2YWYA

Structure of new antigen receptor variable domain from sharks
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
AWVDQTPRSVTKETGESLTINCALKNAADDLERTDWYRTTLGSTNEQKISIGGRYVETVNKGSKSFSLRIRDLRVEDSGTYKCGAYFSDAMSNYSYPIPGEKGAGTVLTVKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords new antigen receptor variable domain
publication title Shark IgNAR antibody mimotopes target a murine immunoglobulin through extended CDR3 loop structures
pubmed doi rcsb
source organism Orectolobus maculatus
total genus 26
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ywyA00
3HG1E 1L6ZA 4YAQB 2NCMA 2NY4B 2R0WH 3ULUC 1SYSA 2Z9TA 3QPXL 1VGEH 4TPRL 5FHBH 1JCKA 5DMGC 4PJ8A 1ZLVH 4Z78B 1KIRB 1RUML 1T4KB 2KH2B 5F6HJ 4DN3L 3QHFL 3LRGA 2F54E 5A2KH 4HHAB 2GTWB 4HKJB 3MV01 4U1GC 3P4MB 3ZZ1A 2AK4A 4Y2DA 4F37K 1IARB 2ZKHL 5DSCB 1II4E 3DARA 3DVNB 4XVTH 4O5LH 4OM1H 1NGPL 1UJ3C 1V5JA 2C4XA 5AD0B 5FFLA 3S96B 4LLDB 4NQCE 1TZIA 1BVZA 3L7EB 3DVIA 4P57A 5F88A 2ESVA 1HHHA 4MJ5B 1JNLH 3QA3A 4P2OD 2DKUA 1BVLB 3IFLL 1QRNB 1FCGA 3K80A 1JN6A 5C0EB 4X5XB 5IEKA 4J3VA 3ARFA 5TE4L 3M45A 1I7ZA 1I7UA 3RUGF 3P3YA 4PREB 4FQXA 4HLZG 5ACMA 1HOCB 5C0GA 2FD6L 2OJEB 3LPFA 2BNQE 1AGDA 1XGPA 2R1YB 3TT3H 3WHXA 3B9KA 4MJIA 1KV3A 3RZCD 2LAGB 1G7PB 4M6OL 1XF2B 2ZSWB 2RFXB 2DAVA 3W11C 3HE6C 2HAZA 3BGMB 2HJLA 4RX4A 3MV8B 4YX2H 5EBLA 3O3BB 1YJDH 5E7BA 3I85A 4MYWB 3WL9A 3OAZH 2X1WL 4I2XE 3VG0H 4LSRL 5SX4H 4IOIA 4RBPH 3V8OA 4Q6YA 1BOYA 3VFSA 5F7DB 1T3FB 4P46C 4K2UH 5FF6B 3U1SH 4JKKA 4HAFA 5IROC 4ZNEA 1U3HA 3L3DA 5JIIA 4N5ED 1T83C 4S1RL 3DROA 1OAQH 1MCSA 1ITCA 3TGXA 5D7LE 5T33H 1U8PA 4L29B 5E9DB 2H2SD 3IFPA 4QOKE 5HI4C 2CDGA 1B4JH 4AQ1B 5C0CA 3NTCL 1I85A 5KSVB 4JO2H 3FQNB 5JMRA 4Q2ZA 2V5YA 1URLA 3CVIL 4OZHB 1V3LA 1RJCA 5IG7A 3S34L 5F1NB 2Y07L 5MENA 4PJ9D 3VWJA 5ESQA 4M1DH 1CD1B 4WFED 4R2GC 3ARTA 4JJ5A 4YHZL 1S7VA 4J6RH 5CJOH 3KPMB 4K9EH 5KOVC 4PJIA 3MGOA 5IKCA 1OGTB 2RQ8A 4KI5E 2C7UB 2ADJA 2NY4D 3KHOA 5DUPH 2IWGA 4OLWH 2AP2A 5I66B 4I5BB 2V5RA 2VO5A 3N1MC 4JM2A 4ORZC 3WXVL 3E6HB 4X6DB 2MTPA 4QRTA 3UC0L 2D03H 3FRPG 4D0BA 5T3XE 3MRFA 4MNHA 1RJYB 5JW4Q 4ENEC 1A7OH 1NAML 4Q9CA 2VL4A 2EDDA 2AJZA 4NQDB 1G7HA 3CVHL 4C83B 3REWB 1CFTB 1HH9B 2YPVH 4JQXA 2NY0B 3WSQH 1ES0B 1KLFA 2BX5A 4G7VH 4M4RA 1RQ5A 1I3UA 3OAUL 3GSVB 2YKLL 3QDJA 1T66C 1ZS8A 4NDMB 1QRND 4PJGE 4OJFL 1I1FA 4WTZG 1F6FB 2WQ8A 3VXRA 1WWWX 2V5TA 1CDHA 2Y9RT 2FLBT 4JO3H 4P4KA 3O6FC 2IH1B 2P7TB 4P48A 5EUOF 1Q1JH 5BS0A 5ICXB 35C8H 4FTVA 1DUYB 4JFPB 4X7EC 3O41A 1KIUA 5FA4A 4UU9A 2WWMD 3WFBL 1F4YL 1P1ZB 3M07A 3F7QA 3T77B 2J1KA 2WP3T 4MX7A 4TULL 3LS4H 5DRXB 5TH2B 5H94A 3MV8D 4BFIB 1JNNL 2XQBL 2O5XH 2JLLA 1GGTA 1RZIA 1X5IA 1BQHB 4RGNE 3SDDB 1CGWA 5ERWB 1K3ZA 2HVKA 4L5FL 2D7TL 1HN1A 3GEWB 3QFDB 1KCSL 1SJEA 5E94B 4UB0L 4RAVA 5J13C 3CLEH 5EIIB 3V6OE 3V5DA 1WFUA 3N9GL 5IK3A 5HHNA 1JZ4A 1OLZA 2MPAL 2R29L 4OQTH 4ZPVA 5E9DD 5GS1C 3HUJA 1A6WH 3L3HA 4Y19B 2ITDA 1A14H 1M6OA 1KULA 3MLPA 3MREB 4L9LC 3QFJB 4LHQB 1Q9LB 3C60C 3C5JB 3P4OB 5CCKH 5SWQB 5F8RC 3MROB 1LHZA 4JFEA 3Q6FB 2YHGA 4NC1C 2AV7B 4X6EA 3BP4A 1U92A 4ZD3H 1LEIA 1KUMA 5IFHH 1Z3GH 1K6QH 5DD5L 2AQ1A 3I84A 1U8IB 3S6CA 3MSPA 3QEHA 1R3HB 3KDMA 4XZUB 4G6JL 3TH4T 4LQ1A 4NYLB 1KNOA 2VDQL 1CDYA 3KLDA 5E2TL 3LY6A 3MRJA 3VFGL 5JUEH 4OUUB 2QHLA 2QQKL 3KPTA 3EO0A 3WUWB 2A77L 4YEEA 4K23H 2R4SH 1K5NB 1S7WA 4JCMA 1IC5H 5C6TH 3S37X 5CEZE 3GSOA 4NQDD 3H9HB 2OZ4A 3O9WA 3QXUA 3WXWH 4OCLC 3E6FA 2NY0D 4HMEA 3IFNL 4BH7B 2BVQA 2ERJB 5EC1A 5EBMB 3U7YH 3STLB 1JWUA 4OCYH 4OZFG 3G5YB 5A16B 5DT1H 3S37L 1UB5B 5FB8B 1MIML 2HKFL 4HUKB 5D2LA 4DN4L 1T0MB 1IILE 2V2WA 1EJOL 5DFWH 4XP5L 5ENWA 3O8XA 2FB4H 2YD1A 1DN0B 4W6YB 1RHFA 4XWOC 5DR5L 2J3SA 3MBXH 3U4AA 5IHZB 4H8WH 3GBLA 2WANA 3TPKA 1NGQH 5CBAB 1GIGH 3UTSB 3SDDD 3E0GA 2HH0L 3B5TA 4NRXB 3BP7A 1F3JA 4X99B 1JZ5A 1JHTB 4UIMA 2GTZB 4ONHA 5CLWA 2AKRB 4R8WL 4KAQH 3MRNB 2XZAH 3BYYA 1MHHB 4HFWA 5TQ0H 1J05B 5DC0A 3C5ZB 2HT2C 4P4RB 3VGAB 4NZRL 1AY1H 1JGLL 1YNLL 2H3NB 1IQDB 2A9MH 3D9AH 1MAJA 4PJBB 2X4SA 4HUVB 2HLFC 5EIQA 2OYPA 4K3HA 3TYGL 4Y19D 2Y23A 3CSYA 1NC4A 4PJ7E 4LDLB 1IM3A 2X4TB 3CXHJ 3QFJD 1RK1A 5IQ7L 4XP4H 1F4WL 1NC2B 3IVKB 3BDXA 5DRNB 5DS8B 1FORH 3EOTH 3EO9L 2PTVA 1HWGB 4HPOL 5IW3A 1CTOA 2Z8WC 5AG9A 5FGCE 2MHAB 4PRNA 4D9QD 3VH8G 2I26N 1JV5A 3MRQB 1MCQA 4P2RA 4IHOB 4DUWA 4X0KA 1KEGL 3C6SB 2GJZB 5GS0L 1OD7A 3HPLA 2FR4A 4XB7A 2Q20A 1QFWH 4EN3A 3O2WH 4JO4L 1MIEL 4NN5B 3CFCH 1H0DB 1XF5A 4PV8B 2ZSVB 4IRSB 3MYJB 3D5OF 1JVKA 1S78D 4OZ4B 1XZ0B 2A6IB 3TNNB 2NYYD 3M1BB 2EKSA 1H5BC 5DMKB 1EA9C 3GI9L 4IDJL 2X4RA 4OB5H 2VL5B 1MFAH 1Z9SA 1FVDA 4Z0BL 4AL8H 4CJ1A 2H32H 1MCIA 1UQSB 3UJTH 3J7HA 1HDMB 4UOJA 1SM3H 4XPFL 4LPUA 1NCBL 5LAXA 1D9KB 3ZKXB 5T3ZE 1RUPL 4NJAL 1UWEH 1QUNA 2WUCL 3L5WB 1W72A 5IWLA 4TSBL 1HILA 2CRZA 3MXVL 5KW9H 4YHOH 5IW1B 1QHOA 4JFDA 1CE1H 4QRUB 2PCPA 4RMUA 1IGIL 2X4OA 4ZXBA 2VDKH 5KSBB 1DQLL 3QO0B 4XNQA 1AHWA 1BLNA 2VSCA 3QDAA 3EYSH 1OPGH 5F9WC 4KKBD 1BIIB 3I6KA 1A6PA 1E27B 4WTWA 1QO3A 5D96C 1YY8A 4PV9B 4R7NB 1NUFA 4POUB 1NFKA 2C3VA 3BZEA 4TVPH 3GSWB 2BJMH 5C0ND 3UTSD 5BVPL 