2YWYA

Structure of new antigen receptor variable domain from sharks
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
b'AWVDQTPRSVTKETGESLTINCALKNAADDLERTDWYRTTLGSTNEQKISIGGRYVETVNKGSKSFSLRIRDLRVEDSGTYKCGAYFSDAMSNYSYPIPGEKGAGTVLTVKAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords new antigen receptor variable domain
publication title Shark IgNAR antibody mimotopes target a murine immunoglobulin through extended CDR3 loop structures
pubmed doi rcsb
source organism Orectolobus maculatus
molecule tags Immune system
total genus 26
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ywyA00
4OV5A 4NT6A 1CFNB 2G5RA 2PYED 3ZYJA 2PN5A 3TBVB 5DFVD 1A4JA 1RVFL 1JZ6A 4Z7QE 1ND0A 4JFED 2NZIA 5E5RB 1T0PB 3U4AA 4YBLB 3Q5YA 5HGAA 2FEEL 4O2CB 4APQD 3V4VL 2QKIB 5C0IA 1SEBA 3TO2B 5F3HB 4PGZA 2OJEA 3QH3B 2YWZA 1CGVA 3MCLL 4KUCD 1KUMA 3DV4A 3QCTL 3RNQA 2OMNA 4LEXL 4LLUA 5HD8D 1MFAL 2AK1L 1DBBL 4QXGH 2A9NL 4LCCB 1EFQA 1EV2E 3KS0H 4ODSL 5DMGC 2A6JA 1E4XH 2EH8H 5EOCH 3JTTB 1AGDA 2IPTH 2F53B 2CLZA 1YPZB 1WWWX 4P46A 4DUXA 4D3CL 4XNZC 3MV7D 4MDJA 4NFDA 1B0RB 4FQPA 2B1HL 1HXMB 1NKRA 2J88L 4Z7UB 1C1EL 1K2DA 4OBSA 4U6HA 4HMEA 5C3TA 2DJ4A 4F33B 2H2SD 3BP7B 5BV7L 4Z7OE 5EUOA 4OI9A 4KI5D 2E7LA 1IZKA 4EUPH 1NC4D 4PRIB 3LKRA 4XBPB 3LD8B 1G7IA 3HS0A 3AMLA 2VIRB 4YDIL 1TZGL 4M93C 2D0GA 4NM8H 4HK3N 3CXDH 2KQNA 4WIQA 3QWOA 5I1EL 3QHZL 4XPFL 2DF3A 4P3CH 1J7VR 1ZSDB 4NIKB 4X4ZA 5JW3L 3O3DA 4ZFFA 4RGND 4A2MA 1PG7L 3B5GA 1OCWL 1YMMA 4UU9A 1MPAL 5I76A 4FXGA 1VADB 3HE7A 5B39A 2GTWB 3VFUB 5C1MB 1IKFL 1I9EA 2ADIB 1EEZB 5JXEA 2W91A 2EIDA 5CZXC 1CDUA 2WBKA 2BY2A 2HRPL 5I30H 4HX1A 4CNIA 1GC1L 1E4XI 3PQYE 2VITA 5I8OH 2XA3A 2FCBA 4FQJH 2A1WL 3UTTB 3R0MA 2IBZY 4NJ9L 5JR1L 3WE6A 2YWYA 2XYCA 1DUZB 5I1JH 4JFXB 2DL9A 3P11H 3HZKA 4NHUA 2YD2A 4L8CA 4Y0GA 3MUGB 1E4KC 5E8OA 1R3HB 4RZCA 1JHTB 5L8LB 3C5ZC 3NCYS 4M61B 4NRXB 4QRRA 1A3LL 3L3GA 1A1MA 3DSFH 3NCBB 5GS1B 1CLOL 3QIBA 1AHWC 1ZHBA 1KN2L 1NGXB 3ULUF 2R69H 1P1ZA 1I4FB 4BFBD 3MLVH 3BKJL 3H7BB 2E6JA 5C0CD 2JCCF 2X4RA 3KAAA 3KVQA 1DFBL 3WEXA 1DQLH 1FVDB 2F8XC 2B5IC 1XH3A 4K7FB 2IPUK 5KSAC 1L6ZA 1OARL 2YXMA 4EDWH 4JRYB 4XH2A 5DRXA 5C09A 3OR6B 4PGDB 3TA3D 3TIDA 4FN0A 1PZUB 2AEIT 1U3HD 5H94B 1FNSH 1MI5A 1OWWA 1H15B 4YE4L 3QUMH 1WVZA 3LQZA 5FA4A 5HHOA 4J3TA 3QAZC 2ADFL 3LOWA 4YQXH 4HIHA 2J3SA 5E1AB 3CMOH 2HKHH 1RZJL 1A7OL 4IRJD 2MCPH 4PGBA 3ARED 4KMQA 1LQSR 3OF6D 4PJIB 4M43L 2GSIA 4DKFH 4BUHA 1VA9A 1RIUH 2GYSA 3PWPE 3RVXD 5DWUL 1UCBH 1EZVY 4JANB 1NBQA 5HYQB 4PGCA 2Q7YA 5ICYA 2Y1VA 3K46A 3IFLL 5D2LB 1CK0L 2ZUUA 4L4VA 2Y07L 5F6HI 1HNFA 2WBJD 4L4JA 5IB1B 3V4VH 3DGGB 4CU7A 1CGXA 3PL6B 1ES0A 2IGFL 3H42H 5FB8B 3VXSB 3W39A 3STZA 3UYPA 5KSBF 3E6FA 3MCLH 4LCWB 2CH8A 2JJTC 1CDIA 2CUMA 4PLKD 2NY1D 5CBEA 3GSRB 4JJ5B 5E4EC 3ZE1F 4R4ND 3HC3L 1MFAH 1RZGB 1DBBH 1KTLB 2A9NH 2RHEA 4OD2B 5F7MC 3D6GA 4HDIB 2NYYC 3TWCL 4ODSH 4RGMC 1OAUL 1E0OB 4NO5B 2DWDB 3TN0D 3JUZA 3IFOA 3QO1A 4D3CH 1KCVH 3BPLC 4MQXD 5E9DA 1AR2A 2B1HH 3RWJA 5FECB 2J88H 1C1EH 4OF8A 1I8LA 3RGVC 1YPZE 5DZOA 4XI5D 3JBG7 5GISH 5I8CA 3UTQB 2XY2A 1AY1L 3OAUL 4XNQA 5DD5L 1UM5L 4H1LG 4Z7UE 2YHGA 5BV7H 4WEMB 4OF5A 1L9MA 4Q6IB 4HUVA 2M1KA 3QIWB 4F7TA 3ZDZE 3UC0L 3SGJC 1VKXB 2WUBH 3CFKA 3DXAA 5DVNA 5ERWB 2EZ0C 4P49A 2DS4A 1TZGH 4MJID 4K3JL 2P24A 3CC5A 5F3BA 3M45A 3GJEB 2QQLL 5I1EH 3QHZH 5GGRB 4XPFH 5JW3H 5C3LD 4LCYA 3MRLB 1AXSB 2CD0A 4KK8D 3DX8A 4PB0L 4XP1L 3VWJD 3QDMB 4KKLC 1PG7H 2YPLE 3TBYA 2OXGA 3WNMA 2XY1A 1MPAH 4P9HH 1UM6L 1XAUA 3NMEA 3IDYB 3BAEL 4XC3L 1IKFH 2AKRB 3FQRB 4GOSA 4WO4B 1OTUD 4OGYL 2F58H 4OLWL 4P5KB 5JOPD 3ESVF 2HRPH 3VXUE 3VGAC 5FFLA 3LKOB 1GC1H 4NQED 1F3JB 1LO5A 3SY0B 1MVUB 4KJWD 3ABZA 2A1WH 4HXBL 2VLLB 4PJAF 4H1LB 2G2RA 2Y6SD 5T1DL 4Y5YA 1FZMB 3CIQA 4WENB 5D7LD 4MS8C 3UTTE 2WINB 1L7IL 5I74B 2H6PA 2CLVB 1HDMB 2DLFL 4AT6A 1QFWM 2X05A 1IAIH 1UG9A 4PJCA 1BQSA 1KNOB 4WW2F 4YFDB 3QQNA 4XBGB 5A16B 3WFEH 3PQYA 4PJ9C 5BO1L 3P0YH 3PGFL 1JPFB 3VD7A 1KN2H 4FQCH 1EVUA 5A2JH 2D4FA 1A4KB 2BVOA 5DRNB 2A6IA 3BKJH 5D7KD 3P40A 4G8IA 3P4MB 1DFBH 4HH8A 4NQVA 4P2OA 5JW4N 4HK0A 5I71C 4Z7VE 4HUWB 4NN5B 4X4MA 2YC1B 4BZ2L 2FHFA 1LE9A 2GIYA 4LNVA 2ZG1A 5F7WC 3SHSA 4DVBA 1OARH 4OZFH 4WDIB 3X11A 4G8GB 2IBZX 4HPYH 2JF1A 2A6DA 4HH9A 1IGIL 3TV3L 4XBEL 5MI0C 5E99L 4NPYA 2VLRE 4FQLH 3RVTC 4R8WH 3Q6FB 4ZTPL 3L5WA 4MNGB 4WWKD 5CJXC 2I27N 3U0TA 5M7QA 1OGTA 4X4YA 3DYPA 3ARDB 1QACA 1ODAA 2I5YL 1RK0B 1O0VA 4ZOCA 2NY6B 3RHWK 1GOGA 2IPUG 2X40A 4M43H 4P59L 1HCVA 3BP5B 4N0FB 1IAKA 4PJ7A 3O4LD 3UYOD 3ROLA 3ROOA 1KYOK 2Z35A 5C6TL 3HFML 3OKLB 4L3CA 4PJFA 4LRNH 1IAII 2C26A 3VJ6A 1X5ZA 3NFNB 4FQ1L 1VFUA 4WUKL 1Z5LB 4XNXH 5T1KA 3A6CL 5F7EL 4JFFE 3TYFA 1R3LA 4FHBD 3MRJA 1J1PL 3IFLH 1PEZA 1CK0H 1WCQA 4NRYA 4Z77A 1F4YL 2ZPKH 2Y07H 5EWIL 3UROR 5IW1A 4ZO6A 1P4LB 4OZHB 4YBQC 3NCJL 3O41B 2R56H 1I7TB 2H45A 3NN8B 4MA3B 2IGFH 1JHKH 4LAJH 1R3IH 5TQ0H 1WBZA 3KPPB 2OTPA 1NCNA 1YC7A 5C92A 3RWGA 4R26H 1I3RA 3HC3H 5C07E 3ZYIA 4Y5XA 4OT1H 3JVGA 2Z4QA 1SJVA 5J11C 3HR6A 5DI8B 4GRLA 4HC1A 1RSFA 4AIZA 1RJCA 3SKMB 1CDYA 3PHSA 1OAUH 2HMIC 5T3ZE 