1GYUA

Gamma-adaptin appendage domain from clathrin adaptor ap1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
120
structure length
120
Chain Sequence
MIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
publication title Gamma-Adaptin Appendage Domain. Structure and Binding Site for Eps15 and Gamma-Synergin
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1gyuA00
1KYFA 2DWXA 2VJ0A 1GYUA 3MNMA 1NA8A 1IU1A 1KY6A 1KY7A 1GYWA 1KYDA 2DWYA 1B9KA 3ZHFA 1P4UA 2E9GA 4BCXA 5CN2A 5CN1A 3HS8A 3ZY7A 1GYVA 2YMTA 1QTPA 1W80A 2A7BA 1OM9A 1KYUA 1QTSA
chains in the Genus database with same CATH superfamily
1S9WA 4WFEE 4OGZA 4RZCA 3G6JB 1G9HA 1LEGA 4P2QA 2BM3A 4DEUA 5IHHA 3LN4A 4BINA 2F7OA 1T22A 3TS8A 4Q14A 5DCCA 2RR3A 4I2XB 1WEJH 1ZLUK 3KVQA 1ANUA 1MREL 1ZHLA 4XX5A 3SQBA 2ZOKA 3HE6A 3VXSD 4RGND 3MLUH 1HAWA 1S2EA 4UIMA 2ARJQ 4UQ2A 5DK2A 3V0WL 5CCJA 5ID1B 2P46B 1A6VL 1FBIL 2DTML 1BAWA 5JW5A 1NGWA 2K6WA 4GPVA 3LZNA 2HRPH 3B2UD 5GZOC 3LTVA 3L95B 1DUYB 2VXTH 1R24B 1BVOA 3TVMD 1F02I 1WWWX 4DQOL 3HKFA 3D18A 2NYYC 1Q72L 2JTYA 4N25A 5EULV 3ZL4H 3IJ7A 2XTSA 3Q1SL 4JZNA 1OB0A 2DYPD 4XNBA 1COBA 4LAQL 4ZSOB 3T09A 2OXGA 3EO9H 3ISRA 4YXLH 2YEQA 3AG4B 4OIIL 3O11B 2DY2A 4PRHE 1H3PH 1W80A 1GXEA 3LKOB 3V4UH 3WS3A 4HWEH 1JZEA 4G80B 5I6LA 3AQYA 4G8IB 2X6BA 4ODBD 3ZO0A 1E4KA 2IH1A 1NGZA 5D4IA 3W56A 1F86A 2QADB 1LMKA 1IAKB 3W0WB 4HETA 4HD5A 3NZHH 4LFHG 4FLOA 5D7KE 3L3OA 1GGIL 5GSVB 5A40E 3UC0H 1YYLH 3O3UN 4PJAB 3U6XA 1JZ6A 5AW2B 1JFHA 4F15C 3IU4H 1BM3L 3N42B 4KDVA 1LK3H 2V3DA 5IW3A 4BEIA 2E27H 3HS0C 5FXCH 3WKMH 2RTTA 1D7CA 2N1TE 4HW6A 5DQJA 1DYZA 1R5VB 2NY7L 3OG6B 1UOVA 1BVNP 4J3TA 4WW1A 4XCCL 1FYTE 1SYVA 1FH2A 3PHQB 4KH9A 5I16B 4UB0L 2EILB 3QJTB 1CL7L 4M4PA 4U33A 5DSCA 2VXUL 3ULVD 2G3XA 3QORA 4E9SA 5DTFB 7FABH 2XWJB 2R23B 3LEYL 4ALAH 5CR8A 3H3PH 2A38A 3P3RA 4JUTA 3C8KB 4HXBH 4Z76B 1A7RH 3RLSA 4L4TB 4QTHB 1NLBH 2NNXA 5ANHA 4GLRI 4TKWA 4WFGD 3SDCD 2OMNA 3S36X 4X6DE 1OTTC 3GINA 3QCTH 1AD0B 4O5LL 2C4XA 4OLWH 1YMHA 1QI4A 3UMNA 1R5WB 3SGDI 4PJIB 1WVZA 1XIWD 4ZO7A 3OR6A 4N5EC 1DO5A 3TCXA 1AANA 4NZRH 2FT7A 4M8UA 1CBVL 4Z7QE 5F3BB 2GK0B 2IADB 2VLRD 4PTTA 2DWDB 1B9KA 4I0PC 2RMNA 4FULA 4GXUN 4M93B 5D1ZI 5AZEL 5GS1A 3V10A 3P73B 3BPNC 4FQXA 3LAFA 3JWDL 1UA7A 2ADGB 4XR8C 2J8UB 2FSDA 4JFQA 3FQRB 1UB5B 4UOJA 5EBWB 5CF3A 1A25A 3VSUA 1IAIM 3W2DL 1E0OB 5AVVB 3QEQB 4JQVA 3QJVB 1HYSC 3IU3B 4Z7WE 4ZYKB 5I82A 2BVYA 4KPHL 4GG6A 1XR9B 2F54A 2ZKHL 1BFVH 4MFHA 3H9YA 2VAAB 3RWEB 3TT3H 4X9IA 1UB6B 3MNDA 3V5HA 2FO4A 4UIKL 3PAVA 1U3HA 4OKVA 4NRZB 1JNHA 4YPGA 2EEXA 3FT1A 3HRZC 3RWJA 4L3AA 2LVEA 3FUJA 2PYFA 4BUHA 1VCAA 4I9WE 3NACL 2XBDA 4JPKL 1JUFA 2CIKB 5T5NG 3HZKA 4DN4L 5E8NB 5I2IA 3O8XD 3DIFA 2WCSA 1TQSA 1NAMB 2ZZUT 4PRPE 4JN2B 2ADYA 1RZKC 1MAML 2X09A 3ILQD 4FTDA 3GUTB 4XHJD 4PG9A 3O9WD 3UG3A 3O0LA 1GOFA 4MXVE 5L8KB 2G5RA 3IM1A 2BDNL 1IX2A 4D8PB 4Y9CA 5DJ8A 3DK0A 3OG4B 4GRWF 3IJSB 5TDPA 2G0LA 5C0FB 1IGIL 2CIIA 1NIBA 4JFEA 4X0NA 4WDIB 1ML0A 4NJAL 4A2MA 5FOBB 1VKXB 1DJHA 2ZIDA 4PJFE 1JNLL 2J6EL 3QW9A 2DMGA 5JHLA 3I6SA 3PAZA 1I85C 4DKEH 1CGSH 3APNA 2JXMA 3FFCD 3PJLA 1E9QB 2XXFA 3Q13A 5E6YA 1E27B 5CILH 3VXUD 3RPKA 5KSVB 2H1XA 3PWPD 4WY7L 4Y4FB 3M46A 1AXTL 3EYSH 4MLSA 4X4XB 1UC6A 5A7EA 1H3XA 2WMPB 1E4JA 1FG2A 2EYTA 1W72B 2WXPA 2HSIA 3IPFA 2AQ2A 4NC0B 4P46A 1T5XA 1ZCRA 2X4NB 3GUFA 4QKXB 5ESQB 5HD8D 4NQCE 5C07A 3QUXD 4AIXA 1IO4C 5E70A 4H8HA 1BLIA 3T0VA 4I18B 4IBVA 1VGEL 4BV1A 4F7TB 1NUNB 4XO8A 4APXA 1RZJH 2VDRB 5DUPL 2BFVH 5PCYA 1AZVA 3DROA 1SHMA 3CFIC 2PW1B 2ZOLB 4JQXC 3VGAC 3D39E 2V2TA 2YXWA 4Y2DB 3OHXA 2Z31B 4LVNB 1ZT7B 4U1HB 2JE8A 2OULB 4MHHI 3FONA 3OR7A 1EA9C 1PFCA 3IMWA 5EC2B 2Q3XA 1MFDH 4C83A 4F7EA 1JHKH 3NPZB 1F41A 5F7DB 2UZXB 5GGQH 5HHVL 1F58H 1KGIA 5C0NC 1IL1A 3F7PC 3KYOA 4X4YB 5IB2B 4OLEA 5D7LA 2BP8A 5KSAC 4P23B 1DBML 3SDXB 5HHXH 2D7TL 1FE8H 2MTPA 5D1ZD 5KSBB 5EC1A 5C0JA 2PR4H 4L1HA 5EWIH 2XTJC 1G9ML 3B7YA 3CMOH 2E9IA 4N8UA 1A4JA 1I8LC 4FZ8H 3NQKA 1WBXB 3SPJA 2HTKC 2BOLA 2CO4A 1HH9B 1D5ZB 3H42H 2UYLA 4V1DE 4F7MB 3BD5A 3MLZH 1S7TA 1KYOJ 2AJZB 3OJDA 3TEYA 3IDIA 3LQZA 4Y2NA 5T1MB 6CGTA 5E94A 3KCPA 3VI4E 2WWOA 3IT8D 3GGWA 5E8EA 1FNLA 5C7ZA 1A02N 3BP7A 4IBUA 3DGGA 3P9MA 5EU5B 1U6AL 2VLME 3NDYE 2V17L 5AB0A 3TBWB 3HBQA 1T04A 4XBPB 1DBJL 5FPIA 3IFOB 4HUXA 4OCYH 3UGXA 3ZO9A 5F97E 2EH8H 3V6FB 3HS9A 5E4AA 4XNXH 4JM2A 4WRLA 1IILE 3QIBD 2LQRA 4N0YH 4OCLC 3GM0A 4W9ZA 1Q9OA 2LE9A 3P4MA 4WEEA 3IF1A 3MLTA 1J9RA 4OI8A 4WF7A 2NDGA 1B0WA 3O6LL 1BMZA 4JLRB 3G3LA 2RGSA 2X4PA 4JFYA 4J4PC 5I5IA 3NCXA 3AT9A 4YHNA 3C08H 1PSKH 2CZNA 5BO0D 3D2UA 4JRYA 5IEHB 1OAKL 1T5WB 3W5MA 3DSFH 3IXTA 4GAGL 5C7XL 1RL1A 3NJNA 3V6BR 4OZFG 1FGVH 1BP3B 3QNFA 5IVXE 1BBJA 4KO9A 3AXLB 2F7IA 3D06A 5DJAB 4YR6B 3RVWC 1JGEA 1HOCB 3KW7A 4YO0A 2E7DA 3JTSB 1A0QL 3L7EB 1NDMA 2ZWYA 4P4RA 5ESVB 3CZUB 4XI5C 3UO8B 2AHIA 5IK3A 2HJFA 3WS6A 3CH1A 3IRZA 4D0CB 4NQXA 1NBQA 1EEYA 1RUPH 1IRAY 1LP9B 2KZBA 4KDTC 2R0LL 5DEGB 2UWEA 3HG1B 1A9BA 3BPLB 4U6HA 4IHOA 3CUPA 5I1DA 5KBMA 4X42A 4GUOA 4P2RD 1SJHB 2XFXA 3APDA 3MRMA 2X89D 2NY2B 4R97B 2NX5A 