1GYUA

Gamma-adaptin appendage domain from clathrin adaptor ap1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
120
structure length
120
Chain Sequence
MIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gamma-Adaptin Appendage Domain. Structure and Binding Site for Eps15 and Gamma-Synergin
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
total genus 21
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1gyuA00
1GYUA 1KYFA 1NA8A 1QTSA 2A7BA 3MNMA 1KY7A 2VJ0A 1KYDA 1P4UA 4BCXA 1KYUA 1IU1A 3HS8A 2DWXA 2DWYA 1B9KA 3ZHFA 1GYVA 5CN1A 2YMTA 2E9GA 1QTPA 1GYWA 5CN2A 3ZY7A 1W80A 1OM9A 1KY6A
chains in the Genus database with same CATH superfamily
2X6VA 1LJMA 1QVOA 4FERA 3VI3A 2L8AA 4P2YA 1S7QB 2XOTA 4ELME 2OYKA 4OZIE 2AJXH 3LQZA 4H8UA 3SY0A 4OGXH 3DPBA 1FFTB 4NIYE 5AD0B 3T6ZA 4XAWL 1KC5L 3BN9C 4AUUA 2SEBB 2X1OA 2C26A 5I26A 5HDLA 4BGDA 3BXNB 2YD1A 1S5HB 4N86A 1SOXA 4UM8A 5MEPB 4XPHL 3UJTH 4HJTA 1AD9A 4LSPL 4OFVA 1R3HB 5ESAB 1ZA3A 2PTTA 5KTEL 4MJIA 1A64A 4H13C 2Z4QA 2IF7A 5D70H 3T71A 3TJHD 1NCJA 4LF3B 2ENSA 4KO6A 3UBHA 4GSQA 4IOSA 4JRFA 3NTCH 5AB1A 3HNSH 5I73B 1WE5A 1PY9A 5D93B 5D1XA 5CEZH 1E4XH 1WD9A 4JR9L 2VXSH 4KDVA 3OR7B 2DQGL 3FUJA 4AYDC 3MGOA 3IKCA 3FMGH 1YEGL 3ZXAC 1WDAA 4KKZA 3GTNA 4OLUL 3V2AR 1KCVL 1F3DJ 3QR0A 1VFUA 4HV8A 2LAAA 2BVUA 1BGXL 4LKCA 2G2NA 5EUOE 1PSKH 2NY0D 3PFQA 3U7AA 3KGUA 2XFGB 4WO4C 2LQRA 1QVOB 3OHMB 4JVPA 1IAKA 2OZ4H 4UDUA 2DQJH 3QUKA 1MJ8H 4HZ1A 1OGAA 5GSVA 2JI2A 4ALAC 2Z7UA 3PQYA 2DQHH 4X4KA 2ID5A 3VFPA 3MRPB 4QHLB 5AVSB 3L6FA 3SE6A 4NO5A 4DN4H 5K59F 3VQMA 4IK6A 3VRJA 3VXMD 1BD2E 3ETSA 5I0XA 5T5FA 4LSTL 3MRQB 3MFFA 5BRPA 5HYSA 5F6IB 3VRLF 3QARA 3BDYL 1AS8A 1RIHH 5T3XD 3CMGA 1QKZL 4L18A 5FYJL 2JWYA 1S7UA 1FNSH 1U8CA 2EEFA 1AR1D 3Q5TA 5IROA 2F19H 1QHPA 4HUUB 3NN8B 1BFOA 1I8UA 3FNKA 4XPGH 1JPGA 2LW3A 5DHYB 3AXHA 3GWJA 1Q94A 4J8QA 1J18A 5DWPA 5FFGA 5BVJA 3L9RB 4P2RA 3GDCA 3US1A 4GEJA 1H8NA 4G70B 2GJZB 4O2FA 5FO9B 2G5UA 4PY8J 3JWNC 1H3PL 2VMFA 2CBOA 2FGWL 2HG5B 5EF2A 5F70A 2A74B 5CZXC 4MJHA 4DK3A 2HFEB 2WW8A 2AW2A 2GSGA 3IJ7A 4GXVL 1G7JB 4KXBA 1PTZA 5I8KL 3WEOA 1R1CA 2GIXA 2C3VB 3EDFA 3MAWA 1ZLSH 3SIKA 3TPUA 4ABQA 3GMRB 5AD0A 3V4PA 4QWWC 1OPGL 3JSSA 3NOIA 4OLZL 4I87A 1A4KB 5CILL 5B1KA 4X4MA 4QHUA 1DE4B 1ACCA 4G7VL 4HJIA 4KXZI 1ZHBA 5KSVA 1EGJH 3ECBB 1VAHA 2MHAA 3P4MB 1PBYA 2IC2A 1N6UA 2ESVD 3D0LA 3A6OA 4JGJA 2R9HC 3UJJL 1PLGL 3GXUB 4QT5B 5EO1A 2QHLA 3QUXA 1NCCL 3K46A 4YSSA 5D6CB 3LEXB 4Y8DC 3PQYD 3VXUD 3KLLA 4H0GA 4OF3A 3CZJA 5IQ7L 1NCCH 3L9BA 2B14A 3A4EA 5FYKL 3LEVH 4CC4C 2GITA 3ESMA 3I3BA 3UGUA 3V9EA 4LESA 4ONHB 5E8DH 1F3DH 2BW4A 2R0WL 3DSFH 3OKMB 3NN8A 5D7HA 4D8OA 4PJ8D 3Q13A 1WFMA 1UWGH 2ZP0T 3WEBA 3MLXH 4PUBL 1U8NB 4IHBA 2ZSVB 5DJ2A 4FLSA 1NC4A 5JHDE 4NRZB 4R8WL 3Q6FB 4M4PA 3L2MA 1BFVL 2H47C 3GZKA 4IBLT 3UTSD 3QDJD 4KVNH 4GPVA 3VFWA 5JIIA 2CXKA 1NDGB 1UXMA 2CUMA 1CBJA 2ZKXA 1G5AA 4FFZA 3L3OC 5GSVB 4MFHA 2ATAA 4KKRA 2YPLD 2F9BT 3NH7H 5LN4A 4J6RL 1FI8C 1W6LA 2XRAL 2JQMA 2ZYIA 4HWEL 3FJTA 2FEDC 1EPFA 2F1AA 2IXQB 3MFFB 4WW2B 4EI5B 1A8ZA 1INEL 3IT8D 2XWZA 3O6ML 5ESVA 3V0JA 3NGBB 3DOIA 4XB8A 3ZT6A 5SWSB 3PV6B 2R83A 1JZEA 1KDIA 5FGRA 5GZNC 4TQHA 1JK8B 4RISL 2X2YA 2Q0ZX 4YHIA 3RZCB 2XRAH 3T0EE 1BBDL 1E7UA 5E8OA 1BVNT 1OQOA 1OM3H 1X9UA 2WB1A 4KHXH 3EYOA 5C07D 4BFFA 5DZVA 3EYVA 4PG2C 1MHEB 5AZUA 3CHOA 2YRBA 2X6BA 4ETYA 4XOAA 1ORSB 1PZAA 5LHDA 1M1XA 2CCVA 4XPAH 2B7DT 2WGXA 2XACC 1IEHA 4L2YA 4Z0XA 3W2DL 4FJZA 4KH9A 1KELL 1KXTB 3SD5A 3V5HB 4HPHA 3KXFE 3CN2A 3MXVH 2KLRA 1YECL 2HLFC 1J8HD 2H1XA 1OTTC 2UZYA 1U91A 4XNQA 1T0NA 5ADOH 2X2JA 4OF7A 4DGIL 4HK0B 5KS9A 4BV1A 5D6CA 4TVPD 1ZY9A 4R97C 5C0BA 5D4QA 2ZG2A 4R2GB 4BWUA 1L9QA 4R4NC 4M7LH 3ZDYF 4JFDD 4NBXB 2VN7A 1BYOA 3TF4A 1BQSA 4WFEE 3CAFA 2VL5B 2DJ4A 1F3JB 2R4SH 5MI0B 4HKZA 5DZ9A 2OJEB 3SDCA 5D5ME 1NBZA 1B0RA 3E3QC 5SWSD 5DVNA 1FYHB 1X5XA 4MA3A 1AOZA 2GSMB 3LS4L 3BVNB 4XZ4A 1VESA 3RTQA 2WNXA 1D5XB 4MNQB 2XJLA 3R0NA 5CJOH 4MB1A 1KCLA 1IGYA 4R90L 4ZDHA 5CCHE 2GSIB 5IWLA 5GGSA 4MQSB 1VZIA 4LEOA 1ZIAA 3MLSL 3BPLC 1IX2A 1DVXA 2CO7B 1RIVL 3FSAA 3KR3L 4GAYA 4I1RA 3TBWB 4IOFC 4DQOL 3QZOA 4IBQA 1AIZA 4KVCL 1IVTA 2DWEA 4YXHH 4X9BA 2PUQT 3NSCA 5JPNB 3WNNA 3T08A 2YZ1A 5CSZA 1RP8A 3TEYA 1XXFC 1DJGA 4NQDB 4X4XA 4FZEL 5I82A 4AXWB 1FV1B 4J6IA 5F7UA 1KCRH 2ZOOA 5JYLA 1XF3A 2L4OA 2P3YA 3QYMA 1F3RB 5HHXH 5KSBB 4DGVH 1L7TL 2NW3A 2I9LB 5GS0C 2FD6H 1CU4L 4OJCA 4CVXB 1WHPA 2IIJA 3KW7A 5KS9B 3RA7H 4B9JA 4M4RB 2E75C 1FDLH 3C9NB 4UAOB 3G04A 5F6IC 4YHZH 1BZ8A 2JELH 4F9LC 4YXHL 2E9JA 1ZWIB 4IU3B 3PQYB 3OAUH 4PG9B 4JFYB 4Y4FC 3RVWC 4HXBL 4ZYKB 4F2MA 5FUOL 1S7WB 4Q9QL 3BOVA 2M26A 5D7IE 2NW2A 1CBVL 1E4WL 4UILH 4JFTA 1J0KA 2C3VA 3B7YA 4WO4B 3CVHH 4Z0XB 3U1SH 5AW0B 1L7IL 2KKQA 3CPUA 4TQIA 2CALA 2BVQB 1ETZA 4RMUA 3ULUH 2IBBA 3ZL4H 2XVKA 5IHHA 2R2EA 1ZTXE 3RE0A 2HT3C 3SJVA 3BIKB 2D0GA 4E5XB 4EO5A 4AQAA 1XGPA 5IQNA 5TDOB 2QKIB 4DPCX 4QGTA 4Q58C 3WIHH 1ACZA 4U1SB 4WDIA 1RJLA 2O61A 4S1SH 3K80A 3TNMA 4HUXA 3OM3B 1BA9A 5E99L 5F9OH 4JPQA 8PAZA 2H45A 5EBGA 4QT5A 5EO1B 1R3IH 1CG9A 3NYKA 4MKTA 2R69H 5JDJA 