4QGYA

Camelid (llama) nanobody n25 (vhh) against type 6 secretion system tssm protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGFTFEDYAIGWFRQAPGKEREGVSCISNLDGSTYYPDSVKGRFTASSDKAKNMVYLQMNSLKPEDTAVYYCAAVNAQGIYCTDYIIGPYGMDYWGKGTQVTVSSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Type VI Secretion by an Anti-TssM Llama Nanobody.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords nanobody n25, VH domain
total genus 32
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qgyA00
4M6ML 1RZKH 3VRLE 3MA7B 4K3EL 4PTTB 2P48B 2Z8SA 3ULUC 1FO0L 3VXNB 3HI6L 4K3GA 5BRZD 2GCYA 5FIEA 5GIRB 5IB5B 3X3FH 1EV2E 1G7MB 3CD4A 4NQCE 1KOAA 1SQ2N 1K85A 2F5AH 5BRZE 5DR5L 1KN2L 4JY5L 5K9JH 5LJYH 3UTTE 3SQOL 3IS1X 5L88L 3IVKB 5E8EB 1AO7E 2GJZB 3F6LA 3MRLA 5AAWA 2J8UE 3TIDA 4PJ5D 1KB5L 5KSUA 3JBG7 4ZUVA 4WO4C 3IDIB 5D7KD 4ZXBA 1YMMB 1G9MH 3TESA 4HS3B 4LARH 1UB5A 3HG1E 4WHTB 2O61A 3G6AA 1HWGB 1FLRH 1DANU 1HI6B 3QBTB 4JKKA 5D7LE 2DMBA 3EOTH 1A6VL 1RUKH 4AMKH 1A4JA 3TYFA 2Z8VC 1ZLVK 4S1SH 3VI3E 3Q1SL 3CK0L 4MWFB 1U6AL 1SEQL 2C1OB 2YBRA 1M7DA 3RVVD 2FSEB 3RY6C 4NYLB 3MLRL 1HKLL 3QXTA 1QLRB 3Q5YA 1NBYB 3D25B 1HIML 3S4SA 4LLWA 2DMKA 2Q8AH 2WWKO 1IKNA 1ZEAL 1Z0NA 5E8EA 4HC1L 3OKEB 4HH9A 3EDJA 2OL3H 1G7IB 1T21B 3PHQB 4XMPH 1CZ8L 2FWOA 3T2OA 1J7VR 1HEZA 2VDKL 4OT1H 3VXTB 2DQGL 5E2JA 5C6WH 3F12A 4KK9D 3T2QA 4UNUA 5ETUA 1UCTA 5KS9B 4FFZL 4TSBH 3DYOA 4K8RC 1MJJB 2F5BL 5DYOB 5HDQH 4P99A 4MS8D 5EU6A 3CU7A 4JHWL 5EG6C 2I9LA 1SJEA 5J1SC 3MUHL 1CD1A 2MPAL 2X6MA 5EORL 4HG4J 1B4RA 3UROR 1D6VH 4TVPE 3EYOB 5F7DB 1HHHB 1DBAL 1I8IB 3DVNB 3QI9A 3ZO0A 5KSUB 4TVPH 3UYOD 4Z7UB 4M03A 5L2JB 4ALAH 4U1HA 4U6VH 4NQSB 3O3AB 5TE6H 1IEAA 1FVCA 3O8XC 3HG1B 1UM4H 2QBWA 3P4NB 4AENB 3LV3B 4LCIL 3E3QE 4LGSB 1T22A 2NY6C 2R56H 3SKOA 1CWVA 2VLLA 1Q9LA 4TULH 1J10A 3HFMH 1EXUA 3NZ8A 4M8QB 1JYXA 2CO6B 1NAML 4JY4A 2E7MA 4UB0H 2R0LH 3UCRA 4TUOB 2R23B 3NFNA 4QYOA 4G8GB 4ORGB 4DEPB 5EOQH 4ONHB 1L7IH 4I18A 4JY5H 5HY9A 4KTDL 2D7QA 5DJ6B 2M2DA 3QEUA 3BKML 1INQB 4I2XB 3VXPB 4UT7H 4MQSB 3ARBA 3PGCB 1DE4B 1EUUA 4XCEA 4OZGA 3OKEA 4WO4D 1DBMH 3IXAB 4U1JB 3IDYB 1YN6A 4ZUUB 5KJRH 1P6FA 1JWSA 1HHGB 2VXQL 4WU5A 5E8PB 1D6EA 2CJUL 2ZOKA 1G7HB 2YA0A 2QL1A 4L3EA 2YS4A 3RWFB 1A6WL 1MPAL 5I74B 4U1KB 3VXUA 3WXWL 2HRPL 3GMNB 3IFNH 1LEKA 3KLDA 1BFVL 2P24A 2ICWJ 2JB6A 4I3GA 1F13A 4GKZB 5A2IH 3ZDYE 4Z7VF 4QHKI 5K9OA 1PKOA 3LS5L 2IH3B 3Q6GH 4JFZH 3O4LD 5HDOA 2HT2C 3QCVH 1QP1A 3PV6B 5FUOL 5I8EA 4WTWA 2X4RA 4WFED 5KN5B 5JOPD 5J6HB 1LO2H 3D3VD 4EDXA 2YWYA 4YHML 3K2UL 1RK0B 3DLQR 1MCBA 4Z76B 1DEDA 4WDIB 4K55A 2ZSWB 2F19L 4JN1H 5E94B 4R4BA 4GXVL 5H2BA 2HWZH 2AXFB 2P8MA 2Y06L 3PWLB 2PXYD 5BOZG 2R9HD 3FB8B 3OKMA 5ICXB 1XF2A 2MQ0A 4KVCL 3OB0H 2UZXB 1ZGLA 3QCUL 3O4LB 3QUZD 4UINH 5MI0B 3D1MC 2DQJH 1KGCE 3FQNB 4ZTOH 5LGKA 3MJ7A 1F4XL 1SBSL 2AJ3A 3IYLW 1NAKH 3PP4H 4I18B 2PUQT 2GUOB 2V7HB 1RUQH 1TETH 2AJVH 3SOBH 2F74A 2HFFA 2HFTA 4P2CG 1MH5A 4U3XA 3PWUB 5GZNC 5JHDB 2NY5H 4PS4H 3MV8E 1QA9A 1XAUA 3RGVB 2AS5M 1BIIA 1QFWH 1A9EA 1JRHI 3MGOB 4N0CD 5F3BA 5MP6L 1Y6KR 3L5HA 1MFCH 3OL2A 5GGTL 4XNZB 4MDIA 4TNVF 1AXTH 5EZJA 5LAXB 4OD3L 4ZTPL 2BDNH 3V0WH 2F9BT 4P57B 2BVOB 4OM0H 3DRTB 4NZTH 1IFHH 4RAVB 4G9DB 4OLEA 2YUXA 3RWCA 2ZG1A 1K4CA 2XACC 3O9WA 4NYLA 5D1XB 5DJXA 4YC2C 1EEQA 4RA3A 4KY1L 4ORZC 2LVCA 5LAXA 3KG5A 3I6LD 3GJEA 1TZHB 3T0EC 3ME0A 3OGOE 4QRPE 3WSQL 2AXHA 4GAFB 5CJXA 5FYLD 4Z0XB 2CRZA 1T5XB 3STBA 2N4IA 3HI6H 5A2LH 3X13B 1J0YA 5DJZA 1QFWM 3SE3C 4Q6YA 4Z95L 4ZAKC 3TPUA 6CGTA 3TVMD 2BFVL 2AVGA 4HUMB 4PJ9D 2DTSA 2V5RA 3MRGA 4P2QD 2R29L 3VG9C 1R6VA 3FB8A 3LEVH 4DKFH 5AD0A 1MCHA 5I1KH 3ES6B 3FRUA 2XV6B 3O6MH 1TVHB 4L1DA 4JY6B 5D1QD 1MCPL 2AJZB 3HZYB 3FN0H 3HHRB 4R7NB 1A7PL 3CU1A 1CG9A 3O81A 3RKDC 2W92A 3D85B 3KYKH 5I1AA 2XY2A 4WEBL 1NANH 4TYUA 3EZ8A 3A67L 15C8L 2WBWB 4JFFA 3VI3F 3CK0H 4R26L 4GXUN 1KB5H 4BZ1L 1P7HL 1LO2L 2VAJA 3FB7B 4NO0D 3GBML 4KMTH 4OKVB 5EIIB 1NCCL 4GG6F 2BNQE 3VJ6A 1ZMYA 3QIWD 5C07B 2WUCH 5CHNB 1A6UL 5FM5M 1MQ8A 2BVQA 1E4WL 4MD5B 1V7ML 3L3DB 4NN6B 1JPFA 4X6DF 3HI5L 1V7NL 4IOSD 4QWWD 3BQUC 4YHZH 2UV3A 2UZIL 3I6GA 1N6UA 4OCRH 4ZS7H 1KJ2L 2MTPA 1UXSB 5DZNA 1ZGLM 2LAGB 3RUGA 4YZFE 3NGBC 4LU5L 1DBBL 5L2KA 4P23B 1XR8B 5GGUA 1FVEA 5E9DA 3WKML 2QHLA 3UO1L 2IALA 3BPCB 3QIUC 3X12B 1H0DB 2EXYD 1NGZB 5MEOB 2F5BH 2W9DH 1TJGH 4G9FB 5IK3B 1BGXH 3FONB 3QWOA 4PTTA 5AYUL 1P53A 4IOFD 2EDKA 2FJHA 4PJBF 2FD6H 3QFJE 3FQRA 2VMFA 3WL9A 3U7YL 3IKKA 3VXOA 4D0BA 5K9QI 5HJ3B 1YY9C 4LKCA 3MRQB 1QACA 4NJAL 2OTWB 3FFDB 1YPZE 1MQKL 4F8TA 2CUMA 5IFAH 1D5BB 1F3DH 3U0TB 1JZ6A 3QQ9D 5F7YC 4R7DB 1OSPH 3EJYC 2QQLL 3FO1A 3GJFK 2X7LB 2ZUTA 4E0RA 2PKDA 4EN3C 3SDYL 5LWYL 4RWHA 5CD3B 4MXQC 2SEBA 5ISZD 1FNSH 4UV7L 5C0AE 1CICC 5E4EB 4Z9KB 4U6XA 4R7DA 2NXZB 3B5HA 2D31B 3U2SA 3DRQA 2EC9U 2J8UB 4HBQA 3F7RA 3PQYA 2AV7B 2B0SL 4G6ML 4PRNB 2CIIB 1JN6B 5IBTH 2VITB 4YK4C 3B2UD 4W68A 4FXKA 4LCIH 5HYEA 1MJUL 1II4E 2EDHA 2AXGA 3E8UL 1KEGL 1ZHBB 4UT7L 1JF5A 4MD5A 5F1NA 1F3RB 3BN3B 4NO2B 4JRXD 5T1MA 1OTUC 3BISA 2FWOB 4K7PH 1QSED 4WW2A 3GEWB 1CICA 3MUJA 3QUKA 5EOQL 