4UB0H 2C9UA 4RFOH 5F21B 4RISH 4ZJ9A 2BWIA 5K9OB 1AHKA 1J05A 5T3ZL 2G3ZA 1HINL 4ODVH 2QVIA 4KWUA 2K4WA 3L4CA 2IJ0C 2ZOWA 1O9WA 1FGNL 3WNMA 1BIHA 3T0EB 5FYKU 3HLAB 3L1GA 1TVHA 2AJ3A 4U7SA 2VW6A 4FQLH 4PJ8C 2WKLA 1QLEL 3SHSA 3G5VA 2H1PL 1JFQL 2ZXQA 4JHWH 2VDLB 3EZ8A 4ETQA 2H5UA 2Z4QB 5GSRB 3SKOB 5F88B 3V4LA 1SY6L 2Y25A 2OTUB 3V0GA 5T5FL 1KNOB 4H5SA 5HHOB 4CADA 4YK4C 4YE4H 1U3JA 3NZUA 5DZOA 3HRPA 2NY4D 4E2OA 1X6LA 3GS4A 2CUHA 1IARB 2JKXA 4P07A 4H0GA 1DZBA 1F4YH 2PXYC 3Q0HA 4LDCA 1PDKB 2WW8A 4ZTPH 3GQFA 3O41A 3KH3A 4ALAC 3P30L 4PJ7E 3WCYA 3AG3B 4C8XA 4XVUC 3ZTEA 2EKSA 5AAPA 3KPSB 2A99A 5E00A 5LBSA 2H41A 3CDCA 3MQIA 1Q1JL 1ZLVK 5FFLA 3TH3T 3MRLA 1F2QA 3ARBB 1U0QA 3GMLB 3LPGA 4Y16D 5EUOF 5I1LB 1UT2A 5BRZD 3P77A 5JIQA 1CIDA 1WG3A 4MDIA 2RIKA 4ZO9A 5FA3B 4U0RC 5T3XL 4N1EA 5D7JA 2DBLL 3GS0A 4LK4A 2Q6WA 1Z7JA 3ZZSA 5JMRA 4YL4A 3WENA 4ZI8A 2YFNA 4LGSB 3UTSE 2E86A 1PAMA 1RFDL 1HYRC 3RA7L 4LCCB 5DT1H 2Y36H 3CSYA 3CXDH 5CCKH 2VERN 5GGSY 1ZHKA 3MC0A 1MPAL 3CVHA 5CIPB 4PLJD 4AV4A 4HPYH 1UZ8B 5LGJB 1PKQE 4FTVA 2ZP8A 1B4JH 3U46A 1LL1A 2NNCA 1FSKC 4ONFH 3NVQA 4TMPA 2VLKD 4KQ3H 3UJJL 3BIAX 1SOKA 1GCYA 1PYWA 3D8MA 5HJ3A 3H9SE 3EYFA 5BW7C 4MMYB 4MA7H 2F15A 3PRZA 3C6LC 1FLTX 1HU8A 1DVZA 5E51A 1X7QA 1JE6A 2AK1L 3UTTE 2W1NA 2W88A 5FO7A 4LCIL 3QIUA 4FGMA 5CU9A 3VJ6B 4MAZA 2J44A 4WCYL 1PIFA 3PQYE 4GW4A 4NLAA 2FB4H 1L7IL 3BOVA 1QFWM 4EVNB 4OCSH 5F1IB 3SOBL 4WKZB 15C8L 2WLHA 12E8H 1PL3A 5F1SA 1MZYA 1DSWA 1QBLH 4JJ5A 2FJUB 4R5VA 3R0MA 4Y5XB 2B0SH 3ECVA 3U4KA 4RGMC 4EI6A 5BZDB 2AXWA 2A74C 3VO0A 3IMVA 1MDTA 3RVXD 2BY2A 4B9KC 2EVHA 2HKFL 2GCYB 1YRKA 4N8VA 1WA0X 4LB8A 5G4MA 5GS2D 1UKQA 4N2BA 2HUEA 2XPZA 1FNSL 3NSJA 4OLYL 2KZKA 2WXLA 2R2EB 3HCVA 1PG7H 2V2XA 3I3BA 1G9EA 2GFBB 1KIRA 4PJ9A 5F96L 2BH0A 5HDOA 4N68A 2LV4A 4Y1TA 3CLWA 3ZMNA 3N91A 5BVJA 3HMWH 3EOAB 1QFHA 4KRMB 4AIOA 5FO8B 1J8HB 3N44B 4A7UA 4PVNA 1TJIH 1CU4H 4OCRL 2HFTA 5B3JF 3JV4B 1TZHB 1ACYL 2DQCL 3HC3H 2OMXA 1I31A 1L3NA 5DA4A 2OJZH 2EACA 3IJEA 3HN5A 3TIDB 4YEFA 2UUDH 3E38A 3N1GC 5HTSA 3K2UH 4ZMLA 1P0SE 5D5MA 1E30A 3NCEB 3VVVA 3JTTB 4E42B 2P28B 2WKOF 1UM5H 3HR5B 3QI9B 4M3JA 4FZEH 4XH2A 2HFGH 3GD1C 5SWSE 1RZJC 5J1TC 4LGPB 2G4EA 4OZIB 4L9LA 2GQHA 3BDYH 2DICA 4Y19D 2KLSA 4HH9A 4OGAC 4G42B 2OJ1A 4BCYA 5AZUA 1G87A 3QDAA 1OGTA 1JDAA 3P4OB 2XTJD 4WW2C 1ETB1 5DVKA 1ZJAA 2XQBH 1A1NA 1QR1B 4HAGA 4HS8L 1G6RH 3QIWA 5KW9L 1QD0A 2VR5A 1KLFA 4LLQA 4HHWA 1HZKA 5DMKA 2DIBA 3TESA 3WUWA 3LSOA 1LO0L 3Q1EA 5KJRL 3B3BA 1JDDA 2EDRA 1L9TA 1UH2A 4WV1A 5AVQB 4ANVA 5JUEH 2HCZX 1XGQB 5FCUH 4L0YA 5JHBA 1VCBC 3KXFB 3L3KB 4HIXH 3QUZB 2BVEA 3NEXA 2VL4A 4GEIA 4KMLB 3QUMH 4X5XB 4YHOL 3AXIA 4MJHA 1W6LA 1WS8A 2O26U 4XWGL 3TN0A 5LDSA 4PY8I 5ICZA 1MLCB 2N7SA 1HEHC 2FSEB 3O2WH 4KXAA 5K1VA 4YHLH 1QO3A 3UAJC 5LNEA 1JV2B 1ZMYA 1BQLH 3VI3B 2VTFA 5E9DA 4XNDA 4PGBB 3GSRB 1ODUA 2CR3A 2DN7A 3D0VB 2G5BB 4NWUH 3VTAA 1A6PA 2P8PA 3QJUB 3FB8A 2I07B 4K5OA 2NTSP 5C2BH 3MA9H 3HW7A 3WL9A 4LVOB 2JCCA 1HHJA 4M6MH 2TSAA 1WITA 4TOYH 3TO4A 1M05B 2YPKA 1Z66A 4ZK8A 3UO1L 1OOWA 5FO9A 1RULH 5IIEA 4K3JH 4NNYA 4HKJA 3UMTA 3BQUD 2BNUB 3TBSA 1X5LA 4MX7B 3WY4A 4ANWA 3FCTA 1GGCH 2UY7A 1G1OA 5I76B 4G9DA 1HE8A 4R4NC 2PF6A 2IOIA 2IMMA 2EZ0D 2XQ0A 3UTQA 4AV0A 3ETBF 4U3HA 5I1IH 5B1JC 4O02B 5K59F 1BAGA 4IQHA 3L5WB 2GEEA 1YEIL 2O5YH 5EDXA 5T1KA 3WSQL 5AENA 5SX5H 4MNGA 3SY6A 4W9GC 1I7UB 1OT1A 3S3SA 4ZFZA 4MCMA 3LY6A 2HG0A 5IHLB 3D30A 3MFGB 3EH3B 7TAAA 5DZVA 1OQOA 5IKCB 4LBEB 1YLBB 5EIVA 1PZ2A 1WK0A 2JQMA 1CFTB 4FDWA 5E1AB 4O2FA 5FYJU 3GMQA 1J88A 5DMGC 1L6ZA 4NKDA 3CLFH 2EE0A 4ZTOL 2M26A 4FFVD 2XWCA 1NAKL 4K73A 2C4FT 5DHDA 5F1NA 3TEXA 2Y24A 5BCAA 5IQ9B 4M9PA 1NEZA 1M42A 2JELH 2Z92A 3PDOA 3S5LB 1C9SA 5EOQL 1DLHA 2KUTA 3V7AG 1EJ8A 2X4RA 1PY9A 1HHKA 2MWCA 3A4EA 4DVRL 5JPNA 1TSHA 2YMOA 5KG9B 1QLRB 1B3IA 2ICES 3WKYA 1I7ZA 4OLUL 1AMYA 1E28B 3SDYH 2X9ZA 4IOIA 2IAMC 3RU8H 2CE6A 2JB6B 4ADGA 3WJJA 3RX8A 3NCWA 3CZEA 2D73A 4FXKA 2WIIB 4M4RB 4K9EH 3PABB 4XXDA 4IGBD 2GBVA 4PBVC 2DYRB 1QSZA 2FYYA 4D0DA 4JREC 1KCRH 1ECZA 4ZO8A 1RUKH 2OK0H 4I3RH 3MA7A 4NKQB 4FA7B 4YLQT 5DFTA 3FH8A 1C1EH 2NY6B 3T2LA 2FQFA 5CJQL 1UQSB 2YKKA 3QG7L 1KBBA 3STZB 1RIHH 2YGQA 1TPXC 2IH9A 5DRWA 5E6ID 4QXGL 3QBTB 4H25A 3WY3A 5JPMA 5DC2A 1UD2A 3DKHA 4F20A 4Y9GA 1ZS2A 2J21A 2XT1B 1RK0B 4LSPL 4UNUA 1URZA 1YEEL 2HX7A 4TYUA 1SXSA 1KDIA 1QUNB 2BWQA 2EO9A 1IFGA 2M83A 3OKLA 4OCXL 5I9QC 1NPUA 2JK5A 1NBYA 1OAJA 4JPWL 5D7SH 4IMLA 5DWUL 5BRZE 4R2GD 4LLVA 4UTBL 1Q94B 5IMKA 2JSFA 2PO6B 2YIHA 2DQGH 1FZJA 3HI1A 4HQQH 4W9HC 4XZ4A 4JNXA 1ZVSA 2E7CA 5D6DA 4ZW3A 4KJQD 2ZUQC 4POUB 3VXMB 1CE6B 4HWBA 2KKQA 3JQOB 1KEML 4IRJA 4R96B 3GT6A 1N64H 2VDMH 4XMKH 4N2EA 4OM1L 1OTUD 1W0VB 1EVTC 1WAAF 5EZOL 2KH2B 3GI8L 2NCMA 1C8PA 1MG2C 1WZMA 2BS8A 3ATEA 4ODTH 1I3GH 4BD4A 1N19A 2FEEL 2NT0A 3MRBB 3CU1A 1A14H 3VXRD 4W70A 4FADA 4XCEA 3UYPB 4B9CA 4KROB 4PI2A 1U58B 3HNVL 2HTLD 2K0RA 2EADA 1G7PA 2FBJH 4JS7A 1L9SA 3VXOB 3B2VH 1H0DB 4FQIH 3NEEA 1OSZB 4NIKB 2NUPB 2PYEE 4DGYL 4Z6AT 3IJYA 4PJEB 3KGSA 2ZOOA 4IKLA 4BQBA 1MJ8H 4LSUL 4PYGA 4Q0XL 2F53E 4XPBL 4YX2L 2Q1EA 