3D69A 3NACL 3VFPA 3TBVB 3TO4B 2CIKA 5DQJA 4DVRL 2OR8A 2VWEE 3SDCC 2FGWL 3QUYC 1SYSB 2CO6B 3Q5YA 1RVFH 3C5ZD 3HI5L 4QT5B 3U0WL 4Z95H 4ODSL 4PJ8B 3C09C 3QB7C 5CGTA 4Y4FB 4YDJA 4KUZL 5GRYA 5MERB 3RI5K 3KLHD 1SJHA 4RFEA 5DFVC 2AK4B 4IJ3C 1QQDA 2AJSH 3HLAB 3ZSSA 4NHUA 3HMXA 1NC2D 3OB0K 4IEFB 1HCVA 4WO4C 1QPXA 3DRQA 3X14A 4MD5A 1OGAE 3QSKB 3VXME 1Z9LA 3BZDA 1G9MC 4P57B 5F88B 3VWKB 4UAOB 2ESVB 3OSKA 5I1CL 1HHHB 1CXLA 3QA3B 1ZHBA 1CZ8H 5DUMH 1A7RL 1CICA 1FJ1A 1K4DB 3GKWH 4QHNA 3IFOA 1CR9L 3W0WE 1JN6B 2W9EH 4LF3B 5IEKB 3O4OC 1BJ1H 3HI6L 3ARFB 4D3CL 4XNMA 1I7ZB 2IPTL 2MMXA 4Z18A 2ICEA 4FQXB 2EEDA 1P7KA 1ADQA 4XP6L 3GSNL 4W6XB 1KCKA 1RZ7L 4IRSD 4KZEH 5TPWL 4LCYB 5I75B 3B9KB 4MJIB 3U7AA 5K9QI 5D2NA 4LASL 4F9PC 2OMNA 4PTTA 3WLBB 3ZHLA 4OF8A 2J88H 2HJLB 4KPHL 5DLML 5EBLB 5EOCJ 4ZUSA 2ICWI 1A3QA 1C5DA 3HG1B 4K94C 1AQDA 2VABA 1QVOA 4ODXA 1QLEL 2VQUA 2XRAH 1MPAH 1D9KD 1B88A 4Z7WE 4C56A 1KSRA 4O02H 2QSVA 4O2EA 1T2QH 2EDFA 4WNQA 4TNWK 1P4BH 1BFSA 2W65A 3GMNA 1EO7A 2UVEA 4HIHA 5DJYB 5L2KA 5D6DA 1U3HB 3B9VA 5L8JB 2HFTA 3GNMH 3DROB 3CFDB 1HIML 3RGVC 1AGCA 2E7CA 5LQBH 1U8PB 4GW4B 5SWSA 2I9TA 3V7AG 5E8DH 1LK3H 3RWDA 1PQZA 3JUZA 1INQA 1MFEL 4JB9H 5EU7C 4GRLA 1QR4A 4NQCB 5IB5A 3UPCA 2J5LC 4CAGA 5J11B 2WBKA 4W70A 5C0CB 4JFQB 5C86A 4XHQA 4Q2ZB 2XG4A 3U46B 4EUPH 4ORGA 1FZMA 1QRKA 5FHAH 3CFEA 4GOSA 5EBWA 5IG7B 1QLRA 1JRHL 2EZ0C 3AS0A 3VWJB 1YN7A 5ESQB 1LO2L 1A9BA 1KLGA 1WZKA 2VRAA 5HBBA 1W72L 2V5MA 1FPTH 2XACC 3TO4D 1FAIH 4XX1G 4OCMC 5I8OH 1MAMH 4JO1H 4PJIB 5IKCB 1DBML 1A1MA 2ADJB 2BNQB 1MCEA 4AK1A 2X42A 1IKNC 4YDIH 1CK0L 3FTGA 4PJ8D 1VENA 1RMFH 4Y4FD 1FL5B 1IGJA 4JM2B 4QRTB 5MHSD 4MQXC 2B1HH 4JDVA 3LQAH 4AJ0A 5JORA 4D0BB 1Y6NR 4AH2A 3H9SE 4XAWH 4M7ZC 2AK4D 5L2JA 2GSIB 2YRZA 1BP3B 3X3GL 3DX6A 4G5ZH 3LKPB 1BEYL 1WLHA 4GLRH 4DKEL 1G7HB 2WINB 1SY6H 3F7VB 3KPQA 4YIQA 3VWKD 2ESVD 1FVEA 4U49A 4U1LB 4KMLB 1ZS8B 2YK1H 5D7LB 1ZA3A 1I1FB 3VGFA 3W39A 4C4KT 5F6IB 3VXRB 3DMMA 4APQC 4I3SH 5DO2C 2NY5L 4P4KB 3QUMB 3ARFD 3S4SA 4OV6F 2EIEA 1PG7H 4R6UA 2OR7A 4TTDC 4FQXD 5BS0B 1M7XA 3IKCB 2DI7A 3QNZA 4FTVB 3MV7E 3OL2A 4XNZC 2UWEA 4UU9B 5FA4B 5D70L 3B9KD 4M1CC 4MJID 3HMXL 1INEL 1CFVH 3QNXA 2FEEI 2VJXA 4MX7B 5E00A 1B2WL 4OF3A 2EDOA 3C2AL 4G6KL 1T0PB 5FDYA 4RX4D 2G60L 4WW2B 3EOYG 3I6LD 2APBA 3IJHA 3UBXA 4GG6A 3MZGB 1KXQE 4PUBL 3HG1D 4U2ZA 1N5YL 4PJHE 4YC2B 2HVKB 4OFPA 4M7LL 1QSEA 5HY9A 5J89A 1G7JA 1CF8H 3UJJH 5I15H 2NR6D 1ADQL 4XTRC 1U3HD 5IJVA 2ZUWA 1MCWW 1F8TL 5IVZA 4LLUA 4O9HH 4MNQA 3V5DB 1TQCB 4X9BA 4K71B 5HHNB 2YD8A 1HHJA 1EHAA 5KZCB 5IB4A 3QXDA 1UVQB 1MREL 3HUJB 3L3HB 4PJEF 1U8LB 4NQCD 3G6JF 1M6OB 4MD0B 4OCWH 2FO4A 1L9NA 5C0CD 1MJ8H 1HHKA 4HWUA 3ULVF 3F7PC 5GQBA 4FFVD 2EICA 4JFEB 5DC4B 5HXMA 1KELH 2EDTA 2DWDB 5MP6L 4PJGB 3BP4B 1U92B 4ZUVA 3ZTNH 5J6GB 5JMOC 5FYKE 5IUSA 2ZJSL 3VWJD 3QWRD 3AS2A 4LEXL 4JDTL 2R0ZL 1YEFH 4G8GE 4P59H 4C55A 5BZWA 3DV6B 3QXWA 5DMYA 1XCTA 4U33A 1QSFA 2BNQD 1DR9A 3KJ4B 3FB8A 1KNOB 3MRJB 3NN8A 1TQBB 1IL1A 1PDKA 2DQGH 4JM2D 1B90A 3BJ91 2UV3A 4YBHA 1JF1A 4XCFH 1DLHA 2PXYA 1N0LA 1EMTL 4X7SL 5EO9A 3K2UH 4RQQA 1XGTA 1S7WB 4RGNB 3QCUH 3C87A 1DE4A 1PVHA 2DLTA 4HEPG 5CEYA 4X9GA 1TJIL 2H26B 3GFUA 4L1HA 5CGYC 1T0NA 1RUQH 4CN1A 4NKMA 5I73B 4X7DC 2W1NA 2ZPKL 5EC1B 1QLFA 2W9DH 5GRVL 3ALXA 5D7LD 4QRPA 1FO0A 4TSAL 3VXRD 2AEPL 5DJAB 4K3GA 4HUUA 4HIJA 4D9LL 4QOKD 4P4KD 4N0YH 3LB6C 2I60H 5BS0D 5E1AB 2DRUA 5JQHC 1LDSA 1RJLA 1IAIL 1H3WM 4FTVD 5D2LB 5T1DH 1LE9A 4OLUL 2VDPH 5ENWB 5DK2A 4FRWA 3O8XB 5E08H 3QWOB 4X4MA 1CDJA 4B7IA 5CHNA 4LCUA 4YNYA 4M7JL 1QYGL 3DXAE 1BX2A 2BOBA 5D5MF 4LAQL 1YEEH 4XXDA 2VXUH 4Z7VE 5C0AE 5AZ2L 5E2WH 2X1QA 1OAYH 3LEVL 4KRLB 4QRRE 5FUZL 3LKQA 3L95A 1WTGT 3WN5B 2HWZH 5ITBH 4ONHB 4UTBH 2DQDH 4EKXA 1SVCP 5J12B 3D6GA 3UTZA 4WUUA 1VPOL 2R9HD 3KWWB 5T3XD 4PLJD 4NZUH 5GS0D 5D71L 1JMXA 2BXZA 5KZCD 4XPAL 3U48A 4LSUH 5LBSH 2X4SB 1LD9A 4FQ2L 3ULUE 3DO3A 5ETUB 3CSYB 1NC4B 1KN4H 1IM3B 4RGOL 2AJXL 5SV3A 4JN2A 4JZNB 4JFED 4CU7A 2HRPL 3L9RA 1RULH 4NGHH 2YBRA 4BZ1H 5I1HH 3B9DA 4G80A 3IJSB 1CDUA 4BQBA 1E6OH 2B0SL 1EAJA 4YBLC 4PRNB 4R0LC 2WK2A 4KY1L 4X0KB 3BOVA 3UO1H 3HPLB 3EKCA 3LZFH 2DJUA 4P9MH 3ZTJH 2FR4B 4EN3B 1WEJH 4J8RA 4XVJL 2J8OA 1BZ9A 4S11A 3V4VH 1GXEA 2I9LA 1NGXA 4FZ8L 1WBXA 3ET9F 4MQ7B 1IT9H 4RGND 2AEQH 2NW2A 2X4RB 4UBDC 4IRZH 4JKLA 4M43H 1RD6A 3GSQA 1CG9A 32C2A 1LO0H 2VDRL 3BQUC 4XWGH 1MRFL 5LAXB 5ADPL 4LVHB 3U30C 2DDQH 3Q3GA 2YMXL 2BFVL 2Y4SA 3QUMH 1EX0A 2XA3A 2CR3A 3IDYB 4HQQL 1IEHA 1HILB 2AV1A 1GPOL 3BMVA 2X4NB 3JWOL 4HUXB 1JPTH 4JFDB 2PCPB 1FIEA 3LIZL 3MLSH 5EO1B 2X4OB 4Z7QE 4ZXBB 4M48L 4XNQB 1AHWB 1BLNB 3O8XD 5GRVK 1G7MA 1CS6A 4BFBD 3TA3C 4JREC 4CN4A 3I6KB 1DVFC 1XF3A 4R4FH 1QO3B 1YYLH 2R1WB 2NX5E 2OTWB 5FGCB 2E27L 3D25A 2C3VB 4YDKL 3BZEB 3CFIC 4L8CB 3P9LB 3S7GA 1U8MB 5JR1L 4ZAKA 3D69B 1FO0L 4U1NA 1T89C 3QIWC 1A9EA 2A83A 2CIKB 3GMPA 5D6CA 5DQJB 4JHAH 4G9DA 4BA8A 1FIGH 1QFWI 3G6DH 4YUEH 3ZKMC 3NCYS 4UT7H 3DVGA 4YDJB 3V4PL 1OF2B 1UWGH 2Z35B 3TBSA 5CEZD 4KRMB 5E2UL 5DD1L 4HPYL 3QO1A 5H35B 1NC4D 1I9IL 1SJHB 4RFEB 1N6VA 1MCWM 1NSNL 4GKOA 1KCRL 1S7UA 