3DETD 5CUSH 5ICXA 1IKNA 3RWFA 4DZBB 3UJIL 2MFNA 1T21A 4YUEH 4NO5B 5I1LB 3BIBX 3SKOB 3IJSA 4M1CC 3TCXA 3QUXA 1LDPL 1QBLH 3TF7C 1YNLH 4JJ5A 2AI0L 3O6KL 1NAMH 5IBLC 1U8KA 5I74B 2DL2A 1A1OA 1DN2A 4ZFFB 3KDMB 1X5YA 4ETQB 5C6PB 2R69L 4XBPA 5HI4C 4TULH 1ZLSL 2DQHL 3U36A 3ZDZF 5HGAB 4L4TE 3OXRB 2A73B 3MROB 4ZFGH 2GJZA 4HIEA 2Q8BH 4UU9B 4EN3A 3HMXH 3DARA 1YECL 3O8XC 2GW5A 4K8RL 3NCFB 4TVPH 2DQDH 1CDUA 3QFJE 1N6QH 2BJMH 4I3SL 3BSZL 5GS0D 2H41A 4YEFA 5E8EA 4HS6A 4HHAA 5IVZB 4BFGA 4KGJA 2ATPB 4YWGH 4QY8A 4X4ZA 1AFVL 2YHGA 1KCVL 4L8SC 1EEYB 4FABL 1T7WA 4DUXA 4MXWH 3O4LE 3HNVL 5ICYA 5KS9A 2DQFB 2BNQD 5AD0B 4JHAL 3BPNC 1JPGB 1OSPH 4Y5VC 1F4HA 3NAAL 1G9NH 4XI5D 4NGHH 5DHXB 2PCPB 4LEOB 3DSFH 3KYAA 3PHQB 5JA9A 4X6BA 4Z6AT 3TBVA 1FYTE 3BAEL 1XH3B 4PY8J 5DI8B 4UTAH 4I48A 2Q8AL 4U1GB 4W6XB 4DN4L 2XPGB 4EN3C 5CBEB 4ONGH 1P4IL 1ZGLP 1R3IL 2CKBH 4HBCH 4RGOH 4Z7VE 1FDLH 4QRRE 1DBAH 4UIMB 5E99L 4DFHA 5DJCB 3RU8L 1SM3H 1IQWH 5J1SC 4NPYA 2MPAL 5EN2B 5DJXB 3F7YB 1MJ7L 5B4MD 2IGFL 2QTEA 1VEMA 2RBLA 2YPVL 3C08H 2W9DL 4X7EC 3TH2T 1CLCA 5DGRA 3EDJA 4PJXA 2AK4A 2W91A 5BS0E 3NACH 1XMWA 4WFGD 5C08B 3OKLA 2NY4B 1NLBH 1OM3H 2Y1VA 3DX7B 2FD6H 4IIQB 3GKZA 1JGEA 4WFFE 3MCKA 1CGTA 5HYQB 4P4RB 5DVLA 3UO1H 1J88A 1YDPB 1XEDA 4L3EA 4WJ5A 4R4BB 5D6CA 1CXKA 2BNQA 4BSWA 1N59B 5IVXE 3QULA 2VQTA 2DM2A 2EYSB 2P43B 3G5VB 1IGTA 3O45B 4CVWA 4HWBL 4FQCL 3LPWA 5MENB 3MRBB 4KQ4H 5I1KH 3RA7H 1B3JA 3GHEL 1JGDB 3QH3B 2OBGA 3S98A 4ZOAA 4DZBA 5E24E 3RAJL 4Y2DB 5GXBB 1BQHG 3DX8B 4LP4A 4NO5A 3SKOA 5DA0B 5DRXA 2WAHA 4BH7B 3D48R 3U48A 2FATL 4HUWB 4LF3B 5TDPB 4XVUD 3RI5F 3BN9D 3EAKA 3HZKB 1H15B 4KKCD 5EO1B 4DGYL 2VXQL 5I6XC 4ZFFA 3KDMA 4JFDD 3I02B 2E9BA 3C6LD 4ETQA 1VFAB 4OUUB 5ITBH 4XNYH 5GS2D 1HCFX 5HGAA 3UJTH 1W72H 3OXRA 1TIUA 2A73A 3IXTB 3MROA 5K59E 4KHXH 4UU9A 4Z8FL 2LVEA 2WWKO 5JQHC 3PGCB 3GFUA 2N1KA 1DBJL 1MRCL 2ERJC 4OZHB 1JZ4A 1KN2L 2HAZA 3AS3A 2DTMH 3QRGL 5IVZA 5C92A 2ATPA 2YD7A 4FQLL 2BRRH 3QSKB 4U7SA 2JELL 4HJGB 4Q74A 4DCQB 1CQKA 2DQFA 3ORJA 5DDHB 4YFEA 5AD0A 1MCOL 1EJOH 1JPGA 1DVFC 1QRNB 1UZ6F 2AEQL 3RIAK 1RZFL 1J11A 5T5NG 3MLUL 4NT6B 4ZS6C 3KNBA 1FV1A 1MVUA 4JR9H 2UZIL 3TBYB 4X6CF 2PCPA 4LEOA 4D2NA 1T80A 2C1PB 4WENB 2IG2L 4AEEA 1Y6KR 5DI8A 4IJ3C 3MFFB 3D9AH 3EYFA 5JIHA 4Y2DD 2XPGA 5CBEA 4RGMB 4PLKD 4N8PA 5ESQA 3QHTC 5C2UB 4APQC 4UIMA 3C6LA 5D71L 5DJCA 4M93B 2EKJA 2ZCLH 1MY7A 1CFBA 2B4CL 5EN2A 5DJXA 2JCCE 3HCVB 3MV7B 2LE9A 3KHQA 2VLJE 5ADOL 3C5JB 3B9KB 4JFED 3ULUE 5SWSB 3B8SA 3UYPA 1FO0L 1Z0MA 4ONOA 1Q0XL 1OL0A 3DX7A 1BQHB 4U0RC 1NMBH 43CAB 3RTQB 5I1GL 3HI5H 5D5MB 3C60B 2X4QB 3DRQB 1D5IH 4GMTH 5HYQA 4P4RA 3MV8E 4NHCH 3OGCB 1GZQA 1E4XH 1YDPA 4MA1B 1YEGL 4HK3J 2FX7L 5D2LB 4R4BA 4WFHD 1J10A 4P2RB 4LRIA 3QUMH 1OF2B 2P42B 1NSNL 2VDOH 3MLWH 3Q5TA 4OSUL 3FL7A 4ZO8A 2CH8A 2EYSA 3ZYOA 5K9KB 5KG9B 4H0HB 4P46B 2YA1A 3O45A 1QRND 5F7EH 1MHEB 5MENA 3MRBA 4Q58C 1JGDA 1ZLVH 3QH3A 2PTUA 1A3LH 5MEPB 4Y2DA 1BLNB 1CQYA 3VI4F 4XP4L 2RQ8A 5DJYB 3O81A 4BH7A 3VFNB 5JMOC 3LIZH 2NY4C 4HUWA 1MFNA 4ERSL 3BPCB 4NJ9H 5TDPA 2WQRA 1BEYL 3HZKA 2AEPL 1H15A 4DUWA 5EO1A 3S9DB 4IIQC 2V17L 2DICA 3BP5A 3I02A 1VFAA 4OUUA 1N0XL 4P9HC 4JFEA 2OR8A 1A0QH 3MV7D 3QCVL 1A7QL 3R8BB 4AIOA 1X5AA 4NCC1 2NZ9C 5SWSD 3K2MC 4OZHA 1A6UH 3G08B 4DKAA 5EORH 1EEQA 2ZCHL 3BRFA 3LKNB 1FE8L 1I9RH 2DI9A 4PJEF 1G7MB 1NGPH 1UCBH 2FBJL 1OGTB 3HA0A 4OD2A 3ILPB 4O4YH 4WGWB 3C60D 4R7DB 1P4LB 1T6VN 3LH2L 4G7VL 4U49A 2UUDK 4HJGA 2FJHA 2YUVA 3C2AL 4LBEB 2HT4C 5KN5B 2HJLB 1T4KA 1QRNA 2GTWB 1A14L 4M1DH 4Q9CA 3GI9L 3TBYA 2VXUH 3S36H 4DQOL 4FFWD 3VDBA 5D6DA 1S7UB 1KJ2H 1ZXQA 2VZTA 3IJHB 4P5KB 1OP5H 2C3GA 4XCEB 3K2UL 3O2WL 4I18C 3W5MA 1GGIH 3MFFA 3QDJE 2DM4A 3KJ6H 1BECA 2A74B 4M7ZC 1B2WL 4BJLA 4BQ8A 4G43B 4I5BB 4IOSD 1WCBB 1R3JB 2VUYA 1E6OL 1QEWB 1OSZB 4PRAB 2UV3A 3L3OB 4PTUB 1KENH 1NAKH 3Q2CA 4Z7WF 4JM2C 4GOSA 4IDLA 3QCUL 3KS0H 5E9DE 4LVHB 2O5XH 2VR5A 3LRSA 3N9GH 1WZ1H 1QFWM 3MV7A 1GGUA 1VGKB 