1JRHH 3FN9A 4UIMB 2AEPH 1H3UA 1NQBA 4ZUWA 4DVRL 3FFCB 5L2KB 3SCMC 2AK4A 5E9DD 3BFOA 1U8IB 3OR6A 5D6CB 2ZOLA 1YUHA 5DEFA 5DFVD 3THML 2ZCKH 4KRNA 1PW3A 5GS0D 4JQXA 3SDCD 4A6YH 4BZ1H 5FEBA 1QPXA 4DTGL 3HE6A 5A2KH 3WN5B 2VXQH 4XRCA 5DQ9A 1SMAA 5DHXB 3VGGA 5DK0B 2R4RL 1LE9B 1MCEA 1CXFA 1MPAH 3CGTA 1BFVH 4I8DA 4PJDF 4HPYH 2OTPA 3BUYB 4WFHD 1T4KA 4LLUA 4RGNE 4G9DA 4HFWA 5E8NA 3ZT5A 2X4TA 4FZ8H 3ZTNH 3KPPA 4LCWE 1QR4A 4QRSA 1FZOB 4OZFB 1HHHA 5DURB 1ETZB 4G8GA 2E9BA 3L5WB 4GRMA 1WVZA 1U2HA 5BW7A 4HK0A 5JZ7D 2PYEE 3QH3A 5K9QG 1U8JB 4JB9H 5CBAA 3B9KD 4GG8B 3GIZH 5ISZE 4X7TB 1DQJA 1ETZA 2NW3A 1WFTA 4LSTL 4NPYB 3B9KC 1I8MA 1JHLL 3WDHA 3WV0A 4KFZC 2VTFA 3GB7A 3NVQA 3BZ4A 5I1JL 1IL1A 1MF2L 3P4MA 1MFCL 1U3HD 4UDUB 5T3ZD 2C3VB 2XNAB 2R15A 1OSPL 4QRRE 1GL4B 2IG2L 3MRNB 2CMRH 4S0TD 4QHNB 3BN9D 1CIUA 5LWYH 1INEL 5KSAC 4KUCF 3MROB 4QRRD 4PBWD 3BH8A 4DN4H 4Z7NE 2JJTA 3PGFL 4PGJA 3FTGA 3FOLA 3LMJL 1DCLA 2R2CA 3NCEB 1YMMA 3MCG1 2RIKA 5D8JL 3ZL4H 4NZUH 2OM5A 2DM4A 5AUMB 4DK6A 5B3JE 1XF3B 3AS2A 1QLEH 1CE6A 2GI7A 1XIWD 1TITA 5F9WB 5KSBA 1MRDL 5I19H 1WC7B 1Z5LB 4PJ8C 2Q3ZA 4FG6C 3H42L 1I1YB 1IGCH 1SM3L 4PG2C 4K7FA 3BIBX 4CNIA 2Y23A 3LEYH 4R4BB 1KN4H 3MBEC 4XNUH 3ARDA 1P7QA 5F7FA 4NCC1 1FGNL 2VE6B 5LGJB 1KCRH 4LP4A 3GMRA 4DVRH 3F58H 1WCQA 5GGSY 1KIRB 1OB1B 2CKBB 2PW2B 5C0JB 3GJFH 3B9VA 4UT6H 5JORA 2UWEB 4X7FC 5DRNB 4P4KA 1I1AA 5JTWA 4TUOA 4NKOB 5IESL 3M1BB 3F65A 5FYKL 1U8NB 4HIIB 2HYMA 4R97B 4XP4H 4EN3A 4KKAC 2KQMA 3U7WH 5DGQA 3TGXA 5E2TH 5BS0D 1WAAF 2ICWI 2ERJB 2VKXA 2P42B 1IEBB 2BNRD 2X4SA 5F7NC 1I1AB 1CFSA 1LDSA 3MLZH 1EEUA 4X4ME 4U1IB 1RIHH 5F9AC 2DQEL 1P4BH 5CLWA 5FGCE 4BSWA 4J3WA 3ULVL 4AK1A 3DXAB 3DX9B 4ZFZB 4ZFOA 4IS6B 4I3RH 1EX0A 4MQXC 3TZVA 3AREA 2ADGA 2VLRA 5CUSL 4P2RE 5J8OA 4ZUSA 1GGBL 4Y5VC 3P4NA 1UACH 1FFQA 4JQIH 4M1CC 5EZIL 4EI5C 4ZFOB 1HH6B 3CFEA 4AM0B 1G6RH 4PLJC 5EU7E 2VIRB 4F57H 3TT3H 3UX9B 5D7LA 1G7LB 4ORGA 2D7MA 4NKIL 4MAUH 4X7CC 4QXUH 1XEDA 1F11B 3JWOH 3M8OL 3WIIH 2Q20A 5JA8B 1JF1A 2EC9T 1AY1H 4YHZL 4K7FB 2A1WL 1CTOA 4ZNEA 3QPQC 2DL9A 1FNAA 5EU3B 4C55A 1A21A 1N7MH 4JZNB 4WJ5B 5IEHA 2ZJSL 4XNYL 1GC1C 1OQXA 4KUZL 4YHIB 3VD4A 1JIBA 1NMCC 2P5EE 3STLB 5ICZA 3GMRB 5DUBB 5DUML 4PTUB 4I77L 2X4UA 2XA3A 4HUXB 4QXGL 2A6DA 2XTLA 4B7IA 4F7TA 4F8QA 2DLGA 1KENL 4PJDB 2AABH 5EBLB 5CD5D 1SVZA 3L1OL 2FL5A 3KPMB 4TVPD 3F7YA 2IH3A 2NX5D 2NXZD 4HK0B 4U6HA 4GUPA 2Y7QB 3CSBA 2NY2B 5CS7A 4F9PC 4WHCA 5HHME 4NRYB 3C87A 1NLBL 3JV5A 5DJAA 1I8KB 2GSGA 3MRPA 3V4UL 2VLJA 1IGIL 4HWBA 1MEXL 3CVHB 1WWWX 1N3NA 3MLVL 1Z9OA 2YSSB 3KPSD 1J0KA 2GJJA 3O2VH 2VDQH 5IW1A 4MXWL 4AEIL 1Q0XL 4U6YA 1GGIL 2W9EL 4KAQL 5E6ZA 4GLRI 5JMOC 5HDQL 4D0CA 3DXAD 3WD5H 5IESH 4TTDC 5EN2A 4LSSH 1G6VK 4XBPB 2DQIL 3NA9H 4ERSL 4ONHA 4OZFA 3SDXF 3U7WL 1CLOL 3DXAE 4PPTA 3VXRD 4UDTA 4WFFE 3VWKA 5EU4A 4LCWD 2GFBB 5DMJB 1IRAY 2H32A 2AEQH 4RNRA 2A6KA 4ZAKD 3V7MA 1EEYB 1TTFA 1ZA3B 5DUPH 3BRGC 3LV3A 5CZXC 4O51B 2QADB 2IFFH 3FAWA 4JFHE 2EH8H 4X9FA 1L0XA 4LFHG 4LP5A 4Z7WF 5EUKB 3IAGC 4JPKH 2YSSA 1DQML 2N1KA 4QTIL 5AEAA 1MIMH 3WFCL 1QO3B 1FPTH 4P57A 2LTQB 3MA7A 4H0IA 5GS0L 5CZVL 2CH8A 3DSFH 4G7VL 4NUGH 1RZJC 4JM2C 2Z93A 5EOCL 4A6YL 4I5BB 3P73B 4YJZL 1FQ9C 1UB6B 5F3BB 2HJLA 4DGVH 2CXKA 1L0QA 1J05B 2EDFA 1TDQA 1S7UA 5GS2D 1YYLH 3C5JA 4Z7VE 5F6HJ 4M1CD 3S88H 1CDGA 5TF1H 1DLHA 4UIKH 3UJTH 4BYHA 3K81A 4M6MH 5DQJA 1QSEE 4D3CL 3UTOA 4QRPD 1A64A 4E0RB 4HQQL 2P8LA 1U91A 4HGMA 2DQFB 1KG0B 4NDMA 4OCSL 4F9LC 1ZGLP 5D1ZB 2J5LC 3IFLH 1T2QL 5BV7L 2HJFB 1GZQA 3QQ3B 5TH2A 2P8MB 3DYPA 3PWLA 5L0QC 4LVNC 1XF2B 4Z78B 2Q7YA 3K80A 5FHAL 4N0UB 3LIZH 5D1ZC 4PRHD 4G8EA 1U91B 3MJ9A 3WDJA 4K9EL 4MNQD 1D5XA 5D1ZA 3DVGA 3V7AE 3JV6B 1OTTD 4HAFA 2WIMA 2VDPH 5FUCE 1YJDH 3BESR 1IQDB 1U3ZA 4OD1H 5H37G 1W72B 2M1KA 3CXDL 4JFXA 5FFLA 4NP4L 4PJEE 4EI6A 5HHMD 4RFNC 4CW1B 5IW6B 5EORH 3BGFB 1X3DA 2R2HA 4ZAKA 1UJ3A 1FV1B 2IBGA 5HHXL 1BZ7A 2E27L 3LMJH 3OKDB 1J8HA 1VSCA 1WWCA 4GKZA 1B4JH 5GGVY 1CF8L 2HWZL 1J1XH 4HJJH 2BNUA 5DC4B 3EFFB 1RMFH 1M1SA 5DEGB 3QCUH 1DTUA 4PJ8D 3RA7L 2Z92B 1ADQL 1YEEH 4OCYH 2NY5C 1FZMB 3FT4A 3C08L 1Y18B 2C5DC 3AM8A 4H0HB 4YHPB 3QUXA 3MREA 2AKRB 1LQSR 3NFPB 2ZNWA 4OKVA 2P5EB 1I9JL 2AJVL 3SOBL 5CKAA 5DRZA 5FOBB 3OG4B 3OKNA 4GRMB 2R2BA 3O11A 2L7UA 2BVPB 4I0PC 2BY1A 1U58B 1RUAL 3V6ZA 3WHE0 1HINL 3ZDZE 3D2UA 4KHTL 1MHCA 2DWEB 3OJMB 5EOTB 3SE9L 1CVRA 5FAAA 4CVXA 1JPGB 4E9LA 3DMMB 1OTUD 5HHOA 3QZWA 4LVHB 1AI1H 5EZLA 4K2UH 1A7QH 3IDUA 4GJTB 3UBXA 3EW3B 3LPWA 3T3PE 3OAUH 1TJIH 3HNSL 1FPTL 3LKPA 5C1MB 2VSCA 2H26B 4J8RA 5JIHA 4PRHA 3ZDXF 3L3HB 3GHEH 4LIQH 3BT2L 3DETD 4FQXC 1CFTA 4NO3A 1T5WA 3S3SA 1JFQL 1FL3B 1P7KB 5JZ7C 4WNQB 5F6IB 4RBPH 3KLSA 3OX8A 3QHZL 1ACYH 4K3DL 3CH1B 5D9SA 1EFXD 2KBGA 2XKNB 4RCAA 2PW1A 4W81A 5T5NF 1T6VN 5FUOH 4AH2A 1E6JL 1EBPA 1FG9C 3AFLA 3BH8B 1NEUA 3NN8B 4M93B 4EDWL 1KV3A 1U41A 2DYPB 3S3JA 5KTEL 4ZODA 5IVXB 1K4DA 2ZG2A 1RZGA 1IAMA 2HVKA 1KBGH 5FECA 3R06A 1AQDA 5FCUL 4EIZC 5KS9A 4OD2B 4PJXB 1QSZA 1AR2A 2KKQA 2O5ZH 1QR1A 1MCLA 2A9MH 4WU7A 5E56A 4HAGA 1S7WB 2XWTA 4KVCH 3LIZL 3GMQA 4HULB 1YY9D 2BY0A 5J4MA 