4JO2H 1JFQH 4GW1A 3SKOA 1OHZA 5AYQA 5CD3A 5CEYA 2I9LA 5KVDE 4ORGA 4QXUL 4G6FB 3ARDC 4P5MB 5AUMA 2PYEB 2P8MA 1D5IL 2V9RA 1KFAH 1QPXA 3H55A 5KSVB 1NEZA 3ULUE 3EYFA 4S1RL 3EHBB 4NN5C 4JZOA 5IV2B 1WA1X 5H8DA 5C92A 1KPRB 1GVIA 3RFZB 3CBJB 1MEXL 5MEOB 4NUGL 3IM1A 1XZ0B 3SQOH 1DVQA 1N8ZB 3UP6A 4MD0B 3EDJA 3PL6C 5H37G 2F2HA 1NCOA 2IQ9H 5EZOL 1WFOA 4FCAA 5DS8B 4LAQL 5K9OB 1RUMH 3ARUA 3O8XA 4YFLI 5E5LA 3W9DB 2E56A 5DF0A 1EAPA 4AQOA 1THCA 3ESNA 2X3BA 1E4HA 3ULAB 3T04D 1T7YA 1EHLH 2VN5A 1J11A 3X12B 5DJCB 1MFBL 4E9YA 3HE7D 1CDGA 4G80A 5ESVB 1AGFA 2YA0A 3U82B 2YFOA 4MZIA 3O6FD 5E23A 3PV6A 4I2XE 4YDVB 1V55B 3T6WA 1CG9B 2ZAHA 3CG8A 1QFOA 2KH2B 5JXED 4RFEB 4KXZH 3ATFA 3U6RB 3G5ZB 3ATAA 4FFVC 2YK1H 3TH4T 4Z95L 3EBAA 2CDEB 1T6WA 2ADGB 3ARFB 2DMGA 5TFSL 4ZI8A 5I8OH 2Z93A 3GJFA 4ORZC 4A68A 1QRKA 1S9WA 2PKDA 5H35A 4WCYH 5KEZA 4LT7A 4Z7VA 4PRAB 3OKDB 3HG4A 2AMUA 3VI3B 2BY0A 4PRHA 3L4VA 4TSCH 1GTFA 3EBHA 4QTHB 3T2PA 4N2IA 4YDKH 2QADB 3FYEB 5LAPA 5JW4Q 5D1XD 5ESQB 3BVWA 1FC2D 5JQ6L 2G9KA 2VITA 4GKNA 3SDXE 4G9FE 1EAOA 1KTRL 1EA9C 1O7VA 3UGXA 3FH8A 3UMTA 3CFJB 1S9VA 3APDA 1IKFL 4F57H 4ZMZA 1SZNA 4AJ0A 2WVUA 1RVFL 3WDJA 3F8UB 3QEUB 1PYWA 3IU4H 1GC1C 2M8XA 1JDAA 3MNWA 5BJTB 3SKOB 5CD3B 1CE1L 4LOEA 4N0FA 5EC1A 3U4EA 4GUCA 1W72B 3CLEL 3D69B 3T3PF 3I02B 3QG7L 2LHAA 3QDAA 3U9PL 4DK5A 3WIHL 2XN9E 2DQFA 4K94L 3GLZA 1BMGA 4YDVA 1UEMA 3D09A 4L8BB 4XC1L 2HVKB 3DJTA 3QXWA 1JG9A 3CBKB 5D1QA 3IJ8A 1ZS8A 3KJ6L 4GG6B 4PLKD 2I32A 3BWZA 1ESOA 3QIUB 3WHE0 1G6RB 4ONOA 3WMQA 4NBZB 2H3NA 4JFUA 4WTWA 3CFUA 1YMME 4U1HB 3VMOA 4FNLH 1U58B 3ARWA 1M1XB 4R5VA 3VVVA 1CF8L 2BS9A 2A9MH 2FYYA 5JW4R 5DUML 3GTTA 2E9GA 2NY2D 2FQGA 5IVXB 4FYRA 2PWDA 2VR8A 3MRMB 4R5XA 4P5TD 2VXUL 1BEYL 3QEQA 4NPKA 1M6OA 3O9WC 3EO9L 1EDHA 2A6IB 4HBQA 4AGMA 5GJSL 3P73B 4CGUB 1TO4A 1TJHH 1B3JA 2NY4C 1U30A 2ZXQA 3F62A 3CDFA 1X5KA 2ZUVA 4B41A 4PRIB 3S34H 1E9PA 4YO0A 1C7SA 5BZDA 3F83A 4OJAA 4EZMA 4JHWL 4C57C 3G04B 2VMDA 3QUKB 3RPKA 1JV5A 4G3YH 5B8CB 3QYNA 1UACL 1ILUA 3M7FB 2HRLA 5JOFA 4YXLL 1LMKA 1I7ZB 2NZ1A 5B39A 2H1LM 2XKNA 5E2VH 4DGYL 2Q3AA 3Q48A 2FJGA 1HHIB 2EE0A 3BWAB 1ZGLA 2VN6A 3IDJB 3GSRA 3BP4B 3S4SA 4BA8A 5JDSB 2EUWA 4DTGH 3AUWB 2APSA 1WC7B 1YPZF 4ZUTB 4AL8C 3QWRD 3HFFA 3DTXA 4KKAD 1TYEB 4X7SH 3HI6H 1KTBA 4JB9H 5EA0H 1RXLA 2X28A 3NZ8A 2AJUH 4LHJB 1CZ8H 1ETZB 4GAYB 4PJGE 3VXRE 1HN1A 1IAOB 1Y7VA 4XPFH 2EUVA 4FQ2L 5DCCA 1DLFH 2A83A 3C75A 5KVDL 2Z1PA 3KYKL 4CNIA 5C6TL 4XWOC 3QNYA 3QDJA 3I9IA 1F41A 4QY8B 4FTVD 4I4WA 4MCZA 3T6VA 3KWVA 4NQCB 2W60A 1IZJA 5I19L 1IBHA 2ZXCA 5CEYB 1XBRA 4ZX4A 4B95C 4O02L 3BIBX 4L8BA 3B2VL 5FHAH 2E3VA 5K9JL 2HKHL 1KC5H 4E68A 5C6TH 2Z8SA 2BRRL 3FTXA 4NM4L 2BNUB 2MQCA 4TQPA 3VQ2C 3U0WL 4HKBA 1C5DA 1UM6L 3PJSA 5DA0B 1YNKH 2VSKB 4QJ3B 5JHMA 1DO5A 4PWKA 1MI5D 2FT7A 4KTDL 1ACYL 3CDZB 5C7ZA 2V3EA 4I3SL 1M1SA 4OCRL 2ICES 1UCBL 2VDPB 4NKOA 1EZSA 1GW6A 3ZGIA 1BM3H 3WO3B 3P3UA 4KROB 2OMZB 5BVPH 4MNQE 4BCYA 1SMOA 1NGWA 1NSNL 4LL9A 1HHJB 4W9DC 4RNRB 1KPUA 4ZW3A 5F21B 5C9JB 1WS8A 3GPSA 3E1ZA 3OLEA 4UOW0 3M1BA 5ENWA 4BH7B 3BAXA 4WUKH 2K8QA 5J3HC 1N8ZA 1FBIH 1QHOA 3AITA 4L8DB 1KCSL 1BBDH 5C09A 2GBUA 5D2NE 2GI0A 3WV0A 4JNXA 4KRMB 3HE6D 5JPMC 4ZUSB 4FZ8L 4AMXA 5EU3A 1OARH 2OXGB 1MCSA 2ITCA 4GH7B 2EYSB 2B15A 2PYEA 1RMFL 3EO1B 1N8OE 3QIBC 5AZ2L 5ACLA 2MCAA 3BXNA 4BFRA 4HGWB 4QRRB 3I6LD 4IGBC 1AXSA 3CSPA 2Y2TA 1WBYB 4EQ2A 2J6EA 1JPST 1X5HA 3QAZB 1AGFB 4OAWA 4XNMB 1FL3A 4ZQTA 3ROLA 4IBWA 4Y9FA 4HJSA 3TV3L 2GQHA 3I85A 1KJ2A 4A7UA 5CCKH 3TO2A 3CFDB 4B97A 3B5GA 2CIIB 4ODSH 3WFHB 5K69A 5HYQA 1H3WM 3T3PE 1A7QL 4OF0A 5TQ0H 4C55A 3U6RA 1OF2A 2B3IA 1CICC 4IRSD 5F6HJ 3P4NA 2VDLB 1XGTA 3SCMD 1NOAA 1RUPL 1ROCA 1EZLA 4APXA 4NAJA 3D18A 3EYVB 4F7KA 3FB5A 1YEDA 3B56A 4LAJH 4U7KA 2NNCA 1JNHA 1FAKT 2OJ1A 1XIWC 3EGXB 4ZZKA 3MXWH 5ENWB 5DD6B 3BSHA 2IH8A 3LNHA 1S9XA 3OR6A 4LSUL 3BAJA 1ZE3H 4OU3A 2XWTB 1KG0A 3P1VA 3LNDA 4U1LA 2F7QA 3MXWL 3EGSB 1MAKA 2WGNB 3QFGA 4YHYC 1RP9A 3SBWA 3SPIA 3F12A 1FFQA 5DWUH 4RFEA 2FNWA 3ZHFA 1U8IB 3STLB 1GZHC 4TLSA 1A47A 3EJRA 4D0BB 4WU5B 4JM2D 3RWEB 1OV8A 3CFBB 5CP7B 4NOBA 1P84J 3DXAD 4RAVA 5IW1B 4ODTL 5C0AA 2UY7B 2ZX8A 2HWZL 3QEUA 3KPRA 3UPRB 1SJHB 4J3OD 5F9WC 5IESH 3PAYA 2R2BB 1QLFB 1TJGL 4K7PH 1WBYA 3W11D 5DVMA 4HOWA 1MW3A 4HH8A 1NIAA 4ODVL 3GK8H 3FCUB 4J12A 5HHVL 2FTAA 3DGGB 4D9QD 2XQBL 4LDOB 4D7BA 1J5OL 2FATL 2BFVL 2O5XH 3DYMA 3TBSB 5I1AA 1E67A 4KXDA 1E5YA 3QZWB 4CRPA 1AJ7H 1PFCA 2V2XB 3AB0B 3P30H 2G5RA 4YDLC 4KU1A 5CU9A 4FA7B 1JZGA 1T21A 3N44B 4N0CD 4YHZL 4MNHB 3KWTA 2HVJB 5ELIA 4EKJA 3MNWB 2YQ2A 2VMJA 5D7LB 4UYQA 2VJ0A 3D25B 4JRLA 3HN8A 3EUDA 1I8IA 4WTZA 4YDLB 2G9HA 4GUPB 4IGBA 1MHCA 5DMYA 5JOFB 2DQJL 3V0EA 5F3BB 1FH2A 3EOTL 3B7UX 1LE5A 3JWOL 4PREA 1Y18B 3MLTB 2BP0A 2FH6A 5D1QD 1ED3B 5D7IF 1K4DA 5HPMA 2ENYA 2A4ZA 4O2EB 3LRKA 2EDOA 1NFIB 3MCLH 2EDHA 4M6MH 3D0VA 4MCYB 4RZKA 1BXUA 2CIKA 3P77A 5JORA 4NKMA 2EIKB 5TDPA 3BVXA 4NO0A 2HFFB 2J4WL 1F6FB 2R2BA 3V0VA 5A40E 2D3VA 1JGLH 2WINA 1FYTE 2Q6WA 3ARED 1A3LL 5ERWA 4JQIL 3WLBB 2NOYA 1QABA 1TQBB 1QBLH 2H26A 5G5DA 2ISDA 1KFAL 3GLAA 2AV7B 1EEZA 