4DGIH 1M2VA 2DQHH 3CC1A 3DTDA 1LD9A 3NK3A 2OA9A 4XP5L 1JGVL 4XCNB 5DQ9A 3RB5A 4E9LA 4NJ9L 1ZLDA 3BEWB 5LXGL 4NZTL 2IPTH 4AM0B 2F8IA 3VG9B 5IMMB 1U8NB 3VD7A 4WUUD 5CP7A 1Q0EA 3KDMB 1FPTH 4H1LB 5DZNA 2CO1A 1ETZA 3I2CH 4DW2L 1D7BA 1AD9B 1ZSDA 3FQXB 4ZAKD 1WCBB 2JI1A 3HHMA 5F7BA 5KAQG 4Z1PA 4HJJL 5E2VL 4BFOA 4WTXA 4HZLA 2BNRD 3GLDA 1KV3A 4B5EA 1LO2L 4ZXBB 1AGEB 5IQOA 3UBXI 1KFGA 1A3RH 1UURA 4JFDB 3T2NH 3BZFA 4Q74A 3SE3A 5CD3A 1IGML 1CI3M 3MNZB 3ULSA 4M03A 4AKQA 4N8CL 5T1DL 3PHAA 2IMNA 3DO7B 4HMEA 5FKPA 4YHZL 1RK7A 4Y4KA 2YZ1A 1FC1A 3QULB 2NUTA 4CW1A 3EIFA 2WLMA 1H8OA 2X9YA 1CGXA 1F11B 4WGWB 5EU4B 3ZDXF 3RI5F 2VNCA 2EEAA 1IGTB 1AMXA 1HX0A 1P9MC 1ZPLA 1U93B 2BRRL 2L7EA 3GRWA 3T8XA 2E76C 1RCYA 2XV6B 3CFKB 1RHFA 4NBZB 4A67A 4C4BA 1MRCH 3DI2B 5CEYA 4IBYA 1OM3H 3D3VD 4LQ1A 4UZGA 1TU2A 5B8CB 4XMUA 4DP8X 2D31B 4YGAB 1CQYA 3UBGA 4BZ1A 1XGTA 4APQC 4DAGH 1AHWB 2C7FA 2PMZA 2NY5L 3DUSA 3IKKA 3L4VA 2ZUWA 3BH4A 2YR3A 3S34L 3WTYA 5DHYB 2Z8WC 4HMCA 3X14B 4HKZA 3WBDA 2Y3NA 5DVMA 5HDBB 3VGHA 4ZQTA 1E8XA 4JVWA 4NZUL 1MI5D 3MGTB 1U41A 2AAAA 1IM3A 3DURB 3H55A 1PFOA 4I48B 5DD1H 1U8PA 2XTJE 1BZ7A 3MODH 3BJ91 4R90L 5FV1L 3SCMA 4PYHA 4C58B 3LQAH 1U21A 3OAUH 1QG3A 4POZD 1W0YT 1A7BA 4MA1C 5F0PB 4NQEB 3B2PA 2HKAA 2OL3L 5L4JA 3QZWG 2R69A 4LHUB 3DBXA 3ZYJA 1PLGL 3ZR6A 1A4AA 2OMWB 1LWJA 4ZRGA 5K9QG 3T71A 2J1WA 1IEAA 5FB8A 1WAEA 3L9BA 5GGTA 3D7PA 5ENWA 4P3DA 5IOKA 2IQ9L 5C92A 3F58L 1MCPL 2J5LC 1OGAE 4KTDH 2FD6L 2WBJC 3G6JA 4A39A 4M8VA 7PCYA 2EVIA 2ZCHH 3ZHKA 1N12A 4HC1L 4P59L 1HT6A 4I2XA 1CGWA 3RDTC 4Z3TA 2H32B 1S7QB 1RHHB 4HT1H 1XCTB 1U36A 4ADIA 3CHPA 4KVCL 4JKMA 2XWBB 5BO1H 4QRTB 2F5BH 3ULUD 1KCKA 1XQ4A 4BWUA 1W91A 4NGHL 3DJZA 5C9KA 5SWQB 4IMKA 1P5UC 4BQ6A 3KBHE 1NGQL 1U3ZA 1U91B 5FDWB 4PB0H 3L95A 4PWFA 1C08B 1DUYA 3A6BH 4DGVL 3WN5B 3GRGA 4OD1H 2XX1A 1HEZB 4JFHD 1AQKH 3KH4A 4N2AA 3GTTA 3KJ4B 3THML 4ZSOA 5TK2A 3VYNA 4M61B 1KB5H 5ITBL 3GRBA 2YAHA 4LDOB 4NUGL 4OJYA 5IV2B 4JRXB 5C08B 2XXCB 3HZMB 1BV8A 3HN8A 2H2PD 3F5WB 3LKOA 1PJ9A 3JZ7A 4PHXA 2NXZC 1LEKB 4XBEL 4Y89A 3P11L 4G80A 4DGUA 3T3MB 4G8IA 1OP5K 2ICWJ 2WYIA 3PV7A 4F3FB 2EXWD 3MACL 4Q6IC 4ANKA 3IXAB 2ENPA 1IAKA 1KBKA 2G2NA 3TIEB 1E8YA 1FAKT 1P7KB 3W0WA 2GBTA 1WRFA 3AQZA 3MRRB 4NO0B 5GSVA 5L7XH 4PJAA 4B7IA 5I8CB 2ZKWA 1D5BB 2NDFA 4EEEA 3A6OA 2WNKA 3A47A 4PGJA 1D5XB 3OV6A 2COQA 1MKFA 2J2ZB 3LNEA 1ASOA 4OI9A 3WLBB 1Q0YH 4PJHE 1R5VA 1S8DA 2ZKXA 3ARGC 3KBEA 3ARED 3ATAA 4OZFH 1NICA 3PHQA 4RQQB 5I16A 3CG8A 4H8PA 5AAWA 2V5YA 4ZX5A 5DTFA 1IEBB 1WZLA 2GTQA 2R23A 5FUZH 3QEUB 5CN2A 2X6MA 2GJ6E 2LLLA 2CDEB 3C8KA 4Z76A 5AUMB 5KVGH 4L4TA 4QTHA 2APVA 5AW8B 1N0LB 2O6EA 3K4ZA 5BV7H 5B39B 5IVZB 3C12A 4ZMYA 2E7LC 1JF6A 1AD0A 3KHOA 4HBQA 1RZQA 5FGCE 1IGFL 1R5WA 4PJIA 4GW1B 4IBTA 2ICWI 1A21A 2O6PA 3ZE1F 4EI0A 2VGLM 2ZG3A 4N8VG 1KEGH 1P6AB 3MCLH 1ZV5A 3P2TA 5F3BA 2GK0A 4LSRH 1AO7D 2IADA 1CLZH 2Y3AA 4NWTH 2DWDA 4PS3A 2X88A 3B43A 1GSKA 2YRZA 4KKQA 4ZMXA 1ZLEA 3V7MA 2WQRA 1XCXA 2ADGA 4G8GB 1QSEB 2J8UA 3F8UB 3FQRA 1UB5A 5EBWA 4DP1X 5JHDB 4OD3L 4XPTL 1EPFA 3QEQA 1WS7A 3IU3A 4TUKL 5EBLB 4LEOB 4F8QA 4ZYKA 1XR9A 1ZKAA 3QAZB 4KJPC 4OZHB 4QGYA 1UACH 2VAAA 3RWEA 3QWOB 4QY8A 1S7WB 2K8QA 2B2XL 3RKPA 4N90D 5J4MA 2F08A 1UB6A 2R29L 1QRNE 4OCWL 3CDGB 3P0GB 4NRZA 2IWFA 4P5KB 4F1SA 4QOKD 3OL2A 4JEGB 5GRZA 1P4IH 3MRFA 4M7ZC 4D7BA 3FQYA 3I75B 4G5ZL 5JIIA 1X5AA 2CIKA 2IWGA 1FO0B 5E8NA 1N0XH 3DUUB 1YEKL 4UNVA 1MCQA 4B50A 3G08B 4TLTA 1NAMA 4AMWA 1WA1X 5L88H 1UHVA 4NC2B 3GUTA 3FHQA 1YY9C 2XYBA 4X6CF 2R56L 1YEGH 1MCIA 5E5LA 1TTGA 1RU9H 3CFNA 4QUOA 4PLKD 4D8PA 5F0MB 1WH0A 4KOBA 2BIIA 3IJSA 4FFYL 5C0FA 4ZOBA 2A9ML 4JY5H 5D96B 2VXSH 1AR1C 4WDIA 5FOBA 1VKXA 4QTIH 1DLFL 2H0FA 4FNLH 5T33L 2XZQH 4X7TB 2ZSVB 4W68A 4HUVB 1I8IA 2ODHA 2YXFA 5DMIL 3VW3L 3N5AA 1E9QA 1JXJA 2YARA 3NCFB 5I5MA 3C2AH 3QQ4B 5KSVA 1I7RB 1QACA 3OZ9L 3R0NA 4W9DC 4Y4FA 2VLJB 4X4XA 4GXUM 3SE8L 1ZLWH 2WMPA 5TD4A 3VG0L 1W72A 4GS7B 5AWNL 3NIFB 5AB2A 2BSSB 1GHFH 2X4NA 5AKVA 5ESQA 4POYA 2DI9A 1BJMA 3GM8A 4MQSB 4I18A 1BQRA 1GOHA 3OHMB 4F7TA 3DETD 3MLPA 3W9EA 4M6AA 4U31A 1MRFL 5K93A 3CFTA 5D1QB 2NT1A 2PW1A 2WXHA 2ERJB 3GZKA 3QQ9C 4OIAA 2L7QA 2ZOLA 3QUYB 5IR1B 3IETB 3DX6B 3C09C 3GI9H 4U1HA 1ZT7A 1LEIA 1NJ9B 4FE9A 2L04A 4XP9L 1AQHA 4AJ0A 4IRZL 5CLXA 5EC2A 2QQLL 3MLYH 1JD9A 1MCCA 3ZRFC 4ZMTA 5F7DA 3NJXA 2UZXA 2CBPA 1CT8B 1ADQL 3O6FC 4R9HA 4WO4D 4KKPA 2V33A 4O2CB 3IGUA 1JZ3A 4L37B 4X4YA 1KCSH 5E1IA 3IB4A 3WIIH 4UUJB 5IB2A 2A9NL 1BXUA 4CDHA 1F4XL 3QHZL 2BLFA 5I1CH 3SDXA 1AGBB 1MH5B 4O51B 1G1CA 4QLRA 3CN2A 4PJ6A 5KSBA 4PJ5E 3LS4L 3DMMD 3X3FH 4PWJA 1NC4B 1BMGA 4XPFH 1IUZA 1G7JB 1THCA 3O2VH 4X8CA 4FABL 1T83A 4UQCA 3VGEA 1MLBA 4OSUH 4U1JB 2CU9A 3BZDA 1GGBL 1HH9A 1D5ZA 1QI5A 3H56A 3I6GB 3TT1L 4F7MA 2AJZA 3BKML 2B1HH 5C0BB 5T1MA 3QSKB 1JK8B 2HP4A 3HB3C 4LPWA 1EBPA 1VAHA 2GIMA 3CVCA 3R19A 4GRWH 5ISZB 2P80A 3KYKL 2VDQL 5IBUB 5EU5A 1T1XB 4LQFL 1TJHL 3ZR5A 5IROA 3NCYP 4MJIB 4TNWF 2YWYA 3SQOH 3TBWA 3QE5A 2V9RA 3DXAB 4XBPA 4F58H 3IFOA 4PB9H 2WLZA 4QRPD 1A5FL 4UT6A 4MRBA 3V6FA 1HCZA 1QLEB 1V3LA 4EI5B 2GSGB 4HGWB 