3HC4H 3MZGB 3ARGB 1NC4B 2B5IC 3IKCA 3QO0A 1N7ML 3QUKB 4P5TA 1DSFL 3HAEA 1HCVA 3PP4L 3VXPA 4G43B 2PETA 1XF4B 2QQKH 1FC2D 4K3HA 4QXGH 3HPJA 3X14B 2XQYG 3IXTA 2NX5E 3F7VB 4HK3J 5HHXH 5J6HA 3BXNB 4M9PA 1JYWA 3K8MA 1EEZB 2ADJB 1WBYB 3KYMA 5E8OA 1K4DB 5EA0H 3N9GH 1KGCD 1FBIL 2JJVA 1V7MH 4WY7L 2VLKB 4Y16B 5HGAA 1J05A 2E9IA 3FFDA 1HI6A 4HZLB 4J7RA 3QCTL 4LLQA 1OGAB 3KDMB 1JWMB 4XVSH 3VDBA 2C3VA 4AT6A 4CVWA 2X89D 2UYLB 1JZ3A 3TIEB 3MACH 4HH8A 1BX2A 4YHLH 4QO1A 2HJKB 3C09B 1P4LB 5MEOA 1U92B 5FYJL 1JK8A 2AGJL 5C07A 1OGAA 1BAFL 1NGWA 4AEFA 3EDDA 1C12B 2KZWA 4OJFL 3U36B 4NHUA 1IGIH 4MQTB 5AYUH 1BF2A 3VFMB 4KHTH 1BIIB 4NQCD 5ESQA 2DYPD 3SE9H 4RISL 3IFPA 3WJJC 3GSVA 4MAYC 4N90D 4O4YH 3QQ9C 5HVHC 3GSWB 5IMMB 4L4TB 4L8SC 3VXNA 1R3IH 1KB9K 4S1DD 4L9LB 1WAAE 3KGRA 1XGYL 3QXVA 1MI5A 1XCTA 2DLEA 1NSNH 1AQKH 5IFJA 4LPWA 4PJ9C 2CQVA 4X9IA 4TNWK 4YFLI 1NC4A 3MYZA 5I0ZA 3U82B 3QIUD 4NNXA 5I66A 4M43L 5FO7B 1FZJB 4XPFH 4KZEH 3H3KA 4PJ9B 1OAYH 3QNXB 2HJKA 5DMIL 1L4IA 3CFBA 3NPSB 4TUJA 15C8H 2AK4E 5CJOH 3HR5B 2H45A 4JLRB 4IEFB 4FN0A 3EYOA 3NTCH 3T0ED 1KXQE 3KNBB 5EIQA 4UT9H 3WNMA 3WFBH 3GSNH 3TF7C 2CR3A 4JFEA 4JRYE 3LN4A 3FAXA 1H8OA 3VWJB 2K3TA 3L5XH 4PLKD 1BZ7B 1T6WA 5CWSA 4YUEL 5K33A 1KJ3L 5EBLA 4UIMA 4K7PL 4V2BA 1TTUA 4Y2DD 4YEEA 3N0PB 4QHMA 4ZPTA 4N9GB 3TBWA 1VGKB 1U8HB 1NDMA 5IMLA 4F7PA 3G04B 1FIEA 1Q38A 43C9A 4O2CB 4MA1B 3MRLB 1DBBH 2IQAB 2ICCA 3QRGH 2VN4A 5KAQF 2I24N 3IVKA 3ECBA 4HHAB 3U79A 4F58H 1BIHA 5FYKU 2ZKHH 4K23H 2F54B 5L7XL 3MRMB 3PWVB 4QOKD 1UYWH 3VWJD 4NM8L 1LO5B 3MJ9H 4DKEH 2MQ3A 2NR6C 4JDTL 1OF2B 4PRIB 3B8SA 2ORBL 3QRFM 5E8NB 4M7KH 3H3PL 4Z0XA 2VJXA 1KPUA 3GM0A 3QUYC 3KPOA 1OD7A 4FZ8L 3LS4H 5E1HB 3ZZ1A 4P3CH 3T65B 1YJDL 2BC4B 2VR9A 3UC0H 1E4XI 1MREL 4LRIA 1BECA 5C3TA 1FYTE 4NFBA 4GRWF 3VXQB 1UZ6E 4NOBA 1VFAB 1YPZF 2W91A 3MGAA 2P43B 2Q3AA 4URTB 3C2AL 5ITBL 5KS9F 5DVKA 1J5OH 5AYQA 5IB1B 5E5RB 1CDHA 4N8VG 1TJHL 2Z91B 3EYQD 4EUPA 2APVA 4RWYL 1BVKB 1OPGH 2YBRB 3JTSA 4S1DC 1TVHA 3ZLQC 1S8DB 4F7CA 4GMSH 4YE4L 3HE7A 5I1EL 1KJ2H 1D5ZB 2AXFA 4Y89A 5DDHB 4YHKH 1INDH 4KK6C 2WWMD 1UXSA 4LASL 3NCCB 3HZVA 1PD6A 1TXKA 3EYFA 1QKZH 2XKSA 4DFIA 4JFYB 3F5WB 1BQUA 1EO5A 1XGQA 3E6FA 1EFQA 1J12A 1EGJH 4NQDA 4G8EB 3VFVA 4KZEL 1EVTC 3KYAA 2ZCHL 3IJSA 3FQWA 1XT5A 1WFNA 2YPKA 1N5AB 1CK0L 4ZSOB 4XGZB 3KPLB 1CU4H 4OFIA 4BK5A 5C0GB 2CDFA 4XAKE 3CX2A 3GSNL 1LNUB 1A7QL 3EYVA 3W9DB 1OLLA 2XY1A 3NOIA 2XZCL 1MWAA 1QHPA 1TZGL 1UVQB 3U83A 1JVKA 1QFOA 3MRFA 4ZO9A 1I1RA 1T0MB 4C56A 5JW4N 4CN4A 3MXWH 5JXEA 2O26U 3GK8H 1HN1A 1YNLL 4BH7B 4NOFA 5MHSE 3VI4F 1NDGA 1R3JA 5BOPA 3O41A 1D3CA 2WLZA 2WQ8A 2XZAL 3MNWB 4BZ2H 4XVTL 3QULB 3HKFA 2QSTA 1IAIM 1S78D 1KJ2A 3FQRB 4HKZA 2A6JA 2F53E 4D0BB 4Z6AT 3IRPX 2FJGA 5IROC 1U3JA 3HE7C 2LABA 3VXUD 2Q76A 3C5SB 1DLFL 3QDMD 3GKWH 4H25B 1JN6A 2G9HA 4JRYB 1M71A 3GIZL 3MLZL 1TCRB 3HC3H 3QG6A 1K3IA 5CJBA 2O5ZL 1IGJA 3IFNL 1OGTB 3JWDC 1WZMA 4BQ6A 3QR2A 4PV9A 1J8KA 3PWJB 1BWWA 1FORH 1E28B 2FATL 4TTGA 5E6IB 3JTTB 3QCVL 3C8KA 5ITFB 3N9GL 2D4DA 2QSCH 3HE6D 4E42B 3QIBC 4KGLA 1U8HA 2R0WH 4EDXB 1FFOA 3GRWL 3W0WA 1CDIA 2X4RB 3TT3L 3WJLC 1IM3A 3QZWB 5EZLB 4MJ6A 3BVNA 2P5WD 3MNVA 1JGDA 1RPQA 2YPLD 5EA0L 1CL7I 3CAFA 4JJ5A 3T0XA 4MDJB 1ZEAH 2AJUH 3C6LA 3O4OB 1I8KA 2GSGB 1J0IA 3MRFB 3H42H 2VLJD 4BQCA 2JJSA 2DBLH 3O8XD 5IQ7L 1EZVX 2W1NA 1S7TA 3VU2A 2MCPL 3WIHL 4ZTOL 5ID0A 1QBBA 3FHAA 1OVZA 1PZ5A 1WIUA 3RQ3A 5JDJA 3OJVC 3CFKB 1P69B 4KQ3L 2IH1B 3LKOA 4FQLL 1BWMA 4JJHA 4X9BA 4EOWH 1LK3H 1NJ9B 4TUKL 1FE8H 3JZ7A 1MJ7L 1NGPL 3OXSB 4PJCE 1XMWA 2O61B 4FXGB 4X6DA 3MRBB 4PR5A 4F7MB 3D6GA 3G04A 5EN2B 5GGTH 5DMKA 2VDRL 1HHKA 1JGVL 2XQYK 4MS8C 3MFFB 3QDMA 4OD3H 3JV6A 4OD2A 5KSVA 2YUWA 3CUPB 5EZOH 1KACB 3I3DA 3PXHA 4RX4A 4C83B 4KRPB 4XAKD 5FDWA 1NLBH 3N85L 2D7PA 2I27N 1KFAH 2VR5A 4CDHA 3ZE2F 4M48L 4TNWF 1NEZA 5I1LA 1MAJA 1RIHL 2E6JA 3MLXL 1EEZA 1S8DA 4OZIF 1CXEA 3QDJD 5KSAA 1TZHA 3CLEL 3HC0A 3NTCL 2I9TB 3ZSTA 2A0LD 4X7EC 5CEYA 4XCYA 1ND0A 5GIRA 4AEHH 5BRZB 3IDXL 3T2NH 1HSAB 2MPAH 1ZSDA 1L7TL 4ESKA 1QO3A 4OCNC 3SGDH 2DIBA 2ICEB 1ZK9A 4U6HB 3FL7A 1MCFA 2APXA 3V4VH 1WZKA 4Q9RH 4P5MA 1CFQA 2AQ2A 3MGTA 2HG5B 4IRJA 5GS1A 2DQUL 2HJLB 2P5WA 4P0DA 2EZ0D 5DJ2B 3WO4C 3T1WA 5K9KA 3QIUA 5D1ZD 3P30L 2P8PA 4ZXBB 4YBQD 5ENWB 3EO9H 1A6TA 2XRAL 3LEYL 3SE8L 3DO7A 4WFGD 3BEVA 4U1LB 2GAZB 4NZRL 3EJJX 3VFPA 3T0AA 3SBWC 1Q9OB 5KJRL 3BZFA 1Q9KB 4EJ1C 3SKMA 3WKNA 4NM8H 1JNJA 2OSLA 1CQYA 4JPKL 4I2XE 5SWZA 5KW9H 3DARA 4BK4A 3WXWH 3LZFH 1U9KA 1OT1A 4LRNH 3HLAB 4OBSA 1QSVA 1X5FA 2DS4A 3TA3D 32C2B 4MZ2A 1K8IB 1Q9KA 5ADOL 1MI5E 4KJYA 2B2XL 4KMTL 3JWNC 1YDPA 4AM0A 4K94H 2UVFA 4ZO6A 4DKEL 1JCKA 4GKNB 4WI3A 3MRKB 1MREH 3MV9E 4MQ7B 4U05A 2ICWA 2AV1A 3RDTC 3UBXB 3UPCA 4YHMH 5CMAA 5F7UA 1FV1A 2AJUL 4CBPA 3KYNA 3R8BB 1NANI 1T0NA 4CDGC 5E0QA 4IS6A 1JZ4A 4JFFB 4JFZL 1MLCA 1JJUA 2FECI 3WIHH 3WXVH 4AQ1B 5E2WH 3MOBL 4TQEL 4UTAH 1HSAA 4X4YB 4UNTA 3OX8B 1YJDC 1JMZA 4DAGH 4WEUD 3RL2B 4K7PX 4JFFD 1DQQA 4ZYKB 3SDDB 1OT2A 4K9EH 4WEMB 3RIFK 2C9AA 5EB9A 2PN5A 1FGVH 3PL6C 4WU5B 4F15C 2C3HA 5ITBH 4POZD 5IVZA 1OCWL 1JGVH 3FKUS 