4MMXC 1CFNA 5HY9B 1CD0A 4XT1C 3Q6GL 5D9SB 4L8SC 5DLMH 3TBVA 3V4UL 5GQBA 4G9DB 3VXPB 4P46D 2NY0D 1EZVX 1I1RA 2AJZB 1JF6A 1S7RB 3EAKA 3GHBL 4O2CA 3BDYH 2QKIA 5HHVH 3TO2A 1CZ8L 5F3HA 1IC4H 5HHPB 3QH3A 4MHHI 4F3FA 1AY1H 3OAUH 1UM5H 2YD1A 1R5IB 2VZVA 3RIAF 4LRIA 2ZCHL 1B4JH 4X0KB 3T3PF 4GAJL 2A2QT 4LCCA 2ZUXA 3CGTA 1MCPL 3MGAA 5HI5C 2UWEF 3TJEL 4PJXE 3JTTA 2QQLH 1U8PB 3WN5B 3LN5B 3DBXB 4UNTA 2F53A 5J7CC 1YPZA 3OGCA 1DE4B 3FRPA 1FJ1A 5CGYD 5TE4L 2NY4D 4ZFZB 1B0RA 3QPXL 1HXMA 4Z7UA 1YMMD 2AJ3B 3HG1E 1MIEH 3BAEH 3F6LA 3HE7D 3K80A 4Z76A 3WIFB 4F33A 1IQWL 1DDHB 3M8OL 3EOTL 4OGYH 3BP7A 4OLWH 2D7TL 2ZUTA 5JXED 4PG2C 1GIGL 4UT9L 4MGXA 1IEHA 4PRIA 3LEYH 4XBPA 2R4RL 5JIKA 2VIRA 2VC2L 4Z0XB 1DEDA 4HXBH 4H5SB 3V52L 2AJVL 2R0ZL 1WSST 3AM8C 5I1AB 5IW6B 4OLEA 2OK0L 1J0KA 1HH9B 4HD9A 2C1OB 5T1DH 3UZEA 1NL0H 5HDQL 1OP3K 4UUJB 3VA2C 1MOEA 4IS6B 4H26B 3N9GL 2DLFH 2PO6C 5DT1L 4YR6A 3M07A 4O02L 1VADA 1XF4B 1HNGA 3VFUA 3OSKA 3SGKC 3TCXA 4P5TB 1V8HA 2ADIA 4M7KH 1EEZA 5DRWB 1II4E 4QRRD 4RBPH 3PGFH 2G9HB 4HMDA 3BGFC 3QIBD 3HZMB 4IDJH 4ZTOH 4NFCA 4FG6C 5KVDL 4NQCB 1M1SA 2UYLA 1A6UL 3UTTA 4JHWH 5LAXA 4R7DA 3FFDB 4KKBC 1DUZA 1N5AB 3GI8L 4MA1B 1JGDA 4JFXA 1XF1A 4M4PA 4F58L 3SDXB 1BM3H 4XPTL 1H3VA 3QJHA 3ZHKA 5DJ2B 1LO2L 5C09D 1JHTA 2NXZD 3TV3H 4LDLB 4XBEH 5E99H 4QXTB 3BSZH 4M61A 4NRXA 4KDVA 5FEBA 3E3QC 4ZTPH 3QUZC 5GS1A 4Q74A 1Q0XL 1MI5D 1NGXA 3WFZA 5J3HD 1T6VN 4ELKB 1I4FA 3GSQB 4NNYB 3PXHA 1JYNA 2MPAL 5HHOD 1KCSL 5TFSL 3H7BA 2ATKB 5KSVA 1HQ4A 5EU6E 3TT3L 2YSSB 1FVDA 3EO9L 3FB7B 4PRPD 4TTGA 3BZEB 5C6TH 4JRYA 5EBWB 1KENL 2VLRA 5C9JB 3IFPB 1A6ZA 2ZKHL 3PGDA 1E28B 1D5MB 2C3WA 3A6CH 5F7EH 3FT3B 1VESA 1L7TH 2GSGB 1FPTL 5HGBA 4HIXH 2V5RA 1J1PH 3QI9C 1LO3L 5H94A 4HC1H 1F4YH 4MJ5B 5EWIH 3ZHDA 4L4VD 1ZEAL 1H15A 2XZCH 1AQDB 1XZ0B 3NCJH 2VLJE 4PJDB 3T0EE 4LPVA 3TM6A 1YY9D 1G9NC 5F71A 1KJVB 5E1AA 2X4UA 3S34L 4PJIA 1RZKL 2Y7QB 3RUGF 2J8OA 3V6FB 4DGVL 1CICB 4P2CG 3KHOA 1QSFB 4JANA 3V6ZB 2Y06L 2D3VA 5HYQA 3KYKH 2DAVA 3EHBC 4RMUA 2JB6A 2IF7A 1WUNT 3Q6GH 3WYRA 3V4UH 3C09C 4QTHB 2CKBL 5D2LA 2X09A 5KS9F 3RWHB 3S35L 1IJ9A 5E9DD 5E2UL 5IB1A 2VKXA 2PW2B 3GHBH 4YHKL 3RU8L 3S8WA 3RZWA 3BD4A 3PL6A 1IFHL 1MCDA 5FB8A 1IEBA 1CVSC 4PBWD 3VXSA 2E7CA 1NAML 3WDHA 4KKCC 1YQ2A 2ZCHH 3GSRA 4JJ5A 1KT2B 4WY7L 4GAJH 1SMAA 2LV4A 1UZ8A 2QADB 1RZGA 2NY3D 4M7ZC 4OD2A 4OZIE 3ARGC 1TVHB 4TNVF 3QUYB 3DXAD 4HDIA 5IV2A 4J1UB 1MCPH 4S1QL 5CJ8A 5GS0L 3RQ3A 4NO5A 2DWDA 1FFPB 4LSSH 1A3QA 1NEUA 2HVKA 1LWRA 1G84A 1T5WB 3MV9B 3SE3A 3QPXH 5FECA 3PJSB 1PG7X 3V5KB 2VQTA 3K1DA 1HQRB 3TVMC 4MDIB 3UTQA 3M8OH 5ELIA 3EOTH 4HIEB 3RL2B 3QCUH 2YEZB 2V17H 4Z7NF 3VG0L 3IJHB 3IRZA 2CUHA 4UT9H 1GIGH 1DSFL 4Q6IA 5SWSB 3QIWA 1VKXA 1U8IB 1T83A 5BOPA 2YD3A 3ETBF 5ERWA 1J1XL 2VC2H 3O8XB 4KGJA 3V52H 2AJVH 2J12B 5C0GB 5GGRA 5L6YL 2OK0H 4HLZG 2DYPD 3MRLA 5F70A 3HG1A 1P7KA 2NQCA 5J56B 3QDMA 3N9GH 4XB8A 4XWOC 4U1MB 1WQVT 3BP4B 4XCYA 3VGGA 4O02H 4MWFA 1FSKB 3MSPA 4I2XB 4YNYB 2AKRA 1KJ2L 3FQRA 4WO4A 2NTSP 4JKMA 1YJDC 1WITA 2WW8A 3GSNL 4L9LC 4OZ4B 4P5KA 5D1ZC 3PQYD 5DFVC 4F15C 4F9LC 4LLYB 5TE7L 1AD9B 3AS3A 5DQ9B 4OZGE 4UIKL 3SGDI 1JNJA 2AJYL 3LKOA 4Y1AB 4XP5L 4W6WB 1F3JA 5KVDH 3SY0A 1HKLL 1MVUA 4RX4A 4G6AC 5T1LB 2VDPL 1A6UH 2VLLA 1JNLL 1MSPA 3N1PC 4H1LA 4ZUVB 1RURH 4P2OD 3T0BA 4JFPB 4EVNB 4NQCE 2O5ZL 2WINA 3FB8B 2ZSWB 5I2IB 2CLVA 4O4YL 4NO0B 4HWZA 4WEUD 4WNQA 1FNGA 1YEEL 1NAKL 4OM0L 1PEWA 1CXKA 2OR9H 1KNOA 2YUVA 5DHXB 3RBSA 3Q3GB 4XBGA 4E0RB 5A16A 1ZLWH 3RVUC 4HW6A 5CSGA 4G6FB 1JPFA 5B4MD 1MFBH 4ENEC 2MPAH 1KCSH 2GITB 5C0BB 5DRNA 3W9DB 3BQUB 3P4MA 5ACZB 2ZJSH 1U0QA 4HUWA 5FHBL 5ITBL 1UWXH 2K3TA 3EO9H 3UYRL 2H2SC 4J3SA 2H8PB 4JY4A 2YRPA 5KVMC 2PR4H 4M1DL 1VGEH 1OAKL 3LEVL 1KENH 4WDIA 4G8GA 2ZKHH 4TUKL 3C60C 4OD3H 4GXVH 1I7UB 2VH5L 1FPTH 5T1KD 1LO3H 2R0KH 2JELH 2P8MB 3H0TB 3Q6FA 5E8PA 2HT2D 4CDHA 3LRSB 1J1OL 1U58A 3VXTB 3IJYA 4MNGA 4ZODA 3RAJH 3E1F1 3PWLB 5D93C 1S7TB 1LDPL 4Z8FH 3DI3B 3NPSB 2ZUQC 1RK0A 4XMPL 3D69B 2N7BA 2X1OA 4QRPB 3BP5A 1RZKH 4N0FA 4DGVH 3ECBB 4MAYB 5IHZB 3WKML 3EGSB 1AJ7L 1UWEH 4GRLD 5E2JA 4XP4H 3W2DL 3NCMA 1Z5LA 1FGVL 5SX5K 5JIHA 2X70B 2VLJA 3QHFL 3BT2L 2CKBH 3EYVB 3E6HA 3QB7C 3NCFB 5BS0B 3S35H 2DKSA 4L3EB 4OLYH 1P4LA 3BYTA 4OZHA 4JPVL 5E2UH 4ZSOE 5FDWB 3O41A 1I7TA 4YHKH 3NN8A 4WFHD 1I3VA 4MA3A 3SJVE 1IFHH 3BW9B 1U8HB 5ID1B 4P4RB 1PDKA 3KPPA 1F4WL 1FZOB 4WY7H 3JTSB 3G04B 3S96B 1L4IA 3PV6B 3FO2B 1CL7L 1MRCH 2W0LA 2XQBH 5DI8A 4QXUH 5FYKD 3RWCA 2ZOLB 3MRQA 3SKMA 3KPTA 5GS0H 1AXIB 5HY9A 1FVCB 3O3EB 2WWMC 3MRHB 3QJFB 4JZJB 4GKNB 3CCHB 5F96L 4G9DA 3MRKB 3VXPA 2F53D 2J8UF 1UXWA 3P0GB 3C8KB 3MMEB 1KJ3L 3F65A 2VXSL 1S7RA 2YR3A 3IU3B 2EYRA 4N5EC 4AQOA 4BSWB 2DM7A 5IG7B 12E8H 3MRMB 5SWZB 2APWA 1NKOA 5HHPA 2Q1EA 1R5IA 2VAAA 1DSFH 2XWBB 4PGEB 5FA3B 3I3EA 4X0KA 1WEJL 5AEAA 2GAZB 4PRID 4TULL 1WGOA 1QVOA 3GI9L 4NWUL 2FJFA 1U8PA 1GXEA 3GEWB 4W81A 1TITA 5ANMB 3ZSSA 1INQA 2XG5A 4NBYB 4WHTB 4G7YL 5ALBL 4ZFZA 1WIOA 5I8KL 3WNLA 2AJ3A 1RHFA 4M5ZL 4W6YB 5AWNL 1KIRB 1HYSC 4MZ2A 4NZRH 4OLVL 2X1QA 3WIFA 1DDHA 4POZD 4RDQG 5TE7H 4XNMB 1EVTC 2GJJA 4IIQC 4U6XA 