3HE6A 4QNPF 2XA8H 2JE8A 4R3SA 1TJHL 3PHOA 3F6IA 4MD5B 1M4KA 3KHQA 5C09A 3X14B 2Z8SA 5FM8A 4KTEH 3VXPA 5L6YL 5JXEC 3EGSA 3ZDZE 4WV1C 5FM5M 4EI5C 3HFMH 5JA8B 4GG8B 1GGYA 4P46A 5I1IL 1CICB 1FJ1B 4QHNB 1A4KA 1GAFH 4NN6B 4HAGA 4LPTA 1WICA 4JZJA 4GT7A 5IROA 1JGUL 2DQEL 4LFHD 4EN3D 4XNMB 3KXFE 5E24E 2DM2A 3MFGB 3VRIA 1T83A 3M17A 2WUBH 2ICEB 1P7KB 2R2EA 2PYEE 2WW8A 1IC4L 3WFDL 1QOKA 4ZMAT 43C9A 3RU8L 4M02A 1TPXC 3V4UL 2F58H 4V1DA 1EGJL 1UM5H 5DRWB 5D2NB 4KK8D 5C07A 1ZLWK 2W0FA 4PTTB 3SJVE 3H3PH 4XPTL 3TH2T 5HVHB 3MLVL 2D2OA 5BV7B 4ZUSB 3VD7A 3MACH 1C5DB 4YO0A 1AQDB 3PQYA 2VABB 1QVOB 4ODXB 3SDXF 4WHTA 4ODVL 5ID1A 4KRPB 1IAKA 3AB0C 4H20H 4O2EB 3DX8B 4WNQB 3GSRA 4Y5YC 2W65B 5L2KB 3KPSA 4HIHB 3SQOL 2A6DA 3NCFB 1EVTC 3DBXB 5DF0A 5E1HB 3PWPE 3DUSA 4PP1D 1AGCB 4JFDD 1WAAE 5EORL 3WE6B 2I9TB 1HWHB 1CGSH 5TJWK 2Q3ZA 4ZXBD 3D3VE 3BKYL 1OGAB 4GRLB 2ATKA 5IB5B 4H5SA 3L6FA 1A7BA 2RCSL 4RWYL 5CJ5A 2CUHA 2J6EH 5D7JC 3HAEH 5KVMC 3BIKB 4ORGB 4KK6D 1J8HA 3CFEB 1QLRB 3W0WB 5DEFB 1KLGB 1ERNA 3TEUA 2FSEA 4OLZL 3RUGA 4Y88A 1YJDC 1YEKH 1A1MB 4DGVL 4PLKD 3FOMA 3O6FA 3P11L 5HHOE 5CEZH 1RPQA 1L0YA 1IGJB 2ADIA 2UVFA 3H3KA 2EDJA 1X5HA 3V5HA 1VDGA 5DK3A 3GHEH 5IR1A 3DHJA 4AH2B 1G9EA 4RMTA 3G08B 1F6AA 3DX9A 5L2JB 1C5BH 3R1GL 5IQ9A 1B0GB 2P24B 2JCCE 3GRWA 2AJVL 2OTUA 5T3ZD 2JJSC 4HK0A 4Z7WB 5C8JB 5AYUH 3FRPA 4QXUL 4NO3B 1LDPL 4NC2B 3ECBB 4QYOA 2XKNA 5DJDA 3KPQB 4YIQB 2FDBP 3L7FB 3WO3B 2A0LC 4H1LB 4LSTH 4OM0L 4YHLH 3ZO0A 2QKIB 1CICD 4JZOB 5C0RH 2Z92B 4F7TA 3IAGC 3HNSH 1PBYA 1Q0YL 3OAYK 4EJ1C 5JO5A 4YGVB 3CC5B 3GMRA 3QNZB 4EDWH 4K9EC 4JVWA 1CIUA 3BAEH 5GS1A 3UX9B 3QNXB 5E00B 2CGRH 4L9LA 5DDHB 3C60A 2ITCB 4LDOB 2R0KH 3STZA 5CAYB 3QUXB 3DSFH 3WCYA 3MJ6A 5I71B 3IJHB 4KZDH 1EO8H 1XFPA 1OAZL 4GH7B 4FNLH 1T1YA 3QBTB 4XNXL 4XAKE 2E9JA 2NY3B 3RGHA 3QCVL 3QDME 3A6BH 4KRPD 3GJFA 3EYVB 2C3WA 1QSEB 1N8ZB 4KFZC 1B4RA 4P2OC 1G7JB 5L2KD 1P7HL 2B1AL 1Q9KA 5IJVB 3OKEB 3A6CL 2SEBB 2VR9A 4MNQB 1ED3B 1HHJB 2WV3A 4PRHA 2CMRL 3R0MA 3JSSA 4ZS6D 3AROA 2IGFH 4TYUA 2ZG2A 1OGAD 4GRLD 5JHDE 1KB5H 3WIFA 4G6MH 3MOQA 3BJLA 3LRHA 2WAHA 3MLZL 1D5ZB 1HHKB 5A3ID 4LSVH 4ALAL 1JBJA 5IB1A 5I9QC 3PWUA 2XPGA 4ZUVB 3PGFH 3RNKB 4RGMC 4XCCL 1N6QL 3W0WD 4YZFF 4HT1L 1MQKH 3FAWA 5FO8B 4XC3H 5E5UB 4J12A 1IAOA 1S7QA 1UEMA 3CPLA 3WIIL 5EUOA 1KFAH 3B5HA 1JZ7A 1XCTB 3MV7B 3FO2A 4YHYC 3VMNA 4IMKC 3FB8B 1WBYB 3NN8B 5C0FA 3RVUD 1IL1B 1WWBX 3RTQC 5FGBC 3HPJA 3VRJA 1DLHB 2PXYB 4HUNB 4UILH 5EO9B 3G9AB 5GISL 5T3ZH 4NN7B 5IEHA 1LILA 1DE4B 1W0VA 5KVGH 2FBJH 4NRZA 5CEYB 4AYFA 2F5BH 2RHEA 1T0NB 4NKMB 1CD0A 5TFSL 1OAXH 1MCBA 2ZCLL 4S10A 4CJ0A 3RWGA 4M8QA 2J2ZA 1A0QL 1BAFH 1RU9H 2IALB 5FUCE 4LBEB 5ITFA 1FSKC 4HUUB 1HQRA 4HIJB 3S3PA 4OZHF 2BY3A 2DD8L 4YHML 5EZIH 1CN4A 3MRGB 4Y8AA 1RJLB 2R56H 4Z77A 2FJGA 3CAFA 1VKXA 4OIAA 3RVXD 3D18A 3K1DA 4HS6A 3QRGH 4R96A 3GRWL 3T0EE 5ILTL 5EOQH 2Y7QB 3SKMA 3OXSB 1C08A 4KVCL 3UTQB 3LSOA 2VXQL 3B3IA 5BW7C 5BV7H 4YNYB 4G6FB 1FYTA 2VLKE 4KJYA 3T2QA 3NZHH 3G5VA 3QUXD 2BOBB 3O6ML 4J7RA 3WO4C 3ZL4H 4G8GB 4X6DF 2F19H 4YK4C 1WWCA 3TPUA 4ESKA 1RZFH 5KANG 4EBQL 2QSQA 2NY3D 3GMQA 1Z2KA 3LKQB 3TVMC 3L95B 1QSED 4JPVH 5AZEL 2CLRB 1U95A 1FLTX 2JJVA 4KROB 4OKVA 4WUUB 3UTZB 1T1ZA 3W9EB 1BD2E 1DBKL 3MLXH 3SOBH 2Z31B 3NAAL 4MNQD 3F5WA 1KIQA 3DIFB 1TVBA 3WJJC 1N7ML 1LEGA 3DI2B 1OW0C 1YMMA 1LD9B 4P5KA 3ELAT 2JJUA 1HNGA 1KOAA 2I07A 5H37G 2BDNH 2VAAA 4HWZA 3CXHK 5FCSH 2FRGP 5D1QC 4FQJH 1E4XL 4O4YH 3OR7A 1H5BA 2NLJA 1TCRA 2J8UE 4PGEB 2ZCHL 1CFQA 1CXKA 2UZXB 2VZSA 2QBWA 1JYVA 5BCAA 4XNYH 3L9RB 4PJXE 2EE3A 4JQIH 4L8BA 4DZ8B 1X9QA 3HC4L 2ZUQC 3QZWG 1YQVH 2VKWA 3RX8A 3N1FC 1I3VA 3SO3B 4H8WC 2QSCH 2AJ3B 3B2UD 2QADC 2C26A 3RVTC 5BO1H 3LKSA 4MVBC 3GB7B 4M62L 1C8PA 4N0UA 3S3JA 3MV7D 3N1GC 5C2BH 2HRLA 4RDQF 1BZ9B 2AQ2A 5EOCL 4X8XA 1KJVA 1XGRA 1LO4L 4MSWA 5BRZA 1ZAGA 3SHSA 1NGXB 1BQLL 2PXYD 1IGMH 3WD5H 4U1SA 1WBXB 4X80H 1R3JB 4Z7VB 5C0AB 5I8CA 3L5JA 1G6RA 4N0FA 4QRRB 1I8LC 5HGHA 4XRCA 4H1LH 4LEOA 3VMOA 1CG9B 3AC0A 4IOFC 3OWEA 4U1IA 3KNBB 3TM6A 3SKUD 3B6SA 1EVUA 1J1PH 4MXVE 1BZQK 2VXSH 3Q3GB 3JV0A 3FMGL 5I30L 4GRMB 4PR5A 3SDCA 3K4ZA 3QUYA 2OK0L 3FQUA 1EV2E 3CLFH 2GJJA 4ZSOE 1KCUH 2BSRB 3NIGF 3OJVC 4L3EA 4OZIE 1HQ4A 4BUHA 2CRIA 4Y8DC 1MRCL 4U1GB 5KS9A 4RFOL 2P1YA 3IDGA 1TJGH 2EDLA 2JKXA 2PNDA 4G6FD 2EC9U 1LEKA 1UJ3B 4E41E 1AO7E 1PSKH 3D25B 4G8GD 3EJYD 1JE6A 4GKZB 5ACLA 2V2TA 5LGHL 1FLRH 1J1XL 4XBPA 2X40A 5HGAA 4U1NB 1HKLH 5LGKA 5D6CB 1UADC 3FQRA 3GMPB 3RWHB 2Q7NA 3O11A 4B53A 3UTOA 5HYIA 4KROD 4G9DB 4WUUD 2XTJE 3UZVB 4LLVA 1Q38A 1A1OA 2Z31D 2XY2A 2PR4L 2UUDH 2I5YL 3DVGB 4GJTB 2OSLA 3N85L 3TBSB 1JWMA 1JPSH 3R4DA 4NBYB 5IMKA 3O2DH 2EH8H 3DRTB 4X8JA 4F9PA 1S7UB 3HE6B 2BSSA 3GMOB 4LGRB 4XCNA 4R3SB 4PJ5E 2FCBA 3PHOB 1T03L 2Y1VA 3VXPB 1KJMB 3N0PB 4PJAA 2H1PL 3EGSB 5HI3C 3NCEB 4X5WB 3U2SA 1GH7A 3UAJC 3ZDXE 3L3OA 5GZOD 5CP3A 5F1IA 5F44A 1ZHKA 2EDQA 3UDWC 3MLWH 2HFGH 5F71A 3WFCL 1NFDE 3EAKA 5C2UB 2FX8H 3IDJA 3VRIB 3M17B 3GJFK 2XG5A 2KQMA 3WUWG 3RGVA 4YDVA 2C1OA 1ZTXL 4RIRA 3THMH 3PXJA 3DXAD 2QHRL 43C9B 5GGRA 1YEDA 5I1DA 4P9HH 1CDCA 2QLVB 5C07B 