1F3JA

Histocompatibility antigen i-ag7
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
182
structure length
182
Chain Sequence
IEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Structural basis of peptide binding and presentation by the type I diabetes-associated MHC class II molecule of NOD mice.
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 182
sequence length 182
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f3jA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1f3jA01
4HGKC 3RWGB 2VDOL 1B4JL 3BXNA 1XF3B 2W0LA 1MHCA 4N8VG 5D7IB 3RIAK 2DIJA 5DD0H 5HHVH 5D4QA 5IFJB 2Z9TA 1KB9J 1UWEH 3GSXA 4JM2B 4G9DB 3NACH 4KMQA 4PJ8D 5DSCA 3VXNA 1S9XA 4AL8L 5F7NC 1KIUA 2VLRD 1TVBB 1PDKA 2E27L 2PR4H 3SO5A 1OP5K 5I73C 1MCPH 1L0YA 2Y06L 1JI1A 4R4FL 3I75B 1U8IB 5GZNC 3E2HB 3LN9A 1S9WA 4PJFE 5I6XB 5L9DL 1BBJA 1FVCB 5I1EH 3FOMA 3ZDZE 1MIML 4GRMA 1F58L 4HT1H 4X6EB 3B2UD 4FNLH 2F53E 4Y0GA 4GAJH 5JQ6H 3PNWB 4I0KA 4LVNC 1CG9B 5DRXB 4ZDHB 3MMEA 5LGJB 3ILQC 1FAIL 2NW3A 3L5XH 3VFWB 1DUZA 4PYGA 1AXSB 2D4DA 5ALBL 5IW1A 4L4TE 1U2CA 4YWGH 1I1YA 3SE9L 2YHGA 4FTVE 1D9KA 1H9VA 4HGMA 5DHYB 3BHBB 5F9JB 4OJFL 1NAKH 4JFOB 3FQNB 4BQCA 3JSSA 3UAJD 4JHBA 3GSQA 5INDB 1R24B 5E1HB 3LQAL 5FKAA 3EYVA 3GBNH 3QIBB 4G8GE 3JV5A 2R39A 4MS8C 5F1SA 4JKKA 1G0DA 1LO4L 3GIVB 5FYKL 3QUXC 4YR6B 3SGEH 4KUZL 4NJAL 2DAVA 5ERWA 1KG0A 4E41D 4JFQB 4P3DA 4RZCB 1TCRB 5TQ2L 3X12B 1EO5A 3HMWH 4K8RC 4Y4FB 4GSDH 4YZFE 3IKCA 4XWGL 4PJFB 4N1HB 1NPUA 3Q6GL 5L0QC 3VFGL 4HWUA 1W0WA 1UJ3C 4RAVB 5GRUL 4EI5C 3BKJL 3LQZA 4BZ1L 5HD8C 1MCWW 2F53B 4XXCC 4HK3N 5E5MB 5LBSL 4XH2B 2WLZA 2IAMB 4X5WB 2CKBL 5HPOA 3GO1H 3VRIB 3U6RB 3G08A 4NQSA 4HF5H 1QYGH 4F57H 2CDFB 1AC0A 5IB2A 2HH0H 3ESVF 3HNSL 4PR5B 2YKLH 1V7MH 1ULVA 2MPAL 3T77A 4J3UA 4XMLL 5EORL 3PGDA 1MEXH 3GB7A 4X6FA 1CICC 1CFNA 3NIFE 2DD8H 4L8DB 1I3GH 3P4NB 4U3XA 3N50A 4NO2B 5IFAL 3TYGL 4OQTL 1OGAA 1C1EL 4MAYC 2DM7A 2VB5A 1YPZE 4M6OH 4M8QA 4WHYG 4LLYB 5JHLH 2Y6SD 4MCYB 4QRPA 3RPKA 1XR8B 3RVVC 3ZHDA 3GRWH 1Q9KB 1QFOA 4HIIB 2EEDA 4RIRA 2HT4D 3V79C 4K3JH 1EXUA 3KDMA 3OKNA 4UV4L 5HHNB 4N90E 4HCRA 5DGRA 5DHVB 3BO8A 1G9ML 5DVNA 4PJXA 2R8SL 1W0VB 4JRXE 4LOUD 3MV7A 3SY0A 3DLQR 4G3YL 5DMJB 5EBWB 1LO5B 1KTDA 4N1CA 4JQXA 5IF0A 4X6CB 1KFAH 1XIWD 4L9DA 4C59B 3IFLL 1Q0XH 1MJJA 4JQVA 5T33H 1BJMA 4Y16B 3UTQA 4P2RB 2A73A 1G7HB 3RRQA 4OFDA 1IE5A 2C3HA 4C56E 1NMCC 3OF6A 2NMSA 4FZ8H 3SKJH 3MV9B 4L8SB 3B8YA 3MZTA 3MNWB 1KB5H 3EJZC 4JVWA 4X6DB 3SGKA 3TBWB 4AQOA 1NGQH 1RY7B 2VUOA 4LRNH 4WV1C 5GS0D 2XA8L 5KSAC 2YPLD 3WKNA 4UAOB 1EVTC 5IB1A 4Q9CA 2R23B 3OGCA 3HUJF 4QT5A 3LD8B 4RAUB 5MEND 1FHGA 3LKOB 1WVZA 4W6YB 5FM5O 3ARSA 3EYUL 5DZOA 5IBTL 1K4CA 5TE6H 2CIKB 3BGAA 3RTQD 1YMMA 5F9WB 3AAZB 5MI0B 3HE6B 2YPKA 2IBBA 4S2SB 2V17L 3AXLB 1ACZA 4JZOA 4R6UA 4U1GC 1QRKA 2NY0D 3FRUB 5FKPB 1GRWA 3MRBA 4TSAH 5HDLA 2XFXB 3DTXB 3V8CA 1JGEB 3SGDH 1AIFA 3GJEB 4M61A 2VKXA 2NY3D 2DKMA 3UYPA 1A9EB 3NBNA 4J6RH 2XPGA 4WY7H 3N1MC 2ADIA 3OPZL 4GKZB 3KHQA 3ARDA 4HXBL 2YUZA 4K3EH 3J8F7 1BPVA 4ZUWA 3RPIA 5DTFA 4X5XA 2XRAL 3D3VA 3PHQB 1QR1B 1BM3H 2NW2B 5B3JE 5ITBL 2HRPH 3AY4C 2DL2A 3BJ91 1O7SA 1QFUH 4PREB 1OCWL 4BJLA 4IS6A 5EPMA 5CGYC 3STZB 5ANMB 3VXRD 1WC7B 4PS4L 4Z9KB 2CJUH 3MJ9A 4OF8A 5FYKD 4U1NA 4CAGA 1NJ9A 4Q6IC 5I8EB 3T04D 3FFCB 1C8PA 4I3SH 4IHOB 2IAND 5INCA 3WEXB 3OL2A 5I66B 2JCCF 4GRLC 3IXTB 1EAPA 2OX5A 4YK4B 4XCEB 2ED8A 4CU6A 5IVZA 2B7DT 4ORZC 2XKSA 3KLSA 3GMQB 2XG5A 4U1MB 1IM9B 5C0CD 1P7HL 3CVHA 3IAPA 4JR9H 1Q9WA 3Q1SL 3K81A 4ZAKA 3UBXG 5IW6A 5CZKA 1ZK9A 5C0DA 5ECJE 1KC5H 2WLYA 5BS0D 1BLNA 1IQDA 4LBEA 1CLYH 1KPVB 2NY1B 2HKFL 4AJ0A 2H9GA 4AMKH 5HI3C 1REIA 3P9LB 5FA4B 1AE6L 3MBEC 2BX5A 3IU3A 4LLUB 4M62L 1R0AL 1A64A 4QRQA 5CCKH 3ZSSA 5B8CB 3BPCB 5HHOB 1FG2B 3EBAA 3BRGC 2P8LB 2F58L 2R0LH 5D93C 1CGXA 5DI8B 1TJIL 3PWVB 1CIUA 4GQ9H 5F7UA 3WO4C 2NXZC 1GCFA 1FZOB 5ID0B 1CFTA 4PRPD 2R2HB 3O2WH 2PNDA 5TF0A 5D7JB 3WDJA 1Z9SA 3LKRA 5CJXC 4GAFB 3R4DA 1S9VA 4G80B 5ESVB 5F7EL 4U1HB 4X99B 3EDJA 1L4IA 1LP9F 4WHCA 1YY8A 4HJGA 3EOTH 3VWJA 4QEGA 1HXYB 3O41A 4K3DL 3KYKL 5CJBA 5KOVC 3JVGA 4XCNA 3I2CL 3MNVB 2FBJH 4FQXC 1C08B 4XI5C 5JW5A 3CK0H 5HTSA 1IAKA 3ARGA 4R0LB 1JK8A 1AD0A 2HFEB 1OM3H 2NYYC 1EHNA 2XZCL 2FD6L 2QSCL 4BFEA 2SEBB 4YHKL 5DFVD 1HQRA 2F5BL 2Z31C 4O2EA 1IGYA 4XP1H 2GT9B 2HJLB 3QR2A 5HGAB 5J7CC 5EZOL 4JRYA 5HHQB 1NBQA 3FO1A 3MOAH 1T5XB 2VL5A 3KPNB 4MB5A 4P46C 5T5FL 3HPLB 2NR6C 5CJOL 3VU2A 2VQUA 4Q0XH 1OF2B 1U95A 4GMTH 5IIEB 1P1ZA 4FFWD 4X9HA 3TBTA 1KT2A 2NY7H 3KR3H 4HKZB 2A1WH 3BGFB 3QNZA 1WCQA 5EU6A 4XPGL 3MLSL 4XBEL 3WHXB 1FGNH 1NFKA 2DQFA 4G8EB 1EJOH 3JWDC 2R0ZL 3ZYOA 2LTQB 4Q58C 5DD1H 1AO7B 2NY6D 1AKJA 3QIUB 3AS1A 4LVHC 1P4IL 3JXAA 4XXDA 1VA9A 4F2MA 1C5CH 3QO1B 4WEUD 2W38A 3DVGB 3QUZD 4A6YB 1BQHA 5D5MF 3BZFA 3MODH 1JP5A 2VC2L 4Y2DA 3IB4A 2VXUL 3T3MF 1N7MH 1D5ZB 2KBGA 2R69L 3L3IA 4XC1H 4F58H 4N0YL 4U1SA 2DMKA 3VFTB 1KPRA 1YNTB 2VLRA 1BAFH 1MREL 1JHKL 5E8NB 4NNPH 3WLWD 1JWMB 3H3KA 2YXMA 1CLOH 3U4BL 4PJ7A 3SKUD 3U0PA 3V6FB 4DN3H 3KHOA 1OHQA 1J87A 3MRLB 1AD9B 1YNKH 4I77L 