3DTXA 4M8VA 3ULUE 4UIKH 2AJYH 1CXHA 2HTKC 3BJ91 5EFIB 2FR4B 1E4WL 1HKLH 3M1BB 4KQ4L 4Z0XA 1B0WA 2VDPH 2JCCE 4I8DA 2CDEB 4H5SA 1JNLH 3BD5A 1HHKB 3UTTD 5I1AA 5IW6A 3L3KA 4J2XA 1HH9A 4Y8AA 2C1OA 5CJQL 4RA3A 4UUJA 2HFFB 2O5ZH 4IS6A 4H26A 3E8UL 2VN7A 2LAGB 3BKYH 4PR5B 4X6DF 4J7RA 1MREH 4LMQE 5AYQA 1BECA 2W0FB 1YEEH 1NAKH 4OM0H 2QQNL 4AIXA 4OLZL 4U05A 4P5TA 2QR0B 4XMLL 1N26A 5DRWA 4NUGL 1LD9B 3QDGB 1WTLA 2G9HA 4XNZB 2DI9A 1OTTD 1G7JB 4M6NH 2HT4D 4NQCA 1EEYB 1UACL 2BC4A 2ID5A 5DXWA 3E2HC 3F7YB 5FHBH 1NBVL 5ITBH 3UYRH 4XNYL 3FFDA 4P9MH 4QHUB 1OQXA 2CUIA 1N5AA 5C0BE 4K9EH 4XCEB 2OQJB 4ZYKB 1A64A 3SDXA 1OAKH 3LEVH 1F13A 1MLCB 2DICA 3ARTA 5DJ2A 4JRYD 3WUWG 1AGEA 2VLRD 4M93B 3WJLA 2YUWA 2VH5H 5BVJA 2N4IA 5BW7C 4JN2B 4QXTA 4NNXB 2PTUA 2ZUYA 4S1DD 1RI8A 4M1GL 3GSVB 4K94H 1ZLVK 3KPRB 4PRNB 1V3LA 3WFDL 4QF1A 4ELKA 1DZBA 2HTLD 4KGLA 3GSQA 4NNYA 3AVEA 3AMKA 4KI1A 5KSBE 1CG9A 2ATKA 4WI9A 3BDXA 4KDWA 4TNWF 5CP3A 5EU7C 2ARWA 2YSSA 3ZE1E 3WFCL 1YDPB 4NFBA 3DO7B 2DDQL 3BZEA 4LSRL 3WKMH 1I7RB 3VGEA 5EBWA 1IGFL 2DWEB 5C9JA 1E28A 1D5MA 2XZAL 3FT3A 2GSGA 1JNNL 3QHFH 3OJVC 3BT2H 5E8NB 4IHOB 4MJ5A 5BRZE 3TZVA 3ILQD 4ZOEA 1FZKB 1A2YB 4JPVH 1AQDA 1CIDA 4PJDA 1NGQL 4JG1L 4IRSC 3O0RL 3QWRD 4GT7A 4EIZC 1DLFL 3C5ZB 5GSVB 1KJVA 3SDDC 2DQUH 3PL6D 4R0LA 4HEME 2EIBA 5FKPA 3VXSD 4LVNC 1F4WH 1I1FB 5EZJB 1NCUA 1U2HA 4G9FB 5KN5B 2HT3D 2Y7QA 4KDTC 1AHWB 3V6FA 1CL7H 4X7FC 2BSSB 1YNKL 5T3ZD 1CICA 3DO3A 3KPMA 1QSFA 3HAEH 5A3IC 3FMGL 4ZPVB 3DX6B 5DJ8B 3VGBA 2YOCA 3NABH 1NMCC 4ZSOA 3MLUL 4XTRC 4QTHA 5F96H 2VSCA 4U2ZA 2B5IB 3SJVA 1KPRB 4I18A 3RWHA 3CH1B 5T3XL 2A83B 2GKIA 2ICWJ 2PW2A 1KB9J 5TPWL 4PV9B 4BFIB 3PP3K 3G6JF 4ORGB 3QSKB 2FX7L 3HZVB 1I85A 1MF2L 4MB5A 3O2DA 2R0LH 1KT2A 4JFHE 1WEJH 5SWZE 1CR9L 3QIWD 4LNRB 3OJMB 1TVHA 3QAZB 3QUYA 1GCFA 3EJYC 4J1UA 1HINL 3GI9H 4PJAE 3AU1B 1YUHB 3D39B 4TUOB 4KJPC 1G9MH 2VDOL 3HG1D 4PJEB 3FO9A 1T5WA 1LP9F 4G7YH 3RP1A 3QDMD 3MV9A 1E6OL 1C7SA 4K8RL 3TPUA 3PJSA 5IMKB 4DJMA 4HG4K 1HH6B 4R3SA 3V5KA 4M5ZH 5AWNH 1HQRA 5I15L 3ZT6A 5E8EB 1UCTA 4MDIA 4WTXA 3VGFA 5HPMA 1L6XA 4HIEA 2YEZA 2JTDA 4WO4D 3IJHA 1WIUA 1QSZA 5CLWA 4AJ0A 1FBIH 1TNNA 1N2RB 1U8IA 1MWAB 4NOBA 3P9LB 1KLGB 3UXFA 5I1KL 3SQOL 3ULUL 1E4WH 3QBTB 4KQ4H 3O8XA 4RX4D 5GGUB 5C0GA 2AJXL 5ACLA 5E4EB 4U1HB 3MOBL 1I8KB 2E8YA 5BXFB 1T2XA 3BP4A 3CSGA 3KWWB 5DD0L 4RGMB 3F62A 4QHNA 3EO1B 3CSPA 1O7SA 4KRLB 4I2XA 4YNYA 3O6MH 4OLZH 1IARB 1T7ZA 2HFEA 4NUGH 1F90H 1BF8A 4ZUUB 1GGIL 3BPLB 3HA0A 4OZ4A 3E0GA 1AD9A 3QEQE 5DQ9A 2NY0C 3B8YA 3BZ4A 2QJDA 4Y1AA 3RGVB 2P5EB 1CCZA 2VYRE 3S36X 1UJTA 5FM5M 5T1LA 1UACH 2VXTL 4GKSB 4M00A 1IKNA 2AQ3A 4XNYH 3FO1B 4OTXL 1WF5A 4JFPA 4EVNA 1GVIA 1RJYB 3GIZL 3FB8A 1G6RB 2ZSWA 5FGRA 5I2IA 4NO0A 3LH2H 2F8OA 4G8GD 5HYJE 1OSZB 2E27L 1SYVA 2AXFB 3QZWG 1UFUA 3Q3GA 4E0RA 2VKWA 4M1GH 3NVQA 4IMKC 2R8SH 1AP2B 1LEKB 1PLGL 5IQ7L 5E08L 3WFDH 1ZKAA 1LK3L 3MNVB 4EN3C 1D9KC 1N0XL 3MOAL 5BV7C 1S9VA 2GITA 5C0BA 3W9DA 2DKUA 1NUDA 3BQUA 3FONB 2OX5A 3I02B 4K3DL 4R90L 2NY6D 1PKOA 2H8PA 3WFCH 1X5IA 2DDQH 3VGAB 5JIIA 4LSRH 2ZG2A 5CZVH 5D5MF 1IGFH 2XZAH 5HDLA 1JNNH 2P5WE 2VLJD 1Y6KR 2P8MA 5ICZA 3H0TA 3T0ED 4ACPA 3MZGB 4N0CD 3LRSA 1AD0B 3HMWL 4DGIL 1CXEA 3OJDA 3S35X 1LMKA 3OXRA 1S7TA 4UQ3B 4N0UE 5H2BB 4PD4K 1OAYL 3QZWB 3DETC 3CUPB 1J05B 1TFHA 3D69A 3QIUC 4LLWB 4PJ9B 4QRPA 1GC1C 5FV2A 1GOFA 3MV8E 3T3PE 1AQKH 4M1CD 5FO8B 4KQ3L 3TGXA 2XI9A 1J8KA 4MAYA 5IHZA 5C0ND 2A73B 1AGFA 3LS4L 1BQLH 1I3GH 1L0XA 4PPTA 3EGSA 3PWNB 4KRNA 4AIOA 1T1YB 3B8SA 3FMGH 4LIQE 3O2DH 5I71B 3MYJB 2X70A 4PY8J 3MLUH 5D7SL 1KLFA 4DKDC 1U8KB 5E6IC 5GGTA 2XZQL 5KANG 2FECL 4OB5L 5BS0A 1MFDL 1CD9B 4OFIA 1P84K 5LGHH 5FDWA 2BNQE 5CCKL 2I07A 5CD5D 5TPWH 1NCBH 1ITCA 1YQVL 5AYUL 5IVZB 3BW9A 1U8HA 2FX7H 3WHE1 5ID1A 5MI0B 1FFNB 1JI2A 1ZGLP 4P4RA 1MF2H 1FZOA 4S1SH 3G04A 3S96A 4ZS6C 1B4RA 4Z95L 1J87A 4ERSL 1CR9H 3PV6A 5DQJB 1TMCB 2OTWB 3H3KA 3F5WB 1HINH 2ZOLA 1GGTA 2OTUA 3H9ZA 7FABL 1JGUL 1FVCA 3O3EA 3FN0L 1VFAB 3MRHA 3QJFA 4JZJA 3MRKA 3VFMB 1UVQA 1GZQB 2GK0B 3C8KA 3MMEA 2OZ4A 1V3JA 3TLRA 4WTZG 4KK5C 3FT4B 1KCRH 3IU3A 5I16B 3IAGC 5DEGB 4Z7WB 4BSWA 5IG7A 4JQXC 4LLQA 1W72B 5SWZA 2FZ3B 4FQHB 2YBRA 2AI0L 5I17A 2E9JA 2XWBA 2VR9A 5FA3A 4PGEA 2MCG1 1RZJC 5I1KH 3SQOH 3ULUH 4U3HA 2MNUA 4MLSA 1IGJB 2AJXH 2FEDC 4MVBC 5ANMA 3MOBH 4OQ1A 1NDMB 4PP1C 5J11B 3AUVA 4WW2A 5CSZB 5JNYB 3STBA 3CX5J 3ZTJH 2MFNA 3UPCA 5IVXF 3RNKB 1F6LL 1MCFA 4GAYB 1KIRA 5IOPB 2AEQL 4YXKL 3QDJE 1D5ZB 4L8SB 1RFDH 4P5TD 3MLWH 1E6JL 1LDSA 1NEZA 5EFIA 2FR4A 4CADB 4RDQF 3M1BA 4X6CF 1J0ZA 3WS3B 2CDEA 3PP4L 4NQCD 4B50A 1HHKA 2D9QB 3ZKXC 4OTXH 4M6MH 3RY6C 5B38G 1MAJA 2HFFA 5IB5B 4PR5A 4P2QE 4JM2F 5I1LB 3SBWC 5EPMB 2W0FA 3KPLB 5FDYA 4OF3A 5EIVA 5LQBL 2HN7B 2DI7A 2R9HC 2QR0A 4JQVC 1J86A 4FXKB 3V8OA 1EJ6A 3EFFB 1LD9A 4C56B 4K2UH 4UTBL 5E7FA 3CH8A 3DRQB 1FFOB 1G7JA 1LK3H 1RK1B 3S3JA 1KB5B 1EEYA 1N59A 1HZHH 3CPLB 4K3DH 4Y19B 3F7YA 3PUCA 1QFUL 2OS7A 3RWEB 4RMQA 4QHUA 3RUGE 3JUYA 4I3GA 4MJ6B 1DUYB 2JJUA 4XCEA 2OQJA 5ALCL 4ZYKA 5J1TC 5JO5B 2XFXB 3MJ9L 2VMFA 3KGRA 4M9OA 4LMQI 4X7SL 4XXDB 3MA7A 3K1KC 5CGMA 