3P4NB 5GJSL 5E7BA 3C5JA 1MLBA 3B9KA 5SWSA 5CZVH 1P6FA 1Q38A 4HWUA 5IVNA 3KLHD 5F21B 1YY8B 3QAZB 4YXLL 1UA6H 2FX9H 4P3WA 1BQHA 43CAA 3BIKB 3RTQA 3OL2A 5D5MA 3C60A 5D6DC 3DRQA 2XZCH 5E8DH 2VITB 4X9BA 3TZVC 1JZ5A 3OGCA 4KKLC 4C59B 5FUOL 2C9AA 5IB4B 5D2LA 2BHZA 4RGMC 4KDVA 3BGMB 4PP1D 1OF2A 3FJTA 2G75B 1FRGL 4MYWB 4OF6A 5C0ND 5KAQF 5K9KA 5KG9A 5IV2B 4M93C 2BSED 5EWIL 4XNZB 1CDGA 2AI0H 1MHEA 2C1OB 3O6KH 5FGBA 4TTDC 5EBWB 4UB0L 3ULSB 3M1BB 2PYFB 2EIBA 3WCYA 1S9XB 3DBXB 3QEQB 3V52H 4OCSL 5MEPA 2CO6B 2R69H 4JG0L 3B9KC 4U3CA 1ZLSH 5DJYA 2DQHH 2DQGL 3VFNA 2DWDB 3T0EB 3BPCA 4G8IA 4XGZB 1PD6A 3V6BR 1T03L 1YECH 4TSCL 4K8RH 1RULL 2APXA 3RTQC 1J8HE 1H3TA 1AGCB 5T1LB 1W0WB 2V2XB 4I3SH 3BSZH 4BSJA 1OGAB 3BEVB 5F6IC 4AY0A 4MA1C 1F4AA 4YXKL 5AYQA 5JQ6L 1UGNA 2E6JA 3UMTA 2X6MA 1AFVH 4UILL 1KCVH 3L5HA 2W60B 4FABH 3OHXB 1LDSA 1E6JL 4GBXC 2W92A 2WBJB 1XF3B 3HNVH 4P46C 3G08A 3PJSA 2BDNL 4OF7A 5I1EH 1G7MA 4OGAC 4JHAH 2VLLB 1JZ2A 5DSCB 4JO4L 3VG0L 1OGTA 3VXQB 5A16B 3ILPA 1P4LA 3MOAL 3NAAH 3B9AA 1M7XA 2HT2D 1MCWW 2XQBL 5EB9A 3WO4C 3BAEH 2V2WA 1I1AB 5KN5A 4I0KA 2Q8AH 5DJAB 2PKDA 4JKKA 4DN4H 2BVOB 3FHQA 2F53E 1P4IH 3I6LE 2GTWA 1A1MB 2XKNB 1S5HB 1OPGL 3MV11 2NMSA 5C0DA 4AEHL 4K3GA 3QFDB 1SVCP 1S7UA 3IJHA 4P5KA 5E99H 4XCEA 3RU8H 3ARVA 4BM7A 4ZTPL 1FVDB 4FFVD 4KV5E 1EDQA 3WNPA 3QEQD 2MPAH 5ERWA 3T04D 1FORL 1MJ7H 4LKXA 2IGFH 3L7FA 1TQBC 1WCBA 1R3JA 1QEWA 2YPVH 4PRAA 2W9DH 3L3OA 5AAMA 3P73B 2XI9A 4PTUA 3T0ED 4GG8B 4X4XB 4YQXL 4P23B 1MNUL 4Z7VF 3T0BA 3MA9H 2XTJB 4WI2A 2DJSA 5D7KD 1L6ZA 4U1SB 5T1LD 5TF1L 3KPLA 3WJJA 1OGAD 1VGKA 3TC9A 3P4NA 1QSFB 3QNXB 1BJ8A 4BYHA 1M71A 3B5TA 2XZAL 1YY8A 2NR6C 5J1AB 2WBJD 2E3VA 3HE7B 1OTSC 1T7VA 3HRZB 2ZWLT 3BIKA 5C0BD 1YPZB 2IALB 1MJJB 4OIIL 2VITA 1NFDF 3BFOA 4U31A 2QJDA 4KAQL 4HWBH 4FQCH 5DRNB 2BHUA 5IB4A 3V6ZB 3GHEH 4P5TD 3BGMA 3CSGA 4YEEA 4AJ0A 2G75A 5FCSH 3RAJH 3QWOB 5EU7E 1I1AD 4LOUC 2ADJA 3MSPA 5FM5M 5A2JH 2GSIB 2I25N 3T2PA 1BBDL 2FATH 5MHSE 4XH2A 1DP0A 2C1OA 4LPYA 5EBWA 5FHAL 4IRSB 3ULSA 2RCSL 4OFVA 3M1BA 3MLYL 4LVHC 4R2GB 2PYFA 5F71A 4DGYH 1GOHA 2VXQH 1IAIL 4X80L 1S9XA 3QEQA 5ANME 3P3YA 5JHDE 2ICEB 4M3JA 3IFPA 2DWDA 4XWGL 3QNZB 5BW7C 3T0EA 4Q9RL 2GY5A 1KEMH 3WD5L 2A9ML 3DX6B 4XGZA 3QAZC 4Z8FH 2M2DA 2ICCA 4RBPH 3BW9B 4R26L 1DBJH 5T1LA 2MJWA 4BA8A 1W0WA 1KN2H 2V2XA 4YHOL 2ZPKL 1OGAA 3BEVA 5DO2C 35C8L 3QRGH 2GK0B 1MI5B 4LP5A 4G7YH 1BVKA 5K9OB 4NM8L 1PFCA 5K59F 2CXGA 5DZNA 1QSFD 3OHXA 4FQLH 1FFOB 2JELH 4GH7B 3ZT6A 2EC9U 2WBJA 1XF3A 5CLWA 3SDYL 2B39A 4LLAA 4XNZC 2VKXA 5C0BA 3MXVL 1T5XB 3HE7D 2VLLA 5DSCA 5HI5C 4M48L 3VXQA 3CJJA 2AEQH 5A16A 1RZFH 2B5IC 3MLUH 3MLPA 4ZNEE 3BESR 1GJIA 4AIZB 2EDEA 1VFMA 4M8VA 1K9TA 2LABA 3U46B 2IG2H 4XBEH 1F6FB 1I1AA 1CYGA 5DJAA 3TO4D 1HEZB 4G3YL 4POZD 4XMPL 2BVOA 3VGHA 1A1MA 3FQNB 3FOMB 2XKNA 4JHWL 1S5HA 3RGHA 1L0YA 2H45A 4MNQE 3T1WA 2W0LA 3QFDA 3QQ9C 3L3HB 3VXTB 2VR9A 3ESUF 3NA4A 4IRSD 5D71H 3GSUA 1U3ZA 5A1AA 1CLZL 3O3DB 1Q9LB 4PRIE 1FVDA 5J57B 2ZUYA 2B4CH 6CGTA 2O61B 1DUYA 1ZT4B 4RDQG 2J8HA 3ARGC 3P73A 5ADOH 4GG8A 1TFHA 4X4XA 3HC3L 1FNFA 1HHGB 2VDQL 2G60L 3QHFL 1FO0H 3LQAL 2PXYB 3BUYB 1UT9A 3D39B 4MZ3A 3SCMB 3F7QA 4U1SA 1BX2A 1Q0XH 1KT2B 3FTGB 3RFZC 5HHME 4TPRL 3C8KB 5I1GH 1UWXH 2IFGA 2K9UA 3B9DA 3RVTC 1QSFA 3HFML 2ADGA 1S8DB 3H42L 2BMKB 1YEGH 4MQXD 3KWWB 2C5DC 2FX7H 2MMXA 5J1AA 1XR9B 1OTTC 3ETBF 3HE7A 4BH8B 4JRXE 3HRZA 1KB5B 1NSNH 4OSUH 2IALA 3EJYD 3NN8B 1MJJA 4JFYB 5D8JL 2DDQL 4G8FA 5E5MB 5DRNA 4WU7A 4WW1B 3V6ZA 3ZE0E 2J8UE 3QFJD 3K4ZA 1BFTA 1LQSR 3QWOA 4MQSB 3MXWL 3HZMB 3P0YL 4KC3B 4XP4H 5HI3C 4BQ6A 3MR9B 4P23C 3HAEG 1EV2E 3EJZC 2XTJC 1KIQB 5DK0A 4ERSH 4LVOB 3D5OF 5JXED 1BAFL 1BEYH 4IRSA 5BRZB 5ADPL 4HUXA 2AEPH 3ARFB 4M7JL 3TM6A 2ZKHH 3DROB 3O4LD 1PSKL 2V17H 4IBLT 4WI8A 5DC9B 5FKPA 4I0PC 1N0XH 2ICEA 4WWID 2HFFB 3QNZA 1F4XL 4G8GE 4CU6A 2KQMA 3BWAB 3DX6A 3QCVH 4WI3A 1GH7A 3RL2B 3BW9A 2C7UB 4XNXL 2X2YA 2C4FU 1M7DB 4PGCB 2PXYD 3QXTA 3SCMD 