1CBVL 4HUWB 1DVFC 4WENB 3HCVB 3X3GL 3L1OL 3BVNA 1LE9A 5FA3B 2OR8A 5IOPB 2FO4A 1R5IB 3CMOL 3RWJA 3QQ4B 2EDXA 2HAZA 1JZ5A 1H5BB 4LEXL 3G9AB 1DBJH 4K7FB 3HC4L 1FFNA 3O6KH 4DTGH 3O6ML 5FYLE 5DK0B 1G7LA 1NAML 3NZ8A 5DD3L 5M95B 2M26A 2OR7A 1ADQH 2EH8H 1M7DB 1MJUL 2B1AL 4ODSL 4UB0L 1IZJA 32C2B 3HZVA 1ZHKA 5AAWA 1NMAL 3UTSE 1P84K 2M8XA 1MHPH 1HEZA 1JTTA 4XCFL 5IVNA 1TFHA 3MPCA 4K2UH 4Q9QH 3QJFA 2ADFL 2E6PA 3DNKA 2NY2C 4OBRA 3TH4T 3O9WC 2OLDA 4FOMA 4E41A 4OGXH 1ZV5A 3DI3B 2A0LD 3GDBA 3ZYJA 3MRPB 1AHWA 3VE0A 2VR5A 1X44A 2ATKA 3HUJB 3QDMD 4Y5XA 3KXFD 4WCYL 4CN4A 3ZLQC 4YDVB 5D1XD 4F9PA 1KIPA 3QCTH 4F7CB 2P24A 2GAZB 4BZ2L 2CUMA 3UPRB 5E56A 5B39B 5GQBA 2RGSA 5I19H 1MCJA 5TDPB 3O81A 3F12A 1GC1H 1NUDA 4FQ2H 5IMLB 1ZVSB 5BRZE 4CVZB 4PBXA 1X5LA 2HMIC 4KH2A 3TWCL 5DURD 4YUEL 4YNYA 4LP4A 2ERJB 2I9LB 2PYFA 5DMGC 1P7QD 1JV5B 5D2NE 1ZT1A 1S5IL 1H3WM 1QSFE 3NFNB 3OKOA 4N9GA 4KROC 2AK4B 4JG1H 1RUMH 5FYLH 5DVLA 2EEAA 3MGOB 1ODAA 2WK2A 5D2LF 3T1WA 3RNQB 1RJZB 5C7XL 5TDOA 2UZIL 5IMKB 4FQHA 4HUUB 3RVTD 3LH2L 4GOSA 1CK0L 3HS0A 1I8MB 4AM0B 3MRHB 3QJHB 5F7FA 3KVQA 1IC4H 4OZFA 2NX5B 2WIIB 3CFBB 4NNYA 5GGUB 5D8JL 3VJ6B 1KENL 4FQQB 1HYSC 3QG7H 2WIMA 3QUKB 4I0PB 4MNQA 3A6CH 3SDDB 1WT5A 3WDHA 3LHPH 3THML 1F11A 1A14L 1DE4B 1FL3B 4HC1H 2JCCB 4H25B 2AQ1A 1XF2B 3X3FH 2XQBL 1XIWA 3E6FB 1YJDL 3S34L 3LB6C 2XWJA 3IF1A 4WI8A 1OLZA 4PLOB 5L6YL 3MLVL 4LCCC 3GUTA 1L9NA 4TN9A 1BZ9B 2ZCLL 3HR5B 4OGZA 5TQ0L 1KLGA 2AJSH 1Z6JT 3LKPB 4OUOA 2ORBH 3BDYH 1ZLWH 2DBJA 2Q6WB 1S7SA 2OQJB 2F8OA 4OF0A 1RURL 2EYRA 4TUJB 4PTTB 1T0MB 3MUY1 1S7TA 2V5TA 4ZPTA 2FSEA 1S9YA 2P5WE 2ZCKH 4X8JA 3HNTH 1S8DA 1CCZA 2PW2B 1QFHA 4RGND 3UXFA 3LKNA 5KOMC 5FOBA 1UENA 4K3HA 2UY7A 5ETUA 2FNBA 3CSYB 2AJVH 2HRLA 2C3VB 3RTQA 4H0HB 2V2WB 4QGYA 5I0DA 4Y5VB 5HHMB 4IOSD 5MEQB 2UYLB 3G5XA 4D9LL 5CLWA 2O61A 2VJXA 15C8L 3O6LH 2Y1VA 2P7TA 3FQRA 3PUCA 2PW1A 3LAFA 3AMKA 1LP9B 3VI4F 2BMKB 4MZ2A 1MI5D 3MGTB 1DL7L 1HHIA 4NKDB 3VRJB 1MOEA 3KG5A 2GITB 1JWSB 2C3GA 2KH2B 5E6IC 4FZEH 2AJZB 1IAOA 1BGXH 3QUXD 4JHAH 5TPWL 3CZFB 1WF5A 4KY1H 2YOCA 1RZJC 5DJYB 4K8RD 3IDJB 4NN6B 5IJVB 1WIPA 2WUCH 1KSRA 3VXUB 2L7UA 1K5NA 1F02I 4EI5D 3L6FA 4QXTB 4RSVA 4U1KB 3OR6B 3QEQB 3KJ4C 1WGOA 2PYED 3VXRA 1A47A 5HD8D 4AEHL 4C58B 1T5WB 2X9XA 4JFEE 1KCSH 5JO5B 5JXAL 1ZLVK 1VDGA 2DBLH 5HYJD 3V5KB 1A4JB 2PXYB 3DUUB 4Z7QF 5JOPE 1RZKL 1EX0A 2ARJB 3BPLC 2OSLA 2IANA 4NQUA 3OXRB 2FWOB 3BQUD 3BH9B 1V3KA 1RMFL 3ZKQD 4BZYA 3C8KB 3DV6B 3DUSA 4P2CG 3RNKB 4ELME 2WAHA 4PJ9C 4YO0A 5GS3A 1LO0L 4OKVA 2Y4SA 4QRRE 4LF3A 4V1DE 5DK2B 3WN5C 5CD5C 4LSTH 3WNOA 4AG4H 4D0CA 5E4EC 4BKLB 4Y5YA 2A2QT 4YHLH 2X2YA 2YMXH 1I85A 5ELIA 5AZ2H 4CVWA 3SOBL 3SGJC 1OT1A 4R7DA 4XVTL 3DHMA 3TZVD 4XP5H 3MLTB 4WI4A 2VXVL 3ZL4H 3PWPA 1SYSB 2VITA 2EDOA 1A6VL 1WBYA 1IM3B 4MD5A 1E28A 4NP4L 2JLLA 2UY6A 1HHKA 1MCWM 4K23L 5SWZD 3TJEL 1EPFA 1ZTXH 1WEJL 2XQYG 5EBMA 2A77L 1YYMH 1VPOH 2DQDL 3OZ9H 4XNUH 4PRPA 3V0VA 1MCSA 2ZPKH 4YQXL 1QEWA 2DM2A 1HHGB 1VB9A 3RY5A 3FCTA 1LO2L 3P4MB 2GJZA 2ARWA 2CQVA 2ED9A 5BV7C 1QBLH 2DQJL 3FAWA 5DK3A 5GISH 5I1KH 4O2FA 4OLXL 2R2EB 5D7SL 1UKTA 4KZEH 3NCJH 4EN3D 1JFQL 5BZWB 5JMRA 4WWID 2DQEH 1JN6B 5F8RC 3MRGA 1DANT 4MJIB 1B6UA 4HX1B 1DP0A 2LU7A 3QZWA 5F1KC 4B5EA 4N8VB 1CDBA 1JNNL 4L5FH 4FQPA 4MSWB 5EO1B 5DEFB 3VDCA 3ISWA 5I17B 3BEWB 2P8MA 1W8NA 1MVFA 3PIQB 4U1JA 3TM6A 3B8SA 3MV8B 3PWJA 3VXOB 4C57C 4NC2B 3IVKA 4Z0BL 2MMXA 3PL6B 3QDGA 4QRSB 4XP4H 2H1PL 1HXMA 3OAUH 3HG1B 2AV1A 5I9QB 2IPTL 4UDUB 1NFDA 1IAIL 4FMKA 3TBYA 5KSVB 1UXSA 4GKSA 2C7UA 3I6KA 4S1SH 2H3NA 4F33B 1YQ2A 4JLRA 4DAGL 1G84A 1BJ1J 4XX1G 43CAA 4Y4HB 5HGBB 4P9HL 5HHXH 1W72L 3DBXB 4U4BA 2BFVL 5CGMA 1FJ1A 4NPYB 1CDYA 1H3PL 4ZTOH 3DX7A 1OSPH 3Q48A 4D0DB 5L8KB 2Q1EA 4JM2C 2ICWA 2NNAA 3WYRA 2X4QA 5K93A 4CUCA 3QUZA 4O2CA 1Z0MA 1NL0L 4LPVA 4X0KA 1M6OA 1P7KB 4OZ4B 4G9FB 5GGVY 1F6FB 4HWBL 4OZIA 5GJTL 1EBAA 3LEVL 2P42B 4FQLH 4CJ0A 5ACZB 5I6XC 5C09D 3D2UB 1ACYH 4LLMA 5HSFA 3RFZC 4ELKB 3BT2L 3HKFA 4LDLB 4AIZB 5D2LB 4PP1C 4P23B 2J2ZA 3HRZB 2I26N 4F80A 3T08A 1NCBL 5FUOH 4WUKH 3VCLB 1JVKA 4MDIB 3GHBL 2D31A 3V7MA 4N0UA 4RFEA 2CMRH 1D5BB 3PV6A 2YA0A 3HNVL 4LNRB 1U8KB 4E0RA 4HPOL 1E6OH 3QFDB 2GY7B 1C5DB 2APXA 4ONHB 3TN0D 5HHPA 2W59A 3BD5A 1TZGL 2QL1A 3QIWD 4YAQA 4CVXB 1LILA 4J2XA 4I9WD 1AJ7L 5C0GA 2MQCA 4HMCA 2XZAH 3IDGA 4QRPE 1YECH 1YEKL 5HI3D 1HH9B 1EEZB 4M7LT 1DR9A 4PRIB 1VADB 4F7PA 2CLRB 4QTHA 3KLAB 5T1LD 1A9BB 4PJXE 3DRTB 2Z8WC 3QHFH 1BD2E 3TVMB 2XNAB 4AY0A 2EH7H 4Y4FC 1U3YA 2B0SL 3LPFA 3VFMA 3QCVH 4JFZH 3QB7C 4TQEL 1ORQA 3D85B 3QPXL 7FABL 3QXWA 5CINH 3B3IA 1N0LA 2N7BA 3C5SB 3D18B 1P4LB 2IQAB 2FGWL 1HI6A 1IEAB 2GUOA 4GKNA 1DLHA 5DUMH 3RL2B 3KXFA 3PDGA 4WI5A 1BVKA 4ZUTB 5D1XA 5GGSB 3K74B 2IAMC 4QNPE 1R3JB 1SBBA 4OZGB 1DEDA 3RDTB 4PJ5B 1XR9B 4FQXD 2WQ8A 4J12A 5DR5L 4WW1A 1KTRL 1N0XH 5FFLA 2NYYD 1OT2A 1OTTC 3EYOB 2JK5A 1LDPL 3KPTA 2W0PA 1F2XK 1EEYB 4WW2B 4UTBH 3CSPA 4OQ1A 1W2KT 1J1PL 3SCMD 2P46B 3DSFL 5DO2C 2DWEA 3O3BB 2NQCA 4P46D 5E9DE 1H3TA 5I2IB 2NR6D 4MLSA 2BVPA 2DQIH 5JXEA 4ZFGL 2KDGA 2BSRA 2LABA 4PJAB 1OGTA 2V2TB 