3S37X 2Z91B 1OPGH 3U4BH 4LHQB 3K46A 3O3EA 2QGEA 1DVFD 2VSDA 2P5EB 2UUDK 4JLRA 4KAQL 1KGXA 2VRQA 1N26A 2R0ZH 4BQCA 2AEWA 3QJOA 5IEHA 1T5WA 3NGBC 1P6WA 3FTWA 3NFNB 5HVHC 1IGYB 3BAEL 4DPCX 3HUJE 4GBXB 5A2LH 3ZKMC 4NI6A 1AGFB 5KVFH 5KVDH 5DC0A 3QISA 1BD2D 4S1SH 2CDGB 3R4DA 5E7FA 5J89A 3AXLA 5DJAA 3BXNB 3ARFC 2Z34A 4ZZFA 1HOCA 4FG6D 4PJDB 3V6OA 5D7EA 3JTSA 3L7EA 5ESVA 1LWRA 4N0RA 4XMTA 1CURA 3RPIB 1ULVA 3L4TA 1X6NA 5C0AA 4UZUA 4D0CA 4LVHC 1LP9A 5IY5B 4TL5A 3HG1A 1QR4A 2APFA 5D7HA 3WOVA 1SJHA 4Z3FA 1M53A 1Q38A 2IDQA 3MUZ1 2JKRM 3CQQA 1BHGA 2BC4B 5K9OA 2VE6B 1UD3A 3O2DH 2CK0H 2W59A 5L9DL 3P3TA 1AOHA 2CH8A 4Z7VB 3Q43A 3B5GA 4H8WH 1EHNA 3HLAA 1UH3A 3T0EA 3FT9A 3MRKB 5AVRB 5KYYB 3AROA 3L9EA 4J1UB 5ACZB 4K7PL 3I50L 1L6PA 4CSTA 4IM8A 1CVSC 4KKAC 4ZS7H 1RZKL 5IBTL 1PZ5B 5ALBH 3MV8B 1I1YB 4XNZC 2Z4QA 2O72A 5GSRA 3SKOA 3WFCL 4K2UL 3EO0B 3KWWB 2P5WD 3T3PE 4C56E 1KNOA 4B7LA 2E8YA 4G9FD 2NQCA 2Y1YA 2JLPA 2FATH 3CE1A 3SIKA 4M7JL 5JNYB 3B7RL 5KTEH 2OMYB 3TEWA 1I9JL 4WTZA 4HCGA 1YG9A 3S3BB 3I6KB 1QFUL 1RZGB 3KPMB 4CILA 1PDKA 3CK0L 4DH2A 1GGUA 3D34A 2NY3C 1XR8B 4PRIE 4TNVK 5GRYA 5SX5K 3KPSA 4AZ8B 5BV7C 2EUXA 2RBLA 4ZFOL 1IVTA 2EXSA 5INCB 1ZLSL 1WHOA 3II2A 3HC0B 1CFVL 3ARBA 3GMLA 5I1LA 4GQZA 1KDJA 1SOQA 4YFLI 5BQ7B 4FEMA 1IKFL 5HDLA 3X13A 1A1OB 4KJPD 4U1GB 2OTWB 4HBCL 5FA3A 3G9AB 2FEDC 2R8SH 1IAIH 1BPVA 3OKNB 2A4CA 4XB8A 4RFNC 2QQQA 4MQXD 3Q05A 1ZAGA 3LRLA 5AYUL 5JHLH 1QSFE 4JO1L 4JY6B 4E9TA 2WNWA 4LSVH 4WI2A 5E24E 4DO4A 1QPXA 4AQ8C 2ORBH 3BGFC 1HNFA 1UWXH 3HAEA 2VT0A 1J1PH 5CIPA 1J18A 1OCWH 2L8AA 1UZ8A 3GJFH 5LGJA 5IBLC 3GBEA 4OBSA 1LTXA 3PP3H 1B4RA 1WFJA 4AQAB 2P24B 2WQUA 1HTYA 1OCCB 1JPTH 4JQIA 3N3EA 3QHFL 4MMYA 2DS4A 4RLDA 4PMFA 5JO5B 3ZHDA 4KY1L 3NCJH 4AVKA 4J3WA 1BM7A 5FKAB 3Q06A 4DO6A 1RKRA 4OQTL 3EJPA 3VJ6A 3U36B 3O4LA 1E4WH 3QEGH 4P2OB 2X2YA 1A3QA 3NCMA 4QF1B 2K9UA 3MLRL 1NBVH 4J27A 3FOMB 4MNQA 4EVNA 3MJ7B 5F1IA 4WKZA 2AQQA 3ZE2F 5BRQA 2OZNA 1UVQB 1R0AH 2AFNA 3QPQD 3F12B 2F61A 4Y5XA 4GG6E 4ZW5A 3C5ZC 4PRHB 3AGWA 5GRJH 4NQVA 4M1DL 3ZTNH 4LASH 1EXUB 3FZUD 2GCYA 4U6YA 2W9EH 1V27A 1F8TL 3FW6A 3BKYH 2CHXA 2IXQA 3JYCA 1KZYA 4IIQC 4KQ4L 5LBVA 3SYOA 2A4ZA 3FYEB 3DIDA 2R2EA 4I0KA 1LMIA 1UYWH 3CBRA 2GFBA 4FYSA 3SDAB 3AABA 3GWJA 5IESH 5CINL 3IVKB 2XACC 4GJTB 4LLYB 5FO8A 3EOAA 1QLFB 1J8HA 4EN3D 1H8LA 2BNQD 1YYML 1OARH 1BA9A 1RPKA 4IOSA 3NA9L 2VM4A 3JV4A 1TZHA 5GRVK 3SBRA 2JKJA 4DHLA 3R8BB 1MW0A 4OFQA 4J3BA 2CSPA 1FYTB 2R2BB 3TIDA 1E7UA 2VMDA 3A23A 4JFFE 1NM9A 4LLAA 4ISVA 4ERSH 3LRGA 3JTTA 1BZOA 4E42A 3TNNB 2NLJB 3HR5A 3VWJB 3QI9A 2XVLA 1MCDA 5DZPA 1JV5B 2SODB 4YBHA 4OZIA 4CUCA 5JHAA 3DJRA 2NYKA 3MAWA 4G42A 1JPGB 2BW4A 4X6DB 3RURA 5EBMB 3WIAA 3P4OA 2HRPL 3MXWL 5DFVC 1QR1A 4ZPTB 3WYRA 5ABZA 5EZLB 3FK3A 2HVKB 3LZLA 2DAVA 4OB5H 4HSQA 1F1GA 3ZL4L 3CNKA 1CDBA 4Z7QB 1QQDB 3PNWB 1RZ8B 1V3KA 2GKIA 4NZ8A 4JM0A 5CP3A 5I0WA 1MQKH 1XGQA 1H3PL 1WZAA 3KXFA 1ZS8B 3L3KA 3QUZA 4HD9A 4HWEL 4TN9A 5F8RC 2IANE 4AZUA 1W0WB 2P49B 4TTGA 2W95A 4X5XA 1INEH 3C60C 3MPCA 1Z5HA 3HE7B 3TTSA 1MLCA 4Z7WB 3IYLW 2FSEA 1FWXA 4NUMA 1JV2A 1W8OA 2VERA 4X4ZA 3VI3A 4QHMB 4PGBA 3GSRA 4FA8A 3D0VA 3UC0L 2G5BA 1YYLL 4LKXB 4WQOA 1RLBA 2CGZA 2I07A 3S4SG 1Z0NA 5DUMH 3Q7JA 2F19H 3IU4L 5F70A 1LK3L 1M05A 2I24N 4YHPA 3WKML 1LDSA 3E9TA 4RIRB 2XWXA 2E6QA 3LN5B 2OX5B 4FQCH 3ZW3A 3CQPA 3P3UA 2BNUA 3UACA 3F05A 4MX7A 1D5MB 2LU4A 2BIMA 2P26A 4W9CC 5I76A 4PRPB 3PWNB 4LRIA 1JHTB 3TA3C 2JJSA 2ZYHA 4ALAL 2QPSA 4O02A 1A7RL 3RVUD 1BD2E 4ESKA 3L5WA 1NLBL 4U2YA 5MENA 4F57H 2C9XA 3QXWA 1EZVX 1I7UA 2R0KL 3CBJB 4R7LA 3KJ6L 4ZFFB 3B9KC 3G5XB 5MHSD 3PF2A 1SPDA 4OLWL 5KZCD 1YUHA 3ARDB 5IKCA 3NIDE 4FQJH 4LBEA 5E1AA 2ZF9A 4PJFB 4BHUA 2EE3A 3PHOB 3ULVF 1FRGL 3EJZC 4NZRL 5F9DC 4YH6A 5CLWA 3QDJE 3HNSH 5IQ9A 5EORH 2L7JA 1XH3B 1TNMA 3S5LA 2XQYA 2PPFA 3FAXA 4ENEC 4AGQA 1F1AA 4IDJH 5IHBA 3UZEA 3ZRSA 3KPNB 4BSVB 5CGYC 4AJWA 2X4OB 3Q6GH 2VXVH 4ZD3H 2YJLA 5KG9A 1CICC 3OF6D 4NN7B 2YMTA 2X2IA 1MEXH 1E28A 4NFBA 4KHTH 1E5YA 4UQ9A 3B9AA 3DDFA 3LYRA 2JB6A 2Z35B 5FDYA 2IVFC 4NQCB 3IS1X 2WIIA 4M4RA 1HWGB 4KX9A 1P7BA 4MB5A 3J27A 3Q2VA 3PABA 3TT3L 4D3CH 3ZXAC 3FTVA 3RUGE 2VZTA 2GK2A 3MUY1 1KXHA 1ZTXE 4DKFL 4HPOH 1ZANH 4Q4EA 1KXTA 3CXFA 2ED9A 5BOJA 3CVHH 5F7UA 3D39B 2Z7WA 1ZK9A 3UEZA 4K23H 1OSPH 4YSAA 4KKLD 4NQDE 4IRSC 3WKQA 3BWZA 4LLWB 1UQSA 3STZA 2DLTA 5CZVH 4IBSA 4QWWD 2PTUA 5HYJE 1BF8A 3BPOC 1J0ZA 5JQHC 2Q8AL 1DSFL 2YD7A 3SGKA 2DKSA 1RK0A 4HP5A 1AE6H 4WEBH 3OKYA 3FT3B 4K8RH 1I1AB 4U49A 1G84A 3EH2A 4PJGE 5ADPL 1VERA 1QUNA 1YNLH 4ORZC 5F7EH 1IC4L 2WOYA 4PWKA 2WZ0A 2VZVA 2FBRA 3H53A 1Q94A 3D2TA 2X6CA 2HJKB 3BSZL 1IE4A 2D7OA 3ISWA 5KS9E 3VXMA 1CE6A 1CR9H 4MB1A 4MCZB 5I8KL 2C9AA 2R4RL 2WWMC 4UM8B 4R96A 3SDDD 4F37K 3QZNA 4YXHH 4G1MB 1W0VA 4M43L 4DKEL 4V1DB 1CGSL 3ZT7A 4OJEH 4X9FA 3A6CH 1CDJA 1MFMA 5DD5H 3IDGB 3GMMB 3VI4B 3HVDA 1C16B 4FRWA 4HEPA 5CILL 3UYPA 3EYSL 1A4KB 1U58A 1PD6A 3K91A 4Y7OC 1KLUB 3B8SA 4DSYA 4UM9B 2CNZA 3EJYC 2OI9B 1H0DA 4X5PA 2W91A 3FUDA 3VXOA 2QEJA 4PPTA 1QVOB 2CBMA 2HT3C 4FXLA 3MLWH 1OSZA 3N50A 2NUPA 3FQNB 2R2HB 4PJEA 1IM9D 