2AQ2A 4R2GD 4JN2A 4NNXA 5B38B 5EU5B 4I5BB 5DO2D 5KS9E 4XX1G 3GSUA 3GSVA 3JWDL 3HMWH 2WP3O 3TZVD 4PRNA 5JDJA 2PO6B 5IBUG 3VA6A 3DIFB 1BP3B 1OAYH 5GGTH 1WV7T 1MLBB 4HWBA 2GHWB 32C2B 3BGFB 1YDPA 3DO7A 4CMMB 3BISA 5DMIL 3LS4H 1I7RA 1FZJB 2IH3B 2DWEA 1CICD 5DZLA 1A1OA 5I1DB 5T1MB 3DARA 1JZ4A 1T2QL 4LIQL 2CIKB 5FO9B 4WGWB 2EXYD 5E8NA 3DRTA 3HMXL 3HE6A 1QFPA 2LVCA 1OGAB 2XZQH 4IHOA 3SJVD 3U7YL 1QBAA 3MCKB 1A2YA 1E4KA 3VH8G 3VXME 3MLYL 5CCKH 3UZQA 3WXVL 1YQVH 3C5ZA 5AYUH 4OD1H 5GSVA 1YEDB 3VFWB 4YHZL 3D3VB 4KMTL 1DP0A 2XTLA 1I1FA 1UH3A 5EZJA 4Z7NE 2FO1A 4U31A 1NFDF 1X5KA 5KN5A 3QUZB 4ERSH 1AHWA 5IBUB 2BSSA 4N90D 3H7LA 2QADD 4MD4B 3CU7A 4JCMA 3WHE0 3QUYD 25C8L 4ZPVA 2X44D 4ZQKB 7FABH 1JGUH 2XQYK 4KRPD 1FYHB 3FN0H 3OG6B 3QUKB 4OCNC 5DMYA 1JGVL 1ADQA 1KPRA 5JW4M 1AI1L 5H37G 2BDNL 5KSAA 5DUBB 4I3RH 2A83A 1LO4H 2Q6WB 4PV9A 4ORGA 3TJHC 4PLJC 1X5FA 1WAAF 3QI9B 2AI0H 5A2FA 4RMVA 5D70L 3QG7H 4LPCA 3MR9A 5GZOC 1SJEB 3L5IA 3VH8B 1HEZB 4MNHB 2RGSA 2FWOB 4H0IA 5IEHA 1FQ9C 4G7VL 1IGML 4PB9L 3O8XD 2NMSA 3AU1A 2BVEA 4M9PA 4HPOL 3CLFL 3D39A 4GLRH 3A6BL 4TUOA 5K9JL 4PJEA 1M05B 2D0FA 5IMKA 4IBLT 5BQ7B 3RY4A 1KCUL 3WXWL 1JPGB 4JR9H 5E8EA 1MCCA 3BE1H 1AXTL 3CNKA 1E6JH 1H3XA 1N2RA 1MWAA 3B5HA 4WI5A 2WQ8A 3U2SA 5IM7A 3P9LA 1KLGA 2YA0A 4UNVA 3LS5L 2J5LC 4Y1AD 5DJ6B 5GGUA 4RSVA 5T1LD 2A77L 1CTNA 2JJTA 1PSKL 5HVWA 4DQOL 3BH8A 1BFVL 4JE4B 4U1HA 5SWQA 5C0JB 5FM5O 2P45B 1CBVL 4M7ZB 3ARGB 5BXFA 3B9EA 4DKEL 4HCRA 3KWWA 4DZ8B 2FRGP 4CDGC 5FYKU 4R7NB 5HJ3B 2W9EL 5JW5A 3LN4A 1QR1B 5MEOB 1JCKA 1T7WA 4ZUUA 2W38A 1X4YA 4I77H 3G9AB 2B2XL 3RGVA 2P5EA 4M02A 3T2OA 5F21B 4N5UA 2IADB 5C0BD 1RULH 3TVMB 4GKSA 4PRBA 1ZLSL 3BQUD 4GLRI 1QFUH 4P2QA 5EA0L 4YBHA 5F7DB 4KJYB 4KKAD 1RJYA 3SGJA 5ALCH 3QWQB 1G6RA 4OFDA 4S1RL 4Y19E 2FLRT 5E1HB 1BD2B 2ITDB 3IJSB 5T5NG 4OBRA 4YFLF 4G8FB 2AXFA 1XGUB 2B1AL 5I73B 5DVOA 2CO6B 3JWDH 1AP2A 1LEKA 3QYCA 4S0SD 2GFBA 1ZGLM 3MNVA 5MENB 1YYML 1CD1B 1U8OB 2VR4A 1WZLA 3ARYA 2R2BB 3FONA 3I02A 5C70A 4IM8A 3BO8B 4L9LB 1W0VB 2HP4A 4POZC 4QRPD 4F15B 5J8OA 4QYOB 5HSFA 5HTSA 2MHAB 4MAYD 3UX9B 1JNHB 1Q9KB 4RMTA 1FO0L 1Z2KA 1T2QH 4LIQH 2EDXA 4O58L 4FFYL 4BA8A 1JYWA 5CP7B 3HMXH 3U0PB 2J8UE 3U7YH 2DM3A 1AD0A 1X9QA 5BS0D 4EKXA 4CW1B 2DQIL 3WXVH 3EYSL 3FL7A 5DJAB 1F3DJ 3OZ9H 5C9KA 5IFAL 5I9QC 1OGAE 2I24N 4P2YA 5H2BA 1JYVA 4YHZH 4KMTH 4GG6F 3P4OB 3CUPA 3LKNB 5CEYB 4CBPA 1J05A 4LLWA 1U6AL 4PJ9A 3CFDB 2FL5B 4MB4A 5FO8A 3IXTB 35C8L 3MBXL 5C8JB 4N1EA 3ZKMC 2A73A 5FK9B 2RCSL 3PWNA 4U7MA 1QBBA 5AD0B 1A6WL 2CKNA 1T1YA 1BX2B 1ONQB 2CIIB 4U1GC 1WFUA 3MYJA 3VXMA 1M71B 1U8KA 1JGVH 3U9PL 3BX7C 2BDNH 3CX5K 3DUHA 4KH2A 1HWGB 4G43B 3IVKB 5CILH 3C60B 3ULVF 2LVEA 4CVXB 3ALXA 5E2WL 5IVZA 4JFHD 3U36B 1A3RL 1FFNA 5JW4R 5DF0A 5SWZD 3VRJB 5D70H 4JRXB 4ODWB 3MLZL 3G5ZB 1RMFL 4Z78A 5CJXA 2FYYB 1ZGLB 5D93B 4MSWB 5DQJA 2OTWA 1A9BB 3N1FC 4FFVC 2X4TB 4NGHL 2XQYG 5EO9B 4G7VH 1IGMH 4PB9H 1IE5A 2ZUQB 2DOCA 4KMLB 4CN1A 4FMFA 2COQA 4HPOH 1VFAA 5AG8A 4IRZL 3IU4L 2IQ9L 3CLEH 3VFMA 4U1LB 1GZQA 4NCC2 2GK0A 2FJHB 4X6DE 1MIML 2DB8A 1Z9LA 5I16A 3FT4A 3VXOB 5DEGA 2EC9T 1S5IH 1KCUH 4Y4KC 3AS0A 1G1CA 2ZUSA 1W72A 3WXWH 1AR1C 2FZ3A 3PIQB 4FQHA 4KTDL 1T0MA 3N06B 4NKIL 1AXTH 4YPJA 2W60B 4JY5H 3BEWB 4X6BB 1UQSB 3LS5H 1NCTA 1RZKC 2D0HA 2A77H 5DJXB 1IGJA 4DQOH 1AGBB 1BFVH 4GUPA 1IT9H 1CBVH 2D9CA 3C5JB 1NDMA 4JG0L 4L4TE 2I9TB 5CSZA 4B7IA 5JNYA 1AGCB 4ONGL 4HMCA 4LBEA 1MCWM 3O9WC 4GKZB 5DMGD 3RNKA 3ZDXE 4GAYA 5IOPA 4CN6A 1CDGA 3C6LC 1PKQE 5C0CB 2W9EH 1CFSA 2PF6A 1D5ZA 4L8SA 2W07A 4TOYL 1G6RH 4KPHH 1R5WB 3B2VH 2DLHA 1IGYB 1QFWL 4WEBL 4WTZA 3VRLF 3ESUF 1BPVA 4CADA 5JOFB 2JIXB 3MZTA 5EN2B 5DFWH 3WS3A 4O51B 5C2BL 1RIVL 2DLIA 5IK3B 1CDHA 5EA0H 4U1SB 4M7LH 4Q9QH 5GS0C 3I50H 5IB5A 2F9BT 3JV6B 3HRZA 4H88L 2FSEB 5I1LA 2VO5A 5EPMA 3B9AA 5AUMB 4N8VB 1C7TA 5C0DB 4OJFL 1HSAB 3BPCB 4FXKA 3EFFA 3L3HB 1U8MB 1FFOA 4JO3L 5E2TL 1RK1A 1OT1A 3CDYA 4PJGB 1KB5A 1NGYB 1OY3B 3CPLA 2VAJA 2J7LA 4Y19A 4X6EB 3RIFK 1VGKB 3RWEA 5EB9A 5F93C 4U1JB 4BZYA 1A6AA 4PG2A 2ZUVA 4MJ6A 4ZUTA 1DUYA 2ICES 2HWZH 4IIQB 4KK9D 5CZXD 5INCB 4OCXL 4Y2OA 5JO5A 2XFXA 3X3GL 2B7DT 4EXPX 5IJKC 4AMKL 1M7DB 1CDBA 1A9EB 4XXDA 2A9ML 1S7VB 3AM8A 2QLVB 4O58H 4FFYH 3T4AB 4ETYA 4KV5F 5EU5A 4I5BA 2NY1B 3MX0A 5DD3H 5D4QA 3HE6D 4P2RB 2PO6A 3U4EB 1GHFL 4C55A 1T1ZB 2GY7B 3WNNA 1VCAA 5IFAH 1EUTA 1D6EB 3G6JE 3MLSH 5IUSA 3C5ZD 4WUUB 1B90A 4OGAC 3SGKA 1MLBA 4B41A 1U6AH 4EUPG 1C08A 1T1WB 1S7SB 5E5UB 5C0RH 32C2A 35C8H 4TSAL 4M6AA 2VL5A 2BJML 2IH3A 2RCSH 4MXWH 5D7IB 1A6WH 5I1DA 1U92A 3QHTC 5T1MA 5TGBB 4DOHB 3EDJA 3E2HB 3JZ7A 1TJGH 4HHAB 2CIKA 5FO9A 4QCIB 4OAWB 5IFJB 2VZSA 3AS2A 3U9PH 1OGAA 2BP3A 1LP9E 3MCKA 1Q9OB 5DRZB 5KSAD 1PY4A 3T3MF 5L8KB 2JKXA 4AEFA 3UJTL 4OIIL 3RZCC 4GRMA 2YXFA 3VD5A 1YEDA 1IC1A 3VFWA 1A3RH 1WWCA 1A47A 1DQDL 4HXAH 2MQCA 4WV1C 3KXFE 2QEJA 2HVJB 3MLZH 1L0QA 3QUZA 2SEBB 4MNQB 1H0DB 4MD4A 4XXCC 1VSCA 5BJTA 2VWEC 1BJ8A 4AM0A 1RJZB 2Y5TB 4ZQKA 3CSBA 4K9EC 2BY1A 4NZUL 4ZUWB 2IQ9H 3D39D 5GGQL 3BH9B 1MIMH 1J8HB 2H1PL 5JLZA 2FB4H 4ODTL 3GSOB 4Q9CA 2Q6WA 1A14L 4LFHG 5KVEL 1NGZB 4KTDH 