1K8DB 1MFEL 3K8LA 4LLAA 3K2UL 2VAAA 4ZO7A 2E5EA 3K4AA 5E2WH 3FB8B 3QEGH 1NCAH 1BD2B 4U1IA 3SDAD 1XCQB 3QULB 2IH1B 2JF1A 1BOGB 4N9OB 3WFDH 1MPAH 3UJTH 3D3VE 4TVSa 3EYQD 2I9TB 4WO4D 3KLHD 1UFUA 3TIDA 1JF1B 4HHAA 2EDJA 4KI5D 1TNNA 3OB8A 3GMMB 1PG7L 1T7VA 1CT8A 1HILB 1J0ZA 1UXWB 1GJIA 1E4WH 2D03H 4Y16C 2R0WH 5AG8A 3DX9A 1TZIA 5HY9A 4BA8A 2RB8A 4R3SA 4OFVA 5DLML 3UJJH 5ID1A 2DYPA 3RKDC 3KPSB 5GS2D 1H3XA 4HGWA 4JEGB 3L3JB 1SY6A 2AI0H 3R06B 4UAOC 2OYPA 3W9DA 3QYCA 5ISZD 3DV4B 5DEGB 5EH1A 1CGUA 2Y23A 5EUOA 1P4BH 1J5OL 3LD8C 5C86A 3RWEA 1DVFD 3MCLL 4OB5H 1RUPL 3H9SE 4RMWA 3ROOB 3P9WB 2VH5H 3T0ED 1D3CA 2F19H 2EDBA 3BPNB 4GRWE 5F9WC 4WFFD 1ZLUH 5MI0C 3HE6C 3VFUB 1OWRM 3HPJB 3CPLB 4MD0B 5IK3A 2HG5B 2Z8RA 5HVWA 3GI8H 4R8WH 3QEUA 5LXGL 5C08E 3L3HB 1Q1JH 4GFTB 4YDKL 1IZKA 1F4WH 1NGWB 3QG6A 4PGZA 1RQ5A 1RZJL 5DJ6B 1U93B 2ZOKB 1XF4A 1XGPA 2J8HA 5CGTA 4M7JH 2Y7QA 4KJQD 4OZHB 1I1AC 1MI5A 2X70A 4XC3H 5IT2H 25C8H 1S7WB 3WLBB 4GXUM 2H41A 1YC7A 1KCVH 2HKHL 1A6AA 2I07B 3QUXA 4IOIB 4WHDA 1VFUA 3KYMB 2VERN 3UBXB 3MRKB 2R1XA 1ZA3B 3O2VL 3DROA 4BH7A 3DYOA 1KPUA 4FQJL 4S1QH 3EFFA 3NH7L 1RFDH 1CFSB 1SM3H 3LN5A 2G2RA 3L3KB 4R4BA 1QPPA 1UJ3A 2BK8A 5DUPH 4EI5A 4KTDH 5CBAB 2PYEA 3C2SA 5HDQH 2PTTA 3N9GH 1TMCB 4G8FB 3SDXB 4XXCA 5HYJA 4IBLT 3MYJA 5EOCH 7CGTA 3U0TA 4D9QE 3LCYA 4YK4C 3LEXA 4IMLA 3CFCL 2X4NB 4PIRF 2PO6D 3BFOA 4L29A 4ZUVB 1WAAF 4WNQB 1C7TA 4ZO6A 1GZQB 5GSRA 5MEPB 4GRWH 4YHIB 1A6TB 3PXJA 5L8JB 1D7FA 4MA8H 4MJ4A 5ICYB 2QQNH 2W91A 3AVEA 2YSSB 4XPAL 3P9MB 4PRBA 1HSAB 2ZJSL 5EOTA 2VLKD 3LDBB 3V6ZA 2BSTA 3R1GH 1CICA 2DI7A 4RGOH 3BP4A 5F3BA 5B8CC 3MRQA 4EVNB 4XMKL 4LEOA 1A5FH 1LEGB 4UQ2A 5A2IH 3D39A 3DXAD 1JPSH 3KYNA 4L4VB 5JW3L 5F6IB 4UOJA 2AV7A 4MAYA 5J11B 3TZVA 1XGQA 5JHDE 3P3YA 4ZSOB 4MNHA 2P4AB 5D7JC 4M00A 1OWWA 1V3MA 3VXME 1U6AH 2BZDA 5SWZA 1YN7A 3CUPA 3FO0H 4ZFZA 1HYSD 3OKDA 4LHUD 1FZJA 4MYWB 1KJMB 3CAFA 4DVBA 5GRVK 1KN2H 3VFSA 2G75B 2YUWA 3E8UH 1F97A 4P4RB 1KNOA 5EN2A 4O02L 4TOYL 4R2GB 2ZSVA 2W9DH 4ZS7H 4MJ6A 1FO0B 1T22A 4R0LC 2E7LA 1QZ1A 5IVXF 4OCSH 4WU7B 2VLJD 3QI9D 1OL0A 1U92A 3ARBB 4PJBA 1T1YA 3EW3B 1FO0H 4XB7A 1A1OA 4U6VH 4WV1A 2XN9B 3B5HA 5H35B 1FN4A 5KSAA 4TULL 3IYLW 1WFUA 3BSZH 1H0DA 1MNUH 3TH2T 3W2DH 3GSRB 3H42H 5HHVL 4NQCA 1X4ZA 5MHSD 4YXLH 4NQDD 1UWEL 2NXYB 3CX5J 3NACL 1ROWA 1QSEA 1I9RH 3BGFC 3NAAH 4J1UA 4QKXB 1N6QH 3IS0X 1UB6A 4CN6A 1S7QA 2PR4L 3I6GB 2RR3A 1MCPL 3DYPA 3FQUA 3U79A 3CNKA 1T2QH 5JHDB 1WV7T 2LTQC 3A6OA 2VQ1A 2JIXB 1FPTH 3OJVC 2IBZY 3ARVA 1BF2A 3VFNB 2Y5TB 5LWYH 5CUSH 2UWEF 3QIUC 4NQXB 3VGEA 5I1EL 5DA0B 2H2SC 2Q7YB 2CDEB 2LAGB 4JKPH 1SHMA 3OAZH 4HT1L 1C5BH 3WHE0 4FNLL 5JQ6L 3DGGA 4GAJL 4NZTH 4U6YA 3VXSA 4RFOH 2APBA 5E2TH 3MV11 1MCQA 2EYSA 5E6ID 1T6VN 4U49A 2Q7NA 1IAIM 1T7ZA 3K7UA 2CKNA 4MXWH 3SE8H 4BUHA 3DARA 4YWGL 3NCBB 3K4ZA 3TBSB 4F7MB 3U7WH 4ZNEA 1NAKL 1INDH 4KRNA 2GIYA 1TLKA 1G9EA 4HS3A 1FIGL 3QRGH 4JFDA 2C4FT 2ITDA 3GKZA 4W4NA 5C09A 5ICZA 1BQLH 2BSSB 4OTXH 3RP1A 3HC0B 2EXYC 1T21A 1IT9H 4Z7UA 4Y7MA 3MLWH 3G6AB 5E6YA 1G6RB 1H5BC 1SJEB 4GXVH 4KVCH 1A7PH 4GRLA 4PLJC 5I1IH 2H6PA 2RQ8A 5ILTH 3H7BB 4Y19B 3FZUC 2UZYB 1YY9C 5CZVH 3HMWL 4PGDA 1J18A 3FN3A 4GSDL 3STLA 2A74A 3CFEB 2AEIT 5DRWA 1CS6A 5FECB 4I4WB 3TN0A 1QLFB 3QIWA 5IEKA 3OJDB 4NQTA 1U36A 3FB5A 2ZUUA 3QH3B 4QO1A 1E6JH 2LVCA 5L2JB 5CFHA 2N56A 3GO1L 4Z7WA 3MBEA 4JCLA 2QSVA 4HF5L 1T1ZA 1QYGL 4F57L 5KSUB 1X5JA 5GIRA 3VFPB 4ETQB 1WTGT 5GXBB 4MNQE 4GXUN 1AXTH 1BFTA 1UCBH 4GUPB 5CSZB 4MAUH 5DJ2A 5T1LA 5DQJA 2EZ0D 4MQ7B 5HJ3A 2VKWA 2YKLL 1V7ML 4JY4A 4ZOEA 1NGYA 5SWQA 5C2BH 5D1QB 4GG6F 3RU8H 1LWRA 1LK3H 3RZCB 4E9LA 1U3JA 3LQMA 1MEXL 2VZTA 4NKOB 1N8ZB 4XAWH 5L2KA 2DD8L 1I3GL 1WBZA 3VI3E 5TGBB 1G7MB 2ICWJ 3ILPA 3X14A 1IGJA 5CILH 2NY5C 5BXFB 4M6OL 4FFVD 1OAKH 5JHLL 3UTTB 3T2PA 1KYOJ 3QHZH 3IS1X 3O3AB 4HJ0C 3H7LA 3GRWL 4MCZB 3VDBA 5I8OH 5JOFB 4P2QE 4FQXA 4U0RB 2DKUA 5J1TC 4K3JL 5T1DH 2FEDD 2J8UE 1WBXA 2ERJC 3GSVB 2XQYK 2C26A 2W9EL 3T0VA 5J57B 2EIEA 2YBRA 4YHPB 5E8EB 5IB4A 4Q2ZB 4WIQA 4NO5B 1IAII 4OV5B 4TSCH 1RZ7H 4PJCB 3N1FC 5C0NC 1KFAL 1WFNA 4GKOA 3SCMA 5HYSG 1Q0XL 2HLAA 5T33L 3ULUC 1A2YB 2D0FA 4P46A 5J6GA 3IDIA 4XCYB 4FZ8L 4Q6YA 4J8RB 3SKJL 3TA3B 2FZ3A 1KB5L 2R56L 3HE7D 1NGQL 2ESVB 2H8PA 4OZFH 1FYTB 4LRNL 3PABB 1G9NH 3EO0A 3BH8B 1BFOB 2VLME 3EOBA 1FFPB 2CXKA 1OY3B 5HDBE 2VXQL 2P5EB 1KOAA 4I0PC 4NCDA 3SDDC 2X4UA 4J23A 2VAJA 4WDIA 3CD4A 1A3LH 4EDXA 5DMYA 4TTGA 1CXIA 4XBGA 1PLGH 4NRZB 3MREA 5TE6L 1U3HD 1HH6A 4LCWD 5E1AA 5D1ZB 3LMJH 2OM5A 3VWKB 1SBSH 1I8LA 5DJ0A 3VGHA 1DQJA 4TSAL 1F3JA 1RIUH 1W72A 1JUFB 1AGEB 3EYSH 5ITFA 5CZXD 4I2XA 2FH8A 2VIRA 5GS0H 1JNHA 3QNYA 1SEBB 1K4DA 3QQ9C 4QHLB 2W65B 4J6RL 4WY7L 2YEZB 4LKCA 3GMNB 3GSNH 4PP1D 1GL4B 3W0WB 4ODBD 3ULVH 1V3LA 4K3EL 2CIIB 2YPVH 4BFBD 3GSWA 1DVFA 4ODXA 5EC2B 5FDWB 4U3HA 2Q8BH 2BOCB 4PTUB 4KWUA 1NLBH 1BM3L 3W82A 8CGTA 2GJ6B 2CDGA 1I3RA 4KDVA 4EXKA 4Y5VC 1QFUL 2KL6A 3N85H 2WBJD 5CLTA 5A3IC 4DKAA 1OAXH 4JDVA 3FT2B 4YDJB 1CU4H 1R5VB 2XKUA 3JV4A 3L5IA 2CJUL 4M6AA 1D5XB 1Z2KA 3SKOB 1N3NA 1ZGLB 3OGOE 5KVDH 5JA9A 4PJDA 1ZLWK 1C12A 