5IFHL 2I26N 1RZJL 3CZFB 3MV9E 3W5NA 4MAYD 2PCPB 3O3BB 1A7QH 3KL0A 1J8KA 4RDBA 1AKJA 2Z4TA 4XCNA 4CKVX 4WJ5B 1ZV9A 3BEWA 3OVUB 4HOWA 2CLVB 3ARSA 5I5RA 4K5NA 1QKZH 1NMAH 4AM0A 4KK5C 4X4MA 3CN3A 1IBGH 5IMMA 1U8NA 3CXHJ 1KCWA 1YNTF 3KDMA 4H1LA 3WELA 4K55A 3BAXA 5FYJH 2GW5A 2HPOA 1AD9A 3FQXA 1MFDL 1WCBA 2XV0A 3BCDA 1YPZE 1QFWH 1JHKL 3VGBA 3Q8EA 3F01A 3SKMB 1FIGH 1WGVA 2OL3B 5EU3B 5GGQL 1F58L 2CO6B 3LKRB 4LEBA 4ZXBA 1AGEA 4ABUA 1DDTA 2ZOUA 2JKWA 4JFDA 2YGNA 3NN8B 4HCRA 5KYWB 3T6VA 4WWKC 2XA8H 5HHXL 3L1EA 2ESVE 1MNNA 3MOBH 1RP9A 3LRSB 3DO7A 3NJHA 5F9JA 5C0DB 1WIPA 5TF1L 2Q9OA 5EWIL 5EO0B 2ZTBA 1JHLH 3QULA 1XXFC 4U1IB 4L4VD 5EU4A 1F11A 1XB6A 4L8SB 3CPUA 1DN2A 1E50A 1TTFA 3O81A 3RZCD 1IGTA 1U93A 5I8OH 3H42L 3BYTA 3RQ3A 1Y7VA 3CFKA 3MLZL 3QDGE 2BS9A 3DNKA 1T4WA 1YJDC 3CDFA 2L0DA 1UCBH 5LDUA 4N0CD 5B8CA 3N1MC 3WIHH 2D31A 5E8DH 3GLEA 3NYKA 3TWCH 4IEFB 2QHRH 1AHWA 3QRBA 2PTVA 3ZE0E 3VGFA 2BSBA 1F4AA 3P54A 5DHYA 1MRDH 1T2QH 3X14A 4OCYL 4P2QD 3Q8FA 1XEDA 2Z7YA 2EH8L 4HS6B 5DF0A 3BRGC 1UWGL 4TUOB 4XNXL 3SBWC 4F8NA 3D6GA 2EUVA 4D8OA 3MGTA 3CBKB 1XAKA 3DURA 4N0YL 4I48A 3TCLB 2VXQH 1CB4A 2OZ4H 4BFGA 1GZQB 2IEPA 1JXDA 3IDYB 5I1EL 2XIDA 1SMOA 2YKLH 3HE6D 5TPWH 2JQZA 4HJIA 4JO4H 4IKIA 4NQEA 5FHBH 4FX5A 3C08L 4MGXA 1PSKL 2D7MA 2RHEA 4WTWA 1KB9J 1G0XA 4LHUA 3DSFL 4PJ7B 3MUHL 4FXGB 4N3UA 2OMWA 4BIKA 2Z7UA 1VADB 3CJJA 1FGVL 3VMOA 5K33A 4OGXH 2Y5TA 5EEUA 1IBYA 4QLWA 2NY0B 2C1PB 5E5MB 5KJ7E 2HYMA 1K4DB 5JQIB 2AMGA 2MMXA 5L4MA 1DO6A 5ICXB 4JFOB 1LDPL 2R9HC 1MIEH 2EIZB 3QQXA 5EMYA 1U95B 3BT2H 1DVUA 2XHNA 4GRLC 4K0OA 1L9OA 1SLUA 1U42A 1RUPL 4F7KA 4PIRF 4BSJA 4WUKL 3CIQA 1IAII 3UTSB 4TTDD 1K5WA 3ESNA 2H32A 1S7QA 2GTWB 4I9XA 1RHHA 2XG4B 1AQMA 1XCTA 2EE9A 4WTZG 3NMEA 4KK6C 4RFOL 2NZ9D 1SNRA 4RISL 5HI5C 4EXKA 2RAMA 1PCXA 2XWBA 2XN2A 4ODVL 3SQRA 4Z7AA 4QRTA 3C9NB 1PKQB 3E2HC 3VWKC 5SWQA 4NO5B 2J1YA 1YY8B 2CXKA 4TNFA 4HCIA 1RLWA 3EGXB 3VYOA 4TPRH 2FIRT 1X7TA 4CVZB 4ORGB 3V4VH 1R46A 4A2DA 1GW0A 2RCSH 1C08A 2AGJL 3POHA 1B2WH 1J0IA 3H9SB 4HK3N 3WN5A 3L2NA 1QFPA 2I9TA 4A2FA 1HEZA 4JHWL 3PGCB 2E47A 1L0XA 1C8QA 1N2RB 2E46A 4M61A 4EUPB 5IV2A 4JAMB 3PUUA 4JRXA 2CLZB 1NFDE 2HVJB 5C08A 4YE4L 3UTTB 5D2LF 5KBDA 3HZMA 3QORD 3I3DA 4BQ9A 3F5WA 4QHUB 5D1XC 2A0LC 1LEKA 5FM8A 3PQYB 2D03H 1HNGA 3MBXH 2ALAA 3MV7E 1F4YL 4F3FA 1FQ9C 4G72B 5I73C 3HAEG 1EDYA 1FNEB 2Y69B 2DIJA 3OMNB 4ZTPL 5FK9B 3VTTA 4EZKA 3V4PH 4M48H 3TIEA 5BS0E 5KN5B 5C09E 1P7KA 3T4AB 2N0MA 4PJBF 3MRRA 4NO0A 4XO4A 4GSXA 4Z3EA 2JB5L 2DPKA 4N2GA 5I8CA 4K7FB 4KZCA 3GO1H 4R4BB 4R7VA 1D5BA 2VW7A 1KGUA 4FN0A 2J2ZA 3D5OF 3VB9A 3WLBA 2CO7B 1M1XB 3QQDB 1FH5H 4RQQA 3ARYA 5A6IA 1O9VA 4FQXD 3VACA 1J5IA 4ODXB 3SKJH 1YN6B 3HZVB 1IEBA 3AS0A 3CN0A 3LVEA 3QEUA 4IJTA 4MD4B 4NN6C 5EPMB 2EEFA 2CDEA 1GTNA 2Y36L 3CXDL 5AUMA 3SN6N 1VZIA 4HXAH 3TA4D 1N0LA 2CUAA 3DARA 1ES0B 2H3NB 3TBCA 3V9FA 3D12B 5IVZA 4DFIA 3I9PA 2F54D 4HPYL 5B39A 5B4MC 5FR3A 1SUHA 2A2QT 1WFMA 3SE4C 1EIBA 1EO8H 5KVGE 3G5ZB 1H3WM 3ZZ1A 3C75A 4L1LA 4KQ3L 4NQSB 1FCGA 3KVDD 1D5IH 3BPCB 3MGAA 4YDKH 5DK3A 1NWPA 1U3HD 5E08H 1GH7A 3P2DA 4GW1A 4TVPD 2BVOB 3B3IB 5JZ7C 4OFPA 5SWSB 2ITDB 4XGZB 2H6OA 2XWTB 4MA7L 1T3FB 3GHPA 4LBAA 1KIUB 5F1OB 3OKKB 3PAYA 2IV8A 3LRKA 2J6EA 5JIDA 2HUHA 2WUBL 4M29A 5D1ZB 4UBDC 1UWFA 2K3HA 4G8GA 3UAFA 1QSEA 4B5ZA 1RSYA 1KTDB 2FB4L 2EDHA 3WJLA 2ZUUA 3L1OH 1ERNA 2Y7LA 5JHDA 4BKLB 1Q4NX 12E8L 4H8VA 5EBLA 4LEOA 2O61B 1QBLL 2VSCA 3KL3A 4K8RC 1KIQA 1XMWA 1CDGA 2BERA 3HIZA 4OZHA 1NCNA 3QWOA 1S7WA 1DBKH 2YD0A 2J20A 2ZSWB 4AYMC 4CU8A 3WIFB 4JFED 4LCWE 3CDGA 4MB3A 5IB5B 5JDJA 3U7YH 1CXFA 4P5KA 1SF5A 1VESA 4F1ZA 4X6EB 2XV3A 3EFDL 1SXZA 3I75A 3V6ZB 2XJLA 2QBWA 5KEZA 2CAKA 3DUUA 1ROWA 3EDJA 1P1VA 4OLVL 1PLCA 4Z77B 3B8YA 3QJSB 3GRWH 2VDKL 4PJXF 1EDQA 3HMWL 3DHJA 1TQWA 1NCUA 4XAKD 1ETA1 4FI8A 1CU4L 4NQUA 2E74C 3IAGC 2P8LB 3HC3L 1QEXA 4L1BA 4P46D 5DEJA 4GKSB 2H0EA 1MY5A 4PRNB 2OJZL 2AABL 5C07D 2E8ZA 4DP9X 2GUYA 4UV4L 4E5XB 4OZGF 2BOCB 4HIJB 3ZQWA 4C4KT 4CL7A 1SN0A 1YQVH 3VNZA 3K2UL 3NPSC 2G60H 3EXLA 2VC2H 5K9QI 4PJ9C 1UM5L 5J11C 1P4BL 2JJVA 2HFGL 3RBSA 3KLLA 5DZLA 4X7TA 2ZSVA 1K8IB 4J3XA 4HUVA 4QXUH 3BDYL 3LS5L 4Q6YA 2I69A 2LAGB 4KXZH 3PNRB 2NXYC 3QUGA 5JORB 2WOBA 5FM5M 2XQBL 2QGDA 4W9IC 2LOEA 3QQ4A 5LVEA 1I7RA 2JVUA 4F15B 2HRGA 3N43B 1OHZA 2ED8A 2VLJA 1TDQA 3CSGA 3TYFB 1X4XA 2BWDA 1E4XI 2R69H 2EIJB 2JKSA 4LMQE 5D7LD 1YN7B 3HS0B 35C8H 2HMIC 5AAMA 2HJLB 5HI4D 4Z7OF 2BSSA 4A7GA 1FA4A 2VDQB 5D71H 3REWB 3SPIA 5JUEL 3WO4C 5FCUL 5FYKD 4HIXL 1KT2B 2AI0H 5IHWA 1MCHA 1UWXK 5D1QA 4K3DH 5SWZE 3QUML 1AG6A 1QSVA 2ZCKH 2CMRH 3QUYA 4W6WB 5IR1A 2BCMA 1QTPA 3HMXH 3DX6A 4FXTA 1IC7L 1XTMA 2BVQB 1C12A 1NJ9A 5E7BA 4YHLL 5IEKB 4N87A 3EJCA 1KB9K 4L48A 4P2QE 3INUH 2XETA 2EEDA 1F42A 4NWUL 3ETBJ 4F8TA 5KYUB 1IC5H 4GSUA 3RHWF 5C2BL 3MA9L 4M6ML 1T0NA 4TOYL 1T20B 4JGJA 2XWEA 4O2CA 4JK0D 2YUWA 4L37A 2CPCA 3EYUH 4UUJA 1J87A 1JGDB 1RULL 3ETSA 1LLAA 2CWRA 4G7VL 3TU6A 4K3JL 4AMKH 4QHKI 2DLGA 4I0PB 2ADFH 4W9EC 1AGBA 1MH5A 3DX7B 3WLWD 1D9KC 2NNAB 4F2ME 5GS0L 3FS9A 3GPEA 4JM2D 4FQQB 2HLAB 3BPNB 3GSNH 4P9MH 