3AFLA 1MLBA 5INDA 2ZKHL 1XGQA 2B4CL 4FFZL 4LBEA 3HUJB 5E7BA 3OJDA 1KYAA 1O6TA 1SVBA 2R4SL 5T5NF 3T9WA 4WGWB 1AD0A 5B38A 2WNWA 1JHKH 2NCMA 2BHZA 3D4ZA 2EEAA 4KROD 4U05A 5B4MD 2HVJA 3EADA 5DJ8B 3ZUCA 3N0PB 5AVUB 4V2BA 1FC1A 2WBJA 1TVDA 2VLKA 3NAAH 3NSFA 4NKIH 4I0PA 1BZ9A 3WU1A 4OLWH 1CD0A 4JS7A 4WZ9A 3QZWG 5JA8B 1M9SA 1JPEA 1M9WA 4IBSA 2IG2L 1GTNA 4ZPTA 5D6DA 3IAQA 1D9KC 2BY2A 4KTEL 2PWHA 3DJSA 2DTMH 1D2PA 3GSRB 2K3TA 5HPOA 1E3FA 1A6WL 3CQQA 4OFQA 3MUGB 4PJXE 4N0CC 1F90L 2VXQH 3MX0B 1E4WH 4UILL 3W9DA 4XBGA 2YOCA 4YZFF 4GUOA 2NNAB 5E9NA 4JFEE 4NKIL 2F8IA 4RESB 1EX0A 3FSZA 4AIXA 4HXBH 1XH1A 3TJEH 2BW5A 2KERA 2Y36H 4KKBD 4NZDA 3G6JF 2F53A 2J21A 4DP5X 4PJFE 4O2FB 3BZ4B 3F3HA 1UZ6F 5TE6H 5TFSH 3S3SA 1Q9LB 1DJHA 3VXSE 4RIRA 1J8RA 1YDPA 2IAND 4LPTA 1QASA 4PS4L 1NC4D 4P4RB 1JD9A 4XP5L 5F7EH 1QR4A 3BHBA 1TKWB 3TWYA 3WFBL 5IBTH 2A77L 1HILA 2H2SD 1IAII 2VB5A 2DJSA 4RAUB 3SDXA 2X4SA 5LGKA 3NFSL 4G8GA 4RNRA 1J8KA 4G8GE 5JPMB 1PF3A 2VDRB 1UH2A 4HWEH 1ZT1B 5FM5M 1NFDB 2WHVA 3VI4B 4NJ9L 4I3GA 1H8SA 4PRHE 5I1KL 1KJ2B 1S78D 3L3JB 4IHOA 1NBQA 2ZUQB 3V55A 1D2OA 2AZAA 1JWUB 2P49B 3GZQA 2Z91B 1OAZH 2A9NL 2R1WB 4FHBD 4XMLH 2I85A 5B8CC 1U3JA 3CDCA 4V1DD 2ATPA 2BNRD 4XCCL 3EXJA 5HYFA 3UBXB 2H0JA 4AG4H 3K4DA 1AG6A 5G4OA 1CGXA 4NQXB 3GMMA 1N70A 3A4DA 1X5ZA 4OFKA 43C9B 2KPWA 4JANB 3BYTA 3MLZL 1CD9B 1F2XK 1FCGA 4XC1H 1J12A 4OM1H 1FVEA 4AJWA 2DQCL 5BJTA 1ZE3C 2JVUA 3U1QA 4FQXC 4N0UA 3WNLA 2ZX6A 3B1TA 5DXWA 4ADGA 4KOCA 4CMMB 5DJ8A 1VACA 5C0EA 2XG5B 1ZV9A 2O93L 3FS9A 1LO5B 5JZ7D 1SY6L 3P11L 1U3HC 4K2UH 3MACH 1ZPLA 3A5VA 4OFIA 3ZQWA 2AQ2A 2R69L 3FT3A 4A7TA 1AFVH 1YECH 3GO1L 3I75A 3W0WD 5B7FA 1NMBL 2OTUA 3DOSB 4M1CC 3L16A 3TYFA 3INUL 1KELH 4FJYA 2HTKD 4N3TA 2QR0B 2W88A 4JM4H 4MRBA 1NIFA 2YBRB 3EJZC 4NUJB 1G7PA 1TMQA 5MEQB 2YUVA 3FB7B 1EHKB 5FUCC 4PJ9D 4E9TA 1E9QB 3LJ3A 3VDAA 4YX2H 4GAJH 4JRXE 1BLNA 4AX3A 1BAGA 2BSSB 2F15A 3MBXH 4HS6B 2ICWB 4P59H 5CIPA 1F11A 4PHZA 1KCUH 5EN3A 4L0YA 1LTXA 1MCFA 3PRZA 3DGDA 4I48B 4FQIH 1ZWIA 3M07A 2X1WL 3DO3A 4DFIA 5I24A 1PD1A 2XVGA 1R34A 1EJFA 3BUIA 5DEJA 4BRJA 3OAYK 3J8F7 4OLXL 5F7BA 3WNJA 2IGFH 2BSEA 1QRNA 1TU2A 2JB6B 4UB0L 4HAFA 2PLTA 3TL5A 2JJSA 2YGVA 5T1LB 2K0RA 2HLEB 2BVYA 2KQNA 4P9HL 2NZ9C 3O0RH 2X4UA 5ID1B 2B1HH 2VDOL 1I8IB 1BWMA 4Q7DA 4PJ5A 1KB5H 3SDXB 3OG4B 5DD5L 3E6FB 5I1EH 2B1AL 2J5LB 3D3VA 5EO0B 4Y4FB 3D39A 1LO5A 3IE9A 1JWMA 4HWZA 1COBA 3LSOA 2IAMB 5B1JC 2IBZY 4DVRL 4JCMA 5BXFB 5EUKB 1JS4A 1BJ1J 3BP6B 2DYPA 3WS6A 3WAKA 1AI1L 2J1KA 2AVGA 4NQED 2F8XC 4M3KB 3FTWA 1XB6A 4ZRGA 1CC3A 2UZIL 1XXDC 2B77A 4KJQC 4PJ7F 2BY1A 3OB0H 2G60H 3VI3E 1HOCB 1TZHB 1A6UH 2OJEA 1E4KC 1F11B 1OCRB 3BD4A 3FUEA 3Q2NA 2MPAL 2R56L 3H0TA 3O6FB 3QJHA 4WWKB 4XH2B 5JPNC 5HPMB 4KTYA 1VFBB 5T1KA 3EGDB 3VYPA 2ESVB 3FOMB 3MRIA 3TO4D 2UUDH 3LPPA 1N5YH 1KIPB 2VLRA 4NFCA 3SJVD 2YAFA 1EFXA 1KXQA 4N87A 4RMSA 4PB0H 4IDJL 4KRPD 1M57B 2R9HD 4MB3A 2F58L 4GRMB 3ZL2A 3EJZD 2QDVA 2QV2A 2IOOA 4PBVC 4HUCA 2KC0A 2MWCA 4IOFD 2MKWA 4U2YA 1ICTA 2BFGA 4JGMA 1NFAA 2J1ZA 5B4MC 4LSPH 4W9EC 2MCMA 5T1DH 4GEIA 1Z9OA 4TSBL 3HG3A 3QC5X 4X83A 3ZIYA 4TL5A 1OE2A 3VGGA 2GHWB 3GHBH 2LABA 1S9KC 1A22B 5AWNH 2QADC 4BZ2A 1IC5L 2VZOA 1ZK5A 4M1DH 3WGVB 1NCHA 1CDCA 1VGEH 2BP3A 3S5ZA 4HBCH 5GGVH 4M1GL 3K71A 1KENH 2NZ9D 1JPFB 3TNNA 2XVBA 1HH9A 3FQUA 3K91A 15C8H 1KOAA 3MJ6A 4ELMB 3OAZH 4FRWA 1F18A 5EULV 3SGKA 4BSVA 4ZMPA 3Q7JA 2CDFB 1FO0L 3FTSA 1MIML 1R3LA 4FNTA 4P5TC 4UTBA 4JB9L 3PDDA 1OW0C 1R4XA 1BQLH 4QEGA 1AI1H 1HOCA 2DLIA 3PJSB 5DZJA 5AWNL 3UADA 1WAAA 3UTTE 3EDDA 1AY1L 3D2TA 1BF2A 5H94A 2X4QA 4R0LC 4QAWA 4P9MH 1NCDH 4G6KL 2AHIA 3HZKA 3T0DA 2QKIC 1HEJC 3V9CA 1IGJB 1U0QA 1UZGA 4HDIA 4YXLH 5B3JF 3ES6A 3BVUA 2OCFD 3CZLA 2K3HA 3PPEA 3MN8A 3GBNL 1IM9D 4Y9BA 3DKHA 4X0KB 5JHAA 4YK4C 3VFUA 4DOHB 2Z3FA 1OK0A 1VFOA 2JTYA 3LXUX 4WO4D 1U8PB 4LOUD 2DLEA 5TDOA 2YGOA 3ENEA 3A4FA 4HCRA 3IRPX 5E9AA 1TLMA 4FADA 4GKZB 5IHBA 1YEKL 4U0RC 4P5KA 4PTUB 4ODUA 1JRHH 5HY9B 4WEEA 2VABA 2BNQB 5I15L 3E1F1 4KY2A 4CJ0A 3MGTB 1DVFD 1TT6A 1NEUA 4K7FB 4N85A 3NJIA 5MHSE 3K1KC 2G3ZA 1KEGL 4ELMF 1N5AA 1QSEE 1Z7JA 2W9EH 1ZS8B 1T83A 5MEND 4WEBL 4MDRA 4YXKL 4NO2A 1GZPB 4P2AA 5CLZA 5T3ZL 5EU6D 5GS1B 4TN9A 1T0PB 3BWUF 1KV3A 1LILA 5EZLB 4RWHA 3QR1A 2Z31B 4HIJA 1I9EA 5DJDA 1RZJC 5I6XB 3OXSA 2E7MA 4ZMAT 1NCBH 1QR1A 3PWVB 4X2UA 1K5NB 2VIRB 5KWYC 4AWJC 3FT3B 3AM8C 2WXHA 4K3JH 3VFMA 2VE6B 5I15H 4TVPH 1RZKL 3REVB 1YEDB 4M6OH 3GFUA 3ZUNC 2CK2A 3LIZH 4RWYL 1SGKA 3JVFC 1XX9C 2FR4B 4JFQB 1IBDA 2XN2A 3DYOA 4FNLL 4KUCF 5FGCE 3T0EB 2CHDA 3N43F 1MOEA 4CC0A 2FNBA 1MXGA 4EIBA 2XBZA 3ZHNA 3AJ7A 2NXZC 3GINA 4HBCL 4X5WB 5GGVL 3AGWA 4ODUB 1YPZE 3WSQH 3VYOA 4RZCA 3B9KC 2HTLD 3GHBL 4DP0X 1KV7A 4NFBA 4V1DE 1TG8A 2KYIA 1X5MA 3CFBA 4JQVA 5CP7A 1QX1A 5IW1A 3HNTL 3II2A 1HHIA 1V7NL 3BWAA 3QJSB 5KJRL 1ZGLB 1XB3A 2V2WB 3KPRB 2W59A 4ODSL 4WAFA 5H35B 1NZRA 3B34A 4X7DC 3UIYA 1F5WA 5KVFH 3K72A 1EJ8A 5H37H 1YQVL 1SBSH 5DSCB 1CVRA 3HBZA 5L4FA 2FGZA 2ADJA 4Z76B 1T5KA 3ZTCC 1YO4A 1S46A 3ILPA 1ZA6B 3G6DL 4BD4A 2Y25A 1Q4NX 2P28B 3TF7C 3HC3L 1UB6B 1YYLH 4JAMA 4N6RB 3V5HA 3BLKA 