5ALBH 1CBVL 3JWOL 3M8OH 4R3SB 2DQFA 3AVEA 4NNPL 2ZUQC 2LAAA 1DQQB 1P9MA 5FA3B 4F15B 3OR7B 4Z76A 1A6ZB 1LK2B 2H2PD 4X0KA 2AXGB 2MKLC 3SJVD 2WM0A 4OZFG 5DVMA 1I8MB 1RZ8B 2EO9A 2DL2A 4LASH 2ZUQB 4NQVA 4XPHH 2V9QA 5FM4A 5BZWB 3WLBA 2BDNL 4X6CA 3ULUE 3CZJA 3TBSA 4X4XA 3CX5J 1R3HA 3O2DA 4JY4B 5D7JA 4ETQB 2JLLA 5D7IF 5L2KD 1T3FB 2HKFH 5C07E 1QD0A 1KCUL 3MYJB 1KENH 3HUJE 3I50H 1YNKH 2VXUH 1AGCB 3S98A 2LE9A 4YNYA 7CGTA 4FOMA 1U8QB 5E9DE 3UZEA 1S7XB 3NGBB 5BJTA 1N59A 4RAUA 1F00I 4X5WB 1OP5H 2XZAH 4NNXB 3KPSA 2CIKA 3I84A 4D2NA 1HOCB 1R3LB 4NQDD 3TN0C 1YQVH 1KJVA 3SDXE 2H32B 5JW3H 3QI9C 4J12A 4HJGB 1RZFH 3MSPA 1YNLH 1G9NH 3O0RL 4PJXE 2V7HA 3PQYE 5ADPH 3BEWB 5A43C 4H20L 2IADB 4OKDA 3NFSH 3RX7A 3I9GH 5I1KL 1ND0B 1AFVH 1G0DA 3W11C 5F9JB 4D0CB 1C16A 3BT2H 3WUZA 3OKOA 5SWQA 4Z95H 3NA9L 3KHOA 4CUCA 5EPMB 2YC1A 4HKBA 3QEQB 3VGDA 4JFDD 3W5NA 5D93C 1DLFH 1UT9A 2VL4A 1IGTA 4HIIA 3M07A 2NQCA 4KRPD 3C2SA 1VENA 4PY8J 4R96B 2DOCA 4OCWH 4LLWB 4XB8A 4RAUB 4X5WA 5KSBE 4P46B 1YY8A 3T77B 2P8PB 4G9FD 2EH8L 3G5XA 3WUWG 4GG6E 2FEEL 2W60B 1F45A 2AJSL 5EFIA 1DQMH 1LNUA 4PFEA 3WE6B 1NCBL 4KJWC 5D7KE 5D7JD 4OLYH 1CFQB 4LQ1A 4AIXA 4G8IB 5LCVL 3DSFL 4G7VH 3RHWK 5EU6D 4G42A 5IFHH 2V17H 4P2OB 5J57B 3I6KA 4DAGL 4PJHA 4W4OC 2I60L 4I5BA 2XFXA 3NN8A 4OCYL 1U36A 1PG7L 2L7JA 1H3PH 1C08B 4XCNB 4Y88A 2LFGA 5DTFB 4OF7A 4HS3A 4P2OC 4I48A 3DVGB 1F02I 2NY1C 1SBBA 1AGBA 1Y0LB 5C0BB 1RIUL 4A6YB 5F1IB 2R0KL 3B9AA 3NA4A 1HH9B 5DSCB 4WW2F 1OGAE 1T1WA 2HN7B 4GRWH 3WHXA 3T0WA 1MFDL 5E99L 4MSWB 2CMRL 1IL1B 8FABA 3QDGA 2PO6C 1NDMB 1W0WA 2VWEC 3T0EA 1A0QL 3ULVD 4U1LA 5HHVH 2EH7H 3UTZB 5BXFA 4PRIA 1FE8L 1XIWC 4PGBB 5HDBF 3PWJA 4XVSL 3VXSA 3NACL 2R23A 4PREB 5DXWA 5C0BE 4PJEB 3LN5A 4PJDA 3QG6B 4YXHH 1JGUH 5I16B 5GSVA 3CSYA 1FNSL 2G2RA 1IKFL 4UV7H 1YC7A 3H7BB 2G5RA 3WS6C 4HC1H 1GGCH 1V3LA 1AH1A 1KFAL 3V95A 3OV6A 1KCKA 3TVMB 2PNDA 2FX9H 3MV7A 2VERN 4OFVA 1I7UB 2LVEA 4R0LC 5DJAB 1WBXA 1FC1A 1RZKL 4GG6B 2X4PA 2BHZA 5I8KH 2X1PA 3E8UH 4Z8FL 1L7TH 2V9TA 1RULL 5T33L 1A9EB 2RR3A 5BS0A 4M6OL 3LEXB 4YFLF 4BSVB 4Y2DA 1J86A 2BVYA 2DQTL 3DI3B 3UTZA 3QUMB 2F5AL 4XP6H 1C7SA 1ZWIB 1GAFH 4UV4H 5FYLE 1BOGB 1D5MA 5DVLA 4FNLL 3AS0A 4B0MM 3KWWB 5AWNL 3BJ91 1P7QB 4LLYA 1DFBL 3G9AB 3THMH 5CJOL 4OCWL 3V5DB 1VCAA 3S3PA 4RBPK 1HH9A 3PQYB 4WUUE 5T5FL 1I3GH 3C5ZC 2VN7A 5JORB 3VWJA 1QLFA 2RQ8A 5I9QC 3MOAL 2WWMC 2OK0L 4LLYB 4X80L 2Z92A 5B8CA 3OAUL 4YNYB 1UH3A 3BSZH 2NYYD 5DJ6A 3RWJA 4LDOB 3QDAA 4WY7H 3EYVB 3OZ9H 4OZGE 1X5IA 3T1FB 2X4OB 2C7UB 4P4KD 3MBEB 1L7IL 5BMFL 2IANB 2QJDA 2YZ8A 4UQ2B 3AB0B 4HLZG 4W6YB 1FHGA 2RFXA 2GW5A 1MUJB 3VDCA 1FVDB 5DK2B 2YN3A 3IS0X 1KNOA 2OZ4L 4EKXA 1HNFA 3QDME 4M1GH 3TA3A 3N1MC 2W0KA 3JVGC 3GMNA 3GMLB 4MLSA 1FL6A 4JZOA 3PDOB 3MJ9L 5CILH 4XMPL 4NKMB 5FF6B 3FO2A 1AGFB 2F58H 1NCTA 4WFHE 4CN1A 5E2UH 3CC5A 1U95A 1KLUB 3MRHA 4D9LL 2J3SA 4DQOL 2ENSA 3VA2C 3MTRA 1QA9B 4JHZA 4R8WL 1J1PH 4BH8A 3DROB 1G7PB 1HQ4B 3H3PH 2Y9RT 1CDJA 2ATPA 2CLRB 5CAYB 1L9MA 4DGYL 5E70A 1NCAH 3UYPA 4YPGA 2YD4A 3K1DA 2DQDH 3T08A 5IBUG 1X6NA 4X7TA 5DFTA 1N8ZA 3E6HB 3DROA 4LLDA 1HEZB 3PABB 4F7MA 1QSFB 1EXUB 4M8QA 3TBTA 5DLML 1T21A 1UKQA 4PRPD 3ZDZF 4DCQB 3WNNA 5JW5B 4GKNA 1TJHH 1MHPL 3CCHA 4MD4A 4N0YL 5F7MC 3PDOA 1XZ0A 2XWTB 5H94B 1QFUH 4JFFE 1FSKC 5ITFA 1EBAA 5DTFA 1BJ1J 1UVQA 4IRJC 4TULL 4LLMB 2FSEA 2XYCA 4LSRH 3TT1H 1I4FB 3L6FB 4Y19D 4LCCA 1AJ7L 3BZEA 1B2WL 1BBJA 5E1AA 3W9EB 2AJZA 2ATKB 3ZT6A 2DQTH 1F5WA 3JXAA 4QRQA 1RU9L 2QV2A 1AD9B 1RHHB 3D0LA 4WTXA 4Z7VB 1VFBB 4OF8A 3SDAB 3IU4L 2GFBA 1X6LA 2YD8A 3RWGA 3A6BH 2P46B 1A9BA 4DZBB 3QPQD 3DX8A 5F70A 3H8NA 3EO1B 2NXYC 3QRGL 1YYMH 4AJ0A 3TBVB 4X6DB 5ID1B 1N0LA 3P9LB 5E2TL 1IFHL 1A7RL 3WEXB 4Y1AE 4GBXD 2MCG1 5DHVB 1O5DT 2DJ4A 3FRUB 4DZBA 1ZLSH 3WIFA 2D7OA 4Z7QE 4PB0L 4NO0B 3K2MC 5DO2C 4Y1AD 3GSXB 4HMEA 4OI9A 1C5CH 1EJOH 1YNTB 4H5SA 1XCTB 3GK8L 4KK5D 4GSDH 3QA3B 3CDGB 2ZWLT 4LVEA 3MRDB 4OFPA 1GOFA 1IC5L 4IIQC 4G6KH 4YDIL 1OAYL 5DMIH 1FL3A 4OGAD 3V4PH 5I8EB 3ARRA 1VFBA 4Y1AB 3W0WD 4X5LA 4HX1B 1PG7W 4DUVA 1GSMA 4JPWL 3V6OC 4DVBA 5LGHH 1J9CT 3ULSA 4GAYA 4NKIH 2I07A 2F58L 4U1KA 1YEKH 3VXUB 3VXMB 3TVMA 1NUDA 2DICA 1N6VA 4LPUA 1RIVH 4WI4A 5DEGA 5EU3A 5GGQH 4MNGA 3H7LA 4GBXC 4ZDHB 1KXVC 5KVGH 2Y25A 4APQB 1KIUA 1H3PL 1SJEB 1PDKA 4KZDH 4U7KA 1BHGA 1M7IB 4MB5A 1N64H 3N06B 2LTQC 4OCXH 1QBML 1IEHA 2P8LB 2SEBB 3SY0A 3BRDA 4OLVH 5DJDB 5TFSL 1R3KB 1IBGL 4FQQA 4HFUL 4JFQB 2AABL 1T1YB 4PJDE 2QEJA 4ETYA 3DO7B 1F3JA 2NZ9D 1KTLB 3K8LA 1HQRB 1MFDH 5E99H 1QSFE 4ZNCD 4N0YH 2D7TL 4IRJD 4CNIB 5EZJB 1BMGA 1TQBC 4C56E 1QSFD 1C5DA 3I75A 4R4NC 3RGVD 2H3NA 5GGVH 5KSAD 3TO4A 4Q7DA 1JZ7A 3O2VL 3UTTA 3CSPA 2MOVA 4AT6B 2FX8H 5KVDH 2BX5A 5EUOA 5CEZD 5CJ8A 2X09A 3VXSD 2EEBA 4QHUA 2H3NB 2Z8RA 3BGAA 1LO5A 5IWLA 2VDLL 4RGNC 4UMGA 2FX9L 3U7YH 1K6QL 2EYRB 3VD5A 3VWKB 5HI3D 1P9MC 4EBQL 4XXDA 3CDFA 4BKLA 1T1XA 5EO1A 5IG7A 3CFJA 3RU8L 1EFXB 4I1NB 2X4UB 4RGNB 2P24B 4P2RB 1P5VA 4KMLB 5EULV 4M48H 4UTBH 5D7SH 3ALXA 1GPOH 4PJ8A 5D2NA 4PB0H 3OR7A 4XAWH 4F7EA 2M26A 4L4TA 4ZOBA 5DD3L 1NKOA 3RZWA 4RGOH 2DQIH 1GOHA 2FGWH 5D7IA 4U6YB 