1UGNA 2OS7A 1H6EA 1NC4A 1USQA 4ZUSB 2BCKB 1NCHA 5I1IL 2YD6A 1G7JA 3LKPB 3SJVE 3V8OA 3RGVC 2VO5A 4FCAA 1MFCH 3TO4C 32C2B 4U1JA 3FN9A 4UOZA 3I6GA 3NH7H 4YMPA 4U3CA 5BRZB 4PM1A 5IJVB 3D2UD 4JRYD 5C0BA 4HDIB 3AADB 5HGGS 1ZGLM 4QIRA 4WI0B 3GIVB 1XD1A 3CVIH 1JK8A 3VFGH 4AK2A 1T7YA 4GAAA 1UD4A 1FFNB 5I18L 5ISZA 3IGAB 3S37H 4S11A 3HRZB 1T1XA 3CLFL 2IV9A 3QJQB 1SVCP 4MJIA 4UI2A 5C6WH 2G30A 4GRWE 3FRPG 3T0BA 5EN2B 4EXPX 1T03H 1MJ7H 5DEFB 2CRIA 3GJEB 3AVEA 4NYLB 2WZPA 4HGMA 4FNTA 4EI5A 2GSGA 3X1BA 2Z91A 4UDUB 5I30H 4N0UE 3JT0A 2GG1A 2A9AA 1SY6A 4BXVA 3ZZQA 4Q2ZB 5T5FA 2P5EA 4A66A 2NX5D 5HHME 2ZONA 1ZTXL 2PYEB 2MJWA 3IJ8A 3OB8A 3RTQC 5I0VA 1Z32X 5KUMA 3BMWA 4OQ1A 3NFNA 1IGYA 2F53B 1KCRL 4GBXA 2OK0L 3GC3A 4ZBJA 4I3RL 1M3IA 5INDB 1AGFA 1WUNT 2CDGA 1CDHA 3CFDB 4G8AC 4MBRA 2YFOA 3BXNA 2ZAHA 4QHNB 3TJHD 4B9ZA 3HI6L 2ENJA 4KGLA 4PJDA 4ZFOB 1RIHL 3CZSA 4TV3A 5KVFE 3ZMEA 3LEXB 1D6VL 2J55A 1ZA6B 3RPIA 4HEPG 2RFXB 1U8QB 2OQJB 3MBEC 4CU6A 2HB0A 1SDDB 1FORH 3Q2WA 2WXFA 4Q9CA 1A4CA 1QFWI 3OPZH 1BEYL 1BZ9B 1R3JB 3DDGA 2ZPKH 3RJQB 1EHLL 4LGRB 3M8OH 4FNQA 1KZQA 1RPQA 3TO2B 2WTOA 4DT2A 4E9QA 3VD2A 1K85A 3FU7B 2JCWA 2NY1C 1DP0A 1CJYA 2BC4A 3BLPX 1ROCA 2VE6A 5ES4B 1ASPA 4P5TC 4E0RB 3MRHB 2P9RA 3I9AA 2FBOJ 1NCBH 2UY6A 4OJFL 4Z7VA 4BFFA 2W0KA 5E4EC 1NFKA 1QP1A 3MRKA 4AW4A 1M7UA 5KYYA 3VGAB 4J1UA 5ACZA 5B7FA 1N64L 2VDML 2ZYRA 4MLIA 3D87B 1E6OH 4B3EA 4H1LG 4CVUA 3ZYOA 2JKLA 4OV6F 1PZ5A 3MV8A 3WEAA 1I1YA 1I3GL 3VQMA 3VDBA 4DTGH 2BS71 5D7JD 4UOQA 4X7SL 3EO0A 3KWWA 5LG6A 3GNMH 5HGAA 1UASA 2V0AA 3GXMA 1TYRA 1MHCB 4EDWH 5GRVL 3ZDYF 1DBBL 2WLNA 1NEUA 3DI3B 3K2KA 5J5EA 5JNYA 1X5YA 2FBJL 3AY4C 4JJHA 4YWGH 2OAAA 2JF1A 2OMYA 3B2VL 3KPPA 3ZPDA 5F7HA 2AJSH 4P2CG 4FQIL 3QNYA 3I6KA 5KSAB 3KPMA 4X2UA 1KTRL 2Q3AA 3CFBB 3DRTB 1N6QH 1N5YH 3TJEH 2VWEC 3HG5A 4HEMA 5E95B 1KIPB 1XR8A 3HJ0A 4FTVD 4UBDD 1JZDC 3V7AE 4DGIL 4MQ7B 2DEWX 2XTJB 2Y1VA 4AZ8A 5C0GB 1S7VB 5INCA 4RMUA 4WFFD 2H2SD 3J7HA 2IPTL 3HC0A 3AITA 4TSCL 2V5SA 4MHHG 5BQ7A 1FPTL 5AOKA 3FQ1A 3GB7B 1A1OA 4AIEA 1SRDA 2AVFA 2OTWA 4UT7H 2LFEA 4J7RA 5F3FA 4XN8A 3OKNA 1KJVB 1TCMA 4AXWB 1JYNA 4OLZH 3QIUD 4GSDH 5EEVA 3JVGC 2JTDA 4WNJA 5DYOA 4OI7A 1MFAL 2BRQA 5IUSA 1A3RL 3MNVB 1YMMA 2YQGA 4NKIH 3D0AA 2KLTA 2Y7NA 1OK0A 1OGAB 3B37A 2ED7A 3D85B 2DM4A 3K72B 4RGOH 3X1FA 1UXSB 4Y1AE 4ZX3A 4AQAA 2P24A 2WLIB 3GXTA 3NCYS 4LIQH 1R3LB 4PJCF 3DX9B 3U4AA 1ACXA 1MRCL 3SE3C 1YEHL 3B7SA 5JO5A 3JYBA 4XN1A 2VN3A 1UEMA 2IWKA 5GIRB 2Y7SA 3FO1A 5FKAA 4ACPA 4PJ9D 3W81A 1VEPA 2G0KA 2GUOB 3F65A 1V3JA 1OOAA 3U36A 4P2OA 2F74B 4DAGL 1EJ6A 4QF1A 4S0SD 4F93B 1FL6B 1N70A 2X1QA 3FOMA 3MJ7A 5CEZD 2EXYD 1IZKA 1UVQA 5HI3C 3KPRA 3F12A 3BZ5A 3TZVC 2G5UA 5F9AC 1MY7A 2X4QB 4BCZA 1CXHA 3EAKA 1T7XA 2IALA 3MODL 4PRHA 4GAYB 6PCYA 2MCAA 1SGKA 1K6QL 3OAUL 1HHHB 2VMJA 2RQ8A 5I15H 1EXUA 4Q9QH 4EMZA 1F4HA 1MFUA 4U6VL 3KPOB 5GPRA 3B34A 3FT4A 5C6TH 2V7HB 4FAAB 2F5AH 4ILDA 5DK0B 4DESA 5IHUH 1GMIA 2Q3ZA 1JTTA 3P0YL 3LB6C 3QIWD 5LCVH 3IVKA 5A2BA 4J8RB 1QLFA 4PJ8B 2E0PA 4J28A 2F1BA 1A9EB 4S1QL 4KTDL 4WK4B 3UTPD 4PJHB 5FO2A 4AVIA 1CYGA 2ZCHL 5TE6H 1E3FA 1OGPA 1FYTA 4JW3A 2EDXA 1MXDA 2R2BA 2K8MA 4AE1A 4YK4B 1J9QA 5EUOE 2IF7A 1EHKB 1IKNC 3TNNA 1UM6H 1UT9A 2NLJA 2X9XA 4L1TA 4HT1L 3VWJA 4IS6B 2GJ6B 4WI4A 2F7PA 1JV5A 3N9GL 2FDBP 3TN0D 4F80A 4WHCA 2PXYB 1J8RA 5BOZG 4HUWB 3ZSTA 2DIAA 4HALA 3NSYA 5BO1L 4L5FH 1JNJA 2F5BL 1JPGA 5DURB 4JMXA 5E9DD 4X6DA 2N56A 5EBMA 4DPBX 3AM8A 2WZ6A 1WHPA 1B88A 4ZPTA 1CGUA 5FGCB 5EZLA 3A6BL 2HVKA 2XZZA 3TO4D 2KC0A 1T0PB 3B1TA 5FM4A 1GY1A 4OD1L 4QHPA 4YSQA 3V95A 1AQKL 1QQDA 2ZG2A 3PNWA 2GC7C 1KB5L 3CZNA 4U0RB 2LVCA 3BD3A 1QZNA 2Y23A 1ZS8A 2QQNL 3FF8A 3ULUF 1KCUH 5LN8A 1W0WA 4XO3A 1U4FA 2X3CA 4RETB 1H6TA 5T1KD 3HE7A 5E1QA 1EMTH 5B39G 4WHDA 3V0DA 4F2EA 1KBVA 2ICEC 4Z7WA 4BK8A 4PS4H 3W1ZA 2F9BT 1RZFH 4QHMA 1ZVNA 1FSKB 5L7XL 1S5IH 1TZOA 2BIHA 4LL1A 2CCVA 5EEXA 2FHFA 4LKXA 4P3WA 3ISYA 1QRNB 1EZVY 4N2KA 5FUOH 1ZXQA 1OAQH 2H0PA 3UGUA 5DJ0A 2F58H 4M1GH 4GMTH 3B6SB 4HSAC 1Q0YL 1TEFA 1BQSA 3QDME 4RIRA 4GQPH 3LN5A 2OX5A 3C6LB 2AQ1A 1FFTB 1I75A 4GO9A 3L2MA 2X1XR 1E5ZA 1EJFA 1D5MA 2WJ5A 2C9QA 4P4KC 2X1OA 4KOCA 4KRPD 4X6FB 4FLSA 3ZHNA 5DRXA 4PRPA 1A7NH 3LNFA 1BREA 3BUQA 2IDCA 1JHTA 3PWNA 5D1XE 3QO1B 3WDHA 1UZ6F 4JG5A 3COOA 4NBXB 4BBWA 1FAIH 4LEEA 2ZKYA 1A7OH 5DS8B 5GGVY 2W65A 6FABL 5BV7L 3NFPA 5EA0L 5M94B 2C7UB 3FCBA 2FX8L 4PSRA 4ZFFA 5BMFH 4DP4X 3ALPA 3G5XA 2X41A 4RGMB 4XNYH 2A73B 2A74B 5LO7A 3ARDA 3FTSA 4Z3HA 1JMXA 4JRLA 4UQAA 5GGVH 4MZ2A 5B3JE 1FJ1B 2DD8L 5B3SB 4UTBA 1BJ1H 4G7YH 5C0IB 4PJFA 3FTUA 3PHOA 4YVUA 3MCLL 4UQIM 5GS0D 2ALWA 3FO2A 4F33B 3ATDA 5EOCH 1CLZL 1XH3A 5LWYL 4S2SB 1QNZH 4X7CC 3G6DH 3ZJAA 3KPNA 4BSVA 2X4OA 2YXMA 4NCC2 3SO5A 3VXPB 5F6IC 1CFQB 4G71B 3SPGA 5CUSH 1EAQA 1I9RH 1RVFL 4TSAH 2XKSA 2DQIH 4H4NA 2Z35A 4BE6A 1EHXA 4NQCA 1MVUB 5FW6A 4GI6A 1UACL 1MQ8A 4LCVA 4NO2B 1CTOA 4AGOA 1Q9WB 1QPKA 1L9RA 2A6KB 3FAWA 4I0CC 2VQ4A 4GIOA 4X9GA 4IRJD 2KPWA 3HAEH 2XZAL 3D39A 1FVCB 3DX0A 4PRAB 4QRRE 3JWNG 1NUFA 4YC2C 4FS0A 5DU7A 1CDCA 4LLWA 3F7KA 4J2XA 3LDBC 4PVMA 1O7DC 