2B2XH 2WQWA 1REIA 1RIHL 5I1CL 3UXFA 1I1RA 4QJ4B 5KBDA 4F3FB 2FB4L 3AVEA 3K6FA 1F6AB 4NWTH 3HAEG 1CMOA 5C0CD 1AGDB 2DWTA 4XCNA 5H2BA 3SKNA 4AGQA 2WXNA 2HJFA 1JXDA 4H5SB 4DAGL 5CBAA 5E9DE 3H8NA 5DJXB 3BPLB 1H6UA 1FBIL 1CQKA 2DQHL 4OTXL 3US9A 2UZXB 4NZUH 3JV6A 3OTTA 4LLYA 3N43B 4FQCL 2WYHA 2PYFB 1WJ3A 3RI5K 4DAGH 2XY1A 4KZDL 3GRBA 3L3IB 3MJ7B 4JGUA 4R7NB 1OQXA 3LZQA 4KNTA 1CT8A 3CFNA 4NO2B 3ZDYB 3QDHA 2IAMA 4PRHB 1JOIA 2J44A 4DKFH 2HJKB 1P84K 5I0WA 1BMWA 2GC7C 1NJ9A 3A4AA 1JUFA 3KBFA 4QRTA 4BFBD 2VXSL 5DMGC 3UG4A 4WUUD 3V0IA 5ILTL 4Y2DD 5DJDB 2P1YA 3BZFA 3CCHB 5T5FL 4YHMH 3O3BB 5IB4B 4JFFD 2JJVA 7FABH 3VGDA 4PJHF 2Y1AA 1E6JH 3V4VA 1DVYA 1QBAA 3NT0A 2EVIA 2J2ZB 1NC2A 2HKHH 5E03A 1CUOA 3RWDB 2P7TA 1FFNA 3ECVA 2CKNA 5TE6L 1FPTL 1F45A 1NCGA 2ZKHH 1XGQB 2APVA 2BVEA 4LBEB 1BM7A 2R69A 4RVBA 3QH3B 2DLGA 1PDKA 1MRCL 3D34A 4XODA 2D9CA 5B38B 4XBEH 4M7KL 3J07A 4HCRH 4LCIH 4XP6L 2Q76A 4EZJA 2AAAA 2OXGA 1CYXA 4NP4L 3J27A 3JV6B 5FUOH 2IPTH 2VQUA 2D3NA 3FCBA 1KN4L 3TBYB 1JNLL 4FXGB 4KNSA 3ZYJA 2FDBP 5HHPB 4PBXA 2HMID 4MDJB 5D1XE 2VDPH 4JZNA 4NHCH 1GOHA 1E42A 5ICZB 1J8HB 2CR6A 3V5KA 3BEWB 2DWDA 3S4SB 1PIFA 4HC1A 4L4VB 3KDMA 4MCNA 3K71B 4ZMNA 2BIPA 1EFXB 3FQ2A 1CLZL 1DQMH 3KWXA 4WHTA 1AKJB 5D8JH 5AKVA 5C0GA 4FYSA 5DURB 5E5RB 6PCYA 1Z3GH 4LLUB 2CBPA 3VI4E 1FNFA 5IBLD 1CTMA 1EVUA 4G8GB 1JHKL 4GI9A 3WFZA 4HG4J 1ZT4B 5C9KA 2NW3B 4PR5B 3HR5B 3AU1A 3QORC 1KXVA 5I9QC 4L5FH 1AVAA 1Z1WA 4P2QD 4DO5A 1CGYA 1BV8A 3KR3H 1QNIA 1IEAA 2X05A 1LO0H 3CQPA 3ME0B 3HCVA 1ZANH 3H56A 1CN4A 4HWNA 1BDYA 3CZUB 1CBVH 5KBLA 4L4JA 5KAQG 5HD8D 4HEMA 4LLWA 2GTWB 3QRBA 4W9KC 3CDGB 1HH9B 3FQUB 3FU3A 4GIAA 3HC2A 4KX9A 4NJ9H 1JF6A 4BSJA 3AZUA 1DTUA 1E5ZA 2ADIB 1MRDH 1XWVA 1PU0A 3NSDA 1KPRA 2O5NA 3BT2L 3FBQA 2JTDA 4J1UB 4E41D 2FSEB 3BDBA 4JZJA 1JF5A 2YAPA 2WO4A 3RGVD 3G5XA 1H5BA 3N40P 3L2NA 4WVRA 3OKLB 1E4KA 3NFPA 4JUSA 3EOBA 4M9PA 5C0BD 3BKJL 4LGRB 3FU6A 1A6TB 4G59C 3TT1H 3WIIH 2EXYD 3APFA 3OG6B 2QEJA 1ROWA 3X12A 2W60B 2Y6TE 3ORJA 5GHWH 4A2FA 5AOMA 4DKAA 4DQOH 3CSFA 3QQ9C 5T3XL 4D94A 4YHML 5C2UB 5F0PB 2JCCE 3T2QA 4XAKE 1I7RA 4HC1H 4P99A 3L3DA 5DJZB 3OL2A 2FATH 4QKXB 4R7VA 5EF1A 1RZ8B 5HHVH 1JJUA 2AJZB 4U1IB 2FHCA 3D4YA 4WSGA 4EF3A 5IW6A 1TVHB 3FQNA 2VXQA 2R8SH 2AITA 2IFGA 3X3FH 2WCSA 4XI5D 4BE5A 5ITBH 1SYSA 1P7KA 2I07B 1R75A 2H1PL 2XTJC 3L54A 4JHAL 4OZGE 3RWCB 1CD8A 4NM8H 5J6HA 2E7DA 1A6PA 2XQYG 3EOTH 2EH7H 3AWEA 3TA3C 2EVGA 1G9MC 2GABA 3OKEA 4X80H 4LASL 4U4BA 1UT1A 3F5WB 5DI8A 3IWUA 1BLNB 4HJ0D 5F89B 4PRDB 4IBTA 3PXLA 4N9GA 4TULH 3MV01 2BVPA 4Y5YC 3UX9B 3Q1SL 5FC9A 2Z31A 3GRGA 1I8LA 3L81A 3CE1A 1ZT4A 4GW5A 5E2WH 1E6OH 4XI5C 2W0KA 2YK1L 3VWJB 1JNNL 4BEIA 2P80A 3EFDL 4WJG3 1WP6A 5FW8A 1KFGA 2OMYB 2V2WA 1CIDA 3VA6A 5FGSA 1XMEB 4KKLD 4ZOEA 4F33B 3NA4A 2ZKWA 2DQEL 4ZW6A 1AGCA 1GJUA 1JPTL 3FT1A 4MQTB 2WQRA 3ZYOA 1E5UI 3CVHA 1VB9A 2W0FA 3CN3A 2FUTA 1RL1A 3ZHKA 4QGYA 3QXAB 4N5UA 4OLVL 2IPUG 3ARGC 4DVRH 4M8QA 1IL1A 3MJ7A 1F4AA 4G7YH 1JWMB 4R7NA 2O6CA 3MRDA 2VYRE 1AGDA 4XCNB 4H40A 5DRXB 3S36H 1T2QL 2F18A 1WH0A 4BQBA 4F7EA 2WNGA 4XP4L 4YE4L 1ES0B 3P0YL 3QFDA 3LRGA 4X8GA 1Y1UA 3CLFH 3U4BH 1VERA 1AHWB 5FYKH 3RLSA 1NC2B 3A3YB 3VXOA 5AOKA 2ZUWA 2PR4L 2PW1B 4OQTL 5L4IA 4OZFB 4JFHD 3CFEA 3RDTA 2WQVA 2Y3NA 3S37L 4WU7B 3JTTB 3DVNB 3TCLB 3U4EB 1LXMA 2OI9B 2IPKB 4LHQB 3WNOA 3ET9F 4UV4H 4LCWE 4NKQB 4P59L 5L8JB 1P9MA 4OI8A 1ZIBA 3GI8H 2BWDA 1FA4A 3IGAA 1YMMD 4XVUD 4Z7NB 3PDOA 3RWIB 5F7YC 1FQ9C 3RILA 4WRLA 3HC4H 4S1SL 3APMA 5F88B 5L4MA 5BUAA 4DPBX 1OAQL 2EYRB 4JRYA 2EDMA 3CN1A 2Q10A 2X3CA 1R0AH 1TMCB 3GSNB 1IAMA 2PYFA 3VWKC 3NBNA 2QVTA 1VDGA 4Z7VF 5DO2D 2J88L 2D73A 3V79C 3OB0K 3PUUA 5C0AB 2NRDA 4UV4L 1MFDL 1NAML 2BCKB 2Q86A 1XSOA 3BT0A 1XH0A 3QJFB 3VTMA 8CGTA 1NFDA 1AQ8A 2HRHA 4DO6A 4PWJA 1CGSH 5L2KD 3OC5A 3RWHA 4UQEA 1KBVA 4D3CL 3DJRA 4YPGB 5FLVA 1QATA 3WKML 1GC1H 4YHIB 5FW6A 4YAQA 1CFVH 4ZMQA 4Q9QH 4V11A 4F7PA 1S5IH 4GQZA 4JDTL 5EIIA 5EBMB 3BKJH 3C5SB 1TSHA 3BP7B 2D3LA 2UX6A 2UYLB 3IGUA 4QHPA 4Y9CA 4BUQA 1LK3L 3GMMB 2C1PB 3IJSB 3GXNA 3MV7A 3OGCB 2X4QB 1FIGL 1H5BC 4KMTL 4XX1G 5IK3B 2AJYH 3V5KB 4A37A 3WXVH 5BS0D 4OR1A 5I0DA 4MJIE 1I3RB 3OKNA 1O6SA 4NRXB 4RX4A 3RGBA 4A6YH 3D85B 3D07A 4POZD 3TH2T 1ITCA 4OLUH 1AD0B 5GRVL 1MXDA 1CFTA 5C08D 1MZZA 2NY1C 3ARBC 2VRAA 3CSYA 2Q76B 5CLWA 1AAJA 1LEIA 2DM7A 2DQEH 4JRYB 3C8KB 3L2LA 4OCSH 1CS6A 3B2UC 3TBYA 4E41A 2H3KA 1MQ8A 1V3MA 2A77H 4NFDA 4JPIA 1DSYA 2IWKA 4LLDB 1ID2A 3KLHD 4R84A 5C0IA 4HHAA 3QDJE 3KXFD 3IF1B 1BQ5A 3IXTA 3V6OA 1IC1A 2F0CA 4OUUA 3H9YA 5IB3A 4A7GF 1U4FA 4PTTB 5T1DL 3PWVA 1M7UA 1CDHA 4JGNA 1KJVB 4NQCD 4FDWA 1MLBB 2BZDA 3DRTA 1S3RA 3VA2C 4QOKA 1DSFL 3REWA 2VTFA 3U9UB 1RPUA 2JB6A 3TC9A 1X9QA 2V5RA 2C1PA 3P9LA 4OGYL 1DJSA 1P5UA 5AL8A 3RL1B 2FVNA 2EIJB 1CYGA 4PWFA 4F37F 5CR8A 2Z7ZA 2NY4D 4NNPH 7CGTA 4HJJH 5F88A 4FMFA 1X4XA 1YEGH 1AG0A 2XWXA 3WUZA 5IQ9B 2Y22A 4M1DL 5DUMH 2H3XC 2WWNA 4R3SB 5ICYA 1MRFH 4PBWD 2CKBL 1KACB 1NMCB 3MBWB 4ENED 3MROB 1NPJA 1BZQK 2P8LA 4M1CD 4QRRA 15C8L 4OIFA 3QCTL 3AW5A 3T0EA 1B2WH 1XD1A 1SXAA 2K6WA 4PJBB 2YXVA 4IMKA 2Q87A 1UACH 1WAAE 