2IPUG 3PWPE 4APQD 3VXQA 1DZBA 3JV0A 1NBZB 5LQBH 4I3SL 3NN8A 4Z7VB 3AM8C 1P2CA 1CGTA 5E5RB 2ADJA 3HAEA 5IVXB 3EO9H 2A9MH 2H32B 5DD6B 1EAJA 3OX8B 4PBWD 1FNAA 5EO0B 3ZE1F 1CLCA 4RGMB 4Y4FD 4HFWB 4NN6C 1F4XH 5GRVL 4H20H 2NTFB 4BUGA 2HFFA 4PPTA 2DJ4A 3BD3A 1PSKH 3QXDA 4JR9L 4WHTA 1KC5L 4KI1A 1CLYL 1Z9MA 1JGDB 2IFFH 2DMBA 2Z92A 4WEMB 1DUYB 2F53D 3OMZA 4AMKL 3JTTA 5LJYH 1DCLA 3WXWH 2FYYA 1IEHA 1MCRA 2X4RB 5CCKL 1C7SA 5SWSB 6FABH 1GGTA 2R0LL 3MLXH 2B39A 1QP1A 4KKAC 4L8BA 4X7DC 1FL6A 1J7VR 4GQ9L 5FYKU 4KUCF 3G5ZA 4L4TD 3MRFA 3MRJB 5EIIA 4KRPD 3O2WL 4FTVD 1ZSDB 4XPHH 3QDGE 4QHNA 4CRPA 2EYTA 1QHPA 4KJWD 1Z5LA 3FO2A 2EKSB 3JWOH 3EOTL 3T8XB 1NFDE 1QLEH 2O5XH 4HUXB 4NZUL 1QO3A 3W9EA 4PLKD 5LG1A 5J06A 4G8GD 1YQVH 3C6LB 1FNLA 1MCFA 3SKNB 2VLKA 1HIMH 1Q72H 3TIEB 2Q76A 1SMAA 2FBJL 4I5BB 4YBQC 3CK0L 3I02A 4PG2C 4LCYB 3DVNA 1F4AA 3IJSA 1N59B 5E95B 1L6XA 3UTPE 3DXAA 3VG0H 4CMMA 1RK0B 2ZUXA 1J05B 3GZKA 3MOQA 1KN4H 4XP1L 3VFVA 3MRCA 4P5KA 1X5AA 5JIIA 1G0YR 3O4LE 5K59F 5D72L 3MOAL 3D9AL 4D8PA 4LHUA 2BVQA 4JVPA 5I76A 4Q0XL 2QQQA 2DTSA 3MJGX 4Y4KD 4GMTL 2X1QA 1HDMB 4M6NH 4WTWA 4PD4K 2NY7L 1JPGB 1KTLA 3KR3L 3MV9D 2A1WL 5EFIA 3WNNA 4M7KH 1S5HA 1AGFB 4HBCH 3W11C 1FGNL 3AREB 2ILLA 1EJOL 4LCCA 5DD1L 1EFXD 2GSIB 4M02A 3BZ4B 1Q0YH 1MAKA 4RMSA 4P0DA 5FAAA 1UQSA 1JRHH 5C3TA 3NCYP 3GJFA 3F7VB 3PL6C 1JYVA 5C0AB 2OTWA 3MODL 2NZIA 1QRNE 3PWUB 4JFXA 3L7EB 4JREB 2MNUA 5DZLA 1N7ML 4DGVH 5I9QC 4L9LA 4NQDA 4XC1L 5E7FA 5JNYA 4F58L 4KC3B 3QFJB 3RGVB 3FOLA 4QWWC 3E3QE 3IJHA 1BAFL 1S7UB 1F42A 1FVDA 3KPOB 4OZFG 1RV6X 4NNPL 4GG6B 3ZT6A 4JN2A 1CLOL 1U8MB 1EO7A 4N90D 4Y4HC 1JHLH 3IDYB 4IRJD 4DN3L 3GSUA 3SDCB 4HZLB 4JRXD 1G7JB 1YNKL 2VABA 2VDQH 3QWOB 3NFPB 2NZ9C 2QHRH 3OAYH 5LGHH 4PLNC 2G5RA 1I7TA 1I1AD 3FB6A 2DJSA 3IFNL 3DURA 3Q3GB 1CD1B 3MUGB 2VN4A 2R1YB 3F7YB 4KV5F 1ONQA 5E6IA 3O45A 4EUPA 3HI1A 3WKMH 1KLFA 1DBJL 3O3EB 3O6KL 4DTGL 2VLLA 4PJEA 3CLEH 4PRAB 3D25B 4JJ5B 1PQZA 5EBLA 1ADQL 3IJYB 4YFLI 2GTWA 2EH8L 1VFAB 2FJHB 4F7EB 2PN5A 3WDIA 3HRPA 5IHLB 3SQOH 1OLLA 4P23C 3FJTA 2ADGB 1MHPL 5JUEH 5IG7B 5IQ9B 4XGZB 3WS3A 4K2UL 4Q9QL 3QUYD 5E94B 1ES0A 4YFDB 2FL5B 3MRMB 3REVB 3FB7A 2M2DA 5AAMA 2N4IA 1KXQE 4MA7H 3FT4B 4LPWA 4YX2H 3FT3B 4JFPA 1NEZB 4PGBA 5L8LB 3VMOA 2WWMC 2D3VA 1A7RH 1KXTB 3IETA 4H8WC 4LVEA 3SKMB 2X10A 4PJ9A 2D7NA 1PYWA 1J8HB 3WN5A 4ZFOL 1S7RB 1D5MA 3CVIH 5I19L 5CD3A 2P44B 2WSKA 1BX2B 4N0CD 1GC1L 1PY4A 4FQ2L 1X3DA 3VW3H 4R4NC 3TVMC 1I8IB 3GMOB 3EZ8A 4MMZC 4QNPF 4ZD3H 3SO3B 4KQ3H 4DZ8A 3RHWF 3VH8A 4OT1H 3TCLB 4UV7H 5IR1B 3GKWH 4JG1L 1RUML 5FYLL 1ZWIA 3C5ZD 4Z7OE 4RBPH 4BYHA 1TVHA 2VDMH 1Q9OA 3CDGB 1ZT7A 4JDZB 1IGIH 4U6XB 1WLHA 2JJWA 3RDTC 3V9FA 4BH8A 4U1LA 1CDCA 5J4MA 3EO1B 3C09B 4J3SA 1IC4L 3B9DA 3QT2A 4F8QA 3KNBB 3OKMA 3S96B 1ZHBB 1I1FB 1XH3A 1OPGH 4WW2C 1UGNA 1HKFA 4PGCA 4URTB 4YPGA 3RUGB 3QG7L 5F71A 3A6CL 3V8OA 2A6JB 5GS1B 1FAKT 5MERA 2X1OA 3LHPL 5C07B 4K9EH 2FR4B 4HC1L 5FUZH 3WE6A 2F54E 2R29H 3TO2A 3DO7A 1T66C 1CDGA 3X3FL 3IFOA 2XI9A 2IJ0C 3U36A 1AI1H 5GSVA 1HHJB 2CK2A 1TQCB 4P2OB 2FIKA 3LRSB 1IC5H 1FYHB 3PWNB 1A6ZB 3FFDA 1F00I 3HE7A 2AJSL 3CU1A 3W39B 4JJHA 2ORBL 3BDYL 4UU9A 5DQ9A 1JYWA 1VGKB 3L3OA 2N7AA 2PCPB 4Y1AE 4PGEB 3RWGA 3E6HB 1XF3A 4D9RE 2ZCKL 3HNTL 3UO1H 4QRTB 2RFXA 2AK1H 4M6MH 5D7IA 4K94H 4XPTH 1KIRB 1A3RH 5IFJA 5CSGA 1QVOB 5GRJH 4PV9A 1F13A 4HZAA 3KLDA 1U3HA 2AJVL 4GLRH 1NCWH 4JFYA 1TVBA 3TF7C 4LAJH 1RULH 4JFFB 3O6LL 2XY2A 3EAKA 3BXNB 1SY6H 3QZWG 1U8IA 4JKLA 1JGUH 5K33A 3SGEI 2WW8A 1X5XA 4XWOD 2VISB 5KW9H 4LCIH 3GSXB 5ESAA 1AH1A 2V7NB 5DSCB 3VXNB 3HMXA 4G6AD 3BPNC 3BMWA 3DIFA 3KPRB 3V95A 5CAYB 4NQEE 2FEEI 1BGXL 4NT6B 3O4OB 4JHAL 5LGJA 3J7HA 4QXGH 4EQ2A 4PLJD 4KY1L 4AIOA 3VFWA 3FZUD 5HGDA 2BVUA 5KSBF 1BVLB 2OI9B 3OKEA 1BBJB 35C8H 4HH9A 2WUCL 1TETH 5DHYA 5F9JA 2WBJA 3ARYA 1S9KC 1FE8H 3D39E 4IJ3B 4CU8A 4JFOA 1I3UA 3NCFB 1MFCH 4MQTB 4EZMA 3MMEB 1KCSL 2DBLL 4H26A 1R24A 4Z8FH 4OD3L 2OL3B 3VRLF 1DUZB 5FHBH 3UPCA 5SWZE 1N6VA 4KAQH 1U58B 4RA0C 2OMBA 3ZSTA 1I1YB 4NHCH 2IBZX 1D9KB 1F3DH 1ZLUK 4GBXD 4JFQA 2DQCH 1TCRA 4X8XA 1M1SA 2MFNA 3X12A 3P0YH 4NO3B 4Y4FA 3ARXA 4KK8D 4WWKB 3Q5OA 4PJFA 1CVRA 3EYVB 4LSTL 1K85A 4RAVA 2XZQH 4N68A 4YBLB 4YHLL 1NUGA 2YMXL 3GM0A 5AZ2L 1B4RA 1GPOH 4LQFH 4PJBE 2F53A 2HN7B 4HAGA 5E5MA 4XP5L 3GIZH 2DIBA 2CRYA 2IAMA 4HJ0D 3ZL4L 4GW4A 4X5WA 2WQRA 4ZOBA 4NRXA 3VGFA 1FL5B 3I50H 1XGUA 5CKGA 3LZFH 3IKCB 5I8CB 5F72S 5FYLD 1ZTXL 1AGBB 1FCGA 1KACB 1H8NA 1R3HB 4NQCE 1RZ8B 1YYML 1P84J 1VPOL 3OZ9L 4FTVA 5FOJA 5KS9E 2ZPKL 1UWGH 1I3VA 1QSEE 1MUJA 4EI6B 2G5BA 1I75A 1QBLL 2YN5A 2P48B 5C0ND 5ICXB 3LDBC 5IW3A 5GISL 5I1KL 1CTNA 3TLRA 1FDLH 3ULUD 3UTSD 2D7QA 5JPNB 1A6WH 4NO2A 3CFJB 4NQSB 3LOWA 3GRWA 3NCJL 4KZEL 4B41A 4ENED 2DQEL 5F6IC 5IB2B 2CLVB 5J11C 5I1AA 5HI4C 2D7TL 4LLYA 4MCYA 4B7LA 2BY2A 1NGPH 3VXSE 4PJ7F 4HIIA 4L5FL 1NC2D 1I4FB 5C0RH 3GB7B 4X6FB 1MLBA 4KKBC 4Y89A 3SDDD 5FGSA 3WHE1 3CFDB 2YD2A 5FO9B 1H3GA 1Q9LB 4TTDC 4ZG1A 2CSPA 5L88H 1DFBH 4X7SH 1OGAB 3I3BA 1LO5A 2DICA 2EKJA 3PDOB 4M8QB 4XP4L 3S5LB 3SGDI 4OGAC 4X7EC 3BUTA 4ZNEE 5E8OA 4CVUA 