3DX1A 4BSWB 2L7UA 4GG8B 5FX3A 1J0YA 4WW2B 3L17A 5HXMA 5L88L 2NSMA 1R3HB 3GXDA 3RI5K 4B96A 3HPLB 2QZ5A 1YEGL 3QO0B 5EZIL 3ZTCC 1TCRB 3FT3A 1I1AA 4WFFE 5IVOA 1RU9L 4RNRB 1CFSB 4JG1H 3VD3A 2DKUA 4HZ1A 2KMWA 1U3NA 3O0RH 1KPUB 5FGRA 3GKWH 2OSWA 4DEWA 1QA9A 4FI7A 3GMOB 3NFSH 3FSZA 4X5LA 1OQXA 2IG2H 2HJKA 3FH5A 1KB3A 2ITCB 3OQRA 1TTCA 4PJ5B 3OQ3B 4YSOA 1VFOA 2VR7A 3NJGA 1A7PH 4QTIL 1I7TB 3F64A 4MCZA 4FNLL 4LSQL 4WENB 3VVWA 1DJXA 5CBAB 4UM8A 4NM4H 4CC0A 4G6MH 4XVSL 5HPMB 2OMZB 4YSTA 4G1MA 3FO9B 1AQDB 3BWAB 4V1DA 4XP4L 4JPSA 5MERA 1RURH 1DEEB 3GMMA 3IDGA 3VI4A 1C16A 4DN3H 5K59E 4FFZH 2R39A 5IB4B 1TQCC 1A4KA 5J3HC 1UD6A 1KLUA 4UM9A 2J25A 1RIVL 3I6LE 2DJUA 1WD8A 1CG9B 2ZJSH 2PCFB 2IFFH 2ZXWB 1QVOA 5I71C 5EO1B 3ULVH 2DDQH 1ZWIB 4JHAH 3K1DA 2R2HA 2WQXA 3CZFA 4OFVA 1VPOH 4Y4KD 2PCPA 3BN9D 2H7WA 3O3BA 4R0LC 5GZNA 4Z3GA 2DQTH 1IGCH 2W0FB 4EIUA 5HHNB 1BPLB 1RJZB 4WJ5A 3WNLA 2CLVA 3OC8A 3ELAT 1X9RA 1NIDA 2GVYA 4XXCA 5FGBA 3GSOB 3VRIA 1KENH 3K8LA 4ZO6A 1S9VB 2EIDA 3L9YA 4P05A 2OMUB 2YSSB 1GS8A 2WC7A 5CFAA 3EJSA 4NS0A 1BGXH 4X8JB 3MLYL 2YGVA 4RAVB 3SKMA 2OL3A 3HUJB 5FYJE 5EU3A 3L8QA 2GABA 2CO6A 4K3EH 4XE5B 4JO3L 1CXIA 2BPBA 2GJZB 43CAB 5IVXA 1JJUA 1KCSL 3WEBA 3NN8A 5KYWA 3RJOA 1T21A 5I1CL 1OY3B 1NUDA 4NZDA 1MFEH 3AWFA 2YAQA 4PP1D 5GJSH 3KWXA 3LRSA 1XL4A 4HUUB 1IM3D 2MCPH 5C0DA 4IBLT 4YHML 5KOVC 5EO0A 1OALA 6PAZA 4XPFL 4Z7UF 3SCMD 1GS7A 4AQOA 4U1IA 3TGXA 3O2VL 2HT2D 4L8SA 1F90H 1F5WA 2IAMB 3QT2A 2DWXA 3S8WA 4HC1A 3RBGA 2AEQH 1O5PA 1LO4H 3NJFA 3ZYZA 3EUUA 2J4WH 2XWDA 5CXPA 2CO2A 4ELKB 2CM6A 4FLHA 3GSQB 3CLEH 2WUCL 2BZDA 3IFNH 4GINA 1XGZA 3L54A 1G0YR 4R26H 4JREB 2JKTM 4JHVA 3GSVB 4KHXH 5CJXA 3PS6A 2FECI 3MRIB 4IEFA 3FN3A 4RA3A 2D8KA 4HJGB 5MP6H 1UXMA 2COVD 2MPAH 4KVNH 4PB9L 4XCFH 2VO8A 3HC4H 1TPXB 1SN5A 1ZT1B 4HS6A 3BVWA 4TUOA 3PL6B 3BESR 3T3PB 3EDKA 3N2JA 3B4NA 4JFUA 3S97C 4C56B 1OPGL 2YBGA 3TCLA 3U4BL 3UXFA 1KSRA 3DGDA 1GZQA 2QPFA 1NZRA 4C4UA 1WAAE 1B6UA 4KTGA 5EZJB 1T89A 5I9QB 5C3LD 4CBZA 3MRPB 2MOVA 5LNGA 4N2HA 4XWOD 3M6DA 4PJ7A 2ZAGA 4PRIB 3CFCH 1BIIB 4FXGA 2LABA 3LOWA 3LX9A 1BBDH 2QVTA 2XZCH 2ZUQB 3ZKXC 1VADA 5EO9B 3LZQA 3HPJB 4S1SL 3CHSA 2C1PA 4OFDA 5E5MA 5F7FA 5A7BA 1K4DA 2XN9E 4S1RH 4G6KH 2CHNA 4ZMZA 5ICXA 4JFOA 1EWHA 5CZXD 2EIZA 1DFXA 4XOCA 1U95A 1CE1H 5TDOB 5T1LB 3OKMB 2VDNH 4MZRA 2X2UA 1R4XA 3CU7A 3DYOA 3UTSA 2CR0A 1QSFB 2RA1A 1DVYA 2GTWA 2JQAA 2G9KA 1AQ8A 4FKEA 1Z5YD 2XG4A 1DTUA 4G1EB 1UM4H 1KXVC 1Q1PA 3G5YB 5C71A 4KV5F 3HLKA 2QADD 1RK1B 3W0WD 3O2DL 2CK0L 5ANME 4EIZC 3C9NA 3U30C 1GA2A 1PKQA 2Y06L 5CMAB 4NO5A 4MCNA 4TNVF 5E6SB 4UTAH 1YY8A 2K9FB 3EGXA 5KANG 4CVZA 1ILSA 4NP9A 4ORGA 1T2XA 4WJKB 3VGDA 3EF7A 3H9SA 3IMSA 4ZS7L 4WVRA 3BLBA 2KS0A 3PGCA 4IU3B 5ALBL 3TPUB 5GGSB 5IVXF 1N2RA 1K9TA 3N85H 1XB8A 4EUPA 1NWOA 3CHRA 1L0PA 4JAMA 4XPAL 4Y8AA 3ZDXE 2CLZA 2HVJA 3HHSB 3UTTA 1J1OH 4U1NB 2FATL 2CDFB 4QHUA 4P5MB 2PTTB 2AQ3A 3FL7A 1I1RA 3BLKA 3PQYA 3UL4A 1ZJBA 4OF8A 4L4TD 4D2NA 5FYLE 1G0DA 3BW9B 1FNEA 5FK9A 4RMBA 5KN5A 5TTRA 3T4AA 5D4QA 2WO3B 1NGYB 3KBFA 4H20H 2ZWNA 1F6AB 2VQ1B 4PG2A 4WFHD 4WIQA 4K9JA 4GH7B 2D7NA 1OB1B 4K7FA 1PZSA 2UX6A 4R4BA 3EGSB 4XNQB 4F8LA 3QXDB 4A7TA 1U2HA 1UA6H 1NA8A 2AV7B 1G7HB 1EGJH 2R29A 5HSFA 1QI3A 1JZ5A 3KVPA 2CO7A 3KNBB 1M1XA 2WINB 3LHPH 3U0PB 2R8SL 1IAIL 3QQDA 4QI3A 2KHAA 4EPSA 5AVWB 2EUZA 5IB3B 2YPVH 4ODXA 1YN6A 3HZVA 3UBXG 4APQB 4MD4A 1LVEA 5EPMA 5I74C 4DUXA 2A7BA 2YPLE 3BFOA 3BKCL 5GHWH 3QEQD 4UQEA 1ES0A 1E42A 2H3NA 2VWEE 3G5ZA 3RVVD 4I1NB 2EDQA 2AJYL 4JFFB 4NQSA 4NQQA 3BPCA 4ZOCA 3M45A 5DJCB 4A6YH 2HLFD 2FWUA 1JPTL 5C9JB 3BVNB 3G04B 4F9LA 1TQTA 4PLOB 2BVOA 1XF2B 4MA1B 3KG5A 3B3IA 4RBPK 2ICWB 5SWSA 2ITDA 4FFYA 4XGZA 3EYOB 2XWTA 4RGNC 1T3FA 2FGWH 3CTTA 3FTXA 3P0VH 3W9DB 1KIUA 1A6TB 3OKKA 2DJ4A 3ARPA 3BDBA 5LQBL 3VFVB 3AQDA 1Q0XH 1UXLA 3QEGL 1E4WL 4Y4HA 3UTZA 3B2UC 4TVSa 3T2PA 2BIPA 4GP5B 3RYMA 1KTDA 3BAIA 4H1LH 4OF5A 3TVMC 4BUGA 3BAWA 3F00A 1BZDA 4BKLA 1ZLVH 3S48A 2J5LB 3H2QA 3RAJL 2WBJB 2O61A 4M7KH 1FLRH 4FG0A 3UFIA 4LP8A 2ZSWA 4U05A 3WIFA 3RDTB 5J3HD 2IBGA 1YJDL 2IANB 5IB5A 3RZWA 1SJMA 2P8MB 2B1OA 4LLDB 2OYMA 2W9EL 1Z3GL 3APFA 3QJRB 1N18A 1Z9SB 3B2MA 4X6EA 5D7IF 1HKLH 3BKYL 3RWHB 4UNIA 3V6ZA 3QUMB 2BSRB 1BJ1J 1RH8A 1U33A 1WFNA 3UJTH 1IU1A 1UXWB 3UAEA 4YXKH 4UWQB 4H26A 1NCAL 3ZDWA 1P5UB 5EOCJ 4Z77A 5IESL 3T6WA 5GZOA 2ZX8A 4Y4FD 5G5DB 4Z9KB 4IRZA 1OARL 1MREH 2EINB 4WEUD 1CD0A 4Y9FA 1VB9A 2P8LA 3HOGA 2B59B 4GKSA 4D9LH 1OM9A 4PRNA 4LU5H 1ADQA 4I4WB 1YCSA 1HCYA 1QTSA 4HH8A 2BOCA 2FLRT 4HIJA 5ESAB 2DI7A 3V0WH 3EFFB 3SPHA 3GMRB 1NL0L 4ERSL 1J9SA 2VMEA 4MCYB 5LGHH 3ARXA 1BAFH 3ULVC 1AI1H 2NXZB 5HVGB 1OSEA 3CFJB 4TNWK 3MLSH 5ELIA 3N0AA 4OLXH 4QEGA 2FK9A 1BD2B 1OPOA 1K8IA 2FCBA 3KYNB 4Q6IB 3SBPA 4MXQD 3UABA 3SDCC 1ZK5A 3U6XS 4E41E 4O02L 4YDZA 4LEXH 3VH8B 3WFZA 1LK2B 2OR9L 5JORA 3BHBB 1IAMA 2J73A 5EF1A 1G7MA 3NIDB 4W4OC 1KXQE 1BZ8A 1UADC 1XIWC 3QEHB 3FBQA 3G6AB 1QOKA 2BIQA 3ETTA 3TP4A 3TYFA 1R5IB 1GR7A 1N9PA 1Z9NA 1T80A 1YN7A 3EYVB 2Z8RA 3HS0A 3QDJB 4ZDHB 4M3HA 2HJLA 3ARGB 3A5VA 4ELMB 4C54A 4XPHH 1YNKL 3REWA 1MQKL 1ETJA 