3FF7A 3GS0A 5HHMB 3UTTA 3L3DB 2AF2A 1EANA 3SDXF 3L13A 5D96B 3QUXC 4LEXH 5JR1L 4HHAB 3VXUA 2WLJA 2DQIH 4JAMB 1KPVA 2NY3C 4PJAF 4YFLF 3NZSA 4S2SA 1MW0A 2ZUSA 2IQAA 4Y4FD 2NR6A 3U2SA 1J8HE 1PNCA 3CHXA 3Q0HA 5HGGS 2PPEA 5J6HB 4YLBA 4FMKA 4UT7H 1HCFX 2OFQA 1T2XA 3K72B 2WD0A 2AJXL 3NCYP 3MRIB 4PGEA 4IDLA 4K3DL 1EHLL 4ZXBD 4Z76A 4PRPD 2W07A 4PRNA 3ARBA 3MCKA 2W0FB 4UTAL 1CTNA 4Y2DB 1M53A 3ZQ9A 2WAHA 1PMYA 2HX8A 1KNOB 1IAIH 3NJLA 2BIOA 2CZNA 4Q8BA 2VDNL 3KYMB 4K5LA 1WBXB 5JW5B 3VD0A 4DKTA 3F84A 2A4CA 1HHHB 1MCLA 4G72B 4KK5C 5E6RB 1SJVA 4HWUA 4WU5A 4P5RA 1YC8A 5L88H 4ADIA 2BP5M 4OKVB 1BVLA 4RAVB 3O3UN 5KYYA 2J1XA 4NO0D 4XBMA 1BMZA 4UM9A 1MCPH 4XB3A 5GJTL 1EHXA 1TQCC 5BRZD 3II3A 4KRPC 5I8OL 2UZXA 1T1YA 2O5ZL 3I50L 1EBAA 2GITB 2RFXB 5ALBH 5AOIA 4B7IA 4J3OF 5CXPA 4TUKH 1RHHA 5DI8B 3FUKA 3TBVA 3WDIA 3QI9A 1HL4A 1IUZA 1BX2B 1KY7A 3FB5B 1BLIA 3N55A 4WV1A 4F7TA 1LHZA 3DSFL 4JRYD 3IU4L 4S0SD 2OR9L 2P7TB 2VLJE 3O8XC 1JZ2A 3CSBA 4YH6A 4LPXA 3MRDB 1TYJA 1ZJAA 2P80D 1NUNB 1G7QA 4P5TB 1R3JA 4C4BA 2Y5EA 3CN4A 4QHMB 5E4OA 2YPLB 4L8SA 4F7CA 4N2MA 4EQ3A 2CNZA 3DNKA 4WW1A 2IPTL 4QRQB 4AMKH 5TGBA 3PDOB 4LCCB 4PSPA 4E9QA 3QFDB 1MI5A 2VC2L 1YUKB 3QIBA 4NGHL 2W07B 4PRNB 3GBDA 1KMGA 2XT1B 1SFDA 3FQ1A 1G7MA 1WAEA 1TNNA 1MFAH 3HRZC 2CLVA 5L2JA 1MRCH 2X89D 5E2JA 1XFPA 4YDJB 1UB5B 1NMBH 1ZDSA 3OQRA 3RJDA 1G6VK 2ROXA 5JOPE 1U95A 4NGHH 2YD5A 4GI8A 4PHXA 4NZRH 2X42A 2EUXA 3BPOC 5I8KH 2EIBA 4D2NA 4AYMC 1MCHA 1L4IA 3LQAC 4IRJD 5CD5C 3VXUB 4WI9A 3DDGA 2X6AA 1CI5A 1T7XA 3SPGA 1BVOA 3U9WA 5EBMA 4Y2NA 5C0RH 5DJYA 3CHPA 1LO4L 3ARQA 4PY7A 4B60A 4YWGL 1U33A 1D5BA 2JXMB 4ETQB 5J89A 3ARVA 1INQB 1OSZA 5SWZE 4NZJA 4AVJA 1NFDE 1QEWB 1OT4A 3C5ZA 3D39D 1G43A 3KE0A 5E8PB 1CE6A 3LRSA 5BOZG 3MREA 1EEZB 1KLUB 1KCWA 1OOAA 2FWUA 3EYSH 3QAZC 4QAMB 5IMMB 4W9JC 4DUXA 4LSSH 1L9TA 5AZEL 2OMXA 4S1QH 4AIZB 1QA9B 2DBJA 4MLIA 3WEXB 2IH1A 3Q9QA 4P5SA 3I2CH 1DP0A 3O9WD 3TT3L 2IADB 4UTAH 1ZT7A 5EU6B 1WBXA 2AEQL 4EZKA 4WNQA 2QQLL 2ZXBA 2AJSL 3WNMA 3NCBB 1DBBL 4KGLA 4WFFE 4XNBA 4AQ8A 3HG5A 3LD8C 5EF0A 5C09E 3GD1C 3NIDB 2FX7L 1OAKH 4KK5D 2MTAA 4ZAKB 4MNGE 5T1MA 4UOQA 1NUFA 5I18H 3L9RA 4H25A 2X2IA 4P2RB 4LMQE 3ISRA 1A9BB 1HCZA 1OWWA 5ACMA 1THAA 3QUML 2J8UA 4WK0B 1FGNL 1JGVL 5ALBL 5AYUH 4C56A 1SBSL 1A02N 3RFRA 4PPTA 2I7SA 4GOSA 3HBPA 3LVEA 2ADIA 4XMWA 1P6AB 1S8DB 3W0WA 1C5BH 3QDMB 4LARL 4WI5A 4IRZL 4BHUI 2VLKE 2FRGP 1D5RA 1DBML 2D3JA 2WK2A 2VKWA 2CLZB 4NQDD 1KN2H 1II4E 4XB7A 2YUWA 3H4HA 3ESOA 12E8L 2YS4A 3U25A 1KGJA 2VH5H 4KX7A 4N2AA 3HPJA 3WSQL 1EZUA 4O58H 4Q6YA 4FC3E 4R2GC 3TIEA 2N1TE 2AJZA 4FQQA 4DW2H 1CB4A 1P7HL 4TTDC 4NQDA 3VB8A 3LKSA 3QXTA 5EOQL 1C12A 1BIHA 3BZEA 5IUSA 5FF6A 4NX0A 1NIEA 3SE8H 2R15A 2RCSH 4R4FH 5CINL 1P4LB 4H8PA 5K9JH 2ZAGA 3I3DA 2H5UA 2O6DA 3BMVA 4LQ1A 3LY6A 1JGIA 3BQUA 5PCYA 1HZLA 1DR9A 3WLWC 1CDUA 1OD7A 4NUMA 1E9PB 4KV5E 4IRJB 4O58L 4W9ZA 4YO0B 1PLAA 1HNFA 4N8VB 3NRPA 4N9OB 4QI3A 4WI0A 1R5IB 4UQ3B 4UYPA 3FFDB 1HI6B 1V54B 4PY7B 1XIWB 1YN7A 2XICA 1OTSC 4QTIL 4FFTA 1AACA 4G8FA 1N5AB 5FUCE 4LLVA 5HGDB 5BOPA 1Q72L 3BSZL 1YUHB 1DEEB 3MRBA 4K71B 4ZTPL 3RUGE 1BD2B 4NAMA 5DZLA 2FJUB 1RJYA 4NLHA 1I9RL 1FVEB 3DJ9A 3QO0B 5EEUA 2IDSA 3RZCC 4FXLA 4PJBF 4F8TA 4G43A 1P7QA 2ZUQC 2OULB 5LBSL 1CXFA 2J4WH 2AJ3A 3C6SA 4FLQA 2PCXA 3IMWA 2IMNA 1AZCA 3CVIL 4XP9H 2VLLB 5FDYA 2VR9A 1QBLL 5DS1A 3CVHL 4MXQD 1UXWB 3W37A 2GC4C 4ONFH 1JXJA 2F53D 1ZANL 3X11B 1EXGA 1FFNB 3RIFK 3BZEB 1JK8A 3REVA 4NQSA 4Q6IA 5IGXH 4L5FL 5DURD 4NUJA 3ZE2B 2GJ6D 2YEQA 4KHXL 4KKCD 1Z32X 1XEDA 4XX5A 2Z8RA 3ZKSD 5GRZA 3U36B 1E9QA 4B9YA 1XSKA 3ZMRA 1DL7H 1YNLH 1C8QA 3H3KA 4JRYE 2NLJA 4XCYA 4AEHL 5C0JB 2Y23A 1IE4A 1S8DA 2VOTA 3GF8A 1KYFA 4RDQG 3WFDH 1M7DB 4K23L 5HHPA 3ZJAA 3MKKA 1ADQA 2VT0A 4FZEH 5DEZA 4ZTOL 4H26A 1CXHA 2O5XL 4D9RD 1HKFA 3VX1A 4W81A 3TURA 2VQ1A 4UB0H 3FU8A 1J5OH 4MJ5A 2VAAB 1R0AL 5EBLA 1AE6L 5J1SC 2F5BH 4IYKA 4NKOB 1ANUA 3GXMA 5CLXA 3VI3F 5JIMA 2EIMB 1TZIB 4PV1C 3M8OH 4HCFA 1KWGA 3CDYA 1IGIL 1P4LA 5EO0A 3IJ9A 3GBML 4F9PC 4PR5A 4WHDA 2QHRL 5I0YA 4RGND 3BAYA 2CHZA 3BC9A 3DRQB 3GI9L 4Z3IA 2F7PA 1IILE 5IG7A 5D2NC 2P44B 4MA7H 4MA1C 5IJVA 1RCYA 3PWPA 4YBQD 4Z23A 4PWEA 2WC7A 3MO1B 3KYOB 1MHHB 3V6ZA 3OXRB 5DQDL 1T5XA 3PV7A 1OAXH 1OGSA 4MQXD 4CN1A 2YGPA 3QQ4B 2CKBB 2JKXA 3EOAA 2QT6A 2V5YA 4Z7WF 4GIPD 1QWHA 4I77L 2CCLA 3TIDA 2WUCL 3DYPA 4DPRA 3MLPA 4LVOC 5C0AE 5EIQA 4FFYH 2AQSA 1A1MA 2BMKA 4GKNB 3W2DH 4HT1H 3T4AC 5C71A 4JRXB 5BMFL 3LNGA 3CU7A 5DC0A 3SPJA 3B2UD 3EJCA 3VE0A 1XGTB 1RD6A 4WSJA 2W1NA 3FFCB 4YE0A 2C3HA 4NQSB 5GS2H 5DUBB 4HIIB 1V10A 3TX4A 2G5BB 3MODL 2DM2A 5AOZA 1I3RA 4NRXA 1O6SB 1MCNA 4L4VD 3ZN6A 2BERA 1AYRA 1IEBA 4EN3D 5CLYA 3HMWH 5TE4H 2Q7YB 4P3DB 5D4HA 4P23B 3OB8A 3C09B 3K2UL 4KKQA 3L17A 1XGRA 1G6RH 4P0DA 4ZFOA 4Z5RA 4WJKB 2XTJE 4Z9KB 2WBXA 3K74B 3SE9L 1G6RL 1NIDA 1XF5B 4EI5D 4YHNB 1UQSB 3RTQC 4QIRA 4AEHH 4ZFFB 3PWLA 4CL7A 4HALA 1K3ZA 3HLAA 5AEAA 1ET8A 3LB6C 4K9EC 1T1XB 4UTAA 1K2DB 4W93A 2Y36L 2QGBA 1W72L 2XBTA 2FIKA 4HDIB 3WL9A 2DLHA 4WV1C 5CGYD 3VXUE 4HS3B 4X6FA 4JO4L 4L05A 5SV3A 3RI5F 2OQJA 3THMH 1VFAB 1DUZA 2IBGA 