4KTYA 4Y16A 2KUTA 3RWHB 2BVYA 2BNUB 4JFDE 1UZ6E 2DLHA 3MV9A 1JPTH 1EXUB 5BRZD 5C09E 1UB5A 3OKNB 2BY1A 4X6DA 3TBWA 3BO8B 3ARBC 4X4ZA 4S1SL 4JN1H 5DMKA 4Z7UE 3H9HB 3MV7B 3SY0B 4XHJC 5HHXL 3RIFK 5JIHA 1KTDB 1QSFD 4BQ8A 3NMEA 3KYAA 2R23A 1EFXA 4ZTOL 1J9CT 2Z8SA 1OSPL 2DQHH 5C6TL 3MXVH 3UTQB 4XVUC 2JJSC 4P4KD 1B9ZA 3T2OA 3FQTB 5IMOA 4JFHD 3LKOA 4TNVK 2IADB 3E1F1 3ZKXB 1MSPA 2CIKA 3VD4A 3QAZC 3AAZA 3HE6A 4S2SA 3BDXA 3AXLA 1DDHB 4FQLL 3RVXD 3FRUA 3OGCB 3ES6B 1JPST 4OSUH 1BEYH 2XFXA 4HW6A 2IGFL 3DTXA 4XVSH 1JGEA 1IGTA 1NSNH 3GJEA 3M45A 1N5YH 4IRJA 4WI3A 1UYWH 4JRXA 4ESKA 1YMMB 4GKZA 1OTUD 4ZFFB 5FUOL 4WUKL 1NANH 1XGYH 1MWAB 3L9RB 1I1AA 2CMRL 4FFZH 3VA6A 1XGTB 3MRBB 3PHQA 1A1NB 1QR1A 5L2KE 1E6OL 2NW2A 5KZCB 1FP5A 2UZXB 4M61B 4KKCC 3L3GA 4PREA 5CJ8A 2XPGB 2ADIB 1C16B 1PKQB 4L3EE 1HHHB 5ANMA 5IHBA 1WC7A 3ARDB 2XZAL 1YECL 2P5WD 1IBGH 5C0EB 3RPIB 5DTFB 3JUYA 3GBMH 3V6OC 4EKXA 3LKSB 4LFHD 3OAZK 3WJJC 6CGTA 1MF2H 4UUJB 1BHGA 4QY8B 4W68A 4KKAD 2IPKB 3WEXA 2B1HH 3VG9B 4R9HA 5KTEH 3IXTA 3QHFL 4NIKB 4NCC2 1EH9A 1RUAH 2CR3A 2EH7L 4XCEA 3W5NA 1U42A 5DHXB 3P77B 4X4XA 2ZNWA 3QCVL 4JFZL 3GMQA 5CINL 4GQPH 1PKOA 1TITA 4U1MA 2X1WL 4KVNH 5E2UH 3IU4H 1IM9A 4N5EC 1HSBA 4H1LH 1VSCA 5DUML 3SE3C 4PJIF 1I8KA 4NUJB 1ZHLA 4OAWB 1KPVA 2XYCA 5EZJB 3MJ7A 3P9LA 4Z95H 1NCCH 1CXHA 1QSVA 1GH7A 5FXCH 5IVZB 5B8CA 5HGHA 1FG2A 5T3ZE 5DJZB 5EIQA 2P8LA 4LGRB 1N0XL 4HUMB 5DI8A 5IBLD 2QQLH 1UA6H 3PWVA 3HFMH 4DW2H 4NRYB 2XWBB 3CVHB 2FH6A 3I3EA 4ZAKB 3K3QA 5ID0A 5D1QC 1XF5B 2ID5A 4Y88A 2R2HA 5C0DB 4UTBL 4ZPVB 5D7JA 4LBEB 1QSZA 1DBAH 3OV6A 3R0MA 5HYSB 5ESVA 5I1DB 2H9GB 1RIVL 4DOHB 4JPKH 4QRQB 4JFED 4JZJB 3RBSA 3ZDYF 2ATPA 2DQIL 2VTFA 3IGAB 4NDMB 5JOPD 4HIEA 4IOFC 1X5YA 3C5ZA 3S37X 4I2XE 3HZYB 4KKLC 3O11A 5E2WL 5KBNC 2H26B 3KWWB 3V52H 3QEGL 4U3CA 5KSBB 1NCAL 4YHYB 4U0RC 2BP3A 3LKRB 4R0LA 1S9VB 3N1PC 2HFEA 2IWGA 2SEBA 1HKLH 1YY8B 1T0NB 1MPAL 1AC6A 3UJTL 3WFDL 4CGTA 4HJGB 1ZVYA 1NDGA 2GT9A 2HJLA 1CXFA 3S35X 2APVA 2IH3B 3VWJB 4QRRD 3T4AA 4WFFE 1QFWH 3O41B 5BJTA 2K1MA 4HLZH 5HHQA 3PL6D 1IQWH 1E4WL 2D03L 1T5XA 3KPNA 1FV1B 2R0WL 3UZVB 1RAMA 5F9DC 1CR9H 4UIKH 1OF2A 3INUH 3TA3C 1AD0B 4R96A 4LLQA 2R0KH 1E4KA 1EA9C 4FXKB 2NY4D 1X5KA 4PJDE 1A7NH 3UJJL 1WWBX 1HQRB 1E4XH 4HIHA 5BMFH 1H15B 3WIHA 3NZHH 4RDQF 4G43B 3ARFB 5FGBC 3T0AA 5IEHB 3WHXA 1JF6A 2AI0L 4G8EA 1ERNA 3JWDH 4JRYB 3V5HB 5K9QI 5T3ZH 5IWLA 3WMSA 2CLZB 1P4BL 2VL5B 1AO7A 3GMPA 3QIUA 2Y36H 2HTKC 4BK5A 2VH5L 4UT9H 3TBTB 3QO1A 2F19L 3ZDXE 3DI2B 3ARQA 4A6YA 2WINB 4FN0A 4M1DH 3AU1B 5EU6B 3O2DA 5EZLA 2BCKB 5D1ZC 2VR4A 3D48R 1EIBA 1RUQH 5B21A 3VWKC 4U31A 1D5ZA 3D87B 1ZS8A 4R8WL 3U2SA 2VE6B 1Q1JL 3VFTA 3ZKSD 3U30B 1F4WL 3ULVC 3OKLB 1CI5A 5E8NA 4MA3B 2BNQE 4F2MB 4QTIH 3HLAB 1JWMA 1V05A 3V6FA 3V6BR 4LLWB 1AD9A 4F7TB 4M7JL 3BOVA 4ZS6D 4Q9RH 3HCVA 5GGSY 4XC3L 5FA3A 5E99H 25C8L 4PJ8B 4U1SB 3B5GA 1JCKA 1CE6A 1R5IA 1HE7A 2Y72A 4JO3H 1KCVL 3JV6A 2VLRB 5M7QA 3T4YA 2VDNH 1ED3A 1H5BA 1ADQA 1AGDA 1T04B 4L3CB 4PJ7B 4K7FA 3U0PB 2HFGH 4S1QL 3TT1H 3Q2CA 5DK0A 1RFDL 1SM3L 3L95B 3QP3A 5E00A 4RX4A 4ODVH 1DQQA 5MP6H 3D5OF 5EULV 5DUPL 2FO4B 4KTDL 1KJ2B 3LVEA 4TUKH 3RWJB 3ZKMD 1UM6H 1MH5B 32C2A 5HDQL 1KLUA 2C3WA 3N9GL 5KJRH 2ZUYA 4MD4B 5EOCL 3HAEH 2IEPA 3BI9X 4JZNB 4KK5C 1G7LB 2P49B 4RGMC 3UX9B 4WI9A 2BNRE 2FECL 4POZC 1BFSA 4JGJA 1XGRA 4P5MB 1MY7A 4NBZB 4MA8L 2QQNL 1FZKB 4GBXA 2C1OA 5BW7C 3GEWB 3HC3H 3MRPA 3EOAB 4EBQH 4ZFOA 1GGUA 2ICEA 2Z91A 4ZODA 3EJYC 3HUJA 3HR6A 4KFZC 4YDVA 5IQ7H 3R1GL 1HEZB 4RGOL 5EIVA 2EXWC 3ZMRA 1A5FL 4EQ3A 3UPRA 1F3RB 3S9DB 1NFDF 5DC0A 5B39A 2X42A 5DWUH 3G5VB 5TDPA 4N0FA 5LCVH 4MGXA 4M43H 3SJVE 5IMLA 1ZVSA 4Z0XB 2X9WA 4CVZA 4Y5XB 2MKLC 1U6AL 3FO0L 1T3FB 3GM8A 1YN6B 4D94A 1KN2L 4QRPD 3E8UL 5F1IB 3VD3A 3NFNA 4PGJA 4OI8A 1DBMH 2RCSH 3C6LC 4H5SB 2AK4A 2V5RA 5IMMB 1T66D 2ZWLT 3F12B 1FFOA 2W9DL 4ZS7L 1RJZA 5IMKA 3UTSA 1P53A 1YEGH 2AGJH 2CO6B 4OCSL 4OZIF 1BD2D 1I8MA 4AM0A 3MRHA 3QJHA 3HZMA 3L7FB 3UYOD 5FO8B 1XF1A 2XKNB 2HFTA 2NX5A 2WIIA 3CFBA 3QUMB 2BHUA 2X4SA 1ZT1B 3ZE2F 4U6VL 5GGUA 1J0KA 1RJYB 4WI2A 4ZTPH 3VJ6A 3OHXB 3BSZL 1MNUL 3WUWA 3W2DL 3H42L 5TDOB 4I0PA 3SDDA 4Z7NE 2X44D 3BP5A 4FQHB 1H8OA 4C83A 4PJEE 4XBPB 4YXLL 3VGAB 5I71B 4HEPG 5I75B 1MAML 1DE4A 1FL3A 5FHAH 1I9RL 3NAAL 1N6QL 4H25A 3QSKB 3U4EA 4M7ZC 4K3GA 4PY7B 3F8UB 1XF2A 1VGEH 4HKJB 3ZO0A 3E6FA 4PFEA 4L3AA 5J1SC 3AREC 1T2QL 4I0CC 4WU5A 1MAJA 5MEOB 1FPTL 4Z76B 5LWYL 3BZEB 1ORSB 4HKXA 5CUSL 3M07A 2A6KA 2Q3AA 4DZBA 4OF5A 4JKPL 2Q6WA 2GY5A 2WWKT 4PJIB 1F11B 1C5BL 1T7XA 4NZTL 3PGFH 4RFOL 4TUJA 5D2NA 1WIOA 4PTTA 5E2TL 5E9DD 1QSFA 5E70A 2AP2A 1NGZA 1XIWB 4PRHE 4JREC 3IF1B 3VD7A 2PW2A 3WD5L 4UOW0 2I5YH 4MXWL 1PW3A 3SE8L 3RGVC 1CVSC 1KLGB 4KHTH 3S4SB 3CSYA 2Q8AH 2C3VA 5I16A 5C71A 2V2WA 3U7WL 2YPLB 5JW4Q 4Y5VA 5MEQA 2UYLA 1INDL 3QCUH 5J9PA 1B4JH 3D3VD 3AUVA 3SDCC 3QRGL 1T1XA 1LP9A 2BMKA 3B9KD 3ARPA 3OXSB 3QQ3A 1GZPA 5MENB 3LKNB 2DL9A 2J5LB 5I18H 3OBAA 4P2YA 3FKUS 3MGTA 1IT9L 4UBDD 3MSPA 5E8DH 5IHZB 5LKNA 3V2AR 4KK6C 3LIZH 3MLWL 4AEFA 3RTQB 3TNMA 1JWSA 2C9AA 4WUUE 4GXVL 2AJZA 4JANB 4KVCL 