4PGCA 3EIFA 2CUIA 4OZGB 4QTIH 5I71C 1LWRA 4GRLA 4BH7A 5C70A 3KXFE 2ZUVA 2YUZA 2H2SC 1FO0B 4PJGB 1DL7L 5T5NG 3ZE2E 1P4IL 3D2UD 5BMFH 5IBTL 5EOCJ 1A02N 1WICA 1KBGL 3EOAA 4HUWB 4KKBD 2ZOKB 1NBZB 2DM2A 3L3HA 3FB5A 1CDBA 2WP3O 3I2CH 5FKPA 5KOMC 3OF6A 2F54D 1TQCC 1XGTA 2QHRL 4MQ7A 1E4WH 4IDJL 5FXCH 3PQYD 1PLGH 4MA1C 5HGAB 1KJVB 1T20B 4HLJA 5GXBB 1AIFB 5CGYC 4W4NA 2NY4D 3W39B 3CX5K 3EOAB 3ZE1F 2XNAA 5FGSA 4POYA 1ORQA 3DMMC 1WTLA 3BN9C 4F80A 3GO1H 2HFGH 1YN7B 3IF1B 1YEDB 2NW3B 5BW7C 2X5PA 2VDML 4WWKD 4Y2DB 2C26A 3ORJA 3P9WB 1U3HC 5I6XB 2FEDD 3OKKB 4XP9H 1A6AB 5ICYB 2WBJC 3PIQA 5E03A 4FFVC 3AY4C 4OCSH 1S9WB 2JJUA 2PTUA 4NQUA 2FD6L 2GJ6B 2KZ1B 5J9PB 1NFDF 4OV5A 2WLYA 5JPMB 5L6YH 1ZHLB 3HZKB 5FA4B 2IBZY 3N85H 4X0KB 2OCFD 4XMLH 1JV5A 5GS3A 1ZANH 2I07B 3HCVA 1N26A 1UWXH 1F6AA 4K9EC 5E95B 3ARDB 4Z7NF 3TH2T 1AO7D 3BPOC 1N0XH 2A77H 2O93L 1PFCA 4HH9B 4V1DE 2DQDL 1D9KC 4EN3D 2VQ1A 3T2NL 4JQXC 3PWUA 3MBEA 2YRZA 5GRYA 4UU9A 2R69L 4LSRL 5AUMA 2OI9B 3IFOA 1CXLA 2BXYA 3F12B 3FO9A 5HGGS 1H3VA 1YEHL 2HMIC 1ADQA 1CF8H 4WGWB 5D96B 3MMEB 4MZ3A 1MCSA 3IU4H 2Q7YB 5KG9B 3ES6A 3ARED 3HAEG 4L1HA 1ADQH 1BJ8A 1YEEL 3DWTA 4G8IA 4QRUA 5TJWK 5F1IA 5DRWA 3MXVH 1QBLL 1B2WH 2EKJA 1QRNB 1KIRA 3TZVB 1H5BC 3QI9D 5HI5C 4JDVA 1VGKA 4ODTH 4BFGA 2BNQB 2X40A 1F3JB 5F7WC 4HGWA 3EYFB 4N8VB 5ACMA 4WV1B 5IK3A 1NJ9A 3T3ME 4YX2H 2CIIA 4GOSA 1DBAH 4CJ1A 3NZHH 3SGKA 4LRNL 1QHOA 1LO4L 1HH6A 3CFEB 5JW4R 2I25N 4P2OD 3U2SB 3AUVA 5GRVK 2VLLB 1MIEL 1A6AA 4AIZB 3EFDL 1HNGA 4XT1C 2QQQA 4PD4J 4WCYH 1G9NC 3FFCE 4OUUA 5IQ9A 3VGFA 2GQHA 1CLCA 4LRIC 5TF0A 5EO0B 1V05A 5DC0A 5HHQA 1YMMD 3ZHKA 4X98B 5HVWA 1E4KA 5ENWA 3PF2A 2FGZA 4JM2F 4OZIB 4K3EH 1MJ8H 3LKQB 3VE0B 4OFDA 5DRWB 3ARGD 1NEZG 5JIIA 5I1HH 1P5UA 1F4YH 4JFDB 3QNYB 3QEQD 5HGDB 5EPMA 3GRWA 4X8JB 2JCCA 3O41B 4Y4FB 1U8PA 2NX5A 1WCBA 3VRIB 3KPSB 3V79C 1OY3B 2WW8A 2JIXA 4U1SB 1XH3A 3P4LA 3DGGB 4LMQE 3OHXB 5IHLB 4O02L 1W72A 5C9JB 1RSFA 3OJ2C 5BVJB 4XP9L 3MA9L 2H1PH 2QQNH 1TMCB 4Y5YC 3U0PB 3IXTB 2E5EA 1OP9A 5IVXF 1S7SA 3BQUA 3PHQA 5I1GH 1TIUA 3VH8B 4IIQA 4NZRH 4Z7UE 1UZ6F 1T22B 3FCTB 4JR9L 1MCRA 1VADB 4KI5E 3O3DB 4MNHB 5J56B 2NXYD 5CJQL 3L3OB 2AJSH 5GGSB 3WFZA 3S4SB 5A3ID 3WDIA 1LDPL 1OAZH 4O5LL 5D2LE 3PNWA 3LY6A 4PD4K 1H8SA 2KQNA 3EOTL 1VEMA 2NY6B 1N0XL 1NC2D 2A77L 2CRIA 3X17A 2GTZA 1RUML 2WINA 4JKLA 3WFDL 1KULA 4NRXB 1XR9A 3FQTA 3FQXB 4YEFA 3GSQA 3J8F7 2I9LB 3SEPA 4YHNB 2AV7A 2WIIB 2HVKB 3O4OC 2FECL 5IR1B 2Q7NA 1LE9A 3DPBA 4YFEA 2FX8L 5KVDL 1JPST 3QIWC 3FQTB 3ETBF 3U6RB 2VC2H 4Y4KD 4PJ7A 3C5ZA 4YE4H 1HHJB 4HK3N 5CJXC 4PYGA 1EHLL 3ZKXB 2VWEE 1MLCB 1AHWB 4KUZH 1UKTA 5LQBL 4ZFFA 2E8ZA 3O9WC 5HYQA 4L8SA 3PIQB 3MV9A 3H0TB 4QLRA 1AHWC 1S5HA 5D7SL 2IQ9H 4OF3A 5D1QC 4YXLH 4B50A 3LD8C 2A9NH 3QEUB 2EZ0C 5DQ9B 2J88H 1K6QH 3L7FA 1YEDA 4NZJA 4JAMB 4RISH 5DRXA 4OLUL 1FJ1B 1AGEB 2XA8H 3HPLA 5FM5O 3MJGX 1ONQA 3IETB 4CVZA 3SKNA 4RDQF 3VFSB 3F7PC 1M05A 3W5MA 5ICXA 1IGJB 4Q6IB 3ULVE 4XAWL 2ILLA 4RGMC 2JK5B 3RNQB 3UEZA 2E7HA 4NC1E 1VACB 5IHZB 1LHZA 2GEEA 2V2WB 5HD8D 4QOKE 2ESVE 1G7LA 1U92A 4R4FL 4BSWB 4A2LA 1T04B 1QBAA 1RHFA 4LPTA 3BIKB 1JGEA 1PQZA 2WZPD 1I8IA 1XGRB 1ZHBA 1KJ2B 3OKYA 1UA6L 4P2QA 3AM8C 4JQIL 1ZVSB 3RWIA 4LEOB 4NWUH 5D4QA 5CEZH 3QULA 1NUNB 5C71A 3KLHC 3TBTB 1RJZA 3V0VB 4X6DE 1EEYA 3CNKA 3L7EA 3SO3B 1A4JB 3BKMH 2DLHA 5MERA 3DXAA 5KVFL 4NUJA 4JFXB 4QHUB 3BXNA 1UXWB 2GUOA 4H26A 5B39A 5I1CL 5J0BA 2YWZA 1E28A 1G9NL 3E2HC 1IAOB 1IKNC 1IC4H 5C0AB 1S7RA 2OK0H 4AIOA 4H20H 4P23A 4Z78A 3MRCA 5FO7A 3PG2A 1U95B 4XTRD 4R90H 4N68A 1AP2B 4HT1L 2UWEF 4QGTA 2G9HB 3GFUA 1ZANL 1PBYA 5C7XL 4PLNC 4ODXA 4V1DD 1O7SA 3LAFA 3WL9B 2X9WA 1CCZA 3R1GL 3CVIL 4JKPH 3T0BA 2R9HC 2WUCL 4PJXA 2OL3B 4W6XB 3P0VH 2MNUA 2QADD 2XWJA 3PGDB 1BLNA 2DJUA 2C1PB 1K8DB 1ZT1B 1MLBA 3BRFA 4QHNA 1XR8A 5KS9E 4M5YH 3JTSB 3SGEH 5ID0B 1B9ZA 2B8OT 5EFIB 2A6DB 4OLYL 3RWHA 3VG9B 5DURD 3RWDB 1OPGL 2VUYA 1BEYL 2X9YA 1G1YA 3FOLB 1W8NA 1A6PA 1CG9B 2FHCA 5DGRA 4OI8A 5IHUL 3ARBC 5DJ8A 4TUKH 4FXGA 4PB9H 1RAMA 3GIVB 3C2AH 4L3EE 3CLFL 5DHYA 1YEHH 4MCYB 3ARBB 4KGJA 5J6GA 1RIUH 5I73B 1S7TB 1C7TA 1QFWL 3WS6A 2BJML 2E27H 1S9YB 5T1KB 4KTYA 4KKLD 3SCMD 1UM6H 1IGYA 1PYWB 1DDHB 1A6TB 5C0DA 3VMPA 3QXUA 5B3NA 3BHBB 1CU4L 3F62A 1EIBA 3WLWD 4GQ9H 5T5FH 4OM0L 4NKDA 3VFWB 1K2DB 1UEMA 3UJIL 3NFPA 4RAHA 4AEEA 3WBDA 1J8HD 3W9EA 5CFHA 1C12A 4ZFFB 2PO6A 3LHPH 1AJ7H 5B22A 2RCSL 2IWGA 5JOFB 3QFJD 5CZKA 3RBGA 4Q9RL 1WFUA 4NQSA 2EIDA 1SY6L 3WN5A 4QHLB 4JFDE 5GRXG 3S35X 4KJYB 2NY6D 1JGUL 3DRTA 1FFRA 3MRDA 4HKZB 3K4ZA 4WCYL 3TH4T 3MRPB 3CSYB 4NQXB 3B3IA 1CICD 1T89C 3D39D 1YYML 1GRWA 1P84J 4HX1A 5I74C 4KPHL 3IETA 5GHWH 4D3CH 1CE1H 2GITA 3EJYD 2OR9L 3RAJL 3U1SL 2GAZA 1NCWH 4XVUC 5BXFB 2H9GA 4HUXA 2ID5A 1BZ9B 5I1HL 3SJVB 5JNYA 1C5CL 1EJOL 1NBQA 3KPQA 3DGCR 4JVWA 3CFDB 4ELME 3DX8B 3W11D 4WFEE 5T3ZE 5CSGA 1KYOK 3OKMB 3VGBA 1T1ZA 3DRQB 2VDPL 3RRQA 3ARTA 5CP7A 3ULUD 4HSQA 1S78C 3A67H 4O2FA 2X4NA 2W65A 4YDKL 4MD0A 1KG0A 2R0WL 5EUOE 5F3HA 4OZHA 1W0YT 5MEQA 4QXWA 3TEUA 1YEJL 4ELMA 1DEEA 4LEXH 4QRSB 3VFRB 2FATH 4RAVA 3QUYD 1SYSA 5TQ0L 2B1HL 3WFEH 