2ZCHH 3DVFA 4XVTL 1FE8H 1RD6A 2GK0A 4ONFL 1YJDC 3TJEL 5EO9B 3GMOB 2FBJH 1F6AB 4D0DA 3D0LB 4G7VH 3LH2H 4PRPB 1UYWL 1UH2A 4QRRD 2VTFA 5CSZB 4KXZI 1FFOA 1Y6MR 3CDCA 1IMHC 3O4OB 4QWWC 2FWOB 5HYSG 2XY2A 3C2AH 1JRHL 4Z18A 2BOCA 1T5XA 2P5WB 4OLWL 3ULVC 1U3JA 4MHHG 4R2GC 4XCYB 4DW2H 2YS4A 1A14H 5IVOA 4PJ7B 3GI9H 4AIZA 4DQOH 4N8VB 3U46A 2IPKB 3K2UH 3O2WH 3LDBB 3S5LB 4L9DA 1RJLB 5ABDE 1JNNL 4GRWH 1FC1A 2DLTA 4LVNB 1B2WH 1CTNA 1EBPA 2GITB 1S7TB 1WBXB 5EU6E 3P11L 5JXEA 3O4LA 3MQIA 3VXTA 3E0GA 5BRZD 3ET9F 3F7VB 3O3DA 1Q9LA 4PRHB 5BCAA 3QCUH 4QOKE 3ZL4L 4U6XB 2AW2A 3H9HB 4LLVA 2O61A 1ZT4A 4YH6A 3VGBA 1UJTA 5GJSH 5HHPB 4N9OB 1HHGA 3VRIA 1IARB 4NZUL 2R9HC 3T4YB 4PGDB 4Y7MA 2PXYA 3BUYA 2WNGA 3SCMA 4Q7DA 3T1FB 3HG1B 3PUCA 1KT2A 1YJDL 4YXLH 3RBGA 1E28B 3FTGA 3HUJE 4QNPE 1NBVH 3WV0A 3C8KA 1MFCL 1JVKA 1QBBA 2VN4A 4GS7C 2EXYD 1CL7I 3AXLB 1EZVX 1S8DA 4X4MA 1MCHA 5FUOH 1KV3A 3KWWA 5DURD 5HDQL 3V7AE 1BWWA 4PRPD 1Z9SA 4NN6B 3WN5B 1XR9A 5J12B 5JORB 1QZ1A 4IMKC 4BH8A 1MCLA 3FAXA 3VDAA 5IGXL 4LLQB 3V5HB 1LHZA 3NN8A 3BH8B 4H20L 3B2UD 5E5MA 2DM7A 4WW1A 1U95A 4LLDB 5JLZA 4OFDA 4HJ0D 4JPWH 7FABL 2KZWA 4TVSa 4OCSH 3FFDA 1DBBL 2VJXA 1HSAB 3MR9A 2DQGH 4HEME 1KIQA 2WWMD 2AKRB 2DJUA 3FKUS 1XZ0B 5BRZA 4KMLB 4M6ML 3RL1B 1T03H 4TSCH 3ARFA 1RULH 4BZ1L 3DROA 1X44A 5GS1A 2BVPB 3O6FD 1SEQL 4YPJA 5E1AB 2X70B 5J3HC 4YXKH 4LSDA 4GG6B 3K1KC 5JQ6H 5C0EB 1XGUB 4NZTL 4UILH 4MMXC 3RL2A 4Y19B 1Y18B 1QPPA 2QADB 1E6JH 1M7DA 3VXOA 4PGCA 2ED9A 2BDNH 1CD0A 4LQFL 4CADB 2FNBA 2CLRA 3HG1D 3I50L 3FQXB 5EO9A 3GMOA 4JO4H 3VG0H 3IFLL 2AK1L 1F6AA 3D0LA 2OK0L 4NQTA 4PRPA 3MOQA 4R3SB 1ZVSA 4JAMA 4Z76B 5H37G 2IF7A 3QI9B 2FWOA 2B8OT 2KPNA 4HJJL 5DUML 5F6HI 3QWQB 3LOWA 2W1NA 1KXTB 3ARFC 4XCYA 2VLJD 4PJ7A 1OPGH 3VFRB 3DI3B 3QG7L 4AEHH 1YEHL 4JFQB 4N8VA 3GJFK 2FHBA 4F7EB 4WI6A 3IKKA 4WW2F 4ZTPH 2EKSA 4DOHB 1FORH 1GGYA 2DRUA 4GW4A 4N5ED 3VD3A 1WBXA 1H3GA 3MV8D 3EZJB 1UFUA 3MO1B 3GGWA 1MNUH 5CEXB 1TZIB 2BNRB 1NKOA 2YWZA 3F7VA 1JYWA 3O2DL 1PJ9A 2Y6SC 4KDTA 3H9HA 3V79C 2PO6B 2HKFL 1DQQA 1G1YA 1MCSA 1WFNA 1X5FA 3O4OC 1KB5L 1U8MA 1G6RL 4X0KA 5I8EB 2R8SL 2EECA 3WS6A 3T4YA 4H25B 5F9WB 4LARL 2A6DB 2XZAH 4YJZL 3T1FA 1J05B 3HG1A 3FONB 1E28A 2OZ4A 3BPOB 3OKEB 3D87B 1MUJA 2HJFA 2DI7A 2JJTA 4M6NL 4OIIH 4MJ6B 4TNVF 1HILB 3AXLA 1TNMA 4J3UA 1K4CB 1T1YA 4KAQH 4JO1L 4NP4L 2ICES 3SPVB 2NY2D 4GXUM 3QI9D 2B20A 3SE3A 1WZKA 4KQ3L 5CGYC 3TT1L 4LLQA 4HIIB 3V5HA 1YY9C 1BBDH 3BH8A 1LO5B 4EDWL 1CN4A 1SHMA 5FHAH 4Y5XB 4ZDHB 2RCSH 4LLDA 3MLYH 1NCBL 2VE6B 4X80H 4KHTL 4M62L 1B0GB 3D3VE 2OTUB 1LO3L 3MV8A 4XWGH 4Q9RH 3WD5H 1GOGA 1XZ0A 2A9MH 2QL1A 4L8BB 4F2MB 4EBQL 4M00A 4HLZG 4R26H 2BVPA 5HYSA 1NANH 5DFTA 2X70A 2ZPKH 4GQ9L 1DEEB 4GG6A 5JOFB 2PO6D 1A9EB 2H3NB 3KPSE 1OB1B 4NN6C 3WN5C 1XGUA 1NGXB 3QEUB 4NM8H 5J12C 5T33L 3CDFA 3SE3C 1FZJB 3L3KA 2BOBA 4LIQE 5T1KD 2W38A 1F42A 3SDYH 4YDJB 1PZUB 2EDLA 3MXVH 4LLWB 4HIHB 4YC2B 3WSQL 4R8WL 4OZIB 2APTA 3U0TB 3MLVL 2P8LA 4RAUA 2M8XA 4R3SA 4Z76A 1HYRC 3FQWA 3QI9A 4PY7A 5D70L 1JZ7A 4R7NA 5E9DD 1KGCD 4G3YH 2FO4B 1UH3A 1KB9K 4JHWH 2A6IB 3VFRA 4F9PA 3WIHL 3PWPB 1L6XA 1DN0B 4NKOB 5DC0A 4LSRH 4F7EA 4WV1B 3NCYS 2UWEE 3SGJA 2OMBA 2JF1A 4L5FL 2VDML 4Y0GA 3WKML 2QSQA 4M02A 3I3EA 2QADC 4D9LH 2Y9RT 3MO1A 3MGOB 3SDDD 5CEXA 3OZ9L 5L7XL 2VDQH 3RNKA 3AC0A 1JFQL 3QHFH 3SE4A 3ZKXB 1N6UA 3LQAH 3TBTB 5TPWL 2PO6A 3P30L 3BZEA 4TPRH 4PJIF 1JPTL 4AL8L 2GI7A 3BD5A 3HFMH 2FLRT 1Q9KB 3H42H 4PJHB 3BD3A 5J1TC 4F8TA 4H25A 1BFOB 3FQUA 3DV4A 2A6DA 1TZHB 2DQCL 4QRUB 1RIHL 4PJ8B 4UOJA 1U3YA 1QSEB 2ENSA 1YEDB 2CDEB 4MJIB 4MJ6A 4DGIL 1HILA 2DDQH 3DIFB 3UX9B 1K4CA 1GAFL 4LHUB 3J8F7 3SGJC 5GGRB 2YN3A 1U6AL 5F1SA 1J0KA 3THMH 3DVGA 1JMZA 1J8HD 5IB2B 5F9DC 5L6YL 1FP5A 2AP2A 5LKNA 3MXWH 3P0YH 4JLRB 4FQ1L 4HIIA 4PJAE 3X11B 1IM3B 3LQZB 1BVZA 2COQA 3E6HB 4Y5YB 3UPAA 5IFHL 3K80A 1DDHA 1BAFH 4Y5XA 4ZDHA 1GYAA 5ADPH 2MKLC 1S9YA 3EDFA 1GZPA 3LKRB 1PSKH 4WY7L 1B0GA 1HE7A 4OV5A 1BQSA 