4EUPH 1A7PL 3AM8A 1B0RB 5T5NG 5CBEB 3KPPA 5I1IL 1DN2A 5ILTL 2P7TB 2NY0B 3BKYH 5CZVL 2PW1B 3MBXH 4GAYB 1HQ4A 1K9TA 5DJYA 3LN4B 3IDJA 4HIXH 5IJVA 3G6JE 5DJDA 1MFNA 2IFGA 4M1GH 1RIHH 2NY3B 2E7MA 5F96H 1F58H 4U1KA 3RWCB 3OR6A 4FMFA 3QEQA 3EOYG 1BZ7A 3P4LA 1KEGH 3H9SD 4IMKC 1E6JL 3G5YA 1T5WA 1DANU 5JO5A 1UH4A 2P5WA 2DS4A 5E2JA 3V5KA 3OAYK 3DUUA 4HS8H 1L7IH 3D6GA 2ARJA 1I9IH 1AXTL 1UCBL 4TUOB 3OXRA 2FWOA 4MAUL 4OLWH 3AGVA 3BH9A 5I1JH 5C08D 5C2BL 3BRFA 2DN7A 3L6FB 1Y0LB 3RU8L 3C8KA 4O51A 4PJHE 1LK3L 5FGCB 1IEBB 3VXRB 4XAWL 4ETYA 1U8OA 2VYRE 4MXVE 3Q5TA 4NFCA 4BKLA 4AQ1B 5CILL 2IANB 1KBGH 4YXKH 5CIPH 3FTGA 3F5WB 4NC0B 4OCMC 4OFKA 1OAKL 1TZHA 4L4VD 4YHZH 2QSTA 3RZWA 3QHZL 3RL1B 5I8OL 3C9NA 5TE4H 3HAEG 3MLTA 5GJSH 4PG2A 1SYSA 3WL9B 1YUHA 1FNGB 3DUSB 5CJQH 1IM3A 3SO3C 5D7IE 1ZXQA 2YN3A 3GMLB 3Q6GH 4KKBD 2ZUSA 4LF3B 5EUOF 5C0CB 4XP6H 1DEEA 4D0CB 2XTLA 1IKFH 5DJXB 4GG8A 2CKBB 4TTDD 5BS0B 4TSCL 1RZ7L 1MCCA 1INQA 3P4MA 5BV7H 1EFQA 1V8HA 2VITB 3RJDA 2R2EA 1INEH 3CH1B 1KELH 3S3SA 5FCSH 4D9QD 3H3PH 1MRFH 1HHKB 1WIUA 3C09C 5BZWA 2VZOA 5I74B 5FCUL 1JN6A 5EBMB 5CWSA 1GGIH 2LV4A 1G9NL 3LV3A 5JZ7C 3EUUA 5E6ZA 1AGCB 4PRPB 3V0VB 4FA8A 4HX1A 4UT6L 3HNSH 1UM5H 5J12B 5A43C 3FCTB 4O5LH 4MSWA 5GRYA 2RBLA 5GS1C 3TPUB 2ZOLB 1A3LL 2MHAB 3PIQA 4XVUD 4QHUA 2P1YA 1ZOXA 1T4KA 3VXOA 2JB5H 1PLGL 4QRRA 3NA4A 3MX0A 4YIQA 4RBPK 5IVOA 3BN3B 3PL6A 4QRSA 1RUKH 1AKJD 1ZLSH 3LMJL 1TQCC 3C2AH 4M7LH 1SBSL 3QZWB 4QYOB 2HVJA 1T7WA 2X40A 3AC0A 5JHDD 3BMVA 4UDUA 4GMSH 1RIUL 2DLIA 1MCBA 3EYSL 2BVEA 4YHMH 5GS0L 3VXMD 4K94C 4PV8B 4UTAH 4Y2DD 3PWJB 4OFIA 2CRZA 3C60B 4D0BB 3MRDB 3GFUA 2QTEA 2E9BA 3GSNL 1WFOA 1AQDA 1GOHA 1WWWX 3BEVB 2YPVL 1HXMB 4MQXC 4LHUG 3GMRB 2DM3A 3OR7B 2KQMA 2Q8BL 2VSCA 5IP4A 3ZYIA 1NLBL 1QTYT 2KZWA 3TBYB 2J88H 3LEYH 4GKSB 2C7UB 1P7KA 4NN7B 2H3NB 1X6LA 3N85L 1MCDA 5CEYB 1OAXL 1D5IL 2CR6A 4NN5B 4NZRH 1CU4L 4HH8A 4WGVB 2NY6B 3VXTA 1FJ1B 5KVDL 3DX7B 4ONGH 3EGSA 3B9EA 1JL8A 2YD1A 5H8DA 1U8PB 1WFTA 3X13A 5C92A 4RWYH 5KVEH 5IKCB 1NUFA 5DVOA 4ELKA 2NNAB 1YEFL 2X4QB 5LQBL 3HMXH 3QUZB 4O2CB 4AIZA 4X0KB 2GQHA 4P23A 3O4OC 2AJYH 3HRZA 3VCLA 3EO9L 2A9ML 4OZIB 4FXLA 2R4SH 3VDAA 2QJDA 1D5BA 2OI9C 2UUDH 4LNRA 4J4PC 3T3PF 1F4XL 4YGVA 4H20L 1O5DT 4LLMB 3BUYA 1PSKL 3O6FD 2GCYB 4DUWA 1C5DA 1RK1A 9CGTA 4ONHA 4IJ3C 5GHWH 5HVHB 3WFZA 2IFFL 1RSFA 4CVXA 5HYQA 4G6JH 1NCNA 1MLCB 2ZCHH 1YEHH 1XEDA 1UKQA 3BWAA 2D31B 5KG9B 1HH9A 4N0UB 4RFEB 6FABL 4OCWH 3MLXL 4E0RB 2CLRA 4X9IA 1D9KC 2E6QA 3G04B 3KLAA 4P3CH 4EUPG 2FDBP 3QXVA 5HHPB 3U46A 4XPHL 2FCBA 1I1CA 3ARZA 4YAQB 4Z18A 3TVMA 2XNAA 1Y6KR 4X6CE 3NCEB 3B5TA 5C0GB 5I1HH 4WWKC 3ZYZA 3KPLB 1GAFH 4P2RE 1JGVH 3JWOL 1QLEL 2O5XL 4YBLC 1QG3A 5HYIA 4EEEA 1EHXA 2D9CA 3MV9E 4LPXA 2W1NA 4QTHB 3C5SA 1P4LA 1YQVL 2IQAA 4DVRL 1IEAA 3MLZH 4X6DE 1JZ7A 3RL2A 1CTOA 4NZJA 3EHBC 1HIML 4ZUTA 1Q72L 4Z5RB 5GGSA 1R3JA 4OZGA 1N5AA 3RDTA 4LSUH 5DT1H 2YWZA 2AQ2A 4P9ML 4XNQB 5A2LH 3VFMB 3WNLA 1KIQB 2H2PD 1AQKH 2YD4A 4BFIB 1WWCA 2GSGA 1KN4L 1N2RA 3B3IB 4X98B 1LD9A 1BREA 3LS4H 4GKNB 5JDSB 1CQYA 2GUOB 1EEYA 4WW2A 3QDMB 3KXFB 2X6MA 3MR9A 3NGBC 3BW9A 4XTRC 2DOCA 2K3TA 3O3BA 4U6HB 4M6NL 5I2IA 3TA3D 2F58H 4PJAA 4M7KL 1K8DA 1BECA 5JORB 4MNQD 5J3HC 4HBCL 5IROA 4XPBH 1PEZA 1EJ6A 3FB8A 1FC2D 3S37H 1J1XH 4XP9H 1BD2A 5DURB 5KVMC 1QQDB 3QDJE 3DETC 3BRDA 2D0GA 1XCQA 3NIDE 1TTFA 2DWEB 1Q0YL 1P7QB 1MRDH 5DHVH 5FGRA 3WFCL 4FXGA 2KQNA 1JRHL 2HTKD 1ND0A 2OJZH 2X1PA 4I13B 4M9PA 4QOKB 2DQUH 4X7CC 2VAAB 5BCAA 1OP5H 1HILA 3S35H 2DQTH 4JCMA 4DGVL 3O3DA 4R7NA 3VWKD 1FRGH 3HN3A 4H0IA 5ANME 3TJHD 5HPMA 5DMIH 4ISVA 4P2QD 2XZCH 5AYUH 5FYJE 3ULVD 3FFCE 3KPSA 1JHLL 2HYMA 4JPVH 2B2XL 1G1YA 5DRZB 3TIDB 3L3JA 5KN5B 1IFHH 3PG2A 3R06A 1HK6A 2VUYA 2EDEA 4G7YH 5TE7H 2VDQL 1MCEA 1OAZH 4JQVC 2QHRL 5DEGA 4RMUA 5FEBA 4KMTL 3OB0H 3TCXA 5LGHL 1G7PB 5J0BA 5KVGH 1MQ8A 3NCMA 1WJ3A 1HWGB 3DX9B 3DVIA 4Z7WF 3FN0H 1ZVHA 3ROOA 5E9DA 3SGKC 5HY9B 5E08H 3ZKXC 1AFVH 4R3SB 5ID1B 4H88H 3WKML 1CLZH 4HLJA 4HGWB 3CPLA 4RMVA 3CLEL 2HG5A 3TP4A 4UMGA 2HJFA 1UKSA 2VLMD 3O8XC 5EUOB 1IC1A 4ERSH 3QDJB 3SBWC 4DUVA 1F4YL 5HHOE 2I27N 1CGSH 4DFHA 1UT9A 4WTZA 3RVWD 3SQOL 2AXFB 5E03A 5DJ6A 1U93A 2ZOKA 3B9KA 4WTXA 5JUEL 4RGNB 3HZKA 3FAXA 4OZHA 4G6MH 2EE9A 2DQGH 3C08H 2QEJA 3B2VH 1S7WA 2PKDA 3QEUB 2ITCA 2WBWB 3FN9A 4HV8B 3MUZ1 2I07A 4MA7L 4YX2L 3KYMA 3UBXA 4P49A 3MRKA 1OD9A 1ZA3A 4KJPC 4ONFH 1A7RL 5C0BB 2YXFA 1EDQA 1TJGH 3ARDC 4OLVH 1XGPB 3EJYD 5D7KE 2YC1A 1MI5B 5EU5B 3U83A 2X70B 5FYJH 4NQVB 4PYHA 3CVIL 1NAMB 3H9SA 3QUXB 5JLZA 4LAQH 4G8FA 3SDXA 3K1DA 3DROB 4W6XB 3OSKA 3EFFB 4ZD3L 4ZUVA 4KQ3L 4WNQA 1GZQA 5MEPA 1A6TA 2G2RB 4P48A 3TBVA 5C08A 5ICYA 2J12B 4OT1L 5EC1A 1HNGA 1RPQA 4UV7L 3GKWL 3PWPD 1BZQK 2PYEB 3P9MA 1PX4A 1OAUH 2PTTB 3C6LD 2VDML 4KI5F 1NMAH 4HWEH 1HSAA 4NO0B 4DGIH 5HYJB 1IGIL 5DUBB 5T5NF 3LEXB 4QHKI 4W70A 4EVNA 1LEGA 3ARRA 2BRQA 1AO7E 3A0OA 3BQUB 3WO3B 4L4VA 4N1EA 3F6IA 1RZIA 4KDTC 3BP7B 2BC4A 4WCYH 5EOTB 4DKFH 1T0PB 3M1BB 2BSTB 1VKXA 4K9EL 4JZJC 4LEOB 2R29L 4WVRA 4JKWA 4P4RA 4HDIB 2DLFH 2LU4A 1OTSD 2OTUB 3TZVB 2X89D 1EO8H 