4HDIB 5FO9B 4RQQA 3UTSA 3ZTNL 4ZXBC 1WAAA 4CMHB 3BQUD 1JP5A 1SJHA 3V0VA 1UB6A 4M7ZB 2X4OA 5KVGL 1FDLH 1EH9A 1MNUH 3NIGF 4NZDA 5SV4A 2AQ3A 4LKCB 5C8JB 4M7LL 1F97A 1XGPA 2V2TA 2DKUA 5CEZE 5DS8B 1JGEB 4BQ9A 1MY5A 1JZ5A 1JZ2A 3A6CH 4V1DB 4ZUVB 1OM3L 3TYGL 3W2DH 4FQQB 3PHOA 4LSTH 4LSUL 3MODL 4FQLH 5I66B 1O0VA 3TA3B 4OLWH 3D39A 5C08A 1IEBA 5ALCH 1R5IA 2R4SH 3LKPB 5DMGD 2FH6A 3TLRA 4Y16A 4XXCC 2H2PC 2MCPH 4PRDA 1XIWB 4BFBD 2ADIA 4PJBB 3AAZA 5HGBA 4D9LH 5EOTA 4JPVH 1OB1A 4D9RE 5F1SA 3V6FA 3QYCA 1FFPB 1H0DA 3KPPB 1LEKB 1XH3B 1YQ2A 1SJVA 8FABB 1CD8A 5CINL 5SV3A 35C8L 3QHTC 5FOBA 4H0GA 2WNGA 1XIWA 1CLZL 4PJXF 3VGEA 3G6DL 4QHMB 4ZPTB 4OAWA 3MREB 3BOVA 1JL8A 4FMFA 4NHUB 5AD0B 2WV3A 1CGUA 1MWAH 2BRRL 3DOSA 3BD4A 1LVEA 1HOCA 1R3LA 4R0LB 1HE7A 1U8OB 1NGXA 3L3KA 4JZJC 4Q9BA 4NT6A 1SM3H 3KXFA 3PP3K 3QJHA 4HWBL 1DVFD 2IJ0C 3KVQA 5KTEH 3FT2B 3D85A 4HF5L 3KS0J 2XN9E 4J23A 4LHJB 2F54E 1RZFL 4XBGA 3KJ4C 1OAKH 5E8DH 3UTSD 3AMLA 4Q74A 3HC0B 2FYYA 3QDJB 3B9KB 3ARFD 3D87B 4TN9A 5K59E 4YXKH 3QIWA 4WWKB 5LXGL 5GJSH 4AH2B 1Q9WA 3GMPA 1RU9H 3A6OA 1IQDA 1TPXC 2XOTA 5K9JL 1ZLVH 3AU1B 2BOCA 1D9KA 1JUFA 2FZ3A 4Z77A 3VXTA 2EDWA 4N0CC 5JPNB 2R39A 4NHCL 3QEGL 2HTKD 3SPVB 2Z31D 5DA4A 1IGFH 4YDKH 1X5HA 2FHFA 5DD0H 4GG8A 2DQEH 4WO4A 2RBLA 3DBXB 2YEZB 4HIHA 3ULVH 1YC8A 1KTKE 3C6LC 2Y07H 1ORSB 1NBYA 3D25A 4EZMA 2AP2A 5IV2A 3VGHA 3GUTA 4R90L 3G6JA 1RK1B 1IGYB 1PYWA 4H1LG 2AJYL 3RTQC 2I26N 1BPVA 5EZIH 1ORQB 1FAIL 2RGSA 3MQIA 3DVNA 3QI9B 5BS0E 1AD9A 2P5WB 5T1DL 3SBWA 4XC3L 5K9KB 2VSDA 4LLQB 2W0PA 3O6FA 2VDKH 4OT1L 5GRVL 3MLRH 4HUKB 4NIKB 3HRZB 5B4MD 3UZQA 4EI5A 5C0CD 5C6PB 1O7VA 3C60C 5E8OB 1K4CB 3DIFB 1P4LA 5TDPB 3FJTA 4CJ0A 4JCLA 1GZPA 4R97C 5DJYA 4OSUL 3RNKB 3VD9A 4U1IA 1GGUA 3NIDF 3JTTA 3AREC 4PBVC 5E6ID 2Q86B 3NCJH 1EDQA 3QDGB 1ZVHA 3MX0A 3HB3C 1I1AC 2D2OA 2XFXB 3LQZA 2DQGH 3VWKD 1NEZB 1NGYA 3ARXA 4QOKA 2QKIA 3S34L 3CC5B 4X4XB 4MA3A 1AXSB 4MAYD 4APQA 5ISZB 5HYJA 3CLFH 3L1OH 2PW2A 2YUVA 3P9MB 4ODVL 1I7TA 4Y5VB 1N64L 3MFGB 4GRLC 3JUYA 2BOCB 5F1NB 3ARGC 1RK0A 3TC9A 1INEH 4JDVB 2ESVD 4U31A 3HPJB 5B21A 1OOAA 3LSOB 3SGKC 4U1GC 3TIDB 3MV9B 1J1OL 1NGQL 3OSKA 3V4UH 5HYJB 4KHXL 4NQEE 3GJFA 4WO4B 5IVZB 4IRSC 1PY4A 1LE5B 3VXME 1JF1B 1PZ5B 4FABH 5KG9A 2E9WA 1HILB 3QUZA 3SDCA 1T66D 4I0CC 5I8KL 4FTVA 1JNNH 2Q86A 4LPXA 1ZLWK 4LGPB 4F3FB 4PRBB 2IFGA 2Q8BH 1CL7H 2NY7L 3FTGB 1LO0H 4PJ7B 1FYTA 1YPZA 4KPHH 1AKJA 1CFTB 4GXUM 2XXCB 4NO3B 3HRPA 2BY3A 5GJTL 3L5IA 3KPRB 3QIBD 2W0LA 5CBEA 4HIEA 1ULVA 1F6FB 1FG2A 2F53B 5IB3A 5FB8A 3RL1B 4KKLC 2XI9A 3AXLB 1LD9A 3QEGH 5MENE 3CH8A 4O2CA 5DUBA 1WWBX 1G7MA 4PTUA 3VXMD 3AY4A 5EC1B 4PP1D 4PYHA 3RVTD 5L2KE 3HZMB 4BKLB 1JYVA 5I1IL 2NY2C 2OR9H 4DKAA 3C6SB 3WYRA 3ULUL 1GGTA 4RIRA 1U42A 2HMID 1FNEB 1A2YA 1NH6A 4HWZB 3O45B 5EWIH 3B9KA 3BPNC 4PJ7E 1ZS8B 3ROOA 1YEJH 1CXHA 1FAIH 3S35L 1IAOA 2DJSA 4M7KL 4LVOB 4X7DC 3WJLA 5EIVA 4DJMA 2YD6A 4J2XA 4GXVH 3QISA 4ODHL 2Q76B 1UH4A 5ESVB 3ROLB 3OHXA 2FR4B 5LBSH 3OKNB 1E27B 4O58L 3SDXA 5GRJL 5I76B 2GK2A 2Y5TB 4YPJA 4MJ6B 1MNUL 5HYJE 3AXLA 4P4RA 2VLRB 4DWHA 3BP7A 3LKNB 2H1PL 2QQNL 4AENA 3S97C 1ZKAA 2F19H 4N1HB 3EJZC 4DN3L 4GBXB 4HKJB 4S0SD 4YGAB 1NFIA 1RJYB 4YDVA 1OM3H 1BD2A 2EIZB 3R0MA 2C3WA 4WHYG 1QLRA 2FLRT 2Y06H 3IDJB 3I02B 1P84K 2R0KH 2EYSB 2UY7A 2ED9A 2FEDC 2R4SL 5ANMA 3GUTB 2YPLE 1C8PA 4UILL 3UTPE 3MCKB 2BOBB 4N9OB 1QG3A 1RZ7H 2L4OA 5KSAB 2I9TA 3VFGL 3U7AA 4BSJA 4YBLC 1CVSC 3A6CL 3W2DL 1RUMH 1JGLH 4HIHB 4PJAF 4QF1A 2B1AL 3QPXL 4L29A 4RA0C 4XCEB 3QSKB 4CU7A 4KTEL 4HWNA 5T3XL 1AD0A 4YIQB 4G9FE 4KK6D 3U9UA 3L9RA 5AZEL 5IVOA 2VE6A 4L3AA 4LPYA 5EC1A 1LO3H 1MFBH 4ZO8A 4IM8A 1AGDA 2V5MA 4MD0B 4AYFA 5I8CA 3WHXB 5GZOD 1GC1L 3VGAB 1CGSL 4Y19A 3X13A 4QXTB 4TNVK 2NY3C 3RZCB 3DUSA 4YHYC 1WISA 2VQTA 1VGEH 3B6SB 4M9OA 4PUBH 5IQ7H 1CL7L 2NY7H 4WFGE 3U36A 5JHDD 4QY8A 5HHPB 4I48B 1QUNA 4D0DB 3RZCC 2IMMA 1F2XK 1FVCB 5D9SB 3T4YA 1H8NA 1M7DB 3BDYL 2W9EH 4KAQH 4NKQB 4YR6B 3HR5A 3RNKA 4S1RH 4HUVB 5JO5A 1DVFB 5IWLC 1A22B 4X4ZA 4U2ZA 1I1FA 3EHBC 4UU9B 3CCHB 4MD4B 5IVXA 4FTVE 4NCC2 3FQWB 4RMQA 3GHBH 4ERSH 1RJZB 5EZOL 4LBEB 1OTTC 1HKFA 3I3EA 4TTDD 2OX5A 5HHOE 4K2UL 3MRKA 2E7CA 4XC1H 2IPTL 3CMGA 3BGFC 3ULUH 1OSZB 1FZKA 2ADFH 3BZFB 4O2EA 4P2RD 3MLXH 4R26H 3MJ7B 1S9YA 5T1KA 4GAJH 4P9HH 4XBPA 3DUUB 1I3GL 2AJ3B 3ARYA 1H3TA 1JFQH 2JTDA 1A7PH 4ODSH 4OGAC 2IAMC 3EKCA 5E08L 4HV8A 3KAAA 2B4CL 3VD7A 1FSKB 5EOCH 4Y4KC 3V7AG 1M71B 4N5ED 2QTEA 3P11L 5DD0L 5H2BB 4KK5C 4U7SA 5GRJH 4DGVL 1I1FB 3TP4A 1CLYH 4XNZC 1OAUH 5J3HC 1MCCA 5IBUB 2BVOA 2OYPA 4LU5H 4PIRF 2C4FT 2E3VA 2ITDA 1A6UH 4R3SA 3VRJA 1OGAD 2Z31A 4GAGH 3ULSB 5I1CH 5I8OH 4G5ZL 3D69B 3HI5H 4XH2B 4P5TD 3T65A 1ZT1A 2VLKD 2W9DL 5HBBA 3PDDA 3ZE0F 4DW2H 4OZIA 1H15A 2HFFB 1EUTA 2FIRT 3PWPD 5CILL 4EI6B 2C7UA 1SYSB 2EDJA 4LVHC 4RSVA 5GISH 3LZFL 2H8PA 3D18A 3C8KB 3CUPA 2YXMA 3MOQA 4YR6A 3V8OA 1A1OA 1SMOA 4WNQA 1QBMH 1S7VA 3T0DA 3G6JE 4JREC 2B2XH 5C7XH 3FO1B 2GT9B 3FO0L 2O5YL 3MZTA 3Q5TA 5AZEH 1QLFB 2XQBH 1A2YB 5DHYB 3JUZA 1NC4D 4WW2B 3P0VL 1LO3L 4AG4H 4YHNA 3SE3A 3EOYG 1G7JA 3RJQB 2VZ1A 5HDLA 5H37H 