1QKZL 3BGFB 5L88L 3CNKA 1F4XH 1ZLUH 5F9WC 5F3HB 3SDDA 1NCDL 1AHWB 4NQEB 4ZSOE 4L8BA 5FAAA 4F2MA 4IRJB 4YHNB 3EIFA 5TFSL 4XNXH 3MRRB 2VL5A 3WFDL 4IRZL 4Z0BL 5TDNB 4KMTL 5BV7C 3MV9B 1DEEA 4XVTH 2F53D 3I6LD 4ONFH 5JOFA 1A9EA 2H3NA 3TJEH 1OB1A 2YRPA 3LV3B 4ZXBB 1NGXA 2D9QB 2WP3T 1FZJA 1UYWH 5EFIB 2ARJQ 2IQ9L 4XHJC 3SDXE 1TJHL 4OJFL 4GLRH 1PLGL 4TN9A 1JRHH 2CMRL 4CDHA 4LLWA 2D03H 1RU9L 4OZIA 5IEHB 4LCUB 4OLWH 3FAWA 4ODSL 3D6GA 3RVXD 2C26A 4JHBA 4PJ8D 1CGWA 1QSED 5GS0L 4MJID 1J8HA 1QBAA 1YUHB 2FHFA 3WO3B 2VOTA 5FM4A 2VDLL 5CHNA 1E0OB 1BFSA 5AZ2L 2R1XB 3S3PA 1JNNH 4XPAL 3BOVA 4YZFF 2FO4A 2VXSH 4RGNC 1D5XB 3VG9C 1UJ3C 5HDOA 2A6IA 3P11H 1T1WB 4Y1AE 1JYXA 4UOW0 1J1XL 1DN0A 4NKOA 1EUTA 4LPTA 3HR6A 1CT8A 4WV1A 1WAAE 2DI8A 3ZL4H 1E4KC 2RFXB 4O2CB 4OZFB 5I1IL 3V6OC 4NZUH 4UIKL 4YC2C 2IBBA 4IRJD 1X5KA 2HRPL 3MCG1 4XXCA 1G0DA 5BV7L 3MRPA 1YJDH 3WNKA 4OM1L 5LVEA 3ARBD 1HN1A 2YD6A 3CD4A 4QYOB 4UAOC 1IEAB 1MFCH 5MHSD 3MV9D 5T3XL 3FB6B 2OR7A 1OAXL 4U33A 1F4YL 1Q9KA 5CCKL 3S35L 1RIUL 5HDQH 1OCWH 3TNNB 3MRLB 3QA3B 1SJXA 4P57A 4Y2OA 1TZHA 5JHDD 1O7SA 1F2QA 5IGXH 4PJ8A 5F1NB 1QSEA 1YEDA 1AIFB 2CDEA 4MJIA 4KH2A 5IW6A 3DIFA 5D7LE 4H20H 5I19L 1D6VH 5GGRA 2NY0B 2Q7NA 5E56A 4LCWE 5E8PB 3DLQR 7FABH 1KCRL 2ICWI 1DBBH 3DRTB 4JM4L 4JLRA 5CJXC 5AYUL 3BWUC 3X11A 1IM3A 3WS3B 1N26A 3ZKXC 3AM8C 3E6HA 4LDLB 4Y5YA 3BT2L 3V0VA 4ZFOB 1U8NA 1A02N 4S1SL 4MHHI 2P44B 4M6MH 2K1MA 3CMOL 1X5JA 4LEXL 2YK1L 3JWDC 4BZ1H 3LKRA 2GKIA 1G7QA 1ZEAL 3MNVA 2EDHA 3S35X 1SEQH 4HAFA 4MAUL 1EO5A 4ELME 5GRYA 1AI1L 4JREB 5F3HA 4G6KH 1AHWA 1QUNA 4KK6D 4NQEA 4U1IB 4NZTH 4H5SB 4IRJA 3QJHB 4CN6A 2CD0A 2DQIL 4PJ8C 3MRRA 2JK5B 3ARED 2GYSA 3ARBA 1ZLWH 2P48B 5TDNA 4LQFH 1F11B 3RGVB 2FJGB 5C0CB 2L7JA 3CU7A 3RY5A 3MV9A 3I50H 1U2HA 3LV3A 5D7IE 3IFLH 4ZXBA 3V7AG 2OK0H 4MNQD 4M7KL 2LTQB 4DVRL 2Z93B 4UOW1 5EFIA 4OLVL 4NKIL 4Z7OE 5B3JE 3OAYH 3P77A 3JBG7 4HJJH 4PRID 5DUMH 1D9KB 3K1DA 1I75A 4HFWB 5IEHA 4LCUA 1CDBA 4R97B 1NCAL 2IAMB 3QG7H 1MHHB 2PTTB 4X6CB 1YEHH 2E7HA 1YUHA 1X5XA 4GAYB 4L4VE 1Z9OA 5B3NA 2R1XA 2NXZC 5HHMD 1IKFH 4K23L 5I17B 4G8EB 1ZLVK 1T1WA 3U0WL 4OCWL 5HHXL 4ORGB 1LO4L 4ZO6A 5HTSA 1DQTA 1GOFA 3VCLB 3WFZA 4A6YL 4X98B 4ZXBC 3O2DH 4JRXD 4IOFD 4JQVA 2HKFH 2RFXA 4ZNEA 3G6JE 4OZFA 2P5EE 4ODVL 5JW5B 4NUGL 1G6RH 1CICD 5FYLL 4B7LA 2R8SH 4OFYD 1B6UA 3VGDA 4AMKL 3WDJA 4ODBD 4NN7B 1OT1A 3FZUD 4MD5B 1IM9B 4QYOA 1JHLL 1AD0B 3QZWG 5C0CD 3HE6D 4M6NH 3FB6A 2VLMD 3PQYB 3TCLB 1KACB 5DFVC 4JO1H 2ZZUT 4NP4H 3TNNA 3MRLA 3ZKND 1A6ZB 4HDIB 5C6WH 4KQ3H 3TT1H 5F1NA 1ZGLM 1T20B 1NC2B 1AIFA 4G8GD 1WIOA 4ZQKB 1T2QL 3HTLX 3PWJB 3TIEA 4LFHG 2IAMD 1WIUA 3GIZL 1NCBH 3F8UB 4MJ5A 4YO0B 3CX5K 2EDWA 4KHTH 1O7VA 4M62H 3DRTA 3VD7A 3EHBC 3C2SA 4OF0A 1LO3H 3UZQA 1N8ZB 5MEQB 3CX2A 3ARSA 1W0YT 5F6HJ 1OP5K 1IBGL 3MUGB 3DECA 5I76B 4RX4A 3K81A 4QF1B 4HKJB 3MRHB 4EBQH 5I15L 4GRWF 1HQ4B 5CEZD 3QDAA 2FIKA 5E2WL 1CICA 4MXQD 3DOSA 5T33H 2HG5B 4S0SD 4OFYA 4U1IA 5GZNC 4H5SA 3QJHA 3CXDL 4BELD 4LGRB 3D2UD 5CP7B 2JK5A 1EHXA 3VXMB 4FMFA 3IRPX 1KELL 5I30L 5CIPB 2FJGA 1A7PL 3WSQH 5C0CA 1NEUA 4R8WH 5EUOE 2NY0C 2ZG2A 1IM9D 3I6GB 1AR2A 3LKQB 4ZTOL 3MLVH 1IAIM 5IBTL 1CDIA 3MODL 1KXVC 2Z93A 3KLSA 2KUTA 3JWOC 5JIPA 5FA3B 1S78D 5HD8D 5D70H 1FVEA 4QOKD 1LP9F 3H8NA 4G8GA 4HFWA 1F2XK 2V5RA 4CU7A 4C4KT 5DA4A 2IAMA 3DUUB 4AM0A 1NC2D 3H6JA 1MHHA 2PTTA 5EOCJ 1FIGL 4X6CA 3WIHH 3DURB 5CS7A 4F9LC 3P9MB 4PJCF 4JREC 4H1LB 2X9WA 4GAYA 2Z8RA 5EOTA 2XT1B 1JUFB 5DUBB 3DUSB 4L5FH 4P2QE 2VDMH 3WKMH 1J0IA 3NIFE 4G8EA 4ZMAT 4BK4A 5D2NE 3GEWB 4ORGA 4AEIL 1A7NL 3RGVC 3OZ9H 4Z7WB 5L7XH 3PABB 2Z8WC 3VCLA 2JB6B 4X98A 4GRLB 2ARJB 4O02L 4HIXL 1UEYA 1AO7B 3Q3GB 5FGCE 2LTQC 3P30H 4YHKL 2HVKA 2HMIC 1JPTH 2IPTL 5FFLA 1K3IA 4AL8H 5SWZB 2Z0BA 2I27N 2FZ3A 3SE8L 1D9KC 3NPZB 3MLRH 1G7IB 3CFBB 3TJHC 2DQCH 1VEOA 4MD5A 1IM9A 3KGRA 1I8IB 4PLOB 4YHLL 1AD0A 1C12B 2CIIB 4YDLB 3AY4C 3RWJB 1HK6A 4DGIH 4RFNB 1A9BB 3PQYA 1GAFH 4I8DA 1U6AH 1ZA6A 