1V05A 1XF4B 2QELA 3QCTH 4PP2A 5CLTA 3VB9A 5LG1A 4AM0A 5ITBL 4D0CB 1IQWH 4IS6B 5D2NA 2BRQA 1CO1A 1Q0YH 1JTTA 3SQBA 1E50A 1PD6A 5ITFA 3LS5H 1G94A 3MZGB 4JJOA 4PJCE 4TLUA 3WD5H 2AJVL 3B9KD 2OW6A 4GIOA 4NKDB 5J5EA 2VW7A 3VWJD 4K9EL 1AGCB 3SDCC 3MRNB 1JZHA 1CFNA 1IIKA 2VUOA 3FN0L 2R2CA 4L4TE 4LLQB 4PGCB 2KL6A 3HAEA 3P11H 2BH0A 1F58L 5DEGB 3TIEB 3MRGB 4HA1A 5EIVA 3BAKA 1QBMH 1B2YA 4I3RL 1QI3A 1X5AA 1HVXA 1NUGA 2X10A 3MOBL 3O4LE 5DQDH 5FAAA 3U2SB 2FO4A 4PREB 1NGZA 3KPQB 3O41A 4M7JH 4PYGA 1J8HA 3P9MB 5F3HA 4X9IA 2VZ3A 3RY4A 4M6AA 1DEEA 4RFOH 1SM3H 4NZTH 5DRWA 2FAUA 2JKRM 2WWKO 2N0KA 3FT4A 3MNMA 4BDVB 1FH5L 3LXCA 5AB0A 3W39B 1F8TL 3SBRA 1TETH 5LGHH 3O2WL 1ET7A 4X7SL 2HH0L 1LP9A 2FEDD 1GGBL 1R5IA 4UQ3A 4WNJA 1YEEH 2MPAH 2R56H 1QQDA 1A6UL 4PW3A 4L9LA 4FQ2H 1UA7A 4UZSA 5FWQA 2H26B 4CDHA 4Z1PA 3EG9A 1ML0A 4M61B 3RTQD 4W9GC 4B6ZA 1HH6A 1C5CL 4XO8A 3MV8D 5DTFB 4UT9H 4UNIA 2X44D 3KBHE 4KY1H 3NFSH 3LN4A 1L9MA 1TIUA 2X1XR 2IDQA 4JN1L 1DQTA 2YPVA 2VM9A 1M3IA 3POHA 4Y9EA 1ZVHA 4KKBC 4Z5RB 1OB1B 5HD8C 1OWRM 1TPXB 1WZMA 4ZFZA 1DO6A 2BNUA 2NXYC 5MENB 3VU2A 2W38A 5I1DB 2EE2A 4ZS6C 5DEGA 4F5CA 4MAUL 3NCFB 4I0PB 2NT0A 2IH9A 3GMLB 3ERXA 4ZQKA 1BEYH 3QIWB 1MRDL 1XR9A 4BKTC 4HIQA 2E46A 4KWUA 2LTQB 3T8VA 5KSAA 3QUGA 1RZPA 4QYOB 3RGVC 4PLOB 2XA8L 3L3OA 32C2A 2B59B 2XIIA 1DVFA 1K8DB 2W9DH 2F61A 3X13A 1TZ8A 1I4FA 2ZXWB 3FFOA 1LDPH 2UWEA 1XF4A 4KI5E 5ABZA 2ZP8A 3FCTA 1JCKA 1TITA 1MW2A 1IKFH 5E9DB 3UAEA 5D2NB 5H4YA 4NC2B 1Z5LA 3WY2A 1MW1A 2ZJSL 3PUCA 1F4HA 3PY9A 3PPSA 1FVDA 2PPCA 5TDNA 3NABH 3QB7C 3LKQB 5TH2B 1LD9B 4JBSA 3X3GH 4W9LC 1MJUH 2ADFL 1I7RB 2VC2H 3I6SA 2ZYSA 3GSNH 4EVNA 2OMVB 3QQNA 2ZCHH 1F4XL 3FAWA 4RX4D 1CFQB 1URIA 2C3XA 3VFVB 5IB1B 3PHQA 1E0OB 4PRBA 1GKEA 4MS6A 2EYSA 5KAQF 4UF7C 4HEME 5F0JB 3EZJB 3BCFA 4JLRB 1F2QA 1DFBL 2X4SB 3KPQA 5I6NA 4W9IC 4WW2F 4GKSA 3QISA 4R4BA 3T0XA 4CU8A 5SWSA 4QNPF 5DD1H 4RQQA 1D5MA 1N9PA 1OAUL 4R26L 5SX4I 1CD1A 4Y19D 2BSRA 3V5DB 5E56A 5D7EA 1MFEH 2DD8H 1Q9KA 4Z77B 3CLEH 1PZSA 2JE8A 5DHVA 5C2BH 2ZCLH 3ZHLA 1QTSA 3LKOA 5JHDD 1JWUA 1LWHA 5LCVH 4OUUB 4Y4KA 1QAWA 4PWIA 1JTPA 4JRXA 4ANVA 1QACA 1M4KA 4HJUA 3WJLA 3ILQC 5LJYH 5EEWA 3FTZA 2AK4A 5ADPL 1SJEB 3CHRA 5DJXA 4Y1AD 5D2LE 3FCTB 1ZGLM 3TN0C 1RZGB 4IBZA 5D5MB 2IO5A 4KQ0A 2YAMA 4JKLA 4N2HA 3VD7A 2C9SA 4YDKL 4JG9A 4WUUE 1PDKB 1FZKB 1OP4A 4QF1B 1VACB 4PJEB 5C0EB 4WO0A 4MJ2A 2IADA 3POCA 1JHTA 2GHZA 4A7VA 3QHFH 3OX8A 2PCFB 2JCCB 5AYTA 5ISZD 3QHFL 5BV7C 3VXSB 4A38A 5SV4A 1UXSB 1I3VA 1WT5A 5BO1H 1IC7L 5C0FA 4TUKL 5D1XC 1NANH 1NLBH 3DMMB 1J1PL 3O3BA 4NZRL 1LK2A 2NDFA 1PQZB 3BEWA 4AZUA 1HT6A 2BFVH 2HT3D 3LPOA 4N0RA 2IANE 3FU5A 4UOW1 1A0QL 4R9HA 4ODWA 3ULVF 1V3LA 4YPGA 5A43C 2VNCA 5AG9A 4W68A 3RWGA 4GBXD 5ABAA 3UROR 4XMUA 2YC1B 3HNTH 4N26A 3JTTA 2R1YB 3TO4C 4AM0B 4LEOB 4JVWA 4RMVA 3LKNA 4G9DA 4AZ8B 2VW6A 1MRFL 4XXCC 2HCZX 2J6EL 5HHQB 4MAYC 4R96A 2WXRA 1U58A 3FXIC 1IAIL 2PO6B 3JQOB 5B39G 2E7LA 2RAMA 2CLZA 4B3VA 4UBDC 2XHNA 3MUHL 5BQDA 4G9FA 4NNXA 5IJCC 1NICA 3S37X 1T1XA 1QD0A 1YYLL 2WAQA 4NT6A 3C08L 3OJ2C 1QPKA 3WNPA 1CQYA 5GRWA 3G6DH 1RIUH 3O0LA 5J7CC 2ATKB 1IGTB 1U21A 5E94A 1BXVA 2Q3ZA 3BGFC 1PLGH 4NO3A 5LAXB 3O2DL 1RPQA 1MCBA 1P2CB 4CVXA 2WZ5A 4B9FA 2ZXDA 5KSBF 1HAUA 2NY6D 5IVNA 3NDYE 4R26H 1MCWM 2YAEA 2LU3A 4LPUA 1JV5B 3DPBB 4J1UA 5FCSH 5GRUH 2OMWB 3IDMB 3B5HA 35C8H 3PABA 4LLDA 3FO9B 3ZVVA 2VM4A 3ZKMC 1H0DA 3QSKB 3NIFE 3D87B 5EZPA 3TBVB 2DKUA 1GIGH 3WN6A 1QYGL 1KBGH 1YN7B 5IB3B 3X1EA 5C0DB 1WEJL 3M1BB 2HG5A 1RZGA 5EA0L 4R7LA 4X6BB 2ZIDA 4PVLA 2I69A 5EH1A 5E2UL 4KJWC 1W91A 3FT4B 1NKOA 2GTZA 1A1NA 3TPKA 4BELD 1J1OL 4TKWA 5A2KH 5BV7L 4TPRH 1R33A 1OARL 2ZOKB 5HXMA 4GSUA 5AAPA 2YEZB 1HX0A 4I5BA 2NY3D 2X7LB 3QDJB 2A6DB 4JPWL 4DZBA 1TCRB 4LRIC 3IJEB 3KPOB 3L4XA 5TF1L 4XP5H 5F7EL 1DVUA 2Y2WA 3ESVF 4TVPE 3O11A 1P2CA 2SEBA 1F97A 2AXJA 5DEFB 3ZL1A 1XCTA 5EU7C 4KPHL 2EUZA 5HJDA 4IJ3C 2W65A 3L1OH 3UCQA 2Z92B 4OT1H 2BX5A 2X40A 4H0HB 1U8HA 2D7NA 1OGAB 1SBBA 1WWWX 4YDMA 1MCOH 2FJSA 3QFJA 4JCLA 3N5AA 3FQXB 3RNQA 4YSDA 5BS0E 5HYJD 3KVQA 3NZUA 4GMTL 4AH2A 2NTFA 4GO6B 2F5AL 3WJJA 3ZYIA 3GXFA 5J6GA 2WKGA 2ZPKL 4PJGA 4ZTPH 1BBJA 2OYPA 4U6HB 1KBGL 3KEDA 4MAYD 2CO3A 2BWQA 4A66A 3KLKA 3GEWB 4MJ5B 3HRPA 4BE6A 5HHOB 1ZEAH 2IANB 4M6NH 4OQTA 4XX1E 4XVJL 1XCXA 2F8VA 4ELKA 3ZSSA 2NX5E 2HRPL 4TNVK 1SJHA 2WQXA 2C5DC 2OXHA 3FZUC 4RQQB 4X5XA 1C1EL 5KSUB 5EIIG 4ZMXA 3GMLA 3UTTB 1LQBC 4WQOA 4XN9A 2UXGA 1AGBB 4ZAKA 3AG2B 2UV3A 2ZICA 2Y9RT 1UKTA 1YEJH 3BISA 4OKVA 3L48A 2BOCB 3ECBA 2NZIA 4H7VA 4PJIE 4Y19B 2JB5L 5CMAB 4OM0H 2WOBA 3HE7A 4GSRA 3H9SE 4ZAKD 1DHKA 4HKXA 4X8JA 2J20A 2MIZA 3GC3A 2BZ7A 2R1XA 3IDUA 1I1AD 3F7YB 1T21B 2WMPB 3NJXA 1U8MB 3NIDF 4KI5D 4MBOA 2XV0A 3OKKB 3CSTA 3KPMA 3EZ8A 1AC0A 3PP3H 3O8XD 3ZE1B 2VITB 1TQSA 4MCMA 2NSMA 2P5EA 5FO9A 5J0BA 5C3TA 3BH9A 3WYRA 4Q9RL 4G82A 1FL5A 2JLPA 3OKMA 3O6KH 2P45B 4KJQD 3DUSB 2JIXB 4J28A 3GS7A 1JDCA 3OBAA 3E8VA 1TR7A 5SX4H 3E6HA 4AVKA 4U3SB 4M7ZB 1DBKL 1KTLB 4UM9B 1OP3K 2APXA 2BHYA 2MHAB 1H6TA 2ITFA 1G4RA 1AGEA 2F7OA 2OZ4A 1DZ0A 2L0DA 3D0LB 3BAEL 1U95B 4HHWA 3FRUA 4Y19E 