1A7QL 3QI9A 3HNTH 4NKIH 4DFIA 3IDIB 1N0LA 2KUTA 3AROA 4NQSB 4OF6A 3T0EC 1SJEA 1J5OL 3DUSB 4N0CC 3VH8A 1JE6A 2J6EL 3V6OC 4IRSB 1HEZA 4MNHA 4NZJA 2FWOA 1SYSA 3SDDB 4HFUL 5DK0B 4XVSH 3WFBL 3QXTA 5ISZB 1BIHA 1KPVB 2XPGB 5I19H 1GJIA 3OB0H 3FQTB 4ONGH 1M05A 3QDJD 3MODH 4PUBL 3K4ZA 1JWMB 3L5HA 2NYYD 5J89A 5BQ7A 1LE5B 5LVEA 4JN1L 4DN3H 1NMCB 1U41A 2Y36L 5L88L 3GBLA 4TOYH 4U1KB 4DN4L 4LKCB 3PDGA 4BH8B 1EJOL 1MHHB 3DVIA 4WEBH 4LARL 5IFHL 5EORH 2OM5A 3STLB 1QKZL 3RGVD 1MQKL 2P5ED 5DJ6A 2N7AA 4QNPF 5C2BH 1RIVH 2ICCA 1FL3B 2Q8BH 4P2QD 3NZ8B 1SY6L 5C0JA 1UEYA 2VISB 4N0YH 3ARGA 5LBSL 5D5ME 4WWKB 1KXVC 3W11C 1EGJL 3HUJF 4H88H 2EZ0D 2APVA 5EOQL 3T4YB 4LK4A 3VD3A 4G5ZL 4OKDA 4R7NA 5HJ3A 4Q9RH 2XICA 4WW1A 4OJFH 1QR1A 5MEOA 3MCG1 4XPHL 3Q48A 2YPVL 2HRLA 3S4SG 4LASH 5TDNB 4KKLD 1TLKA 3SCMC 5IR1B 1A7PL 1SVZA 5E2TH 1XF3A 5DK3A 5EBGA 3B9KC 3HNSL 2CGRH 2IADA 3IETA 3TVMA 2DBLL 3QUMB 1DCLA 2Z8WC 5DJ0B 5FUCC 1NLDL 4KJYA 2J8HA 3DVFA 4RISL 3BPOC 3X3GH 1T1XB 4AMKH 2R1YB 3IJSA 2ITDA 4G8FA 1KEGL 1JHLH 2ZNWA 4FTVE 4P99A 3UTZB 1XGUA 4O2FB 4YWGH 5B3JF 1VPOL 3OKOB 4MS8D 2WP3T 1GHFH 5EZLB 3S9DB 5GRUL 1F58L 3D0VB 5MENA 3LZFH 1BVZA 1CD1A 2R29H 1U8OA 2FBJL 1TTUA 2R2BA 2A6JB 4XWGL 5DGQA 4KROC 1TTFA 3U6RB 3BO8A 4LSTL 1AGDB 4X80H 5D1ZA 4L9LA 3S4SB 1W0VA 4F9LA 4LGRB 4QYOA 4TSAH 2CLZB 4WUUE 4ELMB 2NY0B 2OP4H 4YDKL 2MHAA 3V95A 1RIHH 4EXKA 2HH0L 1JNHA 1N4XL 1Q9KA 4UINL 5IESL 3IGAB 3VFTB 1C16A 1JJUA 1VFBB 3WCYA 4KI5F 1NH6A 4FQXC 3VXMD 1EAJA 1S78C 4RQQB 4X8JB 5CP7A 3RBGA 3VMNA 3U0PA 2EDBA 1EK3A 1F2QA 1IAIM 1P7QA 2B0SL 5FCUH 4CW1A 2L7JA 2Z8VC 4PFEA 4UQ2B 5DJAA 1MJUL 1Q72H 1C12B 3OMZA 1K8DB 5F88A 5HYSA 1CE1L 3P4OA 3LKNA 5EIIB 1H3PH 3FAWA 3WJLC 2ZCKH 4EQ2A 3RVTD 2FL5A 1CF8L 5DK2B 3UTSE 3IXTA 4O2EB 3UDWC 4EN3B 1D9KB 5FK9A 5BV7B 4Y16D 5AD0A 1JF1B 4FNLL 3G5VB 1BX2A 1ONQA 1UB6B 2CIIA 5L7XL 2Y5EA 4OM1L 1EEUA 4O5LH 3INUL 1M71A 4NZUH 1QBLL 2EDOA 3TP4A 5E2VH 4ZXBD 2PKDA 1G9NH 3PWUB 4B7LA 4I3SL 5I0DA 2YK1L 5EU7E 2H1PH 4G43A 4J8RA 3IVKA 1NCWL 4ODTH 3EDDA 5IVXE 3C60A 3UTPD 4CVXA 5KVEH 3GIVA 5FUZH 3U36A 1A7QH 2XRAL 4R2GC 3VRJA 1CGTA 2UVFA 5F8RC 1P7HL 4JRXA 4ODWA 3OAYH 3UPAA 5FF6B 3G5ZA 4EZMA 1FN4B 2FYYA 3QXUA 2J6EH 1A9BA 3HZKB 4YBQD 4X83A 4X6CE 2XZZA 4QOKB 5EO9A 1CGSL 5FAAA 4X98B 4RGOL 1RHHB 3QIUB 2HA1A 4R0LC 1X5GA 4OZFG 2ESVE 4OCWH 5C71A 5FGCB 5DS8B 3TO4A 1CS6A 2FJHA 3NACH 5J1SC 4PUBH 1KCKA 4NRZB 3VXOA 2FDBP 2V9RA 2NW3B 5EOTB 4JB9H 2HMID 1CVRA 2IC2A 2Y36H 3ARSA 4KUZL 3BUYA 5DR5L 2XNAB 5HGDB 2EXYC 2JJSC 4J12A 4GMTL 5DMKB 4QY8B 4F7EB 2W60A 3BEWA 3LIZL 5IFHH 4IOFC 2WWKO 3BN9D 1IEAB 3ZLQC 3EJZC 1QKZH 3QCVL 4K23L 4MHHG 3GB7B 1QRKA 5DJXA 2ADGB 3MNZB 1AGBA 1JRHI 1SY6H 3H9SB 3B3IB 4X5WB 2I9TA 1EHNA 1EGJH 4XCCH 1QSEB 1AGCA 3VI4F 3WLBB 3MOQA 1JFQL 1IILE 5EOQH 4GKZA 5FO7B 2H2PC 4G5ZH 5HI5D 2EDDA 4HIHB 5AZ2H 5JXAL 5LXGL 4OZFB 1D6VH 3DX9B 4KRPC 5M95B 4XPHH 3DHMA 3S37L 4AQ1B 2YPVH 15C8H 1TQCC 1JIBA 2VLKB 4PRPB 1IGYA 1CGUA 1A7PH 3N1QC 5DYOB 1EHXA 2VXQL 4ODUB 3QDAA 2JIXA 5EN2A 4IMLB 5JOFA 2DBLH 1KTRL 5DA0B 4O51A 2BHZA 2Q7YB 5ICYB 4FZEL 5IK3A 1NLDH 4Y19D 3NA9L 3OPZL 4U1SA 3FKUS 1K3ZA 4NKDB 3K2UL 4L4VB 3RPIA 1AE6L 3JV6A 2YD8A 5I6XC 4A6YA 2FSEA 4JKKA 4JPIB 5AUMA 1XGTB 3QDHA 2VB5A 4N8VA 5MEPA 5JHLL 3E6FB 1Y6MR 4K8RC 4NWTL 1HSAA 3BPCA 3V7AE 3KPSB 1VPOH 3F6IA 2WLZA 3MLRL 3L3HA 5JHDE 1U8MA 4DVRH 2K7QA 4U6VL 5GRUH 2PO6D 1B6DA 4WHYG 4PJGA 2FBJH 3BRGC 4FP8L 4BQ6A 1VGKA 1NFDE 5CINL 3ULUC 3LQAL 4IIQA 2HFGL 1FDLL 5INCA 1BREA 4WI8A 1Q0YL 4EJ1C 1M7DA 2HH0H 1BEYL 1N4XH 1A9EA 4FG6D 1R5VB 1IL1A 1S7VA 2XACC 4RWYL 3ZKXB 1K9TA 3MFGB 3PWVB 4KKBD 3RVVD 4KAQL 1OGAD 2B0SH 4P2RA 5HI3C 3U4EA 4AL8L 1T1ZA 2JB5L 3KLDA 1MJUH 1D6EA 3GNMH 4TSBL 1G7LB 3BYYA 1CE1H 2Y25A 4WUUA 1WAAE 1NC2B 4N8CH 5F3BB 1UA6L 1P69B 5HHME 4GS7C 4UIMB 3OKEA 3SDCC 4YHML 5JUEH 1S7SA 5EH1A 3DJ9A 3QUZD 3LEXB 2ZWLT 3FOMA 2LAAA 5C08E 2NZ9C 3TBYB 4ZNEE 4FNLH 1FV1B 4OLUL 5L7XH 4L8DB 4LOUC 4OUUB 2PTTB 3D9AL 3GMPB 3INUH 3PGCB 4OAWA 5IFJA 1EPFA 3QEGL 4NQUA 1QBLH 2EXWC 2CR3A 4YH6A 1QO3B 2YK1H 4KKAC 5DRZA 5CJ5A 1NUGA 2YD7A 2F5BL 3G5XB 3SDYH 2X42A 2KKQA 1MCHA 1LK2B 4GRWF 4PJHF 2X4QB 2R2HB 1FYTE 1LO5B 3UTSA 5BW7A 3W5MA 1P4IL 3WHXB 2XRAH 4QGTA 3LMJH 1IM3B 1KOAA 1ZLWK 3JWOL 1GH7A 3QI9D 2EICA 2HJKB 4HKBA 1OPGL 2DYPB 4MNQA 3MA9L 1BQHG 1H0DA 1ACYL 3G6AB 2X7LB 4AEIL 5ADPH 4C58B 3NIFE 1CGSH 2R15A 3UJIH 3ZDYE 1RJZA 2Y5TA 1UWXK 5KVGH 3WLWC 1ZVYA 2IAMC 4ZUWA 5F1KC 3PQYB 4FXLA 2HJLB 4U1NB 1J8HA 4BSVB 2VDRH 2H32H 1XR8A 3GSOA 5EU3B 4MD0B 1DL7H 4R4FL 3EHBD 1NGZA 3MROB 1ZWIB 3THML 4KUZH 3BFOA 2XOTA 5DR5H 5KAQG 1LHZA 5FXCH 4AEHL 4NQSA 3RWFB 2EYTB 1JPST 4XMKL 5M94B 3DUSA 3S88L 2YRLA 1LE9B 4MAUL 2ICWI 2Y4SA 4IRSA 4CVZB 4LP5A 3QCVH 2AXGB 1ZANH 3EW3B 3W0WE 2NY2C 1A6VL 4RFEA 3SDDA 4ZFOL 3IB4A 4M5YL 5CJOL 5DK0A 4F8QA 3D87B 1YN7B 2BCKA 4KKCD 5ISZA 4F2MA 1KPVA 2XPGA 4KDTA 1BQHB 3BIKB 3FQTA 3ARGD 4U0RC 4PIRF 4JHAL 1JWMA 5F9DC 3B9VA 1EAPB 5IB3A 1LE5A 3SE4C 1R24A 2E7BA 1N64H 2NXYC 2GEEA 1QSEE 5IP4A 4U1KA 4X6FA 4LKCA 1PQZB 1GGYA 4A6YH 1MHHA 3QRGL 3H2WA 1FP5A 3STLA 3H9HB 2KBGA 4UZGA 3TVMD 5T1KB 3NA9H 1FL3A 4XVUC 