1OD9A 1H8SA 5C3TA 4QOKA 2PNDA 4NM4L 5GGSA 1II4E 5L6YH 4HDIA 3LSOA 1NMCB 1ZHKB 4FQ1H 1CS6A 2VSDA 1V05A 1T20A 1NC2A 4Y16B 6FABL 3QDME 5DTFB 4R90H 1ZSDB 5IFHH 2DKSA 3PWJA 4KI5E 2X1QA 4KKAC 3MRQA 5DJ2B 43C9B 4YO0A 3C5ZD 2H32B 3GSWB 4XNUL 3L5JA 4WY7H 4BZYA 1NDGB 5L88H 1RMFL 4J2XA 1OTUC 1N8ZA 2R23B 5MEQA 4JZNB 2WANA 1CXHA 4KROC 1NCDH 3IDGB 2W0KA 3MUGA 5I76A 4HKJA 1D7FA 1AC6A 4PG2A 4ENEC 5TFSH 3WFDH 4IRZH 4Z0BH 4NBYB 4YDIL 5C86A 1OLZA 4GRLD 1PKQB 1AO7D 4KMTH 1KNOA 1P6AB 4HGWB 2HG5A 3IDJB 5SWZD 5IJKA 3BIAX 2IQ9H 5CP7A 4LFHD 1TJHH 1T89C 2D7OA 4OJFH 3VXMA 1PLGH 2J5LB 3MJ6A 5DUPL 2CMRH 3C5SB 4RZCA 5CIPA 4PD4K 4N0FB 1RU9H 3UBXB 3LKQA 4NSKA 4ODSH 2KH2B 2VERN 5GS0H 4K55A 2F74B 5IK3A 5FA3A 4XNMA 5T3ZL 1MFBL 4PREB 4OF3A 2BNUB 2OL3L 5L8JB 4NNPL 3ZSTA 3CFDB 4WTWA 2AABL 5AZ2H 5AAWA 3AS0A 3VU2A 4XPAH 1NFKA 5C07E 3ZYJA 3SO3B 3PWUB 5J6GB 3DURA 4GXVL 1J1XH 3C5ZA 3P9MA 1KLGB 4H1LA 4N68A 3H3KA 4I2XB 3M45A 1JUFA 5A2FA 5HJ3B 3MA7B 5IJKC 1IEBB 2MNUA 4F37K 3QZWA 2DWEB 3KPPB 1MFDL 4O5LL 1UADC 5I1IH 3Q1SL 4IEFB 4Z7WA 4UIKH 2LAAA 3PABA 1WTGT 1K5NA 1CL7L 2JB6A 4M7LT 3VH8B 2HRPH 3QUYC 4GRLA 5EZLB 3SKNB 2I9LB 1HSBB 5FA4B 4GKOA 5BV7H 4J4PD 1AO7A 3WDHA 3PP3H 4OM1H 3MRKA 4MXVE 5F1IB 3OSKA 15C8L 4KRNA 5T3XH 5SWZA 1F4YH 4HXAL 5CCKH 3S35H 1RIUH 1G7IA 3CFBA 2NCMA 2YOCA 4NIKB 1UM4L 1EO8H 2Z35B 5GRZA 3KPMB 1I8IA 4HC1A 4NYLB 3KXFB 4FQIL 4WNQA 1D5BB 2CIIA 4NCC2 1NFDB 1A9BA 3BZFB 5I19H 1R0AL 4OZGE 1JZ8A 4S1DD 1UZ8B 5GS3A 3RDTC 2XKUA 3RHWK 5H94A 1KCRH 5TGBA 5HGHB 4JM4H 5AYUH 5TH2B 2VZ3A 1U8PB 1ZHKA 3EDDA 3B8YA 4FXLA 4XPHL 1KCLA 2YD4A 5EU3B 5DTFA 1ZSDA 3OKKB 2IBZX 3BT2H 1I3RB 3FQTB 3IF1B 4EUPB 5F7UA 2YWYA 4S1SH 1MCJA 3WLWD 1NPUA 4N0UE 5IEKA 2NY6B 3CMOH 4YBQD 43C9A 4LEXH 3P4MB 4U7KA 2HTLC 3NTCL 5I73C 2H32A 3GSWA 1ZEAH 3B5GA 4QXTB 1NBZA 1NDGA 1TLKA 2A2QT 4MAUH 1G7JB 2MQCA 1AI1H 2M1KA 1MCNA 3EDKA 3EO1B 5KANG 2E7LC 2AV7B 1XF4B 4HKXB 5DHVB 2R1WB 1FLTX 2ADFL 4J4PA 4PJGF 4YDLC 4MJ4A 4OCLC 3OV6A 4RFNC 5LGJA 5GRXG 1PKQA 4Z7NE 3DPBA 3W9DB 2EE3A 2ZNWA 1WJ3A 4ELMF 3BKCL 4JGJA 4HGWA 3PL6C 1KN4L 4M7KH 1MCQA 1CBVH 1CD8A 4DVRH 1LNUB 5DEFA 3IDJA 4OLVH 4NKIH 4ZUWB 1DEDA 1NMCC 4YFLF 3STZB 4F33B 2NXYB 4Y16C 3KYNA 5D1XB 4FG6C 3C5SA 2EH7L 4X7CC 1MAJA 5DMGD 4N0FA 3A6CH 1QFPA 3UBXA 3ECBB 2VZVA 3SHSA 5D7IF 1T1XB 1NCAH 1MCWM 3QNYB 4JN2B 4YX2L 2NY5C 3WFHB 4PREA 3RX5A 1E4WL 2BNUA 3BDXA 5JPNB 5EO0B 2ATKB 3CFDA 3WUWG 4K23H 3NZHL 2ITDB 1N6VA 2ZUVA 5B38B 4LPCA 3L3DB 3U0WH 3O9WC 3PWUA 3PDGA 4JCLA 4OCWH 5HHXH 1LO4H 5J6GA 1A5FL 2HFEB 1JNJA 4HW6A 1KLGA 2NY6D 1KPVB 4A6YH 4O2FB 4I2XA 4D9RD 5HJ3A 2W0PA 1J0JA 4CW1B 2J6EA 4CBPA 5EOCL 4WO4C 3KPPA 1U0QA 4ODVH 1NAMB 2J5LC 4NUGH 2ICWJ 4OGZA 3VFWB 5FYLH 1MIML 3VH8A 4AMKH 5EZLA 4JFHE 3SKNA 2I9LA 5FA4A 1S5IL 4KJQD 4IS6B 3LN9A 1JPSH 3FRPG 1JHLH 4HWEL 4OLEA 3LD8C 5F1IA 1I7RB 3LZFL 2XKSA 4YIQB 1ADQA 4X8JA 1FL6A 1QA9B 2UWEA 1B88A 4PJXE 1WT5C 2AK4E 2Z35A 5E6ID 3VGAB 3OAZK 3KPMA 4XWOC 3NCMA 1S7QB 4Q0XL 4NYLA 3KXFA 5C0FB 1QR1B 1D5BA 1H8OA 2VZSA 1NFDA 2NY5L 1T2QH 4JANB 3T3ME 3EGSB 4LGSB 3VFSB 3GIZH 1DSFL 1UZ8A 5IT2H 1X6NA 1FQ9C 3MJ7B 3FOLB 5HGHA 4L3EE 1U8PA 2IANB 3TN0D 5I0DA 2YD5A 1KTKE 1YNTA 2FJFA 2WSKA 4UZGA 3BD4A 5EU3A 5FGRA 2BNQE 3IF1A 4EUPA 3FQTA 1CDCA 4FQXC 1IBGH 2NY1B 1FAIH 4RSVA 3P4MA 1EA9C 5GQBA 3EYQD 4QXTA 2FX8L 1RQ5A 5I15H 2A0LC 2V5TA 2RR3A 4WRLA 5E2TL 3SEPA 3VD4A 5KSVB 2CKBB 3WNOA 2V7NB 3NPSB 1NEZB 5FKAB 5E2WH 2AV7A 1XF4A 4HKXA 1BMGA 3ARQA 5DHVA 5KSUB 2FH8A 3UAJD 5KVEL 4DKEL 3CXDH 1FFPB 1BOGB 4PJAA 5JW4R 1KELH 4OFPA 3W9DA 1A7PH 3FQRB 1N5AB 4ZTOH 5IMLA 1JMXA 5IBTH 4Y1AD 3B3IA 5CBAA 5JW4N 3MODH 5D1ZB 4P3DA 3ROLA 4ZUWA 1CE6A 3W2DL 4PJ5B 4F33A 1QNZL 2F5BL 3PV6B 4TVPD 1OAZL 4WFGE 5KSBF 4FS0A 2OM5A 1IC1A 4RFOL 3ECBA 2X10A 4UV7L 3QNYA 1FIGH 1MAML 3HZVB 1ZVHA 3OJVC 2BHYA 5GGTL 5EO0A 1T2JA 2ATKA 3TVMC 5LCVL 3ZKSD 5BOZG 3L3JB 3TN0A 1RSFA 3RRQA 3T0VA 3OBAA 3LAFA 5J06A 2ITDA 1T0NA 5B38A 5DJ8B 1P7QB 2IADB 2VSCA 3ARYA 