3SCMC 2AXFA 2YUXA 1U2HA 3JUYA 5C0AD 2OI9C 5IVXE 4HS8L 4NWTH 4QRRD 3TV3L 4XPHL 2ZG1A 3OZ9L 4YO0B 3O4LE 4G6AC 3PQYB 1KGCD 4QTHB 3RWFB 3OX8A 4GXUN 5ID1B 4TSCL 4R2GB 2FJFA 3GSRB 3BHBA 1IKFL 3NH7L 4ONFL 3KPSB 4HXBL 2A6DB 4LP5A 3ULUD 2Q7YA 3ISWA 1NGZA 1BMGA 3DUSB 5DWUH 5HDQL 1IKNA 4HMCA 2IBGA 5IBTL 1BM3H 3T1FA 3T3ME 4F7EA 3BW9A 3O6KH 3HNTH 5FYKH 3C08L 4JRYA 4X6BA 1REIA 4XI5C 1G6RL 3L6FB 3FZUC 2EDXA 1FV1A 3TT1H 5B39A 4HKBA 4KJPC 1UACL 2HVJA 4PRIA 5IBUB 4NO2A 3VFTA 1CQKA 3QQ4B 5B4MC 1K8IB 3L5XL 4OD1H 4PRAA 5E03A 4OBSA 3KXFB 2FSEB 3RA7L 3BESR 4X6CE 2PYEB 2RGSA 4LARL 3C9NA 1RUKH 4OTXH 4M9OA 4APQA 3QT2A 4XMKH 1FG2A 1DDHA 4U4BA 2D9CA 2XZQL 5C7XL 3ARGB 2ADIB 3SJVB 3LKRB 4FHBD 1FFRA 3CGTA 1MCHA 4FS0A 1X4ZA 4RNRA 1F6AB 3DX9B 5IQ9B 2EE9A 5D7SL 4PS4H 4I4WA 4XGZA 3W11D 3HE6D 4HCRA 4QHMA 5HHQA 4JG1H 5C1MB 1GGUA 2G75A 5IFJA 1G9ML 2XZCL 2KBGA 7FABH 4QCIB 1EHNA 4QYOB 1QNZH 2XKNB 5DJDB 5ESVA 3LMJL 5KSBF 5FCUL 4MA7L 3Q1SL 4QGTA 3MQIA 4DUVA 1JYXA 3T3PF 4DCQA 4QO1A 4UZGA 1A2YA 1AR1C 2EYRB 2EEAA 3O81A 4MMZC 5FGSA 4UQ2A 2JJTC 5FM4A 1OT2A 5J13B 4NQEA 3QPXH 1P69B 5JO5B 1MAKA 3V8CA 4S1QL 3VGAC 2NX5D 1N64L 1PLGH 5GS1B 2FO1A 1GZPA 2M2DA 5C07D 1FL6A 1F02I 4X7TA 2ZWLT 3C60B 3STZB 4K94L 4YQXH 2PTTA 4WU5A 3LQAC 4F57H 4LLWA 2VLJA 2NXYC 5B38A 5F72S 3K8MA 3PQYD 1JYNA 1T1YB 1CTNA 4TN9A 3CSGA 3QH3A 3MJ9A 3GGWA 3MUGA 4R2GD 1NCAH 3OKKB 1MWAL 1NUGA 2F5AH 5D72H 3BT2H 3KPSD 5HHPA 4NO5A 4OLYH 4Q6IC 1S7XB 3VE0A 4XB8A 4HGMA 5CFHA 12E8L 3MTRA 5E4EC 2JCCB 4PRHB 5TE4H 5I8EB 3RWJA 3P9MA 2H8PB 3QG7L 5DZLA 4DKFH 1K3IA 2DLEA 3OJ2C 3WIFB 2X1PA 2MFNA 4M7LT 3SE3C 4ENED 5GRJL 3BD3A 4KKCC 1IBGL 3BN3B 4ZOEA 5M94B 3KXFD 1IAOB 1S7QB 4LSRH 5DXWA 3HCVB 3CPLB 3SEPA 5EUOB 2PYED 3V6FB 1T66D 1DZBA 3BKJL 1D9KC 3MRCA 4DTGL 5KVDL 3CZFB 4OLEA 3EYFA 1Z0MA 3N06B 5ADOL 3H7LA 5C0FB 3D2UB 5CLTA 3ARGD 2Q86A 3SJVD 4S1RH 4D0CA 3H2WA 5J7CC 3AU1A 4LVNB 3VRJB 4IOSD 1PY9A 4N8PA 1L9MA 5IEHB 3P30L 5CJ8A 4HDIA 3S35X 2P5EA 4MHHI 5E8EA 1W0VB 3QDMB 2QV2A 4NRZB 1D6VL 4Z8FH 3BKMH 1CU4H 3WFEH 3TBWA 1EJ6A 5CD5C 4U3HA 2LVCA 3HS0B 3V79C 2QJDA 3RWGB 1QFUL 2Y07H 4MA3A 4O58H 5K59E 3O3EB 4L4VE 2Q8BL 4YHZH 5ITFB 3S35L 1D5IL 5CUSL 4PRBA 4WRLA 3G6AA 4PJEA 5MEOA 3MMEA 3G6JA 2B7DT 1ZSDB 3SE8H 2FJGB 1N59A 1VKXB 3MLUH 3D18B 5L7XL 4R96B 4KC3B 4Y4FC 1I8IB 1ULVA 3O2VH 3VGDA 3SKMB 4PJIF 2F9BT 1UA6H 3BDYL 3MLRH 3LSOB 4HV8A 3MZTA 4JPWH 2EXYC 3NPSC 3C60D 1TZHB 1FYTB 2K7PA 1D5BA 2EIZB 4F7PA 3G5VB 3VG9C 1W8NA 5I18L 5SWZA 4JM2F 1NAMH 5E99H 2XWTA 3BPLC 3NFPA 4OI8A 3TPUB 3CVHH 1CLOL 2QQQA 8FABB 2WWKT 5DJ8B 3GMQB 1T5XB 2QL1A 4UAOC 4Z0XA 4N68A 5A43C 4QRSB 4R0LA 1U95B 1BJMA 1NH6A 1A7PH 4OKVB 1T1ZB 4QXGH 1CL7I 5E8OB 1TVHB 3F5WB 1KIQB 5FDWA 3S88L 1GHFL 4GAFB 4NZJA 4P5TA 1LEGB 5FYJD 1YMMB 4F8TA 2JB5L 4P5KB 2YD2A 2FZ3A 2I07B 3ARXA 2EKJA 2BOCA 2VAAB 4HWZB 4EIZC 3IU4L 1N2RA 3WFBH 1F4YH 1H5BB 2HFFB 1TCRB 2ED7A 4LRIC 1CFQB 5GJTH 5HGBA 3MJ9L 1BJ1J 4LMQI 4L8BB 2FLRT 3FHAA 3BQUA 2XQBH 2J4WL 3VMPA 4G7YL 3HN3A 4GAJL 4N0UB 4WW2F 2B4CH 1K8DA 3MCLL 3RAJL 5I76A 3D2UD 3DO7B 2NR6C 4ODTH 2YPLA 4KI5F 4FN0A 3TWCL 2L7UA 1R5VA 4MSWB 3FT3A 2ZP0T 1AE6H 2VLKB 5I1GL 3CH1B 2MPAH 4U1SB 4RISH 3I02A 3KPNA 5D5MA 4FQQA 5F9WB 3TA3A 1OQXA 4XWOD 5L8KB 2AGJH 2LVEA 1G6RB 3DUUB 3QDMD 5HGHB 5IJKC 4U6YA 4WEBH 4KQ3L 5TDOB 4HIEA 2DQCL 4I48B 1C7TA 3PV6A 5DMIH 4FFVC 4R7DA 4U1IB 3NVQA 5CINH 3OKYA 4NRYA 1BD2B 2BY0A 1LWRA 4JR9H 1WZ1L 3KPRA 1U9KA 1CVSC 1T89A 2W07A 3PL6B 3QIWA 3JWDH 4JN1H 5DD5H 5LCVL 4PR5B 1OTSC 1MI5E 3QUYB 3FQUB 4PJGF 4NBZB 2HT2D 1RSFA 3ZE2E 3JTTA 3C09B 2VDQH 4YFLI 2J8UB 1YEGL 3ORJA 5AG8A 2HLFD 2VZVA 1HQ4B 4MXWL 4POZD 5KS9B 2MKWA 2F74A 2GY5A 5F7EL 4MCZB 3IDGB 1U58A 2FX9L 3W2DH 4JPKL 1FRGL 1FYTD 3MRRA 4GSDH 4M6NL 4WO4B 4DGIH 1YNKL 2V2TB 5JXEA 2JF1A 5F96L 2VSDA 3LCYA 4XBPB 3NOIA 1ONQA 4MGXA 4UNUA 3ARDA 1FNSL 4FQHA 4JRXE 5HGAB 4EI5A 5C9JA 1QSVA 3O11B 3ZKNC 4K07A 2ICWA 3RBGA 3X3FH 5HHMB 3KJ6L 1FBIL 1OHQA 5IGXL 1J0JA 1A1OB 3W9DA 5F6IC 3ULVL 5I1AB 1JWMB 1YMMD 4GQ9H 2HKFH 4DN4H 1BPVA 2AJYL 4YE4L 4X8JB 1H8NA 3R8BB 4XP5H 4YHKH 2BSSB 1RZ8A 2XXCB 5DJ6A 4PY7B 4KMTL 4U1KA 4XCNB 1V3MA 3CU7A 1NBVL 2HT3C 2OJZL 2BSTA 2X4PB 5D2LF 3PNWA 4PJAB 3JZ7A 4WW2C 5FM5O 4OGAC 3U2SB 5CKAA 5FXCH 1TNNA 3PF2A 4KI5C 4OGYL 2HH0H 3NA9H 4LU5L 1SEBA 4R8WH 4AIOA 2VZTA 4OZIB 3IDJB 4KDTC 4KVNL 2OL3H 4YDVB 2QQLL 3FO0L 4S0TD 4Y0GA 1J87A 2C1OB 2IPKA 3QQNA 4G9FE 4KKAD 4RIRB 1SBSH 2VLKD 1TQCC 2LTQC 1YEDB 5I1DB 1AO7B 4Z7NF 3RY4A 1MHPL 2J5LB 1CLZH 5I6XC 3KPOA 3TYGH 3WFHB 4Z9KB 5HHXH 5ID0A 3AMLA 2DICA 2VN4A 5D7JA 4HW6A 5DHYA 4M5ZH 5FUOH 4AEIL 3S5LA 3K8LA 4O2CA 2DI9A 1BD2D 1C5CL 3A0OA 1P2CA 3KPLA 1Z9MA 4LLMA 1OP5K 3PL6D 3BHBB 4G3YL 4CNIA 5C0JA 1YDPB 3QUYD 4ZPTB 3U82B 1NGZB 1KEGH 1UB6B 1AFVH 1Y0LB 3D0VA 1CE6A 1ACYL 1FDLL 2GFBA 4JO4H 1MIEH 2W60A 4P2QE 3OKNA 3BW9B 1DQQA 4PJ5B 4X6BB 3ZSTA 4EEEA 3DWTA 3HZKB 4ZTPL 2P46B 3MRPA 3BH9B 3HE7C 4KHXL 4O51A 4O00A 5DFVD 4M7ZB 3MR9A 4IS6A 1FV1B 4KV5F 4HKBB 2JJSA 4HIXH 4WO4D 3GI9H 4PRIB 1IQWH 4PJDE 1HXMB 5EZOL 1NFDB 2DLGA 3MOBH 4B7LA 4PRAB 3LS5H 2XNAA 2D4DA 5ICZA 4NZTH 3HNVL 1OP9A 1HH6A 1AXTL 3UPRA 