1R3LB 3NZ8A 3DURB 1JTOA 3K2UH 1SBSL 2VISA 5JW4Q 4G6JL 1S7QA 1NCAL 3X14B 1AE6H 5IW1B 2J4WL 3ARUA 1QOKA 3I85A 1NMBH 4CAGA 1RUQL 2B8OT 4KC3B 3T4YA 1IVLA 3GM0A 4G42B 1KV3A 1ADQL 4KHXH 3CD4A 4CU6A 4XCNB 3PWPB 5JHLH 1DQQB 1WBZB 3DWTA 3MLRH 3IKKA 5TDNA 1T7XA 3BD3A 4J3XA 4U6VH 2FATL 4YZFF 4WW2C 4GRLB 1NSNL 4PLOB 3ISWA 5MEND 5EO0A 1ZLUH 4GG6E 4FP8H 1W0WA 3QUMA 5DJ0A 5FOBB 5CINH 1R3JB 2EKJA 5D1ZD 1JTPA 3F7RA 3CK0H 4GAGL 4TSCL 2EC8A 1T1XA 4R96B 2J5LB 4NDMB 2R1YA 4TVPD 4G6AD 4RWYH 5EBMB 4S10A 3K2MC 4EQ3A 4MXQC 5EUOF 3UTZA 4F3FB 4U0QB 4KAQH 3EFDL 4O2FA 1HIML 2V6HA 3OKOA 3R1GL 4D2NA 3QNYB 1BGXH 1I9JL 2FX9L 4AL8H 1P7QD 5EZLA 4WJ5A 3ULVE 2JB5H 2RQ8A 3D0VA 4OFKA 5TF1L 4TSBH 3D5OF 5D1QC 4NKMB 4PJ8A 4DK3A 1A6TA 1UA6H 5IW3A 3JV4B 5J13C 3U6RA 3S4SA 4YHMH 1CXIA 5J6HB 3BIBX 1NFKA 3RVUD 1Z9SA 4ESKA 1F4AA 4ELMA 3SKUD 3OGCB 4ENED 1FJ1B 3MV11 4JO1L 4Y4FC 2WUCH 3IGAA 3VFTA 1VFBA 3MUHL 3BKCL 4A2LA 1D7FA 4Z76B 1OM3L 4RQQA 4X8JA 4D9LL 4JPKH 5DC9B 1G9EA 2F5BH 2FJGB 7CGTA 4UQ2A 2F74B 3C60D 1C12A 4FQIL 1K8DA 4JPWL 4MA8H 5EIIA 3JWOH 2YPLB 1OPGH 4IMKA 1U3JA 4WCYL 5DK2A 4NYLA 4JRXD 3H3BC 4O2EA 5DVLA 1X5HA 1ACYH 2XXMB 1GPOH 4EN3A 1D9KA 3LPFA 1JF1A 3DSNA 3EZJB 3G5VA 4YR6B 1UB6A 4HS3B 4LEOB 3MRGB 3WFHB 2WIIB 3QUXA 3VXUB 3P9MB 4C4KO 1YEKH 1S7UB 3PWUA 1BFTA 1G7QB 3H9YA 4KK9C 4XVTH 3TO4D 5IB2B 2O5XL 4R4FH 3JWDC 3THMH 3TBWB 3TH4T 2UYLB 4GH7B 1IGCL 5LAXB 4R7DB 3CXHJ 4XMKH 4EOWH 5FF6A 4NJAL 3FZUC 4G8EB 1FN4A 1U2CA 4FABL 3VRLE 1JGDB 3HE6C 4MAUH 2LU4A 1T4KB 5INDB 2EDNA 2O5YL 3PG2A 5I9QB 3HI5H 3QJHB 3MJ7B 4QOKA 2ZOKB 5KG9B 1QLFB 2DD8H 1J88A 5GRYA 2HLFC 4X98A 4M5YH 1V7ML 5CJOH 1FIGH 1RHHA 3BHBA 3QIUA 3TNNB 2A0LC 5TJWK 3F12B 1AO7E 2DQGH 3HHRB 2WLYA 1ZAGA 3TIEB 3F7PC 4EI5C 2ED9A 5DS8A 1BWWA 2YKLL 1EX0A 2AABL 4JHAH 4NRZA 4R4BB 4Z7VB 5D96C 3SO3B 1Y18B 2NW3A 4U1GB 2CJUL 1UKQA 2F19L 5EOTA 3BMWA 1KTDB 3O2WH 3RX5A 3R8BB 2VABA 4XPBH 1HQ4B 2WWMD 5KSVB 1EBAA 3W0WA 2XNAA 1DN2A 5E6IA 5HGDA 3WIHL 3HC0B 5DMKA 4QY8A 2WIMA 5TDOB 4F7EA 3QRGH 2PXYC 1IEAA 5FYJD 5EZIL 3GB7A 2JIXD 4N5ED 2VLRB 3NTCL 2FHCA 1A6ZB 3DPBA 3KPOB 3PGDB 4K7PL 2ADGA 3MNZA 4LHUG 4YGAB 5HGBB 3H9SA 1SBSH 1JN6B 4G6JH 1F5WA 3B3IA 4X5WA 1WFNA 1ZTXL 2VJXA 3MRBB 2PUQT 4QHLA 1QSEA 3WLBA 1CDJA 1NCDL 1RUQH 3AAZB 3GHEL 5FO7A 4LCIH 1DLHB 3B83A 2XG4A 4KV5E 2X4UB 4OZFA 3DX9A 4BUGA 2VLKA 5F44A 2YMXL 4PRPA 4WFGE 2BNRE 2IMNA 2H3NB 4JFFB 5DYOA 2A74B 4ODUA 1J0YA 1NSNH 3FHQA 3OKNB 4IMLA 4Y4KB 4JQXA 3LDBC 1HYSD 3I3BA 2JB6B 3QR2A 4JFDE 4HWEL 4NKDA 2F15A 1RVFH 4GAGH 4TSCH 3VXRB 4UV4L 1CU4L 4OF7A 4CJ1A 1OWRM 2HTKD 3A67L 1I8IB 3L1OL 2NY5L 4JPIA 1WZMA 5CIPH 1ETZB 1XGTA 2V5TA 5C07B 1IEBB 4LHUB 2FIKB 2Z31D 3EFDH 3KPSA 1HIMH 3DGCR 5GGVL 3QCTH 4GG6A 4LEXH 1I9JH 2BRQA 4UILL 3T3ME 3IDMB 1UZ8B 4P2RD 2AK1H 4U3CA 2CKBB 3O9WB 5TF1H 3RWDB 5IV2B 3TH2T 3C6LB 1X7QB 3ULVL 2Q3ZA 2CRIA 3KDMB 4UAOB 2VQUA 1YN6B 4WUUD 1I9RL 1U93B 2EECA 1PX3A 4I9WE 1D5IL 3LSOB 2HVKB 2DIJA 4BQ9A 4JREC 2XKUA 1WCBA 3VG9C 5IT2L 4HFWB 1R5VA 3MTRA 5F97E 3BKCH 2C7UB 3RY6A 3PWVA 4ODHL 4GW1B 5CGTA 1MHEB 1U95A 3FFCB 3WSQL 2I26N 2R2EB 5D8JL 3O6FC 2NY7L 4L1DA 4PJXB 1CQKA 5I18L 3SBWA 5CD3B 1F6FB 4FQIH 1L9NA 1TJHL 1G7LA 4JPWH 4YDIH 1JP5A 3UTSD 1NC2A 4JQVA 4CL7A 4FQQB 4UIMA 4K3GA 4WCYH 4F37F 4OQTL 1OF2A 5AG9A 3UJJL 3DECA 3LEXA 3HG1B 1P7KB 4RMRA 4MNQD 1YYLL 2FEEI 2P8LB 3I3DA 4OCMC 2VDNL 1OCWH 3ARBC 1J12A 4PJCF 1FH5L 4XCYB 1QHOA 1FV1A 4XGZB 3WO3B 4XCFL 4N9OB 4LVEA 4L8DA 4OUUA 4MWFB 2PTTA 3X17A 1MJ7L 3GMPA 3PGCA 3MRPB 1DQML 5IMLB 4D0DB 1QO3A 4AEEA 2O61B 5FV1L 3G5XA 1J8HD 5GRXG 2BOCB 2O5XH 1IC5L 4P3WA 2CMRL 1LK2A 5C0EB 2IPKB 2X4QA 1Q38A 1QA9B 2R2HA 1SQ2N 3QFDA 2WMPA 3WHXA 2EYSB 4RAUA 3UZVB 1QEWB 4NJ9H 1XCTB 1IM3A 4D9RE 5JR1H 4HBQA 2ZCLL 2HJKA 4BZ1L 2DYPA 3LRGA 1M6OB 3VGHA 3O4OC 4FABH 4ZOBA 3G6AA 2X7LA 1BHGA 2WNGA 4IRSD 4PBVC 2AAVA 4KRMB 1H8NA 4UDTA 4HWZB 4QNPE 1V7MH 3SDDD 1H5BC 3MBEC 4WNQB 1FNGB 5E7BA 2EKSA 2DJUA 5ISZD 1A3LH 3BUTA 2BRRL 4JM2D 1V7NL 2HJLA 4U1NA 2WAHA 4MB3A 1CLOH 1ERNA 2EDTA 4BSVA 1OHQA 2AABH 1FNLA 2QQKL 3IFNL 4MD0A 5EU3A 4UTAL 5A3ID 1CTOA 2CJUH 3MROA 1ZWIA 2IANE 4KVNL 3ZHLA 1FL5B 4PJ7F 4XTRD 3VFOA 3RWFA 3S37X 3WIHH 2EYTA 1I1AC 4PJFF 4PS4L 3T2NL 3V0WL 1F42A 4JY4B 1JPSL 4URTB 3OGOE 2PYEE 2WWKT 4CVZA 1WISA 5EZIH 2AXGA 3RZCB 4LFHD 4F7PB 3NTCH 5DUPL 4U7SA 1DVFC 4JFEE 1DBJL 1YN7A 3O2VL 4WV1B 4HWNA 4TYUA 2L0DA 1BQHA 1T7VA 4F7CB 3P77B 5E8PB 3NBNA 3BIKA 5SX4H 1ZTXH 1U58B 3IJYB 4KY1L 4YE4H 5EU6B 2X1PA 4WU7B 3P0VL 1NCDH 5B22A 2AXHA 3EJYD 1EAPA 1A7RL 4Y16C 2AJSL 5EDXA 4S2SA 2ADFH 5C0AE 1RZJH 1A7OH 3LV3B 1PQZA 3DV6A 5EO1B 2YMXH 5DURB 4KJPD 3O6LL 4ZXBC 5FYLL 3JV0A 4Y8DC 5DWUH 5IROC 3P2TA 4KZDL 5MHSE 2V7HB 5IBLC 3BWAB 3H9HA 2D31A 4LF3B 4XPAL 5GHWL 1XF2A 3MV7E 5C86A 1RZ8B 3G9VA 4HWEH 1MCRA 5A2IH 3DURA 2VLJB 3MGTB 3T0EB 3HAEG 5IWLC 4NN5C 1C5BL 2VUYA 3E6HB 1MCLA 1CU4H 3X14A 3AY4C 3A67H 3L1OH 3RKDC 2NY5H 3K4AA 3IT8D 1VERA 1SM3L 3D2UA 2BNRA 4G42A 1FRGL 1N7ML 4KI5E 3VXRE 5JHDD 4XCNA 3PWPA 3ZYZA 1DQQA 4V1DE 2Z0BA 2EH7L 1KSRA 1CN4A 2DQFB 3FTGA 3RWCB 3ULVH 5GGSY 3MRQB 3FCTB 3TWCH 4HWUA 3ARDC 3SKOB 1T3FB 1YPZF 2L7UA 