3L3DA 4LNRB 4OCMC 1SJHB 1A7NH 2HFEA 5AUMB 3SGKA 1G0YR 5INCB 2BERA 4PFEA 4O2FA 5E8NB 3ZE2E 4O02H 3VRJB 4HIXH 1T04B 4PV8B 3DXAB 4O00A 1A8JH 4YHKH 4CW1A 3UZVB 3NIFF 2IPTH 2NXYC 1A4JA 4PB0L 1NAMA 4FQ2L 5D1XC 3VFWA 4J7RA 3SE8H 5I8CB 1TVDA 1F97A 2DQUL 4HXBL 3DWTA 3T65B 3O3UN 2VABA 4DWHA 3T0DA 4IS6A 5INDB 5FM8A 2A6KB 1W72B 4Y1AA 4YHLH 1I7RA 1BGXH 4YPGB 4KK9C 2LV4A 3HMXA 1BJMA 2BSRA 5HY9B 5D1ZD 2ENYA 4U1KB 4MVBD 4NM4H 4K3DL 1S7QA 1UQSA 2OCFD 3HLAB 5GGSY 5J7CC 5C08E 1QR1A 4MZ2A 3SGKC 6FABH 2HLFC 5HPMB 4JANA 3EGSA 3VFSA 3L5IA 4PGBA 4DAGL 4RMVA 5I1JL 3MJ7A 4HFUL 3FOLA 4XNUH 3FB8B 1RZ7L 2Y25A 3FO2B 4HSQA 1RMFH 3PDOB 3ZDYF 2Z31B 2ID5A 1OWWA 4NC2B 1P7QD 4KTEL 2YN5A 4Z7UF 1VACB 3RY6A 4UI2A 1JWUB 1CE1L 2QQQA 1EAPB 1JNLL 5MENE 4YDIH 2CKNA 1QVOB 4KXZH 3RVVC 3TH4T 3MV01 1I9EA 2VWEC 3ULUC 3DXAD 5D1QB 2CKBA 2V7NA 1NEZA 4PJFB 2EC9T 2B7DT 1X9QA 5E5RB 3UBXI 1MCPL 1FNHA 1N0LA 4YDVB 2YRZA 1UEMA 3P4LA 2UY6A 4HQQL 4LCIH 5KSUA 4XB8A 1FFPA 1BOGA 3BRGC 3DVNB 4BQBA 2P24B 4L4VD 3H7BA 5DUPH 3ESVF 3FQRA 1BD2B 3S4SB 2NW2B 5JPMB 4NCDA 1N5AA 4KKNA 1EPFA 2J12B 4LDEB 1I8MB 4NHUB 5D1ZA 1HHIB 3D1MC 1TETH 5IIEA 5T3ZH 1KCKA 1MFBH 2D7TL 2OL3H 3PV6A 3DJ9A 4NNPH 5HHVL 1UM5L 2AABH 3AU1A 2ZSVB 1UC6A 2NY1C 2XWBB 1K85A 4L3CB 3F58L 3UTPD 1PAMA 3RY6C 3QO1B 2P5ED 4OZHE 1GRWA 1HQRB 2VLRB 3QXAB 4L8CB 4KK5D 1ZMYA 1TPXB 4GXVH 4JQXC 1CFNB 5E1HB 4XMLL 3GZKA 3QUMB 3C8HA 2B1HL 3L3JA 1TVHB 4WFHE 4P2OD 4ZO7A 3MCLL 3X13B 2JIXB 5AEAA 3IRZA 3FRPA 5DJ8A 1P7QA 2IADA 3CC5B 2CRMA 1MFDH 4O5LH 3Q1SH 2Z31D 3EKCA 4X7FC 5INCA 1CFSB 1QRNE 3UEZA 1WQVT 1CL7H 3VGGA 5FV1L 4KK8D 3ULUL 3VRJA 1T04A 3DXAA 5K9QG 2OJZL 3UYOD 3X12B 1B0RB 5KZCB 15C8H 5D1QD 4NWTL 3FHAA 3RQ3A 3IJYB 2ZG3A 5KSAC 4WVRA 4EDXB 4HXAH 5I8CA 3MYJB 3L1OL 2ZUQB 3ZDXE 1EH9A 3T65A 2PF6A 1UM4H 5C0IA 4MSWB 4CNIA 1BZ9B 5INDA 2A6KA 4FQIH 4X6DF 3QUZD 1FPTL 1BD2D 4YPGA 1MLCB 3KPRB 4K3HA 5ID1B 2QKIA 1AKJD 1EVUA 5HY9A 3MV7E 4LSTL 4LLUA 4U1KA 1CF8L 2V9RA 1QFWI 4MCYB 4Y4KB 4JJHA 5SWSE 1T7XA 3HLAA 1UG9A 3G6JA 2P5EA 4UTAL 3OXSB 1XIWC 4XPHH 1I4FB 4OAWB 5HPMA 3KS0J 3ZE1E 3FB7B 4PLJC 4N0YL 5FF6B 5TQ0L 1WF5A 3ALXA 2VLRD 1IAOB 5D5ME 3NTCH 4HBCL 1R3KB 2EEDA 4P2OA 5TE6L 3AROA 5EBMB 2FLBT 3FO2A 1BIIA 2D0HA 1GHFL 5D2LE 3PDOA 4P2RE 2Z31A 3LB6C 2IPUK 3ILQC 3LPGA 4IHOB 1VACA 3ZYIA 1KJ2B 3QIWB 5J13B 3ARDB 1RHHB 2ADFH 1EAPA 2Y72A 3CFIC 5I18L 3MNZB 5D1QA 3BKCH 3MFGB 4PJFA 4Z9KB 3UDWC 3ARTA 1RUKH 5HYIA 5KZCD 1KN4H 4YDVA 4MA8L 3ZTNL 4NFBA 3SBWA 1IJ9A 3LPFA 3PXJA 5HVHC 3DVNA 3H9SB 3UO1L 5CLTA 2P24A 4JKLA 3MNWB 1JBJA 2EH7H 1BD2A 1VSCA 2NW2A 2E9WA 2OSLA 3IB4A 5I8KL 1AKJA 4M5ZL 1I8MA 4NHUA 1HHIA 4LKCB 3KPRD 1NGZA 4YX2H 1KLUA 1FL3B 1E4WH 5IHZA 4KRLB 1YYML 4TNWK 3G6DL 4L3CA 4Y4KD 3SO5A 2Q20A 3NZHH 1ES0A 3QO1A 1NDMB 2WBKA 4JKMA 1HQRA 2VLRA 3QXAA 4L8CA 1G7PB 2DLEA 1A5FH 3I3DA 5IW1A 1I8LA 1CFNA 3MZTA 3QUMA 4QRPB 4Z7QF 2HTKC 1MJUL 3GSOB 5EUOA 5I2IB 1CTOA 5DS8B 5EG6C 1O5DT 1OW0A 5EOCH 4JO2L 1KTRL 5KS9F 2AQ3A 3C09B 4QXWA 3BP6A 4Q2ZB 1FC2D 1CFSA 5CZXD 3QXDB 1MIMH 4RISL 3RVUD 3QIWD 2GTZB 3C6SA 1S5IH 4X7DC 3L3IB 3X12A 3BXNB 1B0RA 2DBJA 2GSGB 4PJIB 4HWEH 3QQ4B 5IROC 2BXYA 3QDMD 5BJTB 2Y07L 3LZFH 1QP1A 4KI5D 4N5UA 1CG9B 2NY3B 4EDXA 5KANI 3MYJA 4PGEB 5A3ID 2J8OA 3B2VL 5CZKA 5EC2B 2YZ8A 4F57H 4MSWA 1RJYB 2DYPB 1C08B 1P2CB 3GSNL 3H9SD 4LPVA 4G80A 1LE5B 2F8XC 2DB8A 4Q0XH 1HKLL 5D2NA 1BWMA 1DANU 1MLCA 2NY5H 3KPRA 4MNGB 1DE4B 3OX8B 1JI2A 4R0LB 4WW2C 5ID1A 4WFED 5I1CL 3RUGF 4GW1A 1JNHB 2JJSA 3QIBC 5IG7B 4JR9L 1JGLL 3K8MA 5EZOH 5A2LH 2X89A 4OF8A 4Y4KA 3UTTB 1U42A 3EJJX 3T0AA 3I3BA 3MRIA 3OXSA 3MBEB 1RI8A 4C55A 4NUJB 5FIEA 1OAYL 3NCEB 4OAWA 1QQDA 1AE6H 1KJ3L 3FB7A 4OF5A 5FF6A 1J0HA 3OB0H 1ETZB 3GKWL 4AK1A 4X7TB 1W8NA 1IAOA 3GM8A 3VWJC 1MWAL 3OQ3B 1R3KA 1CXFA 1ORQB 2FX8H 2X1XR 4QRPD 5E2TH 1FGNH 2FYYB 3O3BA 5DQ9B 3X14B 4JCMA 2Y23A 4ETYA 3RZCD 4IHOA 4C83B 3ZYZA 1KJ2A 3QIWA 5D96B 1E27A 2K7PA 5KVEH 1KTLB 3BO8B 4DKEH 2DL9A 1LWRA 4ACPA 4PV9B 3QWRD 