4ODHL 2VLLA 3OR6A 3V6OC 1R5WA 5D8JH 1QFPA 2GHWB 3JV4B 2P48B 5HHMD 4WUKL 4APQB 1S5HA 3GK8L 4YHPA 3TJEL 4DVBA 1HZHL 3OBAA 4TSBH 3TJHC 2UY7A 3MXVH 3KPPB 1HHIA 3U0PA 2EC8A 5E5MA 3RNQB 5F89A 2XN9E 4XNZB 4RNRB 3O4LB 1DQLH 1S7SA 1UYWL 1YPZE 3SDXA 4PJ7F 2G75B 4P23B 4WGWB 3RY6C 3T4YA 1DQDL 1A6ZB 5EU4A 1GGCH 4JHWL 4N9GA 3VI3E 4DCQB 5BVPH 4NFCA 2IJ0C 5FEBA 5AAMA 3SGDH 2ZG3A 1EAPA 1NLDH 1T1WB 1B6UA 4P2OA 4LFHG 3WN5C 1S3KH 3I9GH 3U36B 4YDLB 4NQEB 2KZ1B 1VGEL 3CFKA 3HI5H 5FHBL 1FN4B 3U0WH 1Y6KR 4NC0B 1MCCA 3GBNL 1AO7D 2FECI 2FATL 1FL6B 4WI6A 4X7TB 3L3IA 3ZE1F 3RZCA 1NCDH 1H8SA 2BHYA 2PTTB 4WU5B 3DJ9A 2VLJB 3G04A 3MFFA 4O5LL 4OM1L 2DQHH 2EZ0D 3WHE0 3QH3B 4X98A 4PB0H 1IC7L 1RZKH 5TGBA 3GGWB 4WI9A 4ODUA 4OAWA 3MUGB 5I1CH 4AIXA 3KYNA 1DP0A 2AS5M 1LK2A 5INDB 5HHPB 1GJIA 2ED8A 1A7RH 1C16A 4IMKA 3SDYH 3ARQA 2GEEA 5EPMB 4CVUA 2J8HA 3HI6H 1UFUA 3RWJB 5IFAL 3P9MB 4AG4L 1JNHA 4PJ5D 3GSNH 3BUYA 2Z0BA 2DMBA 3SO5A 5FGBA 4MQXD 4QY8B 4WHYH 5TPWH 1W0YT 3TT3L 1ZHLA 2QSTA 1BFTA 4MDIA 2CIIA 4OQTA 4KK8C 1MVUB 2DOCA 1NQBA 1IE5A 4PRID 3BKCH 2DLFH 3CIQA 4F7MA 2FJHA 5DJCA 4YX2L 3TO2B 1I8KA 4NUJA 1K2DB 1YJDL 1YMHB 1EHXA 1FNEA 4JVPA 3OHXA 1W2KT 4H0GA 5TQ2L 1DEEA 4ZTOH 1E4JA 4K2UL 4OGZA 3MRCB 3U1SL 5IF0A 2IANA 4APQD 1KF9B 3E3QE 1ZGLP 4Y89A 3IDYC 4GS7C 2C1PB 5E6ZA 1WF5A 4TTDD 4YAQA 2Q86B 4PP2A 3V6BR 3VRLE 1KENL 4D0CB 1OAQL 1HIMH 4F7CA 4KHTH 3H9YA 1T7ZA 43CAB 3AU1B 4OV5A 5T33L 1MFBH 3JV6A 1PEWA 1KIRA 4M1CD 4BZ2H 3O4LD 4ZODA 4P2YA 2ZCKH 3BZ4A 3AXLB 2P43B 4PTUB 4HHAA 2W0PA 4P23D 1I1AB 5JPMB 1B4JL 4IRJC 3V0WH 2FEEL 3P4MA 4M61A 3TBWB 4JO2L 5CZXC 2EYSA 4HKZB 5AEAA 1AJ7H 4KK6C 5AD0A 4LLDA 1N5AB 4MA3B 3TVMA 4MA8H 4FQ1H 3VD5A 4YH6A 2XXMB 4M1DL 4MJ5A 1X4XA 1A7NH 4NKIH 4XTRD 4J6RL 4PRBB 5CJOL 2DTSA 1BVLA 3G6AB 3B4NA 1QRNA 1GC1H 4PJEB 5MEOB 1DBMH 3G5ZB 3MMEB 3IRPX 3WMSA 4AY0A 5C0EA 5DJ0A 2DQJL 4OLWL 1N59B 3WJJA 1QHPA 3GIVA 2AI0H 1OW0A 1T6WA 4PREA 2H45A 3VW3L 2IBBA 5EU6A 2QQNH 3U9PH 1ZT4B 2OJEA 5D1QA 2D03L 2CH8A 4JFFE 1D5BB 2RFXA 1F3DJ 5SWZB 2VLJD 2BSED 1A7OL 3NFPB 4HWBA 2YPVL 3WSQL 4G7VL 4Z0XB 4YBLB 4R0LB 5JW4N 5F7DA 4Z7WF 4MWFA 2ADFH 5DD3H 2BZDA 4U1MB 3RVVD 1J88A 1QTYT 5FDWB 4LQFL 4JO3L 5JOFA 3FB5B 4G8FA 1Q1JL 35C8L 1UH4A 2YUWA 4UDUA 2FZ3B 5DGRA 5BQ7A 3FQXB 2M1KA 3TESA 4L29A 5E9DA 1N2RB 1SEQH 3RPKA 3HMXH 2XZZA 4WFFE 1I8LA 3C2AH 3LS4L 1MJJA 5TF0A 4OZGA 2VDNL 4L4VB 4L4TE 5CGYD 1TENA 5LWYH 5BV7C 3BQUB 2O5XL 3F62A 4PJFA 2VWEC 5JDSB 5F1NA 2E3VA 2EO1A 2YUVA 1CDBA 2GIYA 2VKXA 1CD1A 4RMQA 1NUDA 1G7QA 5I76B 1OGTA 2C7UA 4MJ4A 1R5VB 3O0RL 3CLEL 3FT3B 3OAZK 1ACZA 4TVPE 5I66A 2MNUA 3BIBX 4RBPK 4OQTL 4OF5A 1MREH 2YWYA 4KI1A 3I02B 3E6HA 4FQQB 4X6DA 1QA9B 4JREB 1OAKH 1A6WL 3TF7C 1JI2A 1DVFB 3IKKA 1A14L 1I1AD 2V5SA 3F58L 4U6YB 5SX5H 4HIEB 1GOHA 3QEQA 3GM8A 4R7DB 1DL7L 2YC1A 4NRYB 5MP6H 4NQDA 4C83A 3ES6A 4BUGA 4ZD3L 4J3WA 1HH9A 1X3DA 3QIWB 3AUVA 1Z3GL 3OB8A 5IFHL 2KZWA 3S4SG 1INDH 1YEHH 3GSVA 1JYWA 4PJCE 3OTTA 3QCTH 5HYSA 3JTTB 3QAZB 2OCFD 2P7TA 3T65B 5ICYA 5JOEA 5ICXA 5CIPH 1DUYA 3SKJL 1U8NA 4WY7L 2F74B 1A3LL 1ZE3C 1FAKT 2R4SL 4L8SC 3E8UH 1EMTH 3UBXG 1CT8A 1H8OA 5DQDH 1SJVA 5FO9B 5SWZD 1IC5L 2CKNA 5C6TL 5TH2A 4ZYKA 2MQ3A 2IBZX 4MMXC 3WXWL 4FQHB 2X5PA 4N90D 4WV1B 4BFIA 4EI5B 5C9JB 1A3RL 5F9AC 2DKMA 5D9SA 1BQHA 2ICWB 5D7IA 3UDWA 1VFAA 2FIKA 4LHJB 3U7YL 4WWKC 1SMOA 3QFDA 3T0XA 5E94A 5GRUH 4OCYL 4FQPA 5AUMB 5HVWA 4PFEA 1XH3A 2NZ9C 3CXDH 2A38A 4PBWD 3SCMA 2FB4L 5JDJA 1RZ8B 5DJ6B 2DMKA 4U1KB 2YD3A 3I6GB 1CXEA 2HLAB 4UBDD 4HWBL 4LCWE 4DGYH 3MBXL 3P4OA 4L4VD 5SWQA 4H8WL 4F3FA 1MI5B 1NGQL 2DWEA 4JG0H 3RX7A 5A2LH 1N3NA 1PYWA 4NFBA 4QEGA 4R9HA 1UT9A 5AZ2H 3AB0B 2CK2A 2FGZA 3PG2A 1SEBB 5I8KH 4Y5YB 2X4UA 4LPCA 1WZMA 2OQJB 4KAQL 1MNUH 2JIXA 1U8IA 2FIRT 2MSPA 4G42B 4DOHE 1VPOH 5TQ0L 3LV3A 3PJSA 1LGVA 4NYLA 1AY1L 2BVOA 3IAPA 1J0HA 4OUUA 2OR9H 4XPAH 5HDBE 4ZFZA 2A9ML 5C71A 4X5LA 4NKOA 1A7QH 1KT2A 1DVFD 4HEME 5ID0B 1K5NA 3MRLB 3TFKC 5D7JB 4XP4L 3TNMB 5BJTA 5DHYB 4BM7A 4NHCH 2WWKO 5KSUA 1S5IH 1FORL 3EOTL 3JWNC 2R15A 4DW2H 1P2CB 1MCFA 4CUCA 4LLMB 3QIWD 2GITB 2B0SH 4BH7A 4CNIB 4FXLA 4ODBD 2AXJA 5C0JB 4IMLA 3UYRL 2DIBA 3EDFA 5EBMA 2ENSA 4QTIL 3ZKMD 3D0VB 1CE6B 1QFWL 3V95A 1ZVHA 3O2WL 3G5YA 5A16A 1QG3A 2W60B 3IXTA 4Q0XH 5FYJU 1A5FH 3D39A 4K3EL 1MY5A 3MR9B 4IS6B 4Q58C 1YEIH 4OCRL 4ZFOA 4M3KB 2OXHA 1DN0A 3CFJB 3P0YL 5DD0H 4P9HC 4OB5L 3UCRA 5JXED 1MFAL 5E6IC 5IHZA 1I9JL 5C08A 4AL8L 5EC2A 4Y4KC 4EI5D 1FNHA 3UJTL 2V2XA 3V7AE 1SM3L 3LPWA 4Z7VF 2MWCA 4FFWC 5F7LB 1MRFH 1HH6B 2BNUA 4TUOA 3UTSA 2VLLB 2A6JB 3OR6B 1WT5C 1R5WB 5E0QA 4I18C 4NRXA 3T08A 4R26H 2YMXH 3WKML 2BFVH 4X99A 2JJTA 1JHTA 1UWEL 4DVBB 3BWAA 4OF6A 2ORBH 4HSQA 4BQ8A 4HQQH 3I3EA 4OLXL 4FABH 2MOVA 2E7HA 3LKOB 1V3JA 4G8IB 5KW9L 4YHOL 3UJIL 3U0PB 1HHIB 3C5ZA 2FX7H 1CE1L 4JFZH 3LIZH 5GS2D 4OSUH 2H3NA 1S7SB 2CDFB 2VDKL 1XF1A 1X6LA 5DJ2A 3RKPA 3ROOA 3ULUF 4KRNA 4XX1E 1F00I 5D1XC 1KC5H 1N0XH 2DQUH 4DK3A 2L7JA 4NNPH 5ALCL 1MI5D 2EDBA 5EU4B 4YDKH 4M5YL 4OF0A 4N9GB 3EJYC 2BJML 1FO0H 1EAPB 1SY6A 1U6AL 2HJKB 4EVNA 4P2QB 4BK4A 4ZFGL 4Q6IA 1G9NH 3IXAB 1LQSR 3C6SA 2GJZA 3C2SA 1MVFA 