5JIQA 3O6LL 3IDNB 2Q7YA 2KBGA 4J27A 4QF1A 4FHKA 3CXDL 4N2FA 1AZNA 5I74C 2WWOA 4I48A 4YAQB 4Q2ZB 1IFHL 3TA4D 4ZMVA 4X42A 5HVHB 3V7AE 2WZAA 2VUKA 2R8SL 3HUJF 3SGJA 1LQSR 4DGWC 4LPYA 3FCSA 3G6AA 3QXDB 3SQBB 3IMTA 2FQEA 4PJCF 4NWUH 4QHMA 4Z3GA 6CGTA 3IJSA 4FFYL 4L1BA 1F6LL 4YGAB 4AK1A 5LDUA 4F7CB 1KIQA 2OSYA 1QEWA 4E0RB 4LCCA 4XMTA 2FEEI 3B83A 2AJYL 5I1EL 3CJJA 1SEQL 2ENQA 3IPEA 5DJ2B 2VDQL 1P4BL 3SGDH 4OD2A 4F9LA 2XKUA 2AQ3A 4LVNC 2FIKB 2E8YA 4MJJA 4DVBB 3TFBA 1TVBB 5J11C 1UWXH 2JJTC 2W81C 3VCLA 1FN4A 5TD4A 3WTUA 1GYUA 1P53A 3D39B 3WE6A 3JV5A 5FFLA 3KLAB 4HUNB 3IMRA 1KTJA 2LVEA 3BPNB 4JO2L 4U2ZA 5MENE 2BC4B 1P9MC 2XWDA 4TULL 3RWJA 5F9JA 4JPIB 1OAXL 4MMZB 1QKZH 1CFSA 2J7LA 1YEHL 4WW2A 4OF6A 4EI5A 4AG4L 4EUPG 1WLHA 4G1EB 4DGUA 5JQ6H 5GSRB 3O3AB 3IVKB 4XMLL 2VDKH 2N7AA 4Y16D 3M1CA 4FFVD 1BHGA 4UNTA 5AG8A 2W0LA 3EW3B 3SE4C 2FGWH 3K1DA 3LHAA 1NOLA 3U1SL 4A7GA 1PKOA 4WO4A 2PNDA 1HXMA 3ZKXB 4FNQA 3IDGB 2I25N 4Y89A 4Z3JA 2V7HB 1U2YA 1SDDA 2R29A 3SOBH 3QWOA 3JZYA 2N56A 4XCFH 3EH3B 4KRPB 4PCSA 3TBCA 2Y6SD 4KI1A 3PU7A 5EBLB 4RFNC 5KSBE 3Q8EA 5T3XH 5JOPD 2G3NA 5JPMA 1QQDB 3GXPA 4ZPVA 1JNNH 1FL6B 1HQRA 2RQEA 3IN0A 3MV9B 4MCZB 3W11C 1RJLB 2WNKA 1D5XA 1KTLA 4I18C 5D7KE 5K93A 4KO9A 3RBSA 4AYGA 1AS7A 4NI6A 3GHEH 4KK6C 3KGRA 4IK7A 4ZX6A 5LKNA 3HAEH 4O02A 4J23A 1S7XB 2OTWB 3HI5L 3SDAC 3GMNB 1A9BA 5CAYB 4M29A 3QORB 3RGVB 1GYVA 5HJ3B 2WXIA 3QCVH 4G6AC 3DXAB 4QHLA 2QTVA 43C9A 1RHFA 3NG5A 1DVZA 1U8OB 3JYBA 1I7TB 2BVTA 4P9ML 2GT9A 4QHKI 3VGEA 2IQ9L 2H4EA 1R46A 1TTRA 4AGPA 3TJEL 3SQOL 3VWJC 1SF5A 1ZVYA 3IDYB 5EU5B 1XR9B 3TA3A 1JPSH 4GW4B 5E7FA 5IOPA 4U6VH 2F54E 1MIMH 4M7ZC 3SZ6A 3TEXA 4BFIB 2OL3H 1GGBH 2EDDA 3CMOH 1NGXB 5K5YA 1RJYB 1TETL 4TMPA 2K9UA 1PCXA 4WGVB 5LGHL 1U8NA 1AKJA 2V9QA 1P7QB 2GIYA 3QUYC 3W1ZA 2X41A 1LP9F 1HYSC 3QPKA 5C97A 2YKLH 3TP4A 2YMOA 1AMXA 4LBAA 1QSEA 4YL4A 5I6LA 2BDNL 4MMXB 4PJBA 2HJLA 5C07A 3MOBH 3ARSA 3QG7H 4YEEA 3TN0A 4PJFB 2CQVA 3BHBB 4U6HA 3VWKD 4JG1L 1CTOA 2ORBL 4KRNA 4ZFOL 2RH0A 3KS0H 2X4OA 2E7LC 2AS5M 3KYKH 3ZT5A 5E00A 3U0TB 2AXFB 2ZOWA 5LNGA 1EAJA 1J10A 4JQXC 5HVWA 2B4CC 2NXZD 3MNVA 2FH8A 3OJVC 4X8JB 3QA3A 3RX8A 2AK4B 4WY7L 2YJLA 4HZLB 3WTVA 1SNRA 1M71B 1GZPA 1I7TA 3CFDA 3MJ9L 3MLWH 4P23D 3SB3A 2OYMA 2AERT 2NTFB 3C09C 3EO0B 3MJ8A 4MTMA 3W9EB 2WTRB 3HC0A 3AG1B 3DWTA 3ZRSA 1PL3A 1UVQA 3LKOB 2PXYA 2X70A 3FDWA 4FLRA 4H2CA 2YPLA 4DP7X 2BOCA 2N01B 2B0SH 1IBYA 4UMSA 4YSEA 1RV6X 2C9QA 5IHZA 3ZZSA 1VADB 2JKLA 3N41B 3O2DA 4XN7A 4MJ6B 3F00A 4WHYG 3MOAL 2WTPA 3BKCH 4WKXA 3U83A 3U30B 5A7BA 5BXFA 2NR6D 2H7WA 1XGZA 1O7DE 5ID0A 1S9XB 4W9CC 4OZIA 1P7QD 2QLVB 1UGNA 4JQIA 5HI3D 4LHUB 2RFXA 1TZGL 3BQUC 2HJLB 2ZQKA 3U2JA 4OCSL 1JL8A 4FFWC 3U48A 4U6XA 4Y5VB 2DQFB 1KJ2L 1JGLL 3VFRB 5CHNB 1G1OA 5KYWA 3T4YB 1R3HA 5ESAA 1KXQE 2J5LC 3H0TB 3O6FA 3QJHB 4AENB 5I0ZA 1DVFC 3DROA 1VFBA 3KMDA 1HQ4A 3IPBA 1YEFH 4MD5A 5HJGA 4BBWA 1JF1B 1GAFH 1I1CA 2ESVA 2VRKA 1GZHA 3CSGA 3DBSA 3BWUC 4Y16B 3PG2A 3PDGA 4G80B 3TA3B 3A6CH 3I9GL 3F7YA 5BZZA 2Y7SA 1OHQA 4CSSA 4POUB 5FW7A 1JERA 3FO0L 5KVEL 1ZXKA 3QCVL 3HR6A 1M71A 1C16B 3IGKA 3DTDA 4LOUC 3SDCD 4Y4HB 3B2XA 7TAAA 5ADPH 1MFAL 3PAVA 4L9LC 4F2EA 1H6EA 1NCWH 2EABA 3BESR 4JKNA 1T5WA 1BFTA 2OMUA 3IDNA 4ZK8A 1HU8A 3T1FA 5BS0B 3E7JA 1ADQH 3Q44A 2ED7A 2CUAA 3KHQA 5E8NB 5I5MA 1DQDH 3UEZA 1QWUA 4OZFH 3HRZB 3MV9D 1DBAL 2DIJA 5T33H 3AXLA 3OMAB 4ENZA 1JHLH 2J8OA 5IHUH 5TPWH 3LB6D 1LO4H 4JY6A 4MNGB 3WEAA 3E80A 5ESQA 3RZWA 3LPGA 1RZIA 3VGAC 3QAQA 1FORL 4JY5L 4LL1A 3IDIA 3BYYA 4F57L 4PV8A 1ZLUK 4ZG1A 1YYCA 4GAFB 4DVBA 1XF3B 1HE7A 2WV3A 5HYSB 2R29L 4L23A 3K8MA 1UWEL 1ZCRA 2XG4B 4KZCA 1CXEA 1VPOH 5GGSY 5T1KD 2DJUA 3LVTA 3ZY7A 3UAFA 5B7MA 4ZS7H 3S35L 4ZD3H 2WTRA 2J1YA 5BRQA 1HZKA 3TIDB 4H8WH 1NJ9B 4JN2A 2HFFA 1TXKA 2CD0A 2X6CA 4MXWH 1HXMB 4JCWA 3QJOA 4YZWA 4A6YB 4B9CA 1I1AC 4S0TD 2FX9H 4I88A 4F27A 1IE5A 1ZHNB 1A7PH 1AZVA 1TQCB 3PABB 5FFOA 5HI3C 3RIFF 1NBZB 1G7HA 1AHKA 1NEPA 3TV3H 2XZAL 5E5MA 2QJDA 4PJCA 5I1CH 4JRWA 1ZVSB 5HYIA 1G7JA 3GTVA 2JI1A 5B1JA 4YE4H 1F02I 4LVHB 5D1QC 5E9DA 3RIKA 5IJBC 1OO2A 3KM1A 1BVKB 2HFGL 4XBPA 4AITA 4ZMLA 4ZOCA 2QL1A 2E6QA 3EAKA 5K9KB 5A2FA 3R1GH 3H85A 5J13C 4Q0XL 2KZKA 2VDLH 2FJHA 4KFZC 4LIQH 4PGZA 4NRYB 1MVUA 3PNRB 1N10A 4IOSD 5EU7E 4BUHA 5INCA 3WS6C 5T3ZH 1RK0B 2DQTL 4UTBL 4TUJA 4WTXA 4JN1H 4Y5VC 1MJ8L 4HUMB 2K4WA 2VLMD 3FFDA 4OFYA 4BSWA 4F58L 4X4YA 5IM7B 4KX8A 4L8CA 4MKMA 3D5OF 3L8QA 4FKEA 3FQTB 2EZ0D 4JM2B 1HINL 1YNKL 4YBQC 2I9TA 3RJOA 4PJDA 3APCA 5DC2A 1A5FL 4G5ZL 5F7MC 4ELMA 2VGLM 3K7UA 1Q38A 4HMEA 2DICA 4EN3C 4G6FD 3C6LA 1U8HB 1R3LB 2E27H 1LE9A 3K6DA 4NBYB 1MLCB 2DEXX 3FN3A 4BKLA 4DZ8B 2ZX5A 3S48A 3NCYS 4D0DA 5I1LB 3T1WA 3HI1A 1T89C 1OGTA 5TTRA 1I7UB 1UFUA 4QTIH 5A2IH 3L3GB 1QZNA 1J0YA 3LIUA 5F1KC 5D7KD 1WAPA 4M5YH 1D7BA 3IAGC 4WI0B 3EH5B 3QUHA 1P7BA 2YZ8A 3IDXL 5B22A 1VCBC 1S5HA 3BSGA 5MEPA 3C60C 1T1ZB 4FQXA 4G7VH 4GXUN 1FFRA 3CDGA 4PJIA 2DRUA 5EDSA 1U41A 2FO4B 4Z7UA 4AKPA 5CCGE 3K6NA 3GIZL 3GGWB 3G08A 1KJMA 5L7XH 1I1FB 2RD0A 3F01A 5BOJA 2Y5TB 4MJID 2V5MA 4GXVH 1MCOL 3H7BB 4LRNL 4NENA 1RY7B 3KEHA 2E5EA 