1GYUA

Gamma-adaptin appendage domain from clathrin adaptor ap1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
120
structure length
120
Chain Sequence
MIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
publication title Gamma-Adaptin Appendage Domain. Structure and Binding Site for Eps15 and Gamma-Synergin
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 21
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1gyuA00
1KYUA 1NA8A 1IU1A 1GYWA 1P4UA 3MNMA 3ZY7A 5CN2A 2A7BA 2E9GA 1KYDA 1W80A 1OM9A 2DWXA 1QTPA 1QTSA 4BCXA 1KYFA 5CN1A 1GYVA 2YMTA 3HS8A 2VJ0A 1KY7A 1GYUA 3ZHFA 1KY6A 1B9KA 2DWYA
chains in the Genus database with same CATH superfamily
1GA2A 4RGOL 4BFGA 2AEQL 3QRGL 3IBOA 5C07B 3KCWA 2V9TA 2AJZB 1CIUA 5EEYA 4HXBL 4YHIB 1FZKB 3QJSB 2BW5A 4L9LA 2BSBA 4W9KC 4AL8C 4A6YB 4R26H 1NUNB 3MA9H 1IC4H 3FB6A 4XI5D 2FDBP 3LHPL 4CN1A 3KH4A 4AQEB 1CR9H 1EWHA 1P5VA 1XDTT 4GRLC 5DD5L 2PCFB 4FLOA 1E5UI 3CDGB 1TYEB 5D2NC 1X5HA 1FLTX 1PYWB 3WIFA 1G6RH 2ZSWA 2GKIA 2X12A 4MJIE 1IKNC 4FD0A 4X9BA 4AEEA 4NC2B 4NRXB 2E7BA 1UXSB 2CDEB 3KLLA 1AGFB 1UCTA 4FFZA 4WO4C 1MRDH 2YFOA 4N6QA 4EN3C 5DK0B 4CMMA 3TV3L 3CGTA 3MCYA 5ACMA 1BEYH 4LAQL 1JBJA 1ZT4B 3CG8A 1TNMA 4KITB 4KRPC 1MH5B 2DIEA 5C92A 2C9RA 4OIFA 4Z7VF 4Y19B 4NRZB 1X5YA 5LXVA 4ZQTA 4U3HA 5E2JA 4U4IA 3SB3A 2ZX6A 3G6DH 4A04A 3WJMA 1RJZA 1UD6A 3DHJA 4PRPD 1KTJA 1MF2L 4BE6A 2NSMA 1TJGL 2ZXDA 3OZ9H 4UI2A 5KBKA 3KBEA 3G5WA 3RGVD 3ZKND 5CCKH 3BD5A 3QHZH 5IREA 1KXVA 2B0SH 4X6CA 2K3TA 4XP5H 1IT9L 4XOBA 2QGBA 4IJTA 4WEUD 4AVHA 2BY2A 1CLOL 3Q8FA 3IFOB 4WENB 3ZR5A 4RMTA 2O5XL 4TLKA 1JG9A 1IKOP 1R24A 3NAAH 2HG0A 3CHOA 1A7RL 1J18A 3TT3H 5D1QD 3GS4A 3A4DA 3S35L 2LAGB 2XT1B 4NJ9L 1Z5HA 4FQXC 1CJYA 5FYLE 4HJJL 4G8FB 4JRYA 1HHJA 3FULA 4H0IA 4I3RL 4N24A 1Q8MA 4DIXA 5L8KB 1W80A 5CEYA 2OR9H 3B8YA 2Y22A 2NTFA 3N1QC 3UAAA 4LSQL 1GAFL 1HIML 3S36X 2VLJE 3N1MC 3IJYA 3SD5A 3AT9A 4HA1A 4JHAL 3OKNB 1KELL 1HQRB 1NWOA 1QP1A 4UQ3A 4DVRH 5EIIA 5AW0B 1V7MH 2HRHA 4XVOA 3X3FL 4TLTA 3NACH 2WO4A 4P23B 1J0KA 4WV1C 4J3VA 4XNQA 4YO0A 3LSOB 1SM3H 3TASA 2J8UF 3RX5A 3RY5A 1UYWL 4OFQA 4I85A 2DLIA 4H8PA 2JKRM 1MOEA 1C5CH 4PP1C 1D5XB 3EGSB 3C6EA 4NQVB 3LKOB 3NT0A 1F4YH 3S5LG 4LF3A 5SWQA 2FEDD 3C8KA 2MH4A 4A6YH 2C1OA 4AYGA 5I8EA 2VERA 1FFRA 3MNDA 1OP9A 5D5ME 5EC1A 5KSBE 5JPMC 1TTUA 1WHOA 4KX9A 1R34A 5C0CA 3QNZA 4U6TA 4M8VA 3LXUX 3JV0A 1MPAL 2WUBH 2ZWZA 1XBRA 3ZTEA 1L9QA 4CNIB 4JPIA 2FGWL 5BMFL 4I9XA 5D2NE 3OF6D 1XSJA 1PDKA 4YK4C 