1RVFL 4LLAA 2Z31C 2GSGA 1HI6B 1AC0A 1H0DA 3ARRA 3MV9E 5C0DA 1TTGA 5E2UH 4HFUL 4JAMA 3DGCR 4IRSA 3MYJA 3L3IB 3PXHA 3VGHA 4UUJB 5B3NA 1RAMA 3SE3A 2M26A 1DSFL 3M1BA 2AJSL 2RR3A 5I9QB 3G04B 4D8PA 3MFFB 4RGMB 4YXHL 2VL5A 4X98B 5L6YH 2HTKC 1F42A 5TGBB 1UQSA 4OAWB 5HGDA 3FN3A 2HMIC 1QACA 4JFOA 1JHLL 1VACB 1LK2B 2E9WA 2DQIH 1CZ8L 1D9KA 2XN9B 5DUML 4YHYB 4DFIA 1QFHA 3L5WA 2W9EL 3TH3T 3PWLB 1QKZH 1BOGB 1JNHB 1IC4H 3RTQB 3BUYB 5DA4A 5BVJB 3DVFA 25C8H 4KZEL 3RU8H 1ZHLB 1EGJH 1T04A 2CIIB 4MDIB 5IIEB 6CGTA 1S7TB 5GSVB 3EFFB 3P0VL 4HC1A 4NM8H 4QHLB 1BIIA 4GBXC 1E27A 2J88L 3FQWA 1FFQA 5DJCB 4M93B 1I8KB 3P77B 4NUJB 2ZUTA 1ITBB 2A0LD 2VR5A 3OHXB 4PD4J 4PRPE 1PW3A 2XRAL 1DEEB 4I1NB 1MPAL 4I9WE 2YS4A 5HJ3B 3TBVA 1FSKB 1T2QL 2IANB 4Q9RH 1P4BL 1IAMA 1E4WL 5HDOA 1VADB 4PP2B 1L4IA 3UTTE 5GS2H 4XVUC 1VERA 3GSUA 4FQCH 4QT5A 4EZMA 4F7CB 4OV5B 5LQBL 4Q97A 4ZFOL 4Y4FA 3JV6B 3QHZL 5E8DL 1LK3L 3WFZA 5MERA 2KL6A 1FHGA 2ID5A 3BZ4B 4JB9L 1U3ZA 1DLFH 4P2CG 2RCSH 4LSPL 3GZKA 4M61B 3WO4B 3HLAA 2R2CA 2E9IA 1OTTC 1BWMA 3GHBH 5FV2A 2EYSB 2B20A 3CSPA 1UKSA 4YK4B 5FHAL 3BPOC 5EU3B 1G0XA 1MFDL 1ZT7A 3ZDZF 1F6LL 2XT1B 3TVMB 3VWKA 1XIWC 3IETA 1BECA 5DURB 1ZVSB 3D0LB 3CCHB 1FPTL 4P2QD 4J3OC 2QTEA 5I8OL 1MAML 2PW1A 4HS3B 4JO1L 1K4DA 1ZLSH 2AERT 2WNGA 3GI8H 5DJ0B 4LF3A 3GIVB 4YDIL 4UT6L 1MEXL 5EU6B 4D94A 4I77L 2PW2A 5C0BA 3CZJA 5D1QB 2B1HL 3HTLX 3LQAL 4LCYA 2AXGA 4F9LC 1NCWL 1NL0L 3TP4A 5D7KD 1WJ3A 1K4CB 3WLBA 1PG7X 4G5ZL 2I24N 4Y1AA 1KJ2H 2ZUQB 1NCTA 1SY6L 4PGDA 1MFCH 2VLME 2BERA 2GQHA 3HG1A 1YECL 2QADB 2V9QA 2BNRE 1E0OB 1Z9OA 2UY6A 1J10A 2XN9D 4MWFB 1WVZA 2YK1L 3FFCE 2DJ4A 1EK3A 4I3SL 5DJYA 1Q0YH 5JOFB 1P84J 2F54A 2WBJC 3LVEA 4G8FB 4RZCB 3RTQD 2HT4D 3CFDA 1WAAF 4UDUB 4ZO9A 2ARJB 3AMKA 5BQ7B 3RIAF 3EYQC 3DV4B 4GW4A 4ZDHA 4PBVC 3AAZB 4U1HB 5DVLA 4CVWA 2IBZY 2E7MA 4PIRF 4NQCA 1CFVL 4J3XA 2Q76A 5IBUG 3VXQA 5IJKA 5HYJE 2VITB 3U9UA 4H0IA 1MJJB 1I1CA 4OZGB 2P8LB 4JFQA 3BZFA 3U46A 1JRHI 5DFTA 4PJFB 5C6WH 3QXTA 4XNXH 1EHLL 3BFOA 5EBGA 3QWRA 5GSRA 3RY5A 5CWSB 1OAUH 1VEOA 2IAND 1SQ2N 3H0TA 4ZQKB 3F6LA 4LPVA 1G7QB 1CF8L 3UJJL 3UXFA 5I15L 1FG9C 2B1AH 1IM9A 5FYLE 5CBEA 4MNGE 2BNQA 4Q9BA 1R6VA 4O9HL 1DUZA 5T5FH 4PPTA 4FXGA 1FL5A 4HLZH 3WS3A 2Q1EA 1WK0A 4HC1L 4X9HA 3FO9B 2F53E 5IMOA 2QR0A 1U91A 4OCWL 2R39A 4I2XA 3NABH 2CD0A 4G8EA 4RRPA 4XT1C 2JCCF 1MJ8L 2GSIA 4BSVB 2OX5A 4Y2DC 2XI9A 5TF1L 3QEQB 3H42H 3LKPA 2YC1B 1KELL 2WINA 3ZTNL 4XCCH 3ES6B 3F7VA 3AM8C 3TVMD 5DURD 5JW4M 2H32B 3VXSE 1XR8B 3T4AA 4U1LA 2VOTA 4LNVA 2X89D 1YEFL 5D7LA 4P59L 4Z7OF 2EXWC 5HYSB 4UT9H 3AVEA 3BPNC 3FN0H 3VFNB 4QOKA 3NCJH 2B4CC 4AENA 3O6LL 3QUMA 1MRDH 3BYTA 5ICYB 3ARGC 3RHWF 2DQGL 3IKCA 5EU6D 3S9DB 1U8NB 4UDTA 4XCFL 5D1QD 2R0LH 3AS3A 3K2UL 1CT8B 2C3HA 3QCUL 4AEFA 5F3BA 4WW2A 1KTDB 4ZYKB 1E6JH 1IGYA 1KTLB 2VH5H 5IMMB 1FZKB 2XQYK 1LO5A 2CKBH 3VD4A 3LN5B 4HH8A 1VHPA 1FNLA 2QADD 3RVTD 5D9SB 2R69H 4MVBD 5HD8C 2YUZA 5JLZA 5D7IB 1VFAB 2FIKB 2W9DL 4NJ9H 4KJQC 1A0QH 2G2RB 3N1QC 4KDTA 4YR6A 2DD8H 3JWDC 4ONGH 1PKQE 2I60L 4U6TA 1XH3B 4WCYH 1D5XA 2EIDA 4LK4A 2VDPL 1UVQA 1T7XA 5TE7L 4HZLB 2MCPL 3SCMB 5E08L 2OI9B 1U8LA 5J06A 2VXQH 2IEPA 4MD0A 3CUPB 1U8OA 3R0NA 4ELKA 3CK0H 2MKLC 4F3FB 4IOFD 5FGRA 2DWEB 2X4QA 2B39A 4PJCB 4U2YA 2DWDA 1N3NB 1PYWB 3OJMB 2VXUL 4PJGA 5J6GA 2FHCA 3R06A 5E2WL 4YBQC 2F8VA 4I13B 5F70A 2X4UB 4U6XB 2HWZL 2LFGA 5ITBL 1BVKA 4UTBL 2DQDL 3F65A 3QUZB 2JIXB 3DV6A 3SGJC 1DBKH 1K85A 4HJJH 3LV3B 3K3QA 3PJSB 3ETBF 3K2MC 1QR1B 1GRWA 4NZUL 1NCUA 3BSZH 2BVOB 1EFXA 4ZFZB 2ED9A 4GW1B 4LSUL 4OFYA 4NKOB 5LBSL 3HE7A 1KT2B 1S8DA 3NCCB 3PGDA 1FH5H 1KN4L 5IOPA 1PD6A 5BJTB 1WCQA 4BH8A 2ZCHH 3QEQD 4ISVB 5KSUB 3GJFH 1RULL 4AZ8A 3HC4H 3QIBD 1HINH 2H26A 4JQXC 1E6OL 4XP1H 1IEBB 1HNFA 2IFFH 1AXSB 4OBRA 3V6OA 4IMLB 3BD5A 4NQSA 4UIKH 1F90L 5DJAA 2RB8A 1I3RB 1WEJL 5TDNB 3IXTB 4P5MA 2RBLA 4WFFD 5EOCH 4MB3A 1IAII 2VR4A 4PG9A 5E1AA 4LCWB 4M7KL 1RIUH 2EEBA 4LIQL 3D39B 3V4VL 1MCDA 3JTSA 4MAUL 2A9NH 4LVNC 1BQLH 4UV7L 4ZFOB 2IMNA 3QWOA 1M7DA 1RURH 4JY5H 1IT9L 1R3LA 4KQ4H 3C6LB 4QNPE 2AEQL 4HULB 4RA0C 3HA0A 3RQ3A 4IRZL 5HI3D 4M43L 1K9TA 5C08B 4I0CC 1OQOA 5EC2B 2XV6B 2V2XB 1S9XA 3UAJD 1LO0L 2J6EA 5F6HI 3HAEA 2BNUB 4TUOB 1JHKH 1UCBH 4XWGL 4EUPB 3PWNA 4A6YH 4TVPD 4NOFA 5CS7A 5T1KB 3WN5A 4XP9L 3CU1A 1FGVH 2W59A 3QUML 3WDJA 4UNVA 3BWAB 5CZVH 4LPYA 3LKNA 4X9FA 1LO3H 1NMAH 3TN0C 1HKFA 3GMMA 3KWWA 4KKLD 3QDGE 5M95B 5L8LB 3MLSL 3T09A 1HSAA 5DJ2B 3SCMD 2IG2H 3ROOB 1MRCH 3VDAA 2VB5A 5ETUA 4JFHD 3UBXI 4POZC 2BMKB 1CLYH 4DAGH 3GO1H 2J8UF 1YYLL 2NXYB 4G6AD 4NM4L 4JZNA 3QEUA 4XCEB 3MNVB 2E7LC 4UOW1 2FEDC 1J1XH 4ELME 5KS9F 5FO7B 4PRDA 5E70A 3IJSA 5DMJB 5ANME 4EVNB 2BVYA 1AQKL 1MJUH 5JQ6H 1N26A 1O5DT 1VCAA 4Q6IB 3QUZD 2JIXD 4JHAL 1DTUA 5ACZB 5T3XL 1FIGL 3G6DL 3OXRB 4YUEL 5E4EB 3LH2H 4OZFH 4UT7L 2GSGB 3KG5A 3N85H 3WLWC 4MZ2A 2XIDA 5C0DB 4XI5D 1UWGL 1F11B 4JAMB 4LKXA 1Z0NA 2IC2A 3FZUD 4AEHL 5F3HA 1TLKA 3PHQB 4KJPD 4MQ7A 4D8PB 1WCBA 2XA8L 2FNBA 5B4MD 3OF6A 1EIBA 4KTEL 4X6FA 4NCC1 5FUCC 5HGDB 3Q6GL 3EDDA 4JFOB 5FA3A 3HFML 5DQ9B 4MXVF 2DM7A 3EOBA 1GAFL 1P9MA 4PLOB 