5DVNA 4YR6B 5AG8A 3T3PE 4RQQA 3CGTA 3QEQE 3O8XB 2I07B 5ACZA 2VRAA 5B22A 2I9TB 3W2DH 3EFDL 2NY3D 3T0EE 3JV4B 4K8RD 4RA3A 3H9SA 4X9GA 5I1HL 1QNZH 2F5BH 4HD9A 4W4NA 1OAZH 1WBZB 3ZKMD 1VERA 5E5UB 4KY1L 4HPYL 1VFUA 5FM5O 2DYPD 5D7KE 4RFOH 4L8SB 5D7JB 4U1NB 1IZJA 1JJUA 3MLWL 5ENWA 5F7LB 5JW4Q 4UV7H 1OGAE 1MAMH 4LKCA 5EU7C 5F7EL 1VHPA 1QPXA 3U9UA 5GGTH 2Y5TB 4PJDF 1HKFA 5LCVH 3DVIA 3U4AA 1T66C 4S0TD 1LILA 3UTTD 4Y5VB 5J13C 4NBXB 3LN5A 4AIXA 3V9FA 1FL5B 1NDMA 2B0SL 3ARDC 1OQXA 2QQKL 3MBED 1G7PA 1EGJL 5DXWA 1I7TB 3QB7C 4QRPA 3WUZA 5GRUL 3BKJH 2V7HA 2WQ8A 3GSOA 1ZT1B 3X17A 5ELIA 4F7CB 5IWLA 4M1CD 4WHTA 5DS8A 1PBYA 1NKRA 2W59A 4NZJA 1KYOJ 3OTTA 1XGTA 3QG6B 5C0JB 3K3QA 2LQRA 4PB0H 5IBLD 5HYJB 4UQ2B 4FQ2H 3GMNA 2DD8L 4CL7A 1B90A 2DQUH 4Q6YA 4N1EA 3QWRA 2GTZA 4HXBH 4XPBL 5HI4D 1MJ8L 1SYSB 1JK8A 3L3IA 1LO2H 3BXNA 1M1SA 4PJIA 1DQDL 3QQ4A 5HDBF 5BJTA 5J56B 1Q0YH 3O8XD 1NGPL 3T0WA 2YC1B 5TE4L 4PGEA 5DK2B 5F7MC 3VD5A 5EC2A 5HBBA 1N4XL 2B1AL 1RJYA 2DYPA 1C08A 1P2CA 1DJSA 4K3DH 5I1AA 1LE5A 3QXVA 3IXAB 1T5WB 2XTJE 2WWKT 1IT9L 4MNGA 1DE4A 3OX8A 4R0LA 4KKBD 4M1DL 1JNHA 3MRMB 5IG7A 1U9KA 3CVHL 4DAGH 5I1JH 3QEHB 1QSFE 3UTTA 3VFVB 4HFUH 5C8JB 1RZ7H 2G2RB 3RVWC 3MBEA 4NUJA 3IDIB 4AYFA 4ZD3L 4KTEH 1ETZA 3TBSB 1B0WA 1T0MB 2HH0L 1YPZE 4OLZL 4QHLB 1CE1H 2W0FB 5ID0B 1NAKL 4JZJB 1ORQA 3QDGB 1JNLH 3KPQB 4PJBF 3IDMB 1L0QA 3VI3F 3GNML 2FYYA 3E3QE 2DLHA 5DQ9A 3W9EB 2V6HA 2A77L 2DF3A 3FFCB 4N8CL 3WFBL 1MCPH 5GJTL 3MLXH 4C83A 4HQQH 5HYJD 2F54B 1KTLA 3BO8A 3HI1B 4K3EL 2CRIA 4I4WB 1P84K 3IFOB 4PV9A 3UC0L 2VQ1B 5J9PB 1QLEL 2YD3A 4X5WB 5IUSA 3ULVE 4YR6A 2OR9H 4JDTL 3O8XA 4N0UA 3OMZA 3A6OA 1ED3A 1ODAA 1YMMB 3RPKA 2ERJB 1FO0B 1QFOA 4ZOEA 4F80A 2YPLB 4QHUB 4WUUB 3CLEL 3JV4A 3OPZH 3ALWA 2D7TH 1T0PB 2FR4A 1WBZA 3CLFL 3HPJB 1K8DA 3HS0B 5HHVH 1UM5H 5IF0B 3VXRB 1NCUA 3HC4L 4B0MM 1JI1A 3F58H 4L8SA 5D7JA 5IHUL 3Q0HA 5HVGB 3FT4B 3RWEB 1WFUA 2BVTA 4TQEL 4LCYB 5GGUB 1MI5E 4N90D 4XMLH 4JFHD 2Y5TA 1G0XA 1HH6A 3HAEH 1DVFB 2B1HH 1U92B 3V52L 3REWB 3MCLH 2E8ZA 4Y5VA 5D96C 4WHYG 1FL5A 3L7EA 4HWBA 2ORBL 2VISB 5C0RL 1I7TA 1JTTA 4IJ3B 3L9RB 4DEPB 1A21A 3CZFB 1R5IB 2AK4D 3ULUH 5IB3B 2AJZB 1FH5L 3QDGD 3LKPB 2OJZH 2YPKB 3U7WL 4APQB 5C0JA 3QG6A 2FECI 4NWTH 5HYJA 1D5MB 3RWHB 4AH2A 3TV3L 1OQOA 2YD9A 1BOYA 3KYKL 1T22A 5DEZA 3L1OH 5D7JC 2CPCA 2DLIA 1SYSA 4KKBC 1A6TB 2DKUA 4KRMB 4L3ED 5FYKE 4NOBA 1AGEB 5I1EL 1FPTH 5DF0A 4RMTA 4RRPG 2YC1A 3DX9B 4FNLL 5DK2A 3TFKC 4LSTH 4U0RB 5EH1A 1CF8H 4WUUD 2EEBA 4RMRA 5F96L 1J9CT 3IXAA 1T5WA 1VA9A 4NRXA 5EUKB 2FRGP 3D39E 4X9HA 4N0YH 4YGAB 2DBLH 5TQ0H 5B8CB 3B43A 2XXCB 1MCIA 4HUVA 3QEHA 4MAYB 3VFVA 3IAPA 3MUZ1 5C8JA 5IMKB 5TE6H 4X4ME 2G2RA 2ZP0T 2XWJB 2NX5B 1BVLB 1DVFD 4D3CL 2K7QA 1GHFH 4ZS6D 1UB6B 4GFTB 1T0MA 2A83A 3BDYL 1IGCL 4QHLA 5D5MF 5ID0A 4EXPX 4WWKC 4JZJA 3QDGA 4Y8DC 1IFHL 3KPQA 4GRWB 3IDMA 3MA9L 5ECJE 5IMMB 5I18H 3GSQA 1MFEL 1NLDL 2XOTA 3V0AC 3W9EA 4QHKI 5HXMA 3GUTB 4APQD 5C0GA 4MA8H 3ZTNH 5EU5B 5GPRA 2F54A 5MEOB 2J3SA 4I4WA 3GDBA 3IFOA 5J9PA 1F3JA 2VQ1A 4AT6A 2NLJB 3P9LB 3GMRA 4X5WA 5BRZE 4TRPL 2F58L 4JKWA 4EI5C 3P4OB 4MD0B 3BMWA 1I1FB 5HHOB 3PWVB 4HCRL 5K9QI 1YMMA 4LAQL 5I8KH 4M5ZH 1JGVL 1FO0A 3VA6A 5CD5C 3I85A 3DYMA 4QHUA 4WUUA 2X4NB 1Z6JT 2X4UB 3HPJA 2XTLA 4QCIB 1LP9B 1CK0L 1YYMH 5HPOA 3G6DH 5EBLB 1IRAY 3VXRA 2GJJA 3FT4A 3RWEA 1NGYB 4XT1C 3BP4B 4JZJC 5I1LA 1WFTA 3V4VL 3V8OA 2YMXL 4PJCB 2IQAB 1MJUH 1DVFA 4PRPE 5T5NF 5AZEL 5JUEL 1U92A 3KYOB 4OKVB 3SDAB 4JO2H 2B4CC 2VISA 5EBGA 2VDKL 2P5WE 4I18B 4KVCL 1KEML 3L9RA 3QIUB 4RISH 3CZFA 4M7ZB 4PJ7E 1R5IA 2EE9A 1JTOA 5ILTL 5IB3A 1NBYB 3LKPA 4LSPL 5JMRA 5C08D 2YPKA 2NY4D 4APQA 4JM2B 2Y07H 1D5MA 1MAKA 3RWHA 4G7YL 1EHAA 4MCZB 3GMLB 3BKMH 2H2SC 3B2VH 3PGDB 3KPNB 2BVQB 1EEYA 1CXIA 2EDKA 2DOCA 4ODXB 1RURL 3GSNH 5IESL 1DLFL 4S1RL 1NGQL 1HKLH 1AGEA 1C1EL 4PRHE 1C5CL 5HHOD 2NZ9D 5I1CH 3BPLB 5F97E 2FO1A 3WLBB 1KTDB 4G9FB 1JGLH 2FSEB 3I9GL 5MEND 3PHQA 3IAQA 5SX4I 