4UUJB 5DQDL 1T03L 4C58B 3BPOB 3IDNA 4LNRB 1HQRA 1VHPA 4P2RA 4PGDA 1ACZA 2D03L 1NLDH 2X1QA 4OIIH 1VGEL 2VDNL 4PUBL 1NBVL 3SGEI 4FFYL 4K8RH 2EIBA 4XB7A 4IRZL 1IZKA 2J8HA 3EYSH 2ADIB 1NCAL 5DJDA 4LCYB 4YHLL 1FL5B 3WHE1 3S37H 3VXUE 2NX5B 1CT8B 1AR1D 2HFEB 3O45A 1S3KH 4CW1A 5IW6A 3VFMA 5JXAL 4S1RL 4ZFGL 3QNZB 3TT1L 5C0FA 5C0RL 2DLFL 4OGYH 2BK8A 2XKNA 5EUOB 5EU5A 4BUHA 3ZYZA 2B5IB 2A74A 5DI8A 2PYEA 1DLHB 1MCWM 2V2TB 4LLUB 1NFDB 1C5DB 3REWA 4R96A 1H5BB 1UC6A 4LSDA 4NN6C 4RZCA 2VLKA 4PG9A 3X3GH 1GPOL 3WMSA 5HI5D 5SWSD 4OM1L 1NSNL 3SKNB 4B41A 4PJEA 3WJJA 4OQTL 1F8TH 5MENB 5GJTH 3WUWA 3RGHA 4GKSB 4Q97A 1ZSDB 3DSNA 4Y16C 2VXVL 3UJJH 1A8JH 3DV4A 4K71B 2IALB 3BPCA 3V6ZB 1YNKL 2CO7B 3LHPL 4FG6D 4GRWB 3IDYC 4XPFL 2ZCKL 4XCFH 2EDEA 5AZ2H 2HH0H 25C8L 1IC1A 4LSQL 3MLUH 4K71C 4MLIA 4F2MB 1UWEH 1T1ZB 1Q9OA 1KEMH 2HJFA 3SKUD 4EDWH 1UGNA 1ZLSL 4MGXA 1P7QD 4U0QB 2ZUSA 4JZOB 2R1XA 1OW0A 4OLZL 3BW9B 4PJ5B 3TBYB 4P3WA 5FYJU 4F37F 3GZKA 3S35H 3JWDL 3LKRB 2V2WA 4M6AA 1I8LC 2OP4L 4FTVB 4HZLA 4Q0XH 1B0WA 2BC4A 3DNKA 2IPUG 5K93A 1XGUA 4L9LC 4Y5YB 5LBSL 2OR7A 1AKJB 3AMKA 2P7TB 1WBYA 3KYMB 4MMXC 4LEOA 3UBXI 1KCVH 4NM4L 3HC4L 4JPWH 2B4CC 4QT5A 3FO0H 3U48A 3SN6N 1REIA 4KKAD 4MJID 4FFVD 5L88H 3FT2A 4W70A 2EDNA 4YLQT 1DSFH 4ODXB 4JDTH 4G80B 5IOPB 5MI0C 3MROA 2FO1A 3EHBD 1JHLH 4CRPA 3GSXA 1YEIL 5JW5A 2JCCF 4EQ3A 3LDBB 5B8CC 2CKNA 4NGHH 1PEWA 4OIBA 4I0PD 2W9LA 5D8JH 3ZL4L 5CIPA 5CGYD 4ZG1A 1C08A 4HT1H 4FQHA 3HA0A 1MRDH 3Q1SH 5ELIA 1S3KL 2NY3D 4Q9QH 1ZA6A 3NIFE 5EBMB 4XHQA 4CMMB 2GYSA 3HFML 3IFPB 5SX5H 4NNYB 2NMSA 4QRRB 3MRIA 1EO8H 1NCNA 3GMMA 1A1MA 4XCCL 3HMXL 2XZZA 4J3SA 2BXZA 1NAMA 3WN5C 1BZQK 2ICWB 1X5LA 1KCRL 4FQXA 2ARJQ 4HC1A 5FYJH 2EC8A 3C9NA 1E27A 5I76A 2H2SD 4AQOA 2MMXA 2CRMA 1U3HB 2JF1A 4BELD 4EEEA 3L3DA 5HHQB 4JRXA 5DJ0A 3GBNH 3GHBL 1HHJA 2HAZA 2BSTB 3LD8B 5HI4D 4PV9B 1YMME 2HKHL 1KPVB 1H3XA 4J3TA 1T3FA 4LLAA 2AAVA 4H1LH 4RFEB 3KPMA 4NKDB 3VFWA 3I9GL 5CIPH 3IAQA 4LCWB 1CT8A 1AFVL 2HFEA 5HPOA 3HI1A 2X05A 4XCFL 4WUUB 5JHDA 1LO4H 1MHCB 3QUYB 4JFEB 1KTLA 4KUCD 2OL3A 3QFDA 4JM4L 1CK0H 4N8VA 4X9GA 3PGDA 4X6BB 3H9HB 2BRRH 4PGDB 1U8LB 3EOBA 2WQRA 5D7JC 2VQUA 3OAYK 2OR8A 3WNPA 4HWBH 1X4YA 4D9RD 4NBXB 4HF5H 1JI2A 3EO0A 2OZ4A 3DBXA 1P4BL 1CFNB 5TE6L 4ODUA 3EUUA 5I17B 4UT9L 3MO1B 1JPTH 5F7EL 3FO2B 5GQBA 1OHQA 3T04D 4XVTH 3EFFA 4QXUL 1ROWA 4Y5XA 2F8OA 1AGCA 4OTXL 3V6BR 1G9MC 4G5ZH 5LXGH 4NBZB 4JO1L 1V8HA 5FCSH 1MUJA 2XT1B 2DQCL 4NT6B 1URLA 1U8PB 4LCWA 3ULVC 5SWSB 4Z0BH 5KVEL 3IAPA 3TH3T 2ZCLH 3FZUD 2ADJA 2EXYC 3TYGH 4MAUL 5IKCB 2NTSP 1YZZA 5I8OL 3TJHC 3T77A 3W9DA 5E5MB 3BD3A 1V3MA 4QRPA 4P23C 5CJQH 3PNWB 4IJ3C 4UNVA 1CFNA 1T7YA 2FO4B 1N5AA 3AROA 3O6LH 4JQVC 4HKBB 4IJ3B 1L0YA 3LB6D 3MRCB 4XP1H 4FXLA 2D03H 2YPLA 2R2EB 4MNQA 1MEXH 3BZ4B 3GB7B 5DHVH 1XCQA 3WFHA 5A1AA 2DWEA 4Y4KA 2OLDA 2X2YA 2OZ4H 5JIPA 1YEGH 5JW4Q 4AG4L 5D93B 4R2GD 4HJ0D 2DM3A 2ERJC 4AEIH 1AKJD 5DS8A 3GSVB 4JM2A 4KK8C 4QYOB 4XPAL 5IV2B 4ZOCA 1IILE 2RB8A 1T20A 5FGRA 5BQ7A 3OKKA 4LGRB 3WD5L 1E4KC 1J5OL 2VDNH 3LQZB 5JW4M 5IP4A 5J11C 3IJHA 5IGXL 1YN7A 1UM5H 5E4EC 4N8CL 2DWDA 2NXZC 3KPQB 3K7UA 4KQ3H 4HKXA 1JNLH 3QQ4A 1XF1A 4JKWA 2BVQB 3PUCA 4YXLL 3HB3D 4HCRL 4EI5B 5F89A 1GJIA 4OB5L 2G2RB 4JFED 2VL5B 3QUXD 4YK4B 2EDYA 5E6IC 1PAMA 2AW2A 4ZNEE 2FLBT 3O2DL 4DGIH 3PWPB 1DN0B 3WNKA 4E5XB 1BF8A 3U30C 4OLUH 4UAOB 3TYFB 4N5UA 2ENYA 4P5TB 1GAFL 4IOIB 4CADB 3RUGB 2BY2A 4UQ3B 3O8XB 1I3UA 1NGQH 4WEBH 1U93A 5CKGA 4JAMA 5GRWA 3HCVB 1PG7X 3MRJB 3SE4C 4JGJA 4DK3A 4FQHB 1MIEH 4JZNA 4WJ5A 4WI2A 1D5XB 3DUHA 1S5HB 1H9VA 4UUJA 2Y07L 4KJPD 4KVNH 4RFOL 3MV11 3G5YA 3MC0A 3MGTB 3ECBB 4HHAA 1CGXA 3NABH 5CZVH 4ONFH 3EDEA 3WIHA 4P2QE 2AJYH 4JFEE 4G8GE 1UZ8B 1RJLA 3U9PH 1V7NH 5HYIA 3MUGA 3MR9A 4LHUB 2ARWA 1HSBA 4HQQH 3OQ3B 3ESUF 3VFNB 3D9AL 1EFXA 1KXTB 3A6BL 1CD0A 3QFDB 3BEWA 2ZCLL 3G5VB 4F9LA 5TGBA 1ZLWH 3MLSH 2XRAH 3SE8H 4P49A 3GBLA 4PP2B 3QDJE 3EDFA 4OLZH 4GS7C 1T0NB 5FK9B 3MNVB 4O02H 2HT4C 1F4HA 3HUJB 1BQLH 3T1FA 4JRYD 3KPOB 4GS7B 1JV5B 2CDGA 1B6DA 5DT1L 3MCLL 2BERA 1P7KA 3N1GC 4FXKB 5ADOH 2O5XL 4RGMB 4JPIB 2UUDK 1WGOA 3OG6B 2GJ6D 2J4WH 2XPGA 3BDBA 1KLGA 4GW4B 5D2LA 4XWGL 3RPIB 2VXTH 3L3IA 2QSCL 3SGJA 3CPLB 1PX3A 2VABA 3DMMA 2E9JA 1BVKA 2A0LC 2APFA 2YHGA 3H9SE 1X9QA 3J7HA 4JPIA 3RI5F 4FHBD 5C9JA 4M8VA 4MCZA 5DD6A 1W0WB 4O2EB 1LMKA 4KHXH 3BH9B 4GKSA 4DN3H 1I75A 1MRCL 2OS7A 2X41A 1R5VA 4S2SA 3TN0A 3WO4B 2Z4QB 2CXGA 2VABB 3BUYA 5MEPB 4Q2ZB 5KANI 3CFJB 4U3HA 1BEYH 5AG9A 2JCCB 4Y4FA 2VC2L 5F96L 4GQPH 3R4DA 1F90H 3CSGA 1AXIB 1K5NA 2UZIH 4U1MA 1X5XA 3P73A 4IMKA 4OZGF 4A6YA 4YDLB 1N4XL 2G60H 2NNAB 3GBNL 5D1QA 2DTMH 2C1PA 2D7NA 5DJ8B 1Z3GH 2ZUUA 5E5MA 3VXRA 2R1YA 5TFSH 1GHFH 2VAAA 1BREA 4YHOH 5EIIA 4AIZA 2A9NL 1CQKA 3T8XB 1EAJA 4NO0A 2Y5EA 5FK9A 5D70L 3GSRA 1VFOA 1FCCA 4YC2B 3RZCA 2CKBH 5TH2B 3GJFB 3BPLC 2W60A 5GGRA 3QUZC 2JE8A 4J3VA 4KVNL 3S5LB 1E6JH 2XIDA 2R4RH 3PL6A 4G6AC 1BZ9A 4PR5B 2EDTA 4HIXH 2NLJB 3O3EB 3D48R 3R06B 1AD0B 1DBJL 4EUPH 1QFHA 1I1CA 3K4AA 3SDYH 5F97E 1WFOA 1Q94B 3OGCB 4O51A 1IGTB 4Z7WE 4R4FH 3P3YA 4EXPX 1FIGL 1CR9L 3JV0A 