4NKIL 3NEEA 1AKJB 3SY0B 2BP8B 3WJLA 5AKVA 2D0GA 1DSFL 1X5KA 4OCNC 5IW3A 3V0GA 3FT4B 4R8WH 1DJXA 4F9PA 3QJHB 1EFXB 1U6AL 3QQNA 4B7IA 2Q86A 5IW6A 4L1LA 3SKUD 5IHHA 4TQPA 4ZDHA 4DUXA 1I8IB 4OR1A 3PDOB 3G7TA 1E9QA 1XF3A 4LHUG 4L18A 4ODBD 4QRAA 3CPUA 1NCIA 1K5NA 1Z5LB 2HKHL 1T21B 5CJQH 3HAEG 2IPUK 5D6DC 4P9HH 3DARA 4U0RC 4Y1AB 3QQDB 4Z3TA 2WXPA 3P9LA 5IBUG 2O6EA 5E9NA 1BWMA 1MCBA 3QXAA 1JGLL 3LIZA 4EO5A 1X6LA 4HS6A 3IFPA 1J86A 3SKJL 2HTLD 3KLDA 4GS7C 5D2LB 4IS6B 1B3IA 2Y36L 4YLBA 2DV6A 5JMOC 4FFYL 3MLRL 1MXGA 4PGDB 2XHNA 2DAVA 1T1ZB 2CXKA 1R3HB 4E41E 1KGXA 3CXDH 2B1HL 2VITB 2DQHH 1FC2D 4NNPH 3QUZA 4B9FA 3HMWH 2XV3A 1JNLH 5AAWC 5DZNA 5HGAB 4M7ZB 1V05A 4RA3A 3M1BA 5DD1H 3UTPE 5HHQA 3UDWA 4HJEA 1HNGA 2ZYIA 2QGCA 1BZ7A 3NN8A 2AS5M 2XTLA 1U8PB 2GSGB 1DJHA 2ROYA 5KS9E 5FXCH 4XXDB 5JZ7C 3FTXA 4NN6C 1NC4D 3R1GH 5TE4H 1PZDA 4UDUB 4KKZA 3DIFA 1VSCA 1KDJA 4NNXB 2ADGA 4N2EA 5JPNB 1C16B 4X8CA 2HFEA 3BHBA 3QO1B 3HJ0A 4O02H 4JZOB 4ANWA 4HIHA 1A2YB 5CIPA 2NXZD 3C6SB 3TWCH 5D1XB 3AG3B 3NSDA 4HKBB 5L7XL 3GZQA 2ITCB 3Q1EA 1XGTA 4JFYB 5HSFA 1CE1L 5LBGA 5CU5A 1XH3B 2NYZA 5ICYA 1I1FA 2MCG1 3JV4A 4JO1L 4LEBA 3O3EB 3ZHLA 3GSWB 5SWZA 4ANVA 4HFUL 4WFFD 1IGFH 3DJRA 3MJGX 3SBQA 4AQAA 2HMID 3QR2A 3QHFL 1AXTL 1OZUA 4LCIH 3K6NA 4P07A 4PJEF 2VM4A 2CIKB 3L7EA 4GBXB 4LFHG 1MAMH 2W0LA 4K9JA 4BQBA 3WCYA 3ULUC 4WI5A 1A5FL 2ZCHL 1CI3M 4QOKE 1JNNH 2CWRA 2UY6B 5AB1A 1DDHB 2J43A 2P42B 3QXDB 3DTXB 3WD5L 3LRSA 1M7UA 2UYLB 3H85A 3UXFA 3KPRB 4AM0Q 4MXVF 1KIRB 4XWGH 3H2PA 4JM2B 4OBSA 2BHYA 4JY5H 4F9LC 4DPAX 1MF2H 1NUGA 2NUTA 5IR1B 5EOCH 3V0AC 1U0QA 1YNKH 2PYEA 2P24A 3V10A 4A7GF 4DW2L 4A2FA 3LD8C 4PREA 3BAEH 1XGYL 2EDTA 4DCQB 2QVIA 4WFHE 1SLXA 4XO9A 4AYFB 1GGTA 2WKOF 3RYMA 3LQAC 4E9QA 4XP6H 1NFAA 3P11L 4L1TA 2BZCA 4PV8A 4K8RD 4QR7A 4S0SD 3B2DC 2XV6B 2XG4B 4PJIE 3OR6B 1BLIA 3D4GA 5EU6D 4C57C 4XMVA 3RFZA 3F00A 1XH1A 3WFZA 3MCG1 3TJEH 5AW8B 5I82A 5DQ9B 4M7LL 4QMEA 2X5PA 3JV6A 1MWOA 4CSZA 1JWMB 2XA3A 5HYJB 3IXTB 2AZUA 1HAWA 3IFNL 3IYLW 2XN9A 4UILH 1PSKH 3TYGL 4RSYA 4X7CC 3QFJE 4UQCA 3F5WA 3L7FA 3M1CA 4I2XB 4EVNA 1AOZA 3PJLA 2LGNA 3KL0A 3NFNB 3GI9H 1T7XA 1T5KA 3QCUH 3K2MC 2DEYX 4FZ8H 3S0PA 4XVJH 4EIZC 2HXAA 2H7WA 1KCWA 1R3IH 1A7PL 3VXTB 2AQQA 4ZMOA 2BSTB 5C0CD 4H40A 2V5TA 3WFCH 3WN5C 1YEIL 4LEXH 2KLRA 2LR4A 5KTEL 3MLZH 3PREA 2FVNA 3O9WC 4J27A 1LEKA 3SE3C 1MJ8H 1OAZH 3RVXD 3MROB 5DYOB 5BOPA 1LO0H 4FFWC 1DSYA 4UM9B 4OV5A 4FF9A 4JMNA 1E9PB 1NCBL 2O5YH 4FFVD 1MPAH 4FA6A 1L9MA 3P3RA 4G7YH 4U31A