4GSQA 3D07A 3VCLB 3QFJA 1HOEA 1KT2A 3ZE1E 3H6JA 9CGTA 1GGIH 3EZJB 1F3DH 5HGDB 2K3TA 5DHMC 4X7DC 5IMLA 1INEL 3EDFA 1SMAA 2C1OB 1BM3H 4DZ8B 3DSNB 3QXAB 4JKWA 2BVQA 3H85A 2FX9H 1GSMA 5IEKA 4AJVA 2AANA 5IB1B 2ZWKA 1PCSA 1FV1B 5KYUA 4D9RD 3L45A 3RUGB 5DUML 4CN4A 2P80D 3R18A 5B38G 4NUPA 2MFNA 4RRPM 1T20A 4KUZL 4ENZA 1KWKA 5A16B 5IROD 4PTUB 2PP7A 1U30A 1SJEB 5LNDA 1DJYA 2BHZA 5D4HA 1JGDA 4NQDB 1JL8A 3FUNA 3TV8A 4FQCL 4HWZB 5D6CB 5HYEA 3CDYA 4I0PA 1KFAH 5IVNA 3DX7A 1PKOA 2NNAA 3LXBA 3O8XC 3QC6X 5IP4A 1JZ2A 4X6BB 2XFGB 5HYJB 5EN3A 1CFMA 4FQQA 2HLAA 3FSWA 3ILQC 4L4JA 4LAJH 4O5LH 1TFHA 3BIBX 4ZUSA 1SXAA 2BCKA 3O9WC 3X3GL 4DP7X 3CGTA 4PJGB 4F57L 4AQ1A 32C2A 2EH7H 3A67H 3MOAH 3IFLH 4KBPA 4XP6H 5IJVA 4HDIA 3MUUA 1X7SA 3UEQA 2OV0A 2UX7A 4WI0A 3GIVA 4AUYA 3O3AB 3MJ6A 4X6CE 2QJDA 2QSVA 3GTVA 2FX7L 5F71A 3GHBL 4G3YH 4FQJL 3PXJA 5KS9B 1RUQH 1FDLH 3ABMB 3IGAA 5FLUA 3HRZA 5J6HB 3LRHA 3EBIA 3MNMA 1R3KB 4M7ZB 5EORL 3W2DH 5EN2A 1ZIAA 3I74A 3A3YB 5CGMA 4IDJL 5CD5D 2VDMB 4XMWA 3OMIB 3C87A 3AJ7A 5DEFA 1KUMA 3GJEA 5CGTA 2D2CC 4NYLA 5C0AD 2VXVL 2GITB 2MH4A 1EJOH 3WTUA 4ZD3L 4UDUA 2XJKA 5EF0A 2A1WL 3HG1D 4U2ZA 5EU6E 1MEXL 1NFIB 1O5DT 3QFGA 3Q8BA 4Q2ZA 5F93C 3OKOB 1O7SA 1JZHA 1N59B 2YRBA 2NY2D 1GS6X 1U8JB 2N3JA 3WTWA 4BH8B 4KKBC 5HD8C 2PYEA 3QUXC 2WB1A 5TH2B 4D3CL 3MV9B 2F53A 3BYYA 3T0ED 3H6AA 4U3SB 4HPOL 3ABGA 1AR1B 1TYEB 1ZRUA 2C3VB 5INDA 2QMJA 5JHMA 3GK8H 1N6VA 3RX9A 4WEMB 3KDPB 3BQVA 3MZTA 4K23L 4YDIH 5DD3H 4MMZC 3CFDA 4M7LH 4PBWD 3MKGA 1WZ1H 4QHNA 2OW7A 2R4SH 4ZFOA 5AYQA 2WQWA 5MEPB 3EBGA 3LEXA 5CZVL 3S6CA 1ZA6A 4H2CA 1YPZB 1U8QA 4XMPL 2AXGB 2OQJA 3U48A 3ZKND 3VRJB 1P2CB 1SDDA 1XF3B 1AE6L 4WEBL 4K8RL 4OFIA 2QVFB 4KNUA 1BZ9A 1R3JA 3BX7C 4NJAH 3T77B 2RACA 4DNLA 3QFDA 5IFJB 2QQKH 3NDZE 3TO2A 5G4NA 3C6EA 3FU7A 4HJ1A 4BH7B 1WT5C 2ESVB 1IJ9A 2GB2A 4IW4C 1GY2A 4E0RA 3MRHA 4NUQA 1NKGA 2DEXX 3KPSD 3UOAB 5IFAH 4XHQA 4S0TD 3AU0A 3VM5A 1T6WA 4QRSB 1OP9A 1AZZC 3ARBD 1AXTH 4JE4B 4KMTH 3WD5L 4ZS6D 3C09B 4AEIL 5E0FA 3QDGB 4RFEB 2E9JA 4CSZA 3A6CL 4Q9BA 5D4JA 5DD5L 1O7DE 4ODHH 2J1ZA 3PU7A 5GXBB 1QW9A 4PU2A 1W9XA 3NQIA 1MHCA 4GAJH 1AAJA 1R17A 5DUPH 3O6FB 5ERWB 5JDSB 2MNWA 1FL5B 8FABB 1VACB 3OKDB 3QNZB 3ZE0B 2R83A 4OQTA 3VU2A 3MLWL 2R1WA 3LZOA 5KSAA 5F7AA 2AV1B 2LHAA 1M7DB 5JOPD 5AOZA 3DRTA 4L8CB 3WV0A 1KIPA 4FCHA 4RMSA 1MDAA 3QIBC 4MQ7A 1C5DB 4GKNB 4GW5B 5C0GA 1S7VA 5B21A 1I8LA 1ZHBB 4YSEA 5A3ID 1QKZL 3F7YB 5I1HH 1QHOA 1IBGL 2AK4E 3GB7A 5FYJL 1QUPA 3KPQB 1QFWL 1NDGB 1KJVA 4MWFB 1FIGL 3HB3B 3KLDA 5BZWB 3KM1A 3LIZH 4AXWA 2HH0H 3LKSA 4F8PA 4ZMVA 3O4LD 5I0ZA 1T66C 2Y4SA 4QCIB 5TE4H 1SMDA 3JWNH 3MRCB 3MNVA 5T8IA 1BWWA 1PPIA 1WDAA 1ZY9A 4MNQD 2UXGA 2C3XA 1W2KT 1L6XA 2LU3A 1DQKA 2XA8L 4UMGA 2VN7A 1VDGA 1OGAA 3NAAH 1Z0MA 4ABWA 3D85A 2VLLB 2V7NB 2Q86B 5I1JH 3K72A 1RP8A 4K71C 1JHLL 3L6FB 4HX1B 1OK8A 1TMCB 3TNMB 1ZEAH 3DX2A 2WLIA 5JIPA 1I8UA 1J5OL 1R3LA 5I8OL 5FW8A 1Q9KA 4PSPA 2WZAA 3CHOA 3DX9A 1U6AH 4J4PA 1LO5B 1WQVT 5L2KE 5A2AA 4LIQE 2ROYA 2ETWA 4BFNA 2O93L 1HJBC 1UCBL 3NGBB 3WEXB 5GIRA 2VR9A 1YEJL 2QPEB 4X8XA 3WIHL 3G5WA 3WHE0 5HVHB 5J6GA 4GUPB 1CDIA 1J9CT 1WAPA 2GUOA 4RMVA 3VFSB 4FLQA 4GP4B 3TWCL 1YYCA 2QHRL 2HX8A 4KK9D 1J8HD 1HL4A 4IOSD 1FL6A 3ARFB 4U7KA 2O30A 2PUQT 2I27N 1MRDL 2R59A 2ZUSA 1QBAA 2FIKA 2YD9A 5F7KC 4OT1H 3UZQB 2OSLB 3T0WA 4J3VA 1OAKH 2VXQL 2OZ4L 1NFDB 2AXFB 2X4QA 3EO1B 2Z64C 4LVHB 4GAGH 4GAYA 4KDTA 3VFTB 4L3EE 1KB5B 1XCQB 3QI9D 1HHHA 2NY4C 2YKLL 4GY4A 2ATPB 5J56B 4JO4L 3VXTA 4CMHC 3MV7B 3MR9B 2H8PA 4R8WH 2XXGA 4JO2L 4DOHE 3KPOA 1CFNA 1NCOA 3AACA 1VJSA 1ZDQA 2DOCA 1KGCD 2V7HA 4TLKA 2G2PA 3ESVF 5C09B 5BS0B 5DK0A 5I1KL 3QYNA 5HDQH 2F2HA 3RY6C 3K2IA 4DUWA 2VQUA 1P53A 3LN9A 2Y1AA 4OGXL 4KKZA 4FJ6A 5B1CA 1A2YB 4J8RA 4PJ8A 4U6TA 1Y6KR 4Y16C 4IU2B 1U8KB 5HHQB 4G11A 3ZT5A 4AGPA 4AT6B 4PJHA 2NNRA 2OPCA 4XNZB 3BT2L 1GVIA 3N55A 1N10A 4QNPE 5IT2H 1PU0A 5DLLA 2VJ8A 3UPRB 3GSUB 3S88L 3FU8A 5FS5A 1HINH 3SODB 2Z93A 3KXFD 3QUZD 1CD1B 4FQ2L 2CUIA 3DO4A 4OZFB 2GJ6A 4K94H 3O4OC 1HH6B 1B2YA 2PXYA 2YHGA 4HUWA 4N2IA 4ZNEE 4W81A 5CHNB 3WFHA 4PLJC 2NY3B 2PPAA 4GIAA 3R4RA 3SO3C 4LPCA 2EECA 5T5FH 5BV7B 3MZGB 2QHLA 3N41B 2GI7A 3V4VL 4DERA 4V2CB 3IRCA 2OYLA 2IH3A 2VN6A 4Z3JA 3NJJA 1OW0C 4K7PX 3WXWH 1FF5A 2K45A 5M7QA 3OSKA 4PHZA 5IJKC 3MRNB 3CD4A 4DJMA 4EO5A 3FULA 4RFNB 2X38A 2WXIA 5FYLL 4LLMA 4NUJB 3U0WH 5DO2D 3L5HA 5FCSH 4FLRA 1Q1JH 3MBXL 1ZOXA 2APTA 2YC1B 3F6JA 5MEND 3BGFB 1A8JH 3V4PL 4M48L 1PTZA 3PG2A 3JZYA 4GB9A 1SLXA 4TS6A 1X9QA 4HOMA 4ZFGH 5T3XH 2W8CA 4OFKA 5C0CE 2GY7B 2UXVA 5A2KH 1QRNA 1C5CL 1MCSA 2I9LB 3BH9B 4LCWB 1ZVYA 3RVXC 4XX1G 3ZE2E 3NJIA 2CBOA 3B6SA 1HDMB 5BW7A 3EYQD 4KKBD 4CC4C 3P3YA 4TXVB 1M7IB 3C6LA 2NSXA 3FTGB 4JFPB 4MS8D 5LKNA 1MPAH 4J6RH 3BVUA 5AALA 4K5PA 4X6FA 1NGXB 2P43B 1FO0L 3QO1A 5FGSA 4JRFA 4JBSA 3UJJH 3VFMB 1CD8A 2SEBB 5JOFB 4Z7NF 3JWOL 4HXAL 5DS8A 2R27A 2Y1ZA 3VD0A 2WLYA 2C7UA 5I75C 1EO8L 2WVUA 5EU7C 4PI0A 3QZOA 5HYSG 4KZEL 1II4E 1BXVA 1UKSA 2AP2A 3C5ZB 2A73A 4YDKL 2A74A 4Z3IA 1JGLH 3ML8A 5E08L 3AC0A 1FJ1A 4LCIH 2YAEA 1JVOA 4FJYA 4QRUB 5L4FA 4UMSA 3BSZA 3E8UL