4PJAF 4DJMA 3WFCH 4DZBA 3T0EC 4MA1C 4LMQE 4HBCH 2WUBL 1EEYA 3VFOB 4PJ7A 1A6UL 2X4NA 4HUXA 4MB5A 5F9DC 4LCWD 3LDBC 4IIQC 2M8XA 2J12B 3D39D 4KKAC 4Z7UE 5EO1A 2YD7A 2QHRH 4OZIF 1T04B 5ISZE 2N56A 1UM5L 5HYFA 4X83A 3CSBA 5JHLL 3C6LD 3FQWB 2OZ4L 3H3PL 1DBBL 1DBJH 1KB5A 3IGAA 4HMDA 2R1WA 3EYUH 5CD3A 5C08D 2OTWA 4AIZB 4L8CA 3P9LA 4JFXB 1U8MA 1Q72H 4D0DA 1AR1D 4TSCH 4H0HB 5IB2B 4OI7A 1WFOA 4M8VA 4H20L 5T1KD 1RZKC 3HMWH 3PL6C 1IKFH 3MV9B 3PGCA 4FZEL 4ONFH 1LNUB 3MUJA 4HXBH 5F9OH 4M6MH 5AYQA 1MUJA 1JTPA 5DEGA 2CRMA 2DBLL 1NJ9B 3GSUB 2NY1C 4WFEE 5IBTH 1CGSL 2A1WH 1B3JA 1OF2A 2Z35A 2EH7H 3C08H 3QEGL 3T0DA 2RAMA 2ARJQ 5IESL 3DTXA 3NPSB 3QUKB 4Q7DA 5H35A 3VG9B 3KYOA 2NXYD 5IHUH 3NIFE 2J6EL 3VXUE 3BPLB 4DEPC 2W0KA 5A40E 3HC3L 1XGYH 4TQEH 1ZT7B 1CGYA 3L5XH 3IETB 1IC1A 2PO6B 3RA7H 4GG8A 3ZDXF 4LARH 2PW1B 4M1GL 2GI7A 1NFDF 1FE8L 2X70B 4W68A 2X44D 4WU7A 4HG4J 5CEZL 5I2IA 2PETA 3EDEA 2PW2B 1PG7W 5C0BB 1WFTA 3H7BB 3V6ZA 3GHEL 2XOTA 2YA2A 3GBMH 2AXGB 5DRWA 1C5BL 1MCOL 3UZEA 1EEQA 5D1ZC 1FZOA 1T22B 5J56B 5IVXF 2OBGA 2XZCH 3BH8A 3IU3A 4KKCD 4Y1AB 5GGSB 5AYUL 1QFWM 1KN2H 5GHWH 4PGDB 4YZFE 4MA7H 1JFQL 3Q1SH 2ICCA 1IZJA 3P4NA 1RV6X 5FKAA 4CMMA 4YHLL 1UH2A 3IDNB 3DX8A 5CP7A 3TC9A 3MV8E 3B43A 1NEUA 2COQA 3HNSL 1N6UA 5LJYH 2WBWB 3DBXA 2F54B 6FABL 2OM5A 2D31A 4M03A 4NFDA 4EDWL 1SBBA 4S1QH 1GC1C 3EBAA 4IM8A 3BAEL 3WE6A 4ZDHB 4YXLH 5B39G 1L0XA 2WSKA 3S36H 1JF5A 1OGAA 4WHDA 2R4RL 3VXMA 4WGVB 1EEZB 2EDNA 2Q76B 3VXQB 4EI6A 4WFHD 2CGRL 1MHCA 3U9UB 1I3GH 1GVIA 2IH3B 1FP5A 1RJZA 2R0KL 2XKUA 5AWNL 5F1OB 3DSFL 5CD5D 3BZFB 3E2HB 5F1KC 1RIHH 3BIKA 4KZDL 2BK8A 1GYAA 1HK6A 4FNLL 3SQBA 2CPCA 2J7LA 3AY4C 3W0WA 2XTJC 5DEFA 5GSRB 2ZUXA 3A6BL 4X6CF 3H0TB 1MWAH 4TTGA 3MV9D 3ZT7A 4H26B 1IM9B 4OZHE 5CBEB 1VGKB 4QHUA 3MGAA 4JDZB 3I3DA 5KVFH 4Y16C 1DUZB 4UINH 2Y5EA 4FXGB 2EDRA 3WS3B 5JPNA 2IGFL 1QPPA 1X5LA 2LABA 1HCFX 2EXYD 4L4JA 1KB5L 2KDGA 1XGQA 5IMOB 2QR0B 1U91B 1Z5LA 3G08A 4G6ML 4I2XB 1YN6A 4G8EB 1B0GA 2P24A 1XEDA 4LSVL 4F58L 5HI5C 4Z7WA 5C8JA 3X17A 4AQOA 4NO3A 3PGFL 3ECBA 2CK0H 1NCCL 2XWJA 5HSFA 1MQKL 3L7FA 4XC3L 4H1LA 4DKDC 2PO6D 1F45A 2Y5TA 3SDAD 5IHBA 3T4AB 5HTSA 4KJWD 2VLRE 5DHVH 2QKIA 3BKJH 4JZOA 2Z92A 3F7YA 4WWKA 1E4KA 2YN5A 4QOKB 4AENB 1ZHNB 3MRHB 4QHKJ 1T80A 3DLQR 5HYJB 4YGVA 3CC5A 5A1AA 1JGDA 4CGTA 3MXWH 2VUOA 5C0BD 1MLBA 4UDTB 3L3JA 3MBEB 4UILL 5CSZB 5T3ZL 5B38G 1MCLA 5I74C 1P4IH 4WFGD 1OB1A 1QBAA 5DDHA 5F3BB 2FBJL 5KVGL 4P23C 1ZVYA 2ITCA 4I9WD 1I7TB 4Y1AD 5CSBA 1IGYB 3V52L 3QUXA 1FFNB 2F5BL 1V7ML 1LO5B 1ETZB 4F15C 4MNGB 1OAXL 5TE6H 5JLZB 3DYOA 3KAAA 3QI9C 3EYVA 3NGBC 5IT2H 3SE4C 3SY0A 5F93C 1RU9L 1N8ZA 4CN6A 3DETC 3S98A 5EUKA 4YR6B 1YYML 1YZZA 1QSZA 5D6DC 3OKEA 2F54D 2VDMH 2F53B 4HF5H 4YDLC 4WEUD 5EZIL 2SEBA 3H9SA 2AXHA 2R56L 3BP5B 2LTQB 1ZLUK 1ED3A 3NIDE 4RFNB 1D5XB 4HZAA 3QRGL 3FO1B 1KPUA 1MCKA 5EOQL 5I6XB 1Y18B 3OKLA 2VDLH 1U8OB 4ELKB 4OLVH 2Z8VC 5BV7L 3X13B 1D5ZA 1WTLA 3O2DA 3VXSB 3EZ8A 2AK1H 2X4QB 3ZL4L 3QP3A 2GJ6E 3BVNA 3RNKA 3MRDA 2P5WE 3R06B 3ZYIA 1F2QA 5DRZB 1RZFL 3TIDB 1NCNA 1WFNA 5E2VH 5FO8A 3QFJE 4IBLT 4X4XA 1OTSD 3GIZH 4JPVL 4DFHA 1BVKB 2CDEA 4WWID 1IM9D 5E5RB 3MV7A 4GAGH 5I1JH 1TETH 2P4AB 3MLXL 3SOBL 4NUGL 5J4MA 3RVVC 1WBYA 1TZGH 1GHFH 2A74A 1EFXB 1A6AB 3FT4B 1KG0A 3PP3H 4MD4B 3NIGE 4NCDA 4M6AA 2D7MA 3HE7B 4JJHA 1S8DB 3PGDB 2BDNL 2VLMD 2BC4A 5IOPB 4FQJL 4O4YL 3TCXA 1OSPL 4BH8B 3OMZA 4PJHA 2EYTA 3O3AA 5DC9B 5I0ZA 5E56A 5E6IA 4CRPA 4JQIL 5CJBA 4Y4KA 2GW5A 5TDPA 3ZKSD 1YQVL 5J9PB 4XMLH 4U6VH 3ZKND 1PKQB 2QSCL 1WT5A 4J4PC 5BO1L 2VERN 4NQSB 3RFZC 5K59F 2YPKB 4R97C 2IALA 4LBEA 1RZGA 3MCLH 3KR3H 4QXTB 3DMMC 5C2BL 5LVEA 4P5MB 4E42B 4PG9B 5HYJD 4Z76A 5I17A 3MRGA 5HPOA 5J1AB 3JTSB 5DJXB 3FB7B 5EN2A 1F3RB 3WKNA 3MBED 1G1YA 1IGML 3WD5L 3EIFA 1M7DB 2Y7QA 5D1XA 3OXSA 1AP2B 3UTQA 1R3LB 2HT3D 3B2VH 5GZNC 4XC1H 1I1AC 1KBGH 4KQ3H 3QRFM 5I1EL 1LP9E 4OGAD 2IQ9H 1S9XB 1DQML 4G8GA 2D3VA 1TTFA 5FYLD 3HAEB 4TRPH 4KI5D 3PWNB 3RL1A 1J1PL 2EIBA 2VXSL 3NZ8B 4BYHA 1EPFA 5IBLC 3V9FA 5L0QC 4JM4L 2CLRA 3HC0A 5I19H 3LEXA 5CJQH 3LKNB 4K3DL 5DJZA 5F7WC 3GMMB 3BRDA 5FK9B 3W9EA 2MQCA 2O5ZH 3CLFL 1WGOA 1V05A 2F53D 2Z31A 4N0CC 1ZT1B 3OKMA 3DIFA 4GUPB 1KCUL 3HZMA 3ARBC 5LG1A 1Y6MR 4JGMA 1HSAB 4JCLA 3QXVA 2VNCA 3TIEB 2KUTA 4LSQH 1TJGL 1I7RA 1FRGH 3VXSD 4M6NH 4PGEA 3BI9X 1OWWA 4JLRA 4C59B 1PSKL 4JY6A 3QEUB 5C0IA 4TUJA 4PJBE 2EO9A 3IYLW 4DZ8A 1JZ3A 1FLRL 1GGBH 5E95B 4U7KA 4PRDB 3EOAB 4I8DA 1Q0XL 1RI8A 1HKLL 1WC7A 1CWVA 2AJ3A 4M00A 1I9EA 1O7SA 1U8HA 2E9BA 3GB7A 3QISA 2UYLA 3KJ6H 1GZQB 4CADB 5IGXH 4E0RA 3ULVH 3NMEA 4LLQA 3BISA 5F7HA 2CUMA 1EFXD 5HPMA 1MCPH 1NKRA 1JPSL 4OFYD 4LKXB 2JELH 4U0RC 3DXAA 3HE7D 1NAKH 3MUHL 4OF7A 2EH8L 5F3HB 3CDYA 2HJFA 2BCKA 1R3JA 4Z7VA 5C0AA 1WCBB 4LRNH 2Z91B 4KK5C 4QRRA 5DD6B 2Z4QA 4X6FB 5JTWA 1KTRL 3R8QA 5FA3B 3KNBA 3MODL 4YXKH 2LU3A 3ZE0F 4BZYA 1V3KA 4K55A 3EOBB 3T2PA 1RFDH 3MLWL 4DZBB 3I50L 4GRMA 4CVZB 4GS7B 4NKDA 3TJHD 1EEYB 4KVNH 4PJ7B 3ZE2F 1WUNT 3WYRA 1G9NC 3RWIA 2BSRA 3MUZ1 4P9HL 4LSDA 5I0DA 4ELMB 4W4OC 4IRJB 1PX3A 1A4JA 5ELIA 5K9QG 3QIUC 4BQCA 4L8DB 1KB5B 3IGAB 