1GCFA 3KPSD 5DK0B 2I9TB 1YEJL 5B39B 1OP5K 1I8LC 4P5MA 4BFJA 1UEYA 4L0ZA 5L7XL 3NESA 4P2OD 4XMVA 1LVEA 4K94C 4Y19A 1IGFH 3U0TA 4QYOA 5E1IA 2APBA 2BCMA 3OWRA 3LZNA 4DTGL 4I8DA 4KMLB 4HLEA 2XFXB 2HXAA 3RU8L 3SKJL 2EVFA 4FG4A 4HKJB 1MAMH 3NQKA 3IBOA 3TU6A 4YSUA 3KYAA 2QVFB 3QIBD 1BG1A 4JFEA 1TFHA 1ET5A 4GRLA 3LN4B 4JPSA 3IJYA 4QRUB 4F8QA 2VN4A 4FNRA 5HHXL 5KVDH 4PJHA 2VR4A 4YHOH 3LNIA 3OV6A 4WW2C 3ZLQC 3ZTNH 4EI5C 4CVZA 4JKPH 4K0OA 3V0GA 4EAEA 1XH3A 2P24A 3PWPB 1G0DA 4XNXL 2PN5A 1N4XH 5EOCL 1XB8A 4FXKB 4J6RH 3JV0A 1OCOB 3C6EA 5I8CB 2IV8A 1BWWA 2NPLX 3SGDI 1R17A 3MLUL 4GSXA 2IWFA 1XGYH 5CFHA 2VLJA 2MCPH 1LWRA 2EDFA 2QVIA 4LKXA 3MOQA 2HRGA 4B53A 2XQBH 1UOWA 4PM1A 3UZVB 3PP4L 4W1TA 2H2SC 3GK8L 3RWDA 3MLVL 2YAQA 4JFPA 4AENA 2GAZB 3GMQA 3INOA 1TJGH 4K7PL 2CBQA 4Z7OF 5EOTB 4AEEA 3L5JA 1SY6A 1X5FA 3PJLA 2H6OA 4WEUD 3O2DH 2NYZA 2C3WA 2OV0A 2Z35B 4FNPA 2UY6B 5TK2A 5CN1A 3KNBA 2YPKA 1EMTH 4K55A 2OSWA 5IFJA 2Q1EA 4DOHE 2ZP9A 5HI5D 1T1WA 2ZXAA 3FQYA 5F9JB 4ZO8A 4ZZFA 2O4EA 1OZUA 3EJPA 3PHQB 4WF7A 1OP3H 1G1YA 4Z8FL 3O81A 2NY1D 3LNFA 4XWGL 3T0VA 2OP4L 2ERJB 3H1ZA 4YSQA 1TYRA 2FJFA 4RCAA 3CD4A 2K7PA 2XWEA 4F8PA 4JZNB 1IL1B 4MVBC 3N44F 1AQKH 2A2QT 2N3JA 4XN2A 2DYPB 1ED3A 3GIVA 4LU5H 2DDQH 4XVTL 2VXTL 4C4KO 3KYNA 1LMIA 5HDOA 2F7RA 4R7DB 1PS3A 3GSUA 4Z7VE 4J2XA 1ZPUA 3CNKA 3RPIA 5IP4A 3S3PA 3PWLB 4ONHA 3CXFA 2X87A 5LB1A 1D6VL 3D2UB 3LEYL 2Z64C 3DMMA 3V0VB 4NHUB 1PQZA 3V0DA 2FJGB 3K5SA 1FL6A 1H3PH 1U8IA 4OH2A 4RGNB 7FABL 4ANXA 4N25A 3AUVA 3PL6D 2PW1A 3RWEA 1KIPA 2VLRB 2P4AB 2UXTA 4WU7A 4JFEB 3Q43A 3TCLA 5ILTH 1GYAA 4Y2DC 2AV1A 3EJQA 1IEBB 1PX4A 4O2CA 5DJAA 2G3XA 4H8VA 1MIEH 1NMAL 2MCG1 2LTQC 1XGPB 4QKTA 3CX2A 4ZNEA 2HLAB 1ORQA 1NA8A 3UC2A 5DU7A 4LLQA 2P5EE 4N2CA 1NGPL 4QXWA 1SVCP 3QNYB 3QIBB 2RALA 2QADD 1S7QA 2PPFA 5I1IL 3NK4A 4X80L 3O6FC 4L3CA 3RWFB 2V2XA 3IMUA 2CJUH 4BK5A 3S36L 4TVSa 1R3KB 2EH7L 2RGSA 3AQYA 1PLCA 1M2OA 4CVUA 5EORH 2DW5A 3U7WH 5LLIC 2GBTA 2WM0A 2E6PA 4U1JA 2J3SA 2RACA 5IMOB 5E6SB 1QPPA 2VXQL 3QS2A 3HMXH 4AUJA 1A6WH 1VJSA 1CI3M 1HYRC 2QKSA 3B4NA 5DFVD 1EWHA 4KK6D 3HB3B 4PWGA 4MJIB 1MDAA 2C7UB 3NJVA 2H32B 4AY0A 2BP0B 1JPTH 3B9VA 3HNVH 3MCG1 4N20A 4LMQI 4JMXA 1KLGB 5J56B 5D7JC 5C70A 4XO3A 3VFGH 3TN0B 3L5IA 4Z7OE 1KLUA 1NFKA 3AT0A 2D4FA 4HPOH 5ICXA 4LFHG 2JJUA 3VH8G 4RDBA 4MAYA 1X5YA 3HW7A 2LU4A 4OM1L 3H3PH 1SOKA 1EBPA 2H1PH 1IGTA 4JHAH 2X88A 3WTWA 3ATBA 4NEHB 4I9XA 4Z7WA 2HTLC 1BYNA 3HOGA 2B3RA 3C5XA 2JIXA 1P7KB 3K2IA 4BH7A 3NQIA 4PP1C 5GS0D 2DDQL 4XVTH 2HFEA 3QDMD 4RMWA 3Q5YA 2K9FB 1K72A 1I1FA 1PD0A 4ODHL 4UDTA 5I6KA 3NSYA 4W4NA 3HUJA 2VLME 3RPIB 4FTVE 4KK9D 1U3HB 5FOJA 3FO1B 4APQA 5FX3A 1GHFH 3AWGA 3GXDA 3FCGA 2XA8H 4MMZC 3O4OC 5LWYL 3HS0B 5EUOB 5FYLD 4G1MA 2LAGB 1RFDL 3QQXA 5GIRB 3DK2A 1SJXA 5L2KA 5ANMA 3MCLL 1NFIA 4M6ML 4L3EA 4MCYA 5HI4D 3X13B 2FK9A 1UD8A 3DURA 1IJ9A 4HISA 4ZTOH 1VEPA 3STZB 2DL9A 2W8CA 5IFAH 5D5MF 3QFJB 2WY3B 2NCEA 3M88A 2OLDA 1FNEB 4K7PY 3LV3A 4HWBH 4TXVB 1U8QB 4J3VA 4BRVA 4UV7L 5TQ2L 2WVSA 2C1OA 4X98A 1YAIA 1KLGA 2R4RH 3IAPA 1IV8A 1YNLL 4KJWD 3RY6A 3TT1L 3WIIL 4Y5VA 2BDNH 3DBXB 5JLZB 2V8LA 3GSNL 3HE6A 1AHWC 3L5WB 2NNAA 4QUOA 2YKLL 3ZL4L 3JUYA 3V6FA 1T22A 4HWBL 5IB1A 1CFMA 1NCWL 4P46D 4PRBB 3RDTD 5D1ZI 4F7MA 3V4PL 1JF1A 5E0FA 1YNTB 5DMIH 2Z7YA 3KWWA 1X7QB 5IFAL 2Y07L 2OL3L 1E8ZA 1KCKA 4M03A 3QDGE 3VFWB 1J5CA 3HFMH 5GZOA 1PW3A 2D4DA 2N4IA 2VLKB 3BQUB 3EJYC 3V4PH 4IQHA 1MWAA 3FTUA 3OAUL 1YG9A 4U1IA 4PJ6A 3T4YA 5CU5A 3R19A 4D9LL 4NLAA 4UT6H 5IHWA 5CKAA 2NW2B 4FULA 2Q20A 2FZ3B 2H3NB 4ABVA 3MUGA 4XXCA 5EFIA 4PIBA 1WO2A 5DD0H 3EYQC 2OSXA 1FNLA 5CN3A 1ERNA 3C6LC 5T1LA 3VG0H 3AM8A 3US0A 4QRBA 1ZS2A 3BRFA 4R5TA 5AALA 3WY4A 1J5DA 1EO7A 3BUPA 5D2LA 1CURA 3OGOE 3D4CA 4BWWA 1AANA 4X98B 2AXGA 2DI9A 2A6IA 1R24A 1FFPA 1AP2B 2V5SA 2X9XA 3FH5A 4IKIA 3KPTA 4U1KB 3WTSA 4NQXA 1WQVT 4B3EA 4KITB 3STBA 5JW5A 1SEQH 3IYLW 1MFDH 4HAGA 5HI4C 2BPBA 3FN0H 5E1AB 3QI9C 4GNKB 5JHDB 2WN2A 3EGXA 4GAGH 4LVEA 3TWCL 3PGFH 3OLGA 1DBJL 1XHHA 2H0EA 3TEWA 1MWOA 5HVHC 5IT2L 3O45A 4TSBH 1NINA 1A7BA 1YCSA 3AACA 2FSDA 5EU4B 3MRRA 3N04A 5IBLC 3QQ3A 4XCEB 2QLYA 1MPAH 4PH8A 5E6UB 3R06B 1CJYA 1LYQA 3JV4A 4FGMA 2ZG3A 3OAYH 1TTFA 1ZLEA 3CX5J 4NZ8A 5D7SL 1BVNP 1NBVL 5DVLA 1WCBA 2QQQA 5CGTA 2PR4H 4OQTH 5CP3H 1ZAGA 4J8RA 4G8IB 1SVZA 4X5LA 3QNFA 3C8HA 3BUBA 2X38A 5LXVA 3HE6B 1BQHG 3IMVA 4GRMA 1FF5A 2WVVB 1MCCA 2J2ZA 2DLFH 3RNKA 1IQDB 4HEPA 3FU7B 3TN0D 3VXOB 4M02A 3GM8A 5KYNA 1Q0YL 4KUZL 3ILEA 1AXTH 1N0LB 2RBLA 3SOBL 1MUJA 5K9QG 5IEHA 5M7QA 5LAXA 2MFNA 1MFBH 4GT0A 2A0LD 4LSQH 2H41A 2A99A 3WMSA 4UT9A 4UTBH 2YWYA 3FQRB 3COOA 3NCCB 1RJCA 3LXBA 1F1GA 2CPUA 3EBIA 1JAEA 1M7IA 6FABL 1BZ9B 3LPFA 2O1AA 1S9WB 5MEQA 1LE5B 4HUWB 3SE3A 1U8KB 4DP1X 3BKML 4HWZB 3TYGL 4A2EA 4A63A 1MREH 4OJDH 5SWSE 1INQA 4NUGH 4M43L 4XTRC 2CK0H 3ARBD 4A2GA 1F3JA 4ANWA 1QEXA 5JW3H 4OLEA 3LRHA 4AQEB 3DX7A 4XOBA 3MV8B 1GC1L 2D31A 3LD8B 4JE0A 1KGIA 3G5WA 3MJGX 5ICXB 5IR1A 4D3CH 4ZXBB 3VWKB 2ZNXA 1PG7X 4PJ8C 4FQJL 4GY4A 4K3HA 3IETB 2WVVA 5JHLL 1ZLUH 4LCCC 2YOAA 1Q1JH 3O4OB 4WKZB 4WNQB 1EJOL 3JWNE 3K81A 5FGBC