4XBEL 3TZVB 1XH3A 5EUKA 1I1RA 4DEPC 1OAYH 1Q9OB 3HG1E 4CKVX 4E41B 4ZFZB 1KJ3H 3QPQC 4NQUA 3GKWH 1FBIL 3K8KA 1MWAH 2HT4D 5CJQL 5DJ0B 2WUCL 2X4TB 3TLRA 4CMMB 1IC4L 5IMKA 1CLYL 5BZDB 1FAKT 3SY0B 5JXAL 1BVLA 1RK1B 1UB6A 5ICZB 3FN3A 4RMQA 3F7YA 4QTIL 4M7LL 5IHBA 2UUDH 4NC0B 4NKMB 2W9EL 4OIAA 1JN6B 4V1DB 5JTWA 2ZNXA 5C08A 2UVFA 5IMMA 4FFZL 4XRCB 3VRLE 5L8KB 2RHEA 5BVJB 2E7CA 1JF5A 3GUTA 4IIQA 5IP4A 2VXTH 4JM2D 5EU5A 5MEOA 1ZGLB 3EFDH 4K7PL 5F6IB 5I1HH 4HZLB 2FEEI 3P9LA 4KY1H 4FQPA 4MQTB 4HPYH 12E8L 5B8CC 3P4OA 4MD0A 1I1FA 1N59A 1YA5A 3PWVA 5HHOA 2C3XA 4EQ2A 3CVIL 4MAYC 4OBRA 3V5KB 4GBXB 3G5VA 5FUCC 4B53A 4PG9B 3SQOL 2IPUG 4GG6E 2BY1A 2X4NA 3IDNB 2X4UA 4PYHA 1Z0NA 5GGVL 3EDEA 4G9FD 4Y19E 5LBSL 1PQZB 4QRQB 2DN7A 2H26B 4M8QB 2X44D 2QSTA 3TZVD 1NGYA 2B0SH 3DX8A 2QQKH 3BP4A 3CFJB 4KKLD 1Z9MA 1TVBB 1EGJH 5DJDB 3WO4B 1HNGA 4E41D 4LF3A 4PJCA 1HWGB 2IQAA 5GRUH 4DVBB 4KJPC 2ZKHL 3ZTJG 4K7PX 2NZIA 3KYOA 4YGVB 4OKVA 3SDAA 4TTDD 4KPHL 2Z4QB 4I18A 3AS2A 4HLZH 2C3WA 4YDKL 2DD8H 3IXTA 4RRPA 1LEGB 4GT7A 1F4WL 1O0VA 1QFHA 1UACL 4V1DD 3PGCA 4XPBH 1TQBB 3B9KD 1MJ8H 1NBYA 2QSVA 4NQCB 4K07A 3RIFK 1DQDH 4RCAA 4JM2A 4J8RB 1P69B 3K74B 1WK0A 4OT1L 1GL4B 5JR1L 4DOHE 3EUUA 3RTQD 5IR1B 1JPST 2FCBA 3B83A 3ES6B 3GMLA 4JE4B 4MCZA 5TE4H 3PGDA 3KPNA 2BVQA 1N4XH 2B1AH 4ODXA 3TBWB 2CLVB 4AG4L 2BNRE 4DCQA 4P2RD 5DDHA 4POUB 4NO2B 4YHZL 1IT9H 5FO9B 4RNRB 2EDTA 3N0PB 4DW2L 4GBXD 4NT6A 5ACLA 3WLBA 1KTDA 4P46D 3CVHH 2UYLB 1H3XA 5E2UL 4G9FA 2FSEA 4EIGB 3SDAC 4TUJB 2C1PA 4WTXA 4OGAD 3OKMB 1ZK9A 3TZVA 4CAGA 4WEBL 3QIUC 1DBML 5C09B 1Q9OA 4E41A 4ZFZA 2Q7YB 4ZD3H 3WMSA 1EUUA 5FYJE 4MDJB 2YKLL 3ELAT 5IB1B 2HH0H 4OLZH 5SV4A 4Y4FC 5DJ0A 4KJWC 3FCTB 4CMMA 4ZUTB 4LLMB 4H26B 1DQJB 3GNMH 2F19L 1RK1A 1KGCE 5ICZA 1QSVA 4MNHB 3HCVA 2A77H 4N8CH 3WFBH 5GJTH 4NKMA 2IC2A 4JB9L 1JN6A 1U36A 4DK6A 4V1DA 1YQ2A 4K3EH 2X5PA 4PJGB 1WWWX 4X6EB 1DTUA 3UC0H 2IJ0C 4XRCA 1U3HC 1QLEH 2CR3A 4LIQL 4YFDB 4BZ2L 3BPLC 4JDTH 4NQCD 5BVJA 1NBVL 3ARUA 2X4QA 1YC8A 3RWDB 3MACL 1NBQA 2H8PB 1ZGLA 4I0CC 3CLEH 1XF2B 5DD5L 4HZLA 4EXKA 3CLFH 3MRCB 4F3FB 4P2RA 4D9QE 3HC4H 3X3FL 4AEFA 3T77B 1I3GL 2ZJSL 4X99B 5IHUH 3JWNC 4WU5B 5F7YC 5CGMA 3V5KA 4GBXA 4QT5B 4QO1A 4PG9A 4P46A 1V3JA 4TQEH 5B39B 4UBDC 3IDNA 2NR6D 1OTSD 4JG1L 4JPWL 2B5IB 5CP3H 5E6ZA 3V95A 4QRQA 2VXVL 3ROOB 1BLNA 4M8QA 1Z9LA 1QACA 2ORBH 1EFQA 1TVBA 5C0RH 3G9VA 2MKWA 4OZIE 3IS1X 5GRWA 3SGEI 5E2JA 5D72L 3MC0A 4DVBA 2VKWA 1SY6L 4LOUD 1FH5H 1ZVYA 4MS8D 1V7NH 4BUGA 4YHML 4QTHB 4MGXA 4YGVA 3U7WH 3K4AA 5L2JB 3TV3H 2CDGB 5BVPL 2HYMA 3KYKH 1CR9L 1LEGA 4JZOB 2KZ1B 4X8XA 1OP9A 1WEJL 5ISZB 3ARGB 3LY6A 4NQCA 3PWPE 4FOMA 3LKNA 1C8PA 3QYCA 5D93C 5GSRB 3EO0B 1G1CA 4MQ7B 5C70A 1KEGL 3NVQA 1S7SB 4PGZA 5IR1A 3ES6A 4FNLH 4R7DA 4JVWA 4QHNB 3UCRA 2AV1B 2FEDD 5F96H 2CLVA 5DO2D 4LBEA 1DQML 2BSTB 3BEWB 2D2OA 2HJLA 2N56A 5FO9A 4RNRA 4UDUB 3FO1B 5IQ7L 5C0AB 1RIVL 4GO6B 1WTLA 4PIRF 3RKDC 5DVOA 2CO7B 2AJ3B 4BSVB 4TUJA 3ZHLA 5JZ7C 4PJHE 1I3UA 1H5BB 1NUGA 3GI8L 4LCCB 5HI5D 2DIAA 3VXNB 4D3CH 3ARXA 1Q8MA 5FO7B 3QRFM 2A74A 4G43A 2Q7YA 4I5BA 3W0WB 3MTRA 1OSZA 5IB1A 3BDYH 1QSEE 1IGCH 4XMKH 4MJIE 2I26N 5HGBB 4DK3A 3FCTA 1IFHH 4QGYA 3BQUB 4GKNB 5F7KC 4H26A 3MRDB 1DQJA 5SX5K 1MFEH 1NLDH 4UNUA 4MNHA 3QQ9D 1U2CA 4I0PB 5FV2A 4FRWA 4PJGA 4X6EA 4Y4HB 1U41A 5BW7A 4TRPH 2F58H 2ZG1A 4HGKC 5CWSB 3ARGD 2YXMA 3D25B 4HCRH 2X4SB 1BP3B 4LAQH 2RJMA 1JGUL 1JGVH 4OD1L 3RWDA 3UROR 3ZDZE 2H8PA 5A43C 1XF2A 1R24B 3H9YA 1AR1C 3MRCA 4NQEE 4IOIB 1QLFB 5KSBB 1CK0H 4JFFB 1QHOA 3RVTD 1JYVA 2EE2A 4X99A 2CGRH 4PJ9C 4WU5A 5IVXF 1EHLL 3RI5K 1D5ZB 4Q9QL 4MS8C 5IV2A 3V4VH 5B39A 3MV9E 1WWAX 2YMXH 3SKJL 4UMGA 5C0AD 1OTTD 2EIZB 1HHJB 3U4BH 5DRZB 4JRYB 2ZSWB 2OP4L 3EOAB 5AZEH 5JUEH 3DBXA 3MRGB 4XX1E 4MA3B 3ROOA 1XAUA 4B41A 5JIKA 4E5XB 2AJYL 2ITCB 1X7QB 1QR4A 2Z91B 2VDKH 3VWKC 4KVCH 3JSSA 1JZ3A 1A7RL 1MY5A 3LHPL 5SWQB 3LEYL 1WFOA 1GGTA 3CX5J 5HI3D 1A7OL 5ILTH 4P23D 4DFIA 4LSPH 1AGCA