5FOBA 4PJ8D 4JCLA 3WD5L 1R3JA 1D5IH 4Z7UF 4NUJA 3KJ4C 5ABDE 4NM4L 3EYUL 1UXWB 4R96A 3RRQA 1BBJB 3I9GL 1A1NB 2YA2A 3BN9C 4NDMA 1F3DH 5EBMA 2EYRB 2E9WA 3HAEB 4OZIB 5DD5H 4UT7L 1HK6A 4ODHH 2VAAB 3ARXA 2VXVL 3QNYA 4OCSL 5D8JH 1A7BA 3MPCA 3UC0H 3DMMC 1NCCL 5C7XL 1UM4L 4LSVL 5I18H 1HHHB 4L1HA 1TJHH 3VWKC 4OGZA 2HFTA 3FFCE 1P5UA 4K3JH 4YHPB 1QVOB 4RAVB 4NKMA 2FJFB 3GKWL 3QXVA 5A2KH 5D2NE 3JV4A 1FGNL 3DHJA 3TT1L 4OQTH 5J6HA 3UJJH 4AG4L 3W9EB 3SCMB 1INQB 3GMLB 2AP2A 1NGPL 4XP1H 4PB0H 4K3HA 2VDNH 3B9KB 2NLJB 4EN3D 1D9KD 4RFNC 4AYFA 4NQDB 1UM6H 4LLDB 4XC3H 1MJ7H 3K8LA 3UP1A 4P4KC 4Q2ZA 3QUXD 3VW3L 4PJ5E 5GJSL 1WIPA 4U2YA 3BPOB 5GS2H 1UWGL 1T04B 4U6XB 3DTXB 2FJGA 3GRWL 1IC5H 5JZ7C 4CJ0A 2F74A 2CMRH 2DQJL 3VD4A 2F54B 1F8TL 1EFXD 3B6SB 2D2OA 2YPLA 2ZCLH 3L3KB 4TQEL 1PVHA 4K7PY 3U83A 1G7PB 3CVHL 4J3OC 1EIBA 1L7IH 4MZ3A 5F89B 5MERB 3Q1SL 4QOKD 3DETD 4HS3A 4LEOA 2Z91B 4KROB 3MRGA 3WFHA 2WIIA 3HCVB 4YIQB 3VXUA 4OZGB 3QIUD 3CVIL 5JPMB 1K4DB 2V7NB 3P9MA 2BRRH 4IOIB 3V0VA 1S7UA 1DBAL 5BO1H 2EE9A 1G7QA 3VI4E 5IB2A 2QQKH 3IFNH 3IDGB 3ARFC 3TBWA 1FL6B 4KVNH 2BC4B 4FQXB 3MNWB 1EO8L 2Q87A 4OLXL 4XVJL 3X3FL 4D94A 4MCYB 3W0WD 3WNKA 4PS4H 4WFFE 5E6ID 4JHBA 3T2NH 3RVVC 4BZ2H 4G8EA 3UCRA 1T4KA 3T1FB 5INDA 3LHPL 1A7NL 3BOVA 3MJ7A 5HXMA 1EO7A 2ZOKA 4WWID 5DUPH 5KG9A 1QLFA 1X5XA 1AGEB 1DBJH 1IGIH 5IGXL 1KXTB 5BVJB 3TNNA 3QFJB 3F12A 4Y5VC 4JDVB 2OYPA 2AEPL 4ZS6D 3TIEA 3H9SD 2FIRT 2JK5A 2M8XA 4KY1H 4JVPA 4QF1B 4R4BA 2ZG3A 1QSED 5GGVY 4Z7VA 3S36L 2AJSH 1Y18A 4GMSL 4PJIF 4U1IA 3DUUA 3T0DA 1KTDA 1CG9B 5JQ6L 2I5YH 2VWEE 5E00B 4XP9L 1TPXC 2IMMA 4P59H 2VLKD 3HC0A 5TDOA 5FYLH 4KK5D 3HFMH 1JF5A 5J9PB 4XPAH 5EBLB 5GHWH 4FQ1H 3KPOA 2I25N 5D2LF 4WUKH 3KG5A 2C1PA 4R2GB 5HGHB 1ZV5A 3L7FB 1HHJB 3S5LG 1KGCE 2V5SA 1C5BH 1OAZL 1BZ9A 1JN6A 3TZVB 5C0AA 3MRBA 3TBTA 1X44A 5DEFA 3AAZA 1VEPA 2EDEA 1SM3H 5J6GB 1N7MH 3V6OE 1DLHA 3S7GA 1LGVA 5F7LB 3N0PB 5CFHA 4R0LB 5FKPB 2FEDD 4MVBD 4WGVB 4HJ0C 2RJMA 3KPSD 4MJIE 1FLRL 2EH7H 2H3NA 4PP1D 1WBYB 1O7VA 4JFFA 1KCLA 2A74A 4S0TD 3OKNA 1BBDL 3KPMB 4Y4KA 5B3NA 3WS6C 1BOGB 2C3HA 4LU5L 3WD5H 1AC0A 4L3AA 2R0WL 4ZSOB 3MC0A 4GQ9L 3O6KL 4OCYL 4WHCA 3SJVB 4I18B 1VENA 2DMBA 3EYUH 3VXRA 5KVFL 1F02I 2XKNB 3GKZA 3I9GH 4QGYA 1I8IA 3QWRA 4V1DA 3KJ6L 3L95B 3OXSB 1ETZA 3U30C 1S7XB 1CZ8H 5C07A 3WO4B 4LHUA 3S5LB 1PJ9A 2FIKA 2OL3L 4NQEE 4UT7H 4I48B 1Y6NR 2VXVH 5GRVK 2OCFD 1BLNA 3IDMA 2WBWB 1NCCH 4K71C 1UM4H 4LSVH 2CKBA 3O9WA 4GRWE 1TQBC 1G7HB 1OSPL 1UYWL 3RWDA 3C6LA 1X7QA 5D7LE 3C9NB 3KDMA 4IEFB 1YN6A 4KRPB 3TJEH 2R9HD 1U93A 3U1SL 1NC2D 1TQCB 1H3TA 3TT1H 2E7HA 5F9WC 4AG4H 3V79C 3LSOA 3OG4B 4IDLA 1NAMA 1NGPH 5JORA 3AS1A 3FO9B 4LDEB 5TE4H 4OI8A 3FJTA 3TPUB 4Q0XL 3MLXL 4HFWA 4R3SB 3TFKC 1Z6JT 1KEML 1IZJA 1DBML 1IQWH 2C7UA 4G3YL 1D5XB 5HPMB 3VW3H 4Q58C 4GW1A 4NQXB 1MHEA 4NQDE 3ZTJG 3IS0X 2D7TH 3FFCA 1Q9LB 1UWGH 3U4BL 2R2EA 5LWYL 1BIIA 1VEOA 3HKFA 2IBGA 3QPQC 5FUCE 4PJXA 3RJDA 3JWNC 5I6XB 5CD3A 5I1CL 2R4RH 3UMTA 2B39A 2IG2L 2R0ZH 3IKCA 4FQQA 4Y2DC 2Y23A 1ZVSB 5HDQH 3CVHH 4YAQB 3BGMB 4LSQL 2F54E 5JMRA 2LU7A 2LABA 2P8LA 3EOAB 4F80A 5DT1H 5J4MA 3Q1SH 4XGZA 5GS2D 4GAFB 2IFFL 3GM8A 3PE9A 4QHNB 3MRPA 3CVIH 1F11B 3HNVL 1XF5B 5IMLA 4C4KT 2HFEB 4XHJD 4D0DA 1DBAH 1I7ZB 2O61A 2JCCB 2YS4A 3FB6B 1A02N 5IJKA 4HIIB 2BOCA 1U36A 3NZHL 5TH2A 3BZ4B 3P73B 5C0EA 2IPKA 4Y88A 1XMWA 1QA9A 5ESVB 1KIQB 5J12C 2EYSA 5F9AC 1QEWA 1XCTA 1EO8H 3SE9L 3L5XL 3HPJA 3IDXL 1NJ9B 1PFCA 3GI8H 1M6OA 2CXGA 1KJ2A 4HS8L 4F58H 4XPTH 2APBA 1A7NH 3LHPH 3RGHA 5K59F 3GSNA 3SGEH 3QO0A 3PDOB 4FZ8L 1AO7D 3SOBL 1LO2H 3QXWA 3V5HB 2QBWA 1SYVB 5IGXH 4K7PX 3RIAK 4GS7B 1KTKE 3SDCB 2EO9A 1QNZL 2E6PA 1RZFL 3QXAB 3DYOA 2OXHA 3L3DA 1Q0XH 4U4BA 3QFJE 3S36H 5LJYH 2OSLB 3GMMB 3UAJC 3AXLB 1S9VB 5TFSH 43CAB 1FL5A 5D6DC 1RZIB 2BX5A 3TT3H 4XP9H 5F7HA 3RI5K 3HPLB 3U82B 1S9WA 3HC4L 2XWTB 3RJQB 3RZCA 1BQUA 2E7MA 2BXYA 3T77B 4F7PA 1T66C 4LHQB 3IRPX 5E8DL 3TJHD 4BFEA 3EBAA 4PLJD 4WV1A 4OZHF 2E3VA 5GZOD 3T0WA 4F7CA 5ICZB 3P77A 5KSBB 4HGWB 1ZEAH 4XXCA 5EU6A 4WU7A 3OJDB 4QXGL 5DHVH 3OXRB 3CX2A 3T0AA 4NKOB 1CFBA 4WFGD 3D2UD 2BNRD 1TCMA 5EUOE 1GL4B 3LV3A 2IAMB 2LFGA 3S34H 4BFGA 3PWPD 1ZHLB 5EO1A 3VFSB 2IPTL 2YZ1A 4J3WA 1FLRH 3LY6A 1I8MA 2PNDA 2V5MA 3WKNA 1OP9A 1MAML 1I1YB 4ZAKC 2V7HA 3TO4C 1BBDH 1AGFB 5EC1B 3BWAA 4LF3A 2Y06H 2VERN 4LU5H 5BRZB 1CLCA 1RZ8A 1TXKA 1F97A 3O6KH 3MGTA 3T0EA 4RMWA 4ZMAT 3V6OA 4FOMA 5KVFH 1NANH 3EYFB 4TVSa 2NY2B 4PTTB 4ZS7L 3RU8H 3IXAB 1SBBA 1CGWA 2I07B 3K7UA 5DDHB 1U91B 1EH9A 1NAMH 4NM8L 2OL3H 1QQDB 3I75B 3VE0A 4U0RB 2DQFA 3KPQB 1OSPH 5DJZB 1UYWH 4FFWC 3FCTA 4S1QH 4I9WD 2NXYB 2OTUB 4P23A 3SKOA 1LVEA 1T3FA 3U1SH 4HBCL 3OX8B 3NPSC 1KBGL 2E9IA 5D71L 5T3XE 1UVQB 1V3KA 1GYAA 3ZTNL 2IALB 1BBJA 4JGUA 1A1NA 3OTTA 4Q0XH 3W82A 4QRRE 4DAGL 5I30L 1CE6B 1OB1B 5I75C 1ZHNB 1NEZG 5FYJU 5DC4B 2ZP0T 4LLQB 1DBMH 2QSTA 5DEZA 2YBRB 3HAEA 5IHBA 4OZIA 2X4NB 5I17B 3VG0H 3U4BH 5LWYH 4PJAB 5IEKB 3V5DB 3NFPB 1K8IB 4DGYL 1HHHA 5I1CH 5J57B 1J1XH 2W59A 3HN3A 4YHPA 4RAVA 5F7UA 4OFYA 5L6YH 1FNEB 4Z5RB 2EEAA 2FH6A 2YPLD 5C09E 3W9EA 3SCMA 1NANI 3GMLA 3MJ6A 