5ANMB 3HHRB 3MOAH 4XNUL 5CD3B 1UJ3A 5FYLH 1R0AH 1UM4L 4JKWA 5KSBE 3ARPA 3CD4A 4GKZA 4PD4K 4P3WA 4D0DB 1JGVH 1G1CA 1XIWA 5B8CB 4W81A 1EUUA 3RWHA 3PGCB 2NY2C 1FFPB 2DI8A 3LRSB 2DM4A 5KBNC 1MUJB 2YD5A 3T0WA 5DEGB 5DWUL 2DYPA 4FQLH 1C12B 5F7MC 4NPYA 3QAZC 1HEZA 4F33A 1BM3L 2GY7B 2DTML 3HNTL 3O6KL 1BIHA 3PWVA 5DVMA 3PP4L 2PTUA 2FECL 3DTXB 5C92A 4K8RH 2VXVH 3DRTA 4F9LA 2C3XA 3KYOB 4OIIH 3TT1L 3GMOA 3F7RA 3GUTB 3IDMA 2JB6A 1J0IA 4YPGA 2ADGA 5KG9B 1KJMA 5MHSE 1ZEAH 4XMPH 5DUBB 4ZUWA 4OD1L 2LAAA 1TVDA 2AK4E 2X7LA 4X5WA 5CEXA 4NNXA 1J1OH 1V7NL 4A2LA 4ODHH 1RUKL 4Z7UB 4OTXL 2NY6B 1NDMA 2MQ0A 2R1XA 1HZHH 4WU7B 4XMKL 3V2AR 1RZJH 5ISZB 4NNYB 3OV6A 4NO0B 2ESVE 2WBJA 5JIKA 5I2IB 1YQ2A 5GGUA 4U05A 2CLVA 2NX5A 3V6ZB 2YR3A 2W92A 5K9KA 2Y36H 3KYKH 4PS4L 1FZOB 3S5LG 5ALBH 4JG1L 3BH8B 3IU3B 5HYEA 2UUDK 3OF6D 5KJRL 3I2CH 3REVB 1FGNH 2DQFB 4MJIE 3RIFF 5JW4R 3P4NB 4QTHA 5FKAB 2ZUVA 3RWFA 1NAMA 2VDOH 4CMMB 2FBOJ 4N8CH 4OCXH 3CVHA 2I25N 5CP7B 3I6LE 3DI3B 4K7PH 1P84K 2W9LA 4LAJH 2D31B 3HB3C 3MO1B 3VXUB 1PLGL 3GBNH 1JZ2A 2VC2H 2FATH 5E8PB 4N8VA 3VXMB 4ZNEE 3Q48A 4EI6B 4HUWA 1UC6A 3IAQA 1MHCB 4IRJD 1YY9C 1L6XA 5C6PB 4NP4H 1RJZB 1P6AB 4YQXL 4GRWE 1WBZB 5CZXD 1S9YA 4F57L 4CDGC 1M05B 4PJDF 5EB9A 1QBMH 1AI1H 3QQ4A 1IC7H 3AM8A 1K8IA 3MUY1 4ZAKC 5C0CE 3KXFA 4G43A 1NCAL 1H3TA 2UZIH 2PYEA 3ULUL 2F5AL 5D72L 3BT2L 4LNRB 4OLYL 4FFZL 4QHUB 3IS0X 3T2NH 5DYOA 5MENE 1T7WA 1F4XH 1NFIA 3ARGA 5IFAH 3SJVA 5JPNB 4MCYA 4AG4H 2G5RA 2NNAB 3LKRA 1YC8A 4DKFL 4PJIE 4L8SB 1XF4B 1XGQB 3WJLC 4XVSH 1Z5LB 3VJ6A 1YN6B 1E28A 1YPZF 4P99A 2Q3AA 2LU4A 3EUUA 3OPZH 1Q9WB 4QCIA 3LHPH 3CMOH 4GXVH 4I0PC 3AS1A 1BGXH 2XWJB 4LIQE 2NQCA 1AD0A 1UKTA 3VI3F 4S1DC 2Y5TB 3PWPA 4OT1H 2VMFA 5TQ2H 1BF8A 1WAAA 2EYRA 1I8MB 1FVCA 3F7YB 4WWKB 2NY6D 4NQVB 1MOEA 3D3VA 4JZJC 5ISZD 4NO0D 3F12A 1I75A 3SGKC 1KENH 1RHHA 4L1DA 1JGDB 2X41A 1CFNB 3QDJE 1MF2H 1MLBB 3L3JB 4F80A 3MCKB 3VXRE 4OQ1A 4DUXA 5MEQB 1AC6A 2PKDA 5I16B 1R3IL 4JHZA 3PIQA 1OB1B 2XYCA 4MDJB 5BS0E 1TCMA 4MJ2A 1D3CA 2P8MA 4FTVE 4AMKL 1L7TH 4Z8FL 3BKML 2VUYA 1X5GA 1CU4L 4XBEH 3WFEL 3S8WA 3EFDH 3D48R 4CW1B 1CLCA 1LE5A 1OD9A 5HHOA 2FL5B 3AFLA 4O58L 3SY0B 3QZWB 3ALPA 1L7IH 2GK0B 3OKKA 5EUKB 4HX1B 5K9JH 3L1OH 3SGJA 1IVLA 4ERSH 1S7XA 4PGBB 3H9SB 2DQJH 2ZOKA 3SE8L 2DIAA 2JCCA 4RSVA 1MLCB 3MLUL 2X2YA 1DBAH 5I8EA 1OTUC 3VXUD 5BXFB 5FIEA 3VW3H 2H8PA 2YOCA 1YNTA 1KPUB 3O2VL 3OKLB 5DVNA 1UA6L 3BP6A 3VXMD 1KJ3L 3MLRL 4JPWL 1JUFA 3FHQA 2DL2A 5ECJE 5KTEH 2VLRB 4URTB 5E99L 4K7FA 3BVNB 3HUJE 3MRDB 1PZ5A 5EA0H 2P8PA 3OG4B 3MPCA 4KGJA 4X4XB 3HCVA 2CDEB 1KLUB 3V6FA 5KVEH 4JFEE 2DIJA 1A7PL 3NCYP 3CZFA 5F7YC 4QXGL 1CL7H 2Y72A 4OFDA 1TTUA 4LQFH 3D2UA 1WIUA 2A74B 2CRYA 1KG0B 1GOFA 3VRLF 2NY7H 1CCZA 1ROWA 2HT4C 2OL3A 1N4XL 3QYCA 4OGXH 2BC4B 3UYOD 1NMBH 5EWIL 5EH1A 2BY1A 3B83A 4B50A 4WI5A 4J3SA 4PJHB 3MCG1 4B5EA 2G5BA 2EYTB 1OCWH 3O3AB 3QDMA 5GJTL 3VFRA 5HHVH 1A22B 5E6IB 2Q8AH 4NSKA 4MB4A 2VDNH 1UXWA 1J5OL 4Y4KB 5TDPB 4M93C 5GGTH 3DURA 3HS0A 5GGVH 3OG6B 1AD9B 4I18B 4Z5RA 4OZGF 2B4CL 4X7CC 2EC9T 3O3EA 4WWKD 3TN0A 1A47A 1RZGB 2L0DA 1ZANH 3KLAB 4UTAH 4JKMA 4PJFF 5JHDA 4ODTL 1KPVA 2W91A 2D4FA 4GFTB 1A6VH 15C8H 4Z76B 4LLYB 3O0RH 3FT2B 2PYFA 1KEMH 5I17B 2NZ9D 1ZSDA 4OI9A 1AE6L 2EDKA 3DHMA 2ICWJ 5EN2B 1XT5A 1I8IA 4NQXA 1X7QB 4RISL 1CXFA 2GJ6B 5D1XB 2P5WB 1SYVA 3OJDA 2AGJL 5JOPE 5EU5A 3F58H 3M8OH 1TZHA 4GMTH 1G0DA 5D2LE 4WEBL 2EIZA 4I3RH 4WJ5A 4LOUC 1P53A 5DMIL 1DL7H 2E7LA 5CINL 3RL1B 8FABA 5MI0C 4JR9L 5DJ8A 4HUMB 1CGVA 3EO1A 1T5XA 3JWDL 4JN1L 4QRSA 2C9AA 3HC0B 3LEXB 2AQ3A 2WLZA 1CGUA 5DJZB 5J6HA 5JZ7D 4MJ6A 2HG5A 3GJEB 1NLBL 4U1JB 3H9SD 1TVHA 5E8OA 3OKMB 4N1CA 1WWAX 3HZMB 5DI8B 4Z7NE 4OCSH 1OP3H 4UNTA 4LHUA 3SKJH 4Q9QH 4WY7H 1A3LH 3VI4E 4FMFA 3TFKD 1I7RB 3VD3A 2HFFA 3W2DL 1A64A 4GSDL 5E2JA 3BN9D 4JLRB 5J8OA 3H8NA 4DGIL 2VLRD 4JY6B 5C0IB 4TUJB 3OQ3B 4UV4H 3B5GA 1T7YA 3WNLA 4FFYL 1MJ7H 3E3QC 5EIVA 4YPJA 4HWEH 1A3RH 1CGXA 1WC7B 3IDXH 4LCIH 1U8HB 2GAZB 2UYLB 3T0VA 3X3FL 4E0RB 3T0EA 2PF6A 2OP4H 4LLQB 3UZQA 4ETQA 5FYJL 5GGQH 3DO7A 4S1SH 5HPMB 4ZUTA 1HXYA 5D7IF 4IIQA 4KTDH 4GQ9L 2VLKA 3DXAB 4P2RE 4DQOL 3EJZC 3PDDA 1LP9B 3CH1A 5KSAC 5KAQF 4YHKL 2HJFB 2A73A 2BCKB 4GBXB 4KV5E 3DUUA 4HWBH 1S7RA 5E6ID 2Z4QB 5TDOA 1WISA 4Y4KD 4BKLA 4WIQA 4I48A 2Y06L 1LMKA 3RWCA 1EXUB 4FFWD 1BD2A 1IFHH 4P3CH 5HYSG 1CDIA 3NA9L 3BEVA 1WITA 3PL6A 5I1KH 4YGAB 4X4ZA 4GMSL 4NKDB 4HK3N 4PJCF 4N5UA 1KCVL 2OL3L 1M71A 3SKNB 3WDIA 3RWIB 4XPBL 1F58L 1SBSL 2J8UA 2YXMA 2IMMA 4H88H 2ZZUT 3LD8C 3QQ9C 3MA9H 5GRWA 3SE9L 1WIOA 3INUL 1O7VA 2GJ6D 5D1XD 4NWUL 4PJXA 2P5WD 5H37H 1CLZL 5FYKD 5ESAA 3GSNA 1A4JB 4JKPH 4ZOBA 5HHXL 4MCZA 3TZVC 4JFDE 1BBJB 3VDBA 3U0TA 1C1EH 4WO4A 1U0QA 4M5ZL 5FUOL 4RDQG 3BPOB 4JVUA 1BQHG 3A6OA 3U4BL 1ND0B 1XIWB 2APVA 2R8SH 3QIBC 1WZLA 5KAQG 5EZLA 3ILQC 4JRWA 5LXGL 4GAYB 3MLYH 3UYRH 2OLDA 2ATPB 4QTIH 2AJUH 1DFBH 2YEZA 2DYPB 3FOLA 1AFVL 8CGTA 3B8YA 2D7OA 4NPYB 5I1AA 1HEZB 4F33B 1QP1A 2E7BA 3QHTC 3RIAK 1JZ8A 3MJ7A 3PWVB 3OGCA 3EHBC 4K3EH 3TBTA 3ZE1E 4GKSA 4OCRH 5D1ZA 4PY7A 3K81A 3MV11 4HIXL 3P0YH 3IDMB 2JB6B 2X4PA 1IQWL