2R9HC 4CNIB 1FO0A 1FBIH 4YHYC 3L3DB 4R26H 2OCFD 4MQSB 4WU7A 1NBVH 2KZ1B 3UTZB 3QDGD 5C0JB 1HINH 3ARBA 3VFSB 2AXJA 2V2XB 1S5IH 3VWJC 1KNOB 5H35A 2XN9A 5EN2B 1S3KH 3UO1L 4CU7A 2AK1L 3JVGC 2ZSVB 4M6ML 4K94L 1DLFH 4MJ6B 4XPTL 2OK0H 1A3RL 4HMDA 3QWRD 4L1HA 2JJSA 5GRJL 3OJ2C 2A83B 1ETZB 4EN3B 1CK0H 1NMCB 1JF5A 4F3FB 1U92B 1NCWL 1T1YB 3UTPD 5D6CA 4RMRA 1A1OB 1RULL 3IXAB 3WIHH 3I6GA 3ARFC 2YR3A 1SY6L 4CMHC 5JHDA 4HIJB 4PD4J 1JGUL 1H0DB 4UNUA 3SDCD 3FONB 3AS2A 3VFNA 1UG9A 4NQXA 4PJGF 3VXMA 3O4LD 2Q7YA 5KW9L 4LCIL 2CDEA 3VXPA 3THMH 1II4E 3C8DA 4LLVB 4UT7H 4JPIA 5TF1H 2IC2A 4M03A 4J1UB 4KK6D 1KTKE 4A6YH 1UB6B 3O2DH 3W5MA 1MCHA 5C0FB 4QXGL 4UIMB 2YZ1A 2VQ1B 3HUJE 4M3KB 5I1CH 35C8L 3U30C 2Y25A 3N1QC 1TETL 4F7MA 2EDKA 1FE8L 1MFCL 5I8KH 4PRNB 1A0QH 4Z8FL 3NPSB 4OIIH 2BSSA 1QRND 4PJ8C 3V4UH 3HC0A 4Z78B 3ZE0F 1MJ7H 3V6OA 4KAQL 3WJJA 5J6HA 4NHCL 2AW2A 4NOFA 3MYZA 1JNLL 4YHNA 1SJEA 4TNWK 1UJTA 2ZKHH 2DQCL 5E8PA 3OKKA 2AK4E 3H7BA 3OG6B 3P0YL 2ZUWA 4R90H 4K8RL 3CFEA 1CFQA 2IMMA 3ULUE 5IJKA 2LU3A 3PHOA 1J8HD 1JIBA 3O6FA 4M93C 1ZGLM 2XZQL 5FECA 1T21B 3B2UC 1NDMB 4I4WA 2XWTB 1CGVA 3OJDA 4FQCL 1GPOL 4LQFL 3BP6B 2NX5E 5BQ7B 4U2YA 3GNMH 3CZJA 3QH3A 4NC1C 2W60A 3GBLA 3GIZL 1UACH 1QLRB 3RWIA 3T0DA 1DQLH 3I50L 3STLB 5D96B 3LZFL 4KXZI 5KSUA 3VFPA 4ETQA 1DSFH 4QCIB 5DDHB 5CSZA 2B4CC 3TN0B 4HS6B 4MQ7A 2DI9A 3QIWB 5IEKB 1U9KA 1UWGL 3MRRB 4UNVA 5C8JB 2JCCE 5D1QA 1F6AA 3FB5B 1EV2E 3RVUD 2FIRT 2FGZA 3B43A 1A7OH 3ESUF 4JM4H 4NKOA 4HUNB 1N8ZA 1FDLL 2VWEC 3AS3A 4Z7WB 3OWEA 1T1WB 3FMGH 1A6WL 1H3UA 4NYLA 1G7MA 4OFYD 4LMQI 3U4AA 4L8CB 1VENA 1J1OH 2AS5M 2R1WB 5DJ2B 2NY5H 5BXFA 3WO4B 1K6QH 5HJ3B 1NGPL 4JY4B 5JZ7D 1NGYB 4MCZA 4WFEE 2JJTC 5JXED 5C0RL 4F9PC 3GSVA 4OUUB 3BKCH 4JFHE 1HYRC 4IIQB 1DFBL 5C07D 5L88L 4ZXBD 4YHPA 5E8EA 4Q2ZA 5CS7A 4DN4H 1WWAX 4OF7A 4PJCA 5HHME 5M94B 4UOW1 5F88A 3ULUH 1BBDH 1A2YA 3MROB 4LSQL 3TA3A 1LP9E 1JPTL 2BY0A 3RWFA 4HG4K 4K23H 2FRGP 3PABA 4JN1L 3D0LA 3IFPB 3TNNB 3BH8A 3EZJB 2HT3C 5FGBA 2V5SA 2HWZL 1M7XA 1FFPA 5GRWA 3SCMB 2QHLA 2HLAB 2P5EA 2DQHL 5D70H 1NFIA 2DYPD 4MQXD 4OLXH 3VGAC 2XV6B 3P73B 3JBG7 3BAEH 5I75C 4DUXA 4NUGH 3WV0A 4GW1B 4ODHH 5GZND 2BXZA 2QKIB 3VXUE 3EO0B 5D1ZA 4JFFD 3EOBB 3A6BH 1VFMA 3VWKA 4DKEH 3QEQE 2HT4C 1JTPA 1FORH 3SDAB 1QPXA 4P2QA 4OSUL 1BEYL 2X4UB 1WT5C 3GSNA 1JUFA 1T2XA 1AGEA 4XVSL 2J8UA 1NSNL 1UEMA 4LOUC 4WO4B 4EDXB 5C1MB 4YFLF 3ILQD 1SEBA 3REWA 1N5YL 3MREB 1IL1A 1UYWL 2W65A 4QHLA 3UZEA 3MACH 5F1NB 2YEZA 1M05A 1XIWC 3GMNA 5I15H 2F54D 3W0WA 4OBSA 5E1AB 5KVFH 2FO1A 4I18A 2H1PH 1XGYL 2DKSA 2CIIA 5B22A 5AWNH 1I7ZB 4FFZL 1NKRA 5EC2A 5DJ0B 1GVIA 2BOCA 3H6JA 1DQJB 1F3JB 4PTUA 4EIGB 3FHAA 1W72B 3JTSB 1T6WA 3CLFH 2GJ6A 3WIFA 4MWFB 4G6FB 2VXTH 2ZG2A 4LLDB 2YD8A 1NEUA 4RISL 3SEPA 4LKCB 4Y1AD 5ISZB 3P11H 3FT2A 3VMPA 4MS8D 4YPJA 1ZGLA 1D5XA 1D6EB 2BHYA 4OF3A 4ONOA 4D9RD 1IBGL 1DVFB 3KYOB 2W0FA 3GBML 3IDUA 3C5JA 4RFNB 3T0EB 1NBZA 1MF2L 3RTQC 1MCLA 2CDGB 3EDDA 3GJFK 2B1HL 1EMTL 4Z7VA 5KTEL 2HP4A 2YK1H 5FDYA 3I6LD 5IVXA 1RUAL 2IF7A 2H32A 2NY0C 3ALPA 2EDNA 4G42B 3OX8A 3JV4B 5EO0A 4CKVX 4A2MA 4X7TA 1NGXA 1KEMH 3S7GA 1C12B 4KTEH 1RVFL 4KVNL 4LSRH 2NTFA 5E2UL 3IU4L 5A40E 3KS0H 5BW7A 2ED7A 4MNGE 3T0WA 5A2KH 3JWNC 3ARWA 2X4TB 1JGDA 1P2CB 1DUYA 5K9QG 2ADJB 2PTUA 4MJIE 3EHBD 4Z95L 1NCCL 4NQED 3GHBH 1A22B 1U8NB 5F1OB 5H37H 5GGRB 2QQLL 1UA6L 3DMMC 3HFML 5GGVL 4DW2L 3QNXB 4TRPH 3MV8E 4WHTB 3LQAC 3MRJA 3MOBH 1CICD 5ESQB 1VESA 1ZSDA 1DBAL 1RHFA 5B4MC 2OJEA 2Z92B 5D5MB 4PJGB 3D39D 3JTTB 4F37K 2FYYB 4XTRD 4MAYD 4UINL 4JPKL 3HG1E 1WZ1H 4FFYH 4LKXA 1QBAA 3T8XA 3RVVD 2MOVA 4L8BB 12E8H 3C6LA 4PY8I 3UROR 1OAQH 3SKNA 3MLRH 4IM8A 1FG9C 3KPQB 5EIIB 3TIEA 1G0XA 3VFRB 2GFBB 5EZIH 2EIZB 1RZFH 2YRPA 3V52L 4I5BA 5J3HD 4LCYA 1JRHI 2PO6B 4LPCA 1N59A 4P57A 4UDTB 1PZUB 5BVJA 5LVEA 4LU5H 3DETD 1HKLL 1LGVA 1J05A 1R3IH 1TTUA 3FO2B 4ODTH 3RAJH 1QO3B 2P8PB 1Q38A 1T83C 1QFWL 5J56B 4MNGB 1B0WA 2VLKB 4O4YH 1IQWL 1JWUB 4G9FE 1FLTX 4AH2A 3EJZD 3MA7B 3I02B 1GHFH 4NBXB 1SYVB 4DJMA 1CR9L 4UIKL 3INUL 1HDMA 2R0KL 5KSAD 3DXAB 3I9GH 2BVOA 1JPGA 4KMLB 1A7NL 3NOIA 5I74C 5B39G 2OZ4A 1E4XL 1QBBA 4XCCH 5BMFL 3NZHL 1AGFA 3TYFB 2X89A 5DC9B 5JPMA 4P5KB 4NQCD 2ICWI 2D7OA 4OCNC 3AREA 4P5TB 3F7QA 5J12C 4TVPE 5D2LE 3JWDL 3DX6B 4F9LC 4D8PB 1QSED 4LHUB 1XMWA 2GSIA 5I76B 2Y36L 1ZHNB 4OLUH 5EOCJ 1CIDA 4UT9L 2ZUQB 4Z6AT 1IMHC 4M48H 3F7VA 4M1DL 5HI5C 1BQSA 4F15B 4XHQA 1G9MC 1RUQL 4JQIH 3QWRA 5FO7B 1MQKH 1OD7A 2VLJB 5IV2B 4YEEA 2FJGB 3QI9B 3QFJA 3VXSD 4PBVC 4IRSB 3ZTJH 3O8XD 1S7UA 1K8IB 3KPOA 2F9BT 5F3HB 4QTIL 4PJFF 4PRIE 1UQSB 1U8MA 2BDNH 3C60C 4XMPL 3FRPA 3ZDZF 3SDCA 4HZLA 2DWDB 3WUWG 3QWOA 5DJ8A 2NLJA 1FSKB 3NFPA 3O4LA 4Q9RL 4U0QB 4L9LB 5E99L 1IARB 4FFWC 3SE4C 3STBA 5EB9A 1CDIA 3E2HC 2R1YA 4JO3L 5CGYD 2W07A 2VDNL 1D6VH 4JFDD 2X09A 5KZCD 5DLMH 4NN7C 4J7RA 4PB0H 3T65B 3O3EA 4NN5C 4PUBL 4LSSH 1T03H 2HFGL 1FNSH 1X5HA 4EXPX 4PRAA 3D25A 4OCLC 3ELAT 2VABB 4LSPH 5IFHH 4XNXH 3IJYA 4ODVL 5MP6L 4OZGE 4NHUA 1I7TB 3F62A 4PJ5E 3FB6B 4GRLD 1KJ3H 2DLEA 4TUKL 1UM6L 3QUZC 5C9JB 4QXWA 1OQXA 4Y8AA 4J3XA 