1P4BL 1K85A 3DSFL 2N1KA 3B9KA 4WW2B 2NLJA 2EE3A 4GW5A 2R69L 4NQDA 3ZSTA 4HV8B 4LLDA 5IVNA 1KJ2H 3HNVH 3VXUD 2ERJC 5HHOE 1MEXL 3QQ3B 3GSNH 5F1IA 5HI4C 2AK4B 1T04A 2BVUA 3TH3T 1Q94B 4P0DA 4WI7A 4JAMB 4D9RD 1NEZB 4EDWL 4XP5H 2CRZA 2F54A 5BZWB 4YEEA 5JA9A 5FKAB 3L5XH 3IDXH 4G80B 3B6SA 3SDXF 3KYAA 5FCSH 3HR5B 2Z31C 1H8SA 1G7PA 4W4OC 4EBQL 1EDQA 4QRQB 4NHCL 2EDHA 4O4YH 5F89A 4FZ8H 5D1QB 5MERA 3RY5A 3NOIA 3SOBH 2Z91A 3HCVA 5J13B 3QEQB 4YIQA 4OZGA 1QNZH 5JPMA 1K4DA 2V7NA 1RZFH 4IOIA 3FHAA 5CMAB 4R9HA 5DJDB 1UKTA 4TNVK 5LG1A 3ZKMD 2BXZA 4Y4FB 2HJFA 1EUUA 1UCBL 4EI6A 3IDGA 5BOZG 4HUUB 3RPKA 1FL6A 2DMCA 1U8NB 1T22B 4FQXA 3MNWA 1N59B 2KDGA 2UVEA 2KQMA 5JDSB 4MCYA 2NCMA 4PYGA 3U9UA 5HYJB 3HC4H 4RCAA 1FLTX 4M1DH 2YN5A 3T1FA 1IM9D 1TZHB 1N3NB 5F7YC 1MCKA 5E8DH 4TUKH 1CXLA 1C5DB 2CK2A 3MA7B 1ROWA 2A6KB 1GOHA 3H42L 5E9DE 3QFJA 3V7MA 2DQEL 4JDVA 4PJDF 2LTQC 2M26A 2V9TA 3M17B 5KJRL 1JI1A 4ONFL 1J1OH 3VFVB 3GSUB 3UDWA 2VZOA 4FFVD 1ZXQA 3GSWB 5C0AD 3N1MC 1NPUA 4OF0A 1KYOJ 2HAZA 1LDPH 4YDLC 1LNUB 2QV2A 4IJ3C 3GO1L 2UV3A 4KJQC 4XMPH 5E00A 5C0FB 5K93A 2XKSA 3DXAE 4YDJB 5MHSD 5ACMA 4X99B 4CMHC 4PRAB 1KCVL 1MAMH 3JWOC 5D1XC 4JFFD 5KW9L 5J9PA 5EBLA 1DN0B 1AJ7H 2P5WB 1A1OB 1DJSA 4Y4KD 1MJ8L 4GBXC 3W2DH 1AR1D 5HGHA 1FGVH 5GISL 2AS5M 3IF1A 2AV1B 2V2XB 3L7FA 3KYOB 5I8EB 1HHJA 2EIZB 2RBLA 4LPYA 3DRTB 3HE6B 2GTZB 4N0UB 2KZ1B 1ED3A 3VXRD 5K9OB 3N85L 4ZS7H 2WUBL 3CJJA 1AKJB 4ODXB 4W6XB 4V1DD 1ZMYA 3MV8B 1HN1A 5J6GA 3GJFH 5E6ZA 5C07D 4LHUD 1HILA 2XXCB 3OV6A 4EI5B 1RPQA 4JM2C 3RHWF 2UWEB 4IOSD 1WBYA 5D96B 2OI9C 1WWAX 2EE2A 4DZBB 2P8PB 3O9WD 1QPPA 4OKVA 1OTSC 4GRWH 4P9HL 1BOGA 1C5CL 2VDQL 3C6LD 5JA8B 3ZKNC 2FGWL 3LQMA 4HBCH 1MCWW 1KBGH 2JJSA 5D71H 2BNQB 2F58L 2X1WL 2PXYB 3ZTNH 5KSAB 2XKNA 4MJ4A 2BY0A 1KJ3H 4PJCE 2VXSH 4MYWB 4DAGH 4KVCL 3NIDF 2P49B 4BK4A 3L95A 3OXSA 1S7XA 3D48R 4GJTB 4GXUN 3S5LA 4I48A 5B8CA 3OB0K 1BZ7B 1IAOB 3CSYB 3MR9B 3HTLX 3PABB 5GS0D 4Y89A 3FFCD 4DW2L 4WI2A 4LPTA 4DGYH 4C59B 3EDFA 1G7HA 4X4XB 4X4ME 4TULH 5IEHB 3C9NA 3VXQA 4NWUH 5IIEB 1IAIL 4GO6B 4I0PC 4W4NA 3WFEL 4QRSB 1P4BH 2W92A 3P0YL 1ULVA 2C3VB 3QEHB 1D3CA 5ALBH 4FQCL 3LDBB 4B53A 3CDGB 5I8KH 2VQ1A 1A0QL 3B2UC 4PJ5D 4Y7MA 3G6DL 4OLVH 4C83B 1D5XA 1MEXH 4NQXA 1CL7I 1UJ3C 1KULA 1Q9LA 2GJ6B 3KLHC 4HKZB 1MHPL 3WMSA 3U2SB 2YUZA 5IM7B 1NFIA 1RU9L 3MJ8B 1S5HA 2ZSVB 4HPYL 2AK4E 4PJ7E 1X5AA 2HG5B 4PJFE 3BH8B 1ZVSA 5CJQH 4FQLL 4YAQA 4EBQH 3BGMA 4HZLB 4R8WL 5SWQB 2JJVA 4NHCH 3E8UH 4WFEE 1YNLL 4DFHA 4WU5B 4LKXA 3QDJB 2BVPB 3EOAA 5E6YA 3S3PA 2APFA 5J06A 2GW5A 1HHGB 3QRFM 2ILLA 3ARZA 1B88A 4OGAD 2QQNH 1OLLA 5JW5B 1F11A 4PJ8C 3LN4B 4XMLH 1XF5A 4JREB 1CYGA 1I7ZA 2JCCA 3FB6A 3VG9B 4HIIA 4HLJA 2NNAB 4ZOAA 3P73A 5ITFB 4LRNL 3MRCB 1TDQA 4WFFD 5ESVA 1KIQA 4XNXL 4PRBB 1MCNA 1NJ9A 1NBVH 4M3JA 4MCZB 4JHZA 3OWEA 4P2QB 5J1AB 4UV7L 3O6FB 3GK8L 2ZPKL 2WV3A 1MHCB 2R56L 3RZCD 3PDOA 3WBDA 4DTGL 5FIEA 3V5HA 1Z0MA 1JHKL 3SDCA 1R3IL 1MFCL 2KPNA 3HLAB 5TQ0L 2DQEH 4WFHE 1R0AL 1IMHC 3QXAA 3L3JB 5KJRH 4M3KB 4ONFH 4R26L 5IBTL 4M03A 1EXUA 3SKNB 5DUML 4OT1L 3GGWB 4DCQB 2GFBB 3ARBB 4PP2B 3PV7A 5EU6D 4KZEL 2OSLA 3GMMA 1NQBA 1X6NA 3LRHA 5E4IA 3AXLA 4LL9A 3RUGB 1CQYA 3GO1H 4WHDA 43CAA 1RZIA 5FYKE 5I1HL 4U49A 3MQIA 3HPLA 3QUXC 5DLML 3RTQC 1DQJB 5DURD 1G7MB 2XWTA 5KW9H 4OV6F 3T77A 1KGCD 3BDYL 1MJ8H 2F53E 4HAGA 5KS9B 4I1NB 1IBGL 2P1YA 5HHVL 1IC4L 4JDTL 3O4OB 1D5BA 1B4JL 2J2ZA 5HDOA 4HGWA 5KSBA 3N85H 1AFVL 1NGQH 4JG1H 3O0RH 1H5BB 3MBEB 4NKOA 1DLFH 2FD6L 3DROB 2IAMA 4PRIE 1ZHLA 4WVRA 3VFSA 1FO0B 1MCSA 1YNKH 3AFLA 4J4PA 1I1YA 1PD6A 1FG2A 5EC1A 4QKXB 1K6QL 1C5CH 1Q8MA 2VDQH 2EEBA 1AH1A 2UWEE 2FGWH 5BRZA 1MIEL 3OAZH 5D7JC 4P23D 5ETUB 4WI3A 3OAYK 1G0XA 3VXMB 1I1AB 3DX7A 2BHYA 2NX5B 4ZUSB 3PF2A 5T3XH 4GSDL 3EYFA 4KVCH 4PTTA 3IXAA 1DVFB 3LEYL 5DDHA 3H8NA 1U91A 1MQ8A 1CDCA 1KELL 3NCCB 4UT6L 4NOFA 2FX8L 4HT1L 1X5JA 1QQDA 3I75A 1NL0L 5CS7A 4DW2H 3W11D 4Z78B 1TVBB 3KPQA 4Y16B 3SE4A 5DJZA 1GGCL 2CRMA 5IKCB 2YPKB 3ALPA 4Z9KB 2GQHA 3ET9F 3RDTD 4HUNB 4U6YB 3F7VB 3JSSA 3OX8A 3MREB 4OFYD 4M7KL 1EHAA 4ZXBB 1QFHA 3SCMD 2VDOH 2IALA 4UOW1 5F7NC 5MEQB 4FQ2L 4DKAA 1HOCA 4O00A 1E6OH 3B9KD 4IDJL 2YUXA 4K8RH 4ZTOL 1CE6A 1OB1A 5HHQB 3ALWA 1ZHNA 5E56A 1A0QH 4OIAA 1PZ5B 4NQDD 1RUKL 5I15H 4TNWK 3G6DH 3CFEB 1T0MB 2DTSA 2X4NA 4JHWL 4JGJA 1U8LB 4HKJB 4PJAA 5IEKA 2X4SB 1MHPH 3HI6L 3V5DA 3NFPA 1K8IA 4JKLA 1BM3L 1WFTA 4CVUA 1RU9H 1YNTB 1EA9C 1S7WB 3BN3B 3L5JA 2GJ6E 2F54D 3REVB 5JTWA 2BK8A 2QSVA 8FABB 1FNEA 3KYMB 3BSZL 4Z5RA 4JRYE 4ZNCD 4GUPB 3LPGA 1BVKB 1PG7W 1YNLH 1VFMA 2RFXB 3HRPA 4UB0L 4PREB 5DD0H 4HV8A 3MXWL 4LBEB 4ODBD 3IDJB 3NIGF 4KROD 3K8KA 1CFSB 3P4NB 2NY5C 4RMSA 3QQ3A 3KJ4B 1BAFL 4OGXL 1GGIH 5EUKB 2AK4A 1R3KB 4H0HB 1Q94A 4JAMA 1JTTA 4PJIE 1B9ZA 5BZWA 2VXTH 5FKAA 3BEVB 4FQXD 1L7TL 3L7EB 4G80A 1S78D 4FFZL 1B2WL 1HYRC 4HIXL 1JPTL 3HR5A 4UV7H 3SDAC 3ULVC 4HC1L 3GIZH 3DMMB 3GK8H 4QRQA 3BJLA 4CGTA 1JZ7A 1WT5C 2DQHL 2XZCL 3VFRB 3TC9A 3VWKB 3HRZB 5D1QA 1IQDB 3QG6B 5D2LE 4DTGH 1UKSA 4TUJB 5CEXB 2CPCA 2E27H 5CBAB 1OOAA 3QEQA 1MFCH 4ZPTB 3P4LA 1LEGA 1R0AH 1BF2A 3QFJD 5IBTH 5CMAA 5DJDA