1A1NB 3VFTA 4NDMB 1MY7A 1CE6B 2OSLB 1ONQB 5DD1H 4HXAH 4X4YA 5CEZL 5IIEB 4EBQH 1MRFH 2R1WA 3GKZA 5F72S 3KXFB 3QJHB 4JJ5B 3ARUA 4HPOL 3V5HA 2UYLA 1YNTA 4M6NH 3NFNB 3KYOA 4JO4H 5GZOC 4Y4FD 4G42B 2XN9D 3MRRA 3BGMB 3QIBA 1MHEB 1CD9B 3W82A 3WIFB 1DN0A 4E41E 2A9ML 4L4JA 3NMEA 2ATKA 1IGML 2JK5A 3RNQA 5ERWA 1SJHB 4YHPA 2PO6D 1PX4A 1RZJL 3CIQA 2HG5A 4IRJB 1BQHA 2A38A 2J1KA 4NQXA 3ULUF 3MLPA 2AEPL 3RVUD 1ITBB 4WTZA 4ODSL 2ZG3A 3KYOB 5L2JA 1J0HA 1W8OA 4LCUB 4Z0BL 5KVEH 1U8QA 1A6VH 2IG2H 1FBIH 4LDEB 4Y2OA 5JPMA 1C1EH 1QYGL 5EO0A 1U58A 4KV5F 5MEQB 3QUYA 3VRLF 3QCTH 2UY6A 4YAQB 4DCQA 2NY1D 5IJKC 3OPZL 2FHBA 3O6KL 5I15L 2W65B 3FHQA 3ILQD 4PJCB 3OKLB 5BZDA 3CVIH 4JKPL 5KVMC 1HDMB 3QWRA 3DURA 1KPVA 5D2NE 1DP0A 5IEKB 1LP9E 4GT7A 4PGZA 3MLYH 3F6IA 3CFDA 5LCVH 1RZ8A 1GC1H 3NPZB 1DQDH 1J87A 2JCCE 3DGGA 1HHKB 2H32H 3FQNA 2OJEA 1HQ4A 5C0IB 3ESVF 1N4XH 1QRND 1PG7H 1EAPA 2VITA 3C60B 3Q3GB 4XPTL 4Y4HD 2C3GA 3HE6C 2VLRD 4OCMC 3U46A 4U1NB 1KCLA 4WRLA 4L4VE 2MKWA 1I85A 1E6OL 3GIVA 3AREB 4P5MB 5IHUH 4IIQB 5E94A 4RQQB 3HE6B 4YHOL 4HCRH 3H3BC 3QDGD 2LU3A 4KRPC 4XRCB 3UAJD 5BRZA 3ILPB 5C0CE 1WEJL 3H9SD 3BAEL 1KIQA 5ALBL 4QT5B 1IAKA 1WIPA 5TE4L 3OR6B 2VIRA 1UM5L 5CCKL 4DZ8A 5J13B 4BQ8A 1C5BH 4KK9C 5IUSA 3RUGF 2AJXL 4LCYA 1RZ7L 2WIIA 1D7FA 2HT3D 3EAKA 2Y1VA 4RMWA 3CXHK 3QDMB 1CFBA 4NN7C 1XGRA 4F7EB 4EXKA 2B1AH 3QPXH 5JXAH 1SYVA 3BH9A 3DV4B 3Q2CA 3P9MA 1VKXB 4DN4L 5FKAB 2BJMH 1WZLA 4PJBA 4UB0L 5FECB 1XCQB 1AO7A 3TNMB 2RHEA 2WSKA 2CPCA 2F53D 2DN7A 1JPSL 3VH8G 3ABZA 4PJCA 3RTQD 3RVVC 3CPLA 1IC7L 5C09A 1M7XA 4KTDH 5F88A 4PJ5E 1KC5H 2D9QB 3P77A 3SKMB 5D71H 3OKOB 3QXAA 4I4WB 3UJIH 1RULH 3G5XB 1I7RA 4X8XA 4MNGB 1NAMH 2OQJA 4ONFL 1QBLH 2CD0A 1TQBB 3O6FC 4X99B 3UTTB 1U3HA 3U9PL 5ACLA 1RZJH 2A73A 3GGWB 1HCFX 3INUH 4PJFF 3O0RH 5JOFA 4PJIB 5DJ2A 4XI5D 3F58L 1IM3B 2AV1B 4U1NA 4PRPB 3DVIA 3O6FB 5AWNH 2ZJSH 1T7VA 4XNYH 5FDYA 2XN9B 2J8OA 1C1EL 3BKYL 5F1OB 3S7GA 3GGWA 2ESVB 3KXFD 5B38G 3B5TA 4LSQH 3V6OA 3D2UB 3RDTB 3RWJB 3BPNB 1IQWL 4OZHB 4L8BA 1A6ZA 1RZIA 2X1XR 4MAYB 2BSRA 3NZ8B 3HZYA 3HAEB 3LN5B 2CK0L 4MA8L 4G43A 3TPKA 5DQDH 1T03H 5D7IB 1YMHA 3ZSSA 3ZDYF 4XMLL 2YPVL 1E0OB 3TCLA 1K9TA 4F33B 3FRPG 4HUUB 1AGBB 1Y0LA 3DX6A 1NBVH 1BM3H 2BVUA 1FFNA 1RJCA 4XPTH 1S5IH 4RFNB 5E24E 4XWGH 2A6JB 1EO7A 2CGRH 3PL6B 1SYVB 3IT8D 4M3KB 3TJEH 1X44A 4MXWH 4GMSL 3D3VB 3UC0L 1F90L 5JHDE 3MRJA 1OQOA 2B39A 3H0TA 4NC1C 1W0VA 5JXEC 1FDLL 3TCLB 3QUMH 1INDL 4QTHA 3VDAA 4ETQA 1MRCH 1KT2A 2GTWA 1CGVA 5IBLC 1BJ1H 2EKSB 2VH5L 3VXSB 4RMUA 5CCKH 3RL2A 5DA0B 5FYJD 2R1WB 2BSSB 2GTZB 4Y5XB 1SY6A 4NGHL 4YH6A 5HYSB 2HTLD 4ZUTA 1BQSA 1I3RA 3BKJH 1LDPH 1OAZL 4LNRA 4O5LH 4XI5C 4JFOB 5FGBC 2EKSA 2HTKC 3QQNA 2R0ZL 1N2RB 1NAKL 3O6FD 1LEGB 2A6IB 1A0QH 3BD5A 4KQ4L 3IRZA 4PRPA 5ERWB 1GHFL 4OAWB 3LRSB 3AC0A 1J0JA 4YBQC 5H35A 1MH5B 5F9WC 4Y2DC 4IHOB 1CLZH 3L3GA 4HIXL 4LLVA 4XCCH 3BP4B 4U7MA 1J88A 1X5AA 5AZ2L 1OP3H 4YHYB 5ID1A 2IADA 5F1KC 3H9HA 1FZOA 2WBJB 3HZKA 2YOCA 4OFYD 5E6IA 5IG7B 4X5XA 1LP9A 5ISZA 4NUJB 3IJYB 5E6YA 2YK1H 4JN2A 4PJAA 4JFDA 4QRQB 5TDOA 2DD8L 1BVLA 1DVFC 1KLGB 1K3ZA 1HK6A 4APQD 5HYJD 2HLAA 3HG1D 3T4AB 5CSBA 4ISVA 1FL6B 4H1LB 1BP3B 1BX2B 1D5IL 4L4VA 3V5KB 3ULVF 4M6OH 3QUXC 5DJCA 1QQDB 4OUUB 5DD1L 4PJGA 5C2BL 1KNOB 4DVBB 1JTOA 1FORL 1KCVL 4NM4H 4UV4L 5HVFB 4YWGL 2E7LA 3GKWL 1IQWH 2CRYA 4PGCB 1Q8MA 3FB5B 4NHCH 12E8L 3GDBA 3IB4A 3WE6A 2AK1H 2QLVB 4OD1L 3O3BB 1T80A 1CICB 2FYYB 3HC3L 4HWEL 3VFRA 4NP4H 5I1GL 3TWCL 1MFEL 5EWIL 2NTFA 4IRSB 4P3DA 3O6KH 2IFFL 3OAZH 1UENA 1UJ3C 1S9KC 1M6OA 1NCCH 1FNGA 1NL0L 3HS0A 4JY6A 1G6RB 3UDWA 1M7IA 3N1QC 2VQ1B 5C0CB 4HJ0C 1B4JL 3JWOC 1UKSA 3IDMB 3LPFA 2EECA 3T2PA 2HA1A 4ODHH 5FUZH 1ES0B 4OZ4B 3P0YL 3V5DA 3RY6A 1IGFL 1G84A 2UZYB 3DX7A 5C0BA 3HMWL 3MV8A 4OCRL 3F7QA 3MLUL 4MX7B 3LB6C 2DBLL 4NO2A 3ZKQD 3VXMA 3NCFB 2OBGA 4P2YA 1DUYA 3SDAC 2H9GB 3S5LA 3UP1A 3STZB 4FQ1L 5T1LB 3ZYJA 3QDGE 4M1GL 5EO1B 2NPLX 3BYYA 1I8LA 3I6KB 4EOWL 4PJCF 2NY0C 2YD9A 3QAZC 3D0LB 1RHHA 1BBDL 1NFIB 1TLKA 3SE4A 1I3VA 4NO5A 4EIGB 4RRPA 5K9OB 5D5ME 4PP2A 3V9FA 4MVBC 1OW0C 4Q0XL 4KC3B 4JREB 3STZA 3NCJL 4C83A 5EBGA 1ODAA 3C8HA 6FABH 5FOJA 3ZMRA 1A4KA 2Z93B 4NJAH 4OI7A 4MJIA 2ITCB 4HUNB 2E7LC 3MV7B 4TSAL 1BFSA 1C5BL 1ZHLA 2BMKB 4O9HL 4KTEH 4M1DL 3H7BA 1BD2B 1MFNA 2EIZA 5D6DA 4WHDA 4YQXL 1IM9D 1BGXL 4K8RD 4L29B 4R0LA 3O3UN 4PJHE 3V6OE 1JHTB 3VG0H 1R24A 3UAJC 3MRIB 2EE2A 2BVTA 4MYWB 4I0PA 1YEIH 5EC2A 2ZNXA 1YEFH 3RP1A 1AGEA 1X5YA 3UTPD 2GJ6E 4OF0A 5D7LB 1K8IA 1I9IL 4K7PY 3H9SA 5JHLH 1NUFA 3X14A 1UADC 3FRPA 5IGXH 5D2LF 4MNQB 1BQHG 3GM8A 4MB3A 1U8JA 5CBAB 1FVEB 2EEAA 5DVNA 1JNNL 4BSVA 3DV6A 4MJ5A 4BFIA 3TFKD 5FCUH 4G6AD 3RPIA 1JI1A 3D39B 2EDXA 4P59H 2C3XA 5A40E 1R5IB 1FYHB 2V2XB 5IVXE 5DHVA 5KSBB 5CP3A 3DHMA 2BSSA 4HS8L 1KELL 1F2QA 4OQTA 5KW9L 5EU5B 2WBKA 1VA9A 2LU7A 1CFSB 3TCXA 4XHJD 5HHPA 3WLWC 3G08A 3QWQB 4LBEA 4XNMB 2J2ZA 1J8HB 5DF0A 2PTTA 3BX7C 1RURL 2LQRA 3TWCH 1WTGT 3DMMD 5J1TC 3IJYA 3H9YA 4Y0GA 3T8XA 1FLTX 3ZKXC 4RGOL 3U4AA 4NQCA 3RVUC 5HDBE 3F8UB 4P4KB 3NCMA 4FFWD 1FLRL 2WINB 2PYFA 4C4KT 1X5JA 4NRXA 2QSVA