4TVPH 5BOZG 1FVEA 5KJRL 5K9KB 4RMTA 5E6IB 3O45B 3SN6N 3MCKB 4K7PY 4IMKA 2VLLB 5IQ9A 1QRNA 3QXAA 4QHKJ 4S1DC 4XGZA 5CHNA 4Z77A 2V7HB 1X5GA 3BGMB 5HGGS 5LXGH 2FL5A 3REVA 1KCUH 1A1MA 1YA5A 4YZFF 3TT3H 3FT4A 3QIBC 3FT3A 1LE5B 1NEZA 3MBED 4PJAE 5HVHC 4EBQL 3DRQB 5BO1H 4V2BA 5IHUH 1OOAA 4H8WH 3SKMA 3PQYB 5IQ7L 1X6NA 1J8HA 2OBGA 2O5ZH 2YD5A 2NXZD 2XACC 3AS0A 4DCQB 5DWUL 3PJSA 4FG6C 5LCVL 1BX2A 5L2KD 4M43L 4E42A 4JFPB 3RWDB 1VCAA 1VACA 4HWZA 1F45A 2UUDK 4Z7QE 2E3VA 4L3ED 4A2LA 1MJ8H 1QUNA 3TCLA 4JO2H 1DBML 2RCSL 4XI5D 4G8IB 5TFSH 4YFEA 5IR1A 3NIFF 5CD3B 4PB9H 1Z9OA 1HCFX 3MRIB 4OCRH 1S78C 2R2BB 3KPSE 4JDZA 1YEGL 2AGJL 2Z31D 4X6BA 1YPZF 4OFYA 4LFHG 3CJJA 5EO9A 3SPVA 3ZT7A 2I25N 2AAVA 3VGGA 1B0GB 2ZSWB 5TH2B 1ZHBA 5IB5A 4ZTPL 5GGQH 8FABB 4NNXA 1ZWIB 3AROA 3RUGA 2AEWA 1TVHB 2NTSP 4GLRI 1Q9OB 4LARH 3EKCA 5GS1A 1G7QA 5C07A 4ZXBA 1E0OB 2FR4A 2JELH 5FHAL 2Z4QB 3WNMA 4LGPB 4BSVB 1VGEL 5JW3H 3OKMB 5T3ZD 4OF6A 1NQBA 3M8OH 1YDPA 1XH3B 4MB3A 1DQDH 5EU7C 1R3LB 1IC7H 3F6LA 1CXLA 3CCHB 3L5WB 2WWKO 2GK0B 3PWNA 3BKMH 1A6ZA 5I1LB 3W39A 5MERB 4OZHE 5DJAB 1VGKA 1X4XA 2PCPA 4KHXH 3WE6B 1W8OA 3PGFL 3QISA 1FZMB 1QD0A 3TO2B 5CP3A 43C9A 4PGEA 1JZ4A 3IAGC 3E6HA 4L8SC 4QRTA 4LIQE 5GSVB 5J8OA 2AABH 3RVTC 1JE6A 1KIRA 1NCDH 2I5YL 1R5WA 2FIKB 4M5ZH 4OI9A 1QVOA 3FFDB 3HE7B 2CGRH 5DQ9B 2Q8AL 4ZQKB 3L3OB 5EU4A 3T0XA 2R15A 3C87A 4IDJH 3BD4A 4TYUA 3QCUL 4JFFA 2MQ0A 1HZHH 4TULH 3V4VH 1ZT4B 4J3WA 1BIIB 4ORGA 3ZHLA 4OCYL 2RFXB 3SDXE 3V7AE 5AZEH 4WFGE 3CDYA 5I18L 2VISA 4XB8A 1GGBH 5E8DL 4PV9B 5IB3A 5D71H 2V7NA 3LIZL 1U3HB 3ME0A 4JY6B 2F54A 3KPRA 4JFYB 4LCWB 4YXHH 1WQVT 4NT6A 4NKIL 1AR2A 2HTLC 1U8LB 4OM1H 2JB6B 1KJVA 2D2OA 5B3JF 5I30L 3BKYL 3MBXL 2A6IA 2XOTA 4NBYB 1BVLA 3LSOB 4HIXL 4NZDA 5J1AB 4J4PA 3ZTJG 4M1GL 1RIHL 2GTZB 1ITCA 5F96L 5ESAB 4XT1C 4YH6A 4Y1AA 3DIFB 4L4VE 1KEGL 4JPWH 1ITBB 4WRLA 4RGNC 4ZSOE 2NY2D 3OB0K 2FHFA 2OL3A 4HS8L 1L7IL 3O9WD 3JZ7A 4YDLB 5F7HA 1K3ZA 5HGDB 2BHZA 3OKEB 1I9IL 1U58A 1N64H 4HH9B 5L7XH 1CF8H 5SX5H 4OLWL 5I1JL 1JMXA 4LIQH 2WBJB 3MRNB 4XZUB 2VN7A 4MXQC 2BNQD 2EE6A 5F21B 3ULSB 1FIGH 4NO3A 1V7NH 4H26B 1FCCA 3RI5K 1NMBH 4WWKA 2KKQA 4APQB 5T1MA 5JTWA 2CK0H 1UADC 2AEQH 1SJHB 5H94B 1KBGL 4YXKL 4QLRA 1CWVA 2HMID 4YHZL 1PZ5A 4ZYKB 4OV6F 2HN7A 3UP1A 3I3DA 3K1KC 1GGYA 4S0SD 4NQEA 2XN9E 5D9SB 5GJSL 5TE4L 3TV3H 5DC4B 5CJQL 5DMGD 1FL5A 1R3KB 1NCUA 1TNMA 5I8CA 4KROD 3N0PB 1AGBA 1R3HA 2NY1C 1RZ8A 3S36X 4XP6L 2ZG3A 1WZMA 4LASL 1IKFL 2YS4A 1L0XA 1FQ9C 2QQKH 4KJYA 1DBBH 2IQ9H 1MCOH 2WV3A 2VZSA 3DECA 4EI6A 5BV7L 4M5YH 5ICXA 2WBKA 3O0RH 2Q3ZA 5T1KB 2BOBB 4GW4B 4FHBD 4NRXB 1INEL 1KELL 5JPNA 3CFJA 1MRFL 1XGUB 3H3PL 4OM0H 2Q86B 4FRWA 3BQUC 5T3XE 1JJUA 4GH7B 4AK1A 1GGIL 2CLVA 4L4TB 4UZGA 2BNRD 1WSST 4KRPB 5BZDA 4FTVB 4XNMA 4PG9B 1UM5L 4W6WB 1MUJB 2HT3D 5A1AA 2G5BB 4O5LL 1I4FA 4G7VH 1P5VA 1LHZA 3CMGA 3CFDA 5FO9A 1Q9LA 3LB6D 2JB5L 1LO3H 2OMNA 4G8GB 5DD5H 5IBUG 5EG6C 3PDOA 3T09A 4MB4A 3TZVC 5I1AB 1J0HA 3FQXB 1RUKL 4KGLA 3S5LA 1ZLSL 2V9TA 3C2AL 4M7LL 3IDMB 5CP7B 3CX2A 5F9AC 3RWHA 2BNUA 4GMSL 1ZEAH 1MFBH 3SJVD 1MLBB 4YHML 4NKMB 1EUUA 4UTAL 2W9EH 1NANI 5DD0L 1QFWM 3MUJA 2VDRH 3WSQH 3V6OE 2P45B 3H9HA 5FK9A 4JDTH 1OARH 4CADB 5KS9A 4DEPB 1KB5B 1QR4A 2EDLA 4YHOH 1LEIA 5E8OB 2E7LC 4Y4KB 4Y19E 2APWA 3FQTA 4WFHE 4ZO9A 4EN3C 4M8VA 1T20A 5H2BB 2G60H 1HOCA 5A16B 1KULA 4M3JA 1UB5B 2J88L 2R56H 3LEYL 3BYTA 2IADA 4EIZC 3NCYS 3TFKC 5DMKB 2C1PB 1MHEB 2O5YH 4KRLB 1EBPA 1DDHA 4NZRL 5I1GH 2G9HB 1EFXB 3ES6A 4ONGL 2VXQH 1U8HA 3GI9H 1S7XB 5T3XH 3O8XA 1YJDC 3UJIH 4RWYL 5KVEL 5IMOB 3SBWA 5B38A 1XZ0B 3L5XL 1AY1H 3HMXL 1EZVY 3CIQA 1CGWA 3QO0A 1NCTA 3MZGB 2AJYL 1U8JB 4BSJA 4ZFFA 1FFQA 1YPZB 3S6CA 3AY4A 1MWAA 2R4SL 3L9RA 5EU3A 1XGTA 1A1NA 2HJKA 2XIDA 1Z0NA 1NC4B 3LPWA 4DQOH 1IGTB 1JYNA 3GBNL 4IRJB 1OP3H 5GHWL 4JRXB 5SX4H 1JPFB 4Q6IA 1C16A 1NBYB 1PKQA 4G6JL 4TSBH 3CFKA 1HHHA 1BWMA 3UTTE 2ZCHL 4P59H 3NPSC 1YEHL 1U3ZA 1E4JA 1I1AB 5C0EA 4PRHD 5ALCH 3CXHK 4OCWL 3ULUF 3R8QA 3LKSA 3OG4B 4X4YB 4I48B 1Y18B 4PP2B 2QADB 4C56B 4UUJA 3MV01 1J0JA 1G6RH 4QY8A 4ODUA 4P3CL 2IPKA 4XRCB 1I7UA 2EO1A 3D69B 4PY8J 3DMMD 4PJ9D 3L3GB 1IVLA 3BIKB 4NCC1 2X7LA 1U91B 4RQQA 5CD5D 1ZA6B 4H1LA 4PJCE 3P77A 2Z35B 5B4MD 5JA8B 5I1HL 2VZUA 2YUVA 1GAFL 1JGVL 5JMOC 2VNCA 2BVTA 3U9UB 4WTZG 2QV2A 3MLZL 1LEKA 2ESVE 4X83A 4NUJA 3PWLB 1FYTE 4OAWA 5BVPH 3TO4B 2HH0L 1PD6A 5EZJA 5GRZA 4WUUD 3QUYB 4LSUL 2VZVA 5DT1L 5D96C 3MFFB 5DF0A 4NWUH 1QFWI 4C4KT 4DWHA 4X4XB 1RHHB 2GKIA 5DJZA 1AQKL 2P5EE 5CJXA 2AKRA 1DBKH 4NRYA 3TN0C 2XWBA 1HSBB 3LS4L 3QIWC 1XF5A 1RZKC 1I8KB 3PP4H 4ZPVA 1Q94B 3S8WA 1ZHLB 3ZTNH 4KDTA 5HYSA 4JG0H 1E4XI 1UH3A 3RA7H 5I1DA 1VEOA 3MJ7B 4L3EA 3DWTA 2QSQA 3UDWC 4DGYH 1WAAE 1FGVH 4JZJA 2ZNXA 5HGHB 5CMAB 1W0YT 3IGAA 4NDMA 2YD6A 1LNUA 5ENWB 3ULVE 3K46A 5HVFB 3HZYA 3GGWA 2H26A 3KWWA 3U48A 3V7AG 4XPBL 4MA1B 2Z31A 3S37L 1J1XL 4XP9L 5KANG 5KSBA 4DK3A 4JB9H 1A21A 3CDFA 1SJVA 3W0WE 3FQWB 4AENB 5DJCB 1MRDL 1T0NA 4OD2A 4IIQC 5JIKA 3WFBH 2ATPB 1FH5H 4NZUH 4LSVH 2OJZL 2J8OA 1M71B 1N4XH 2I60H 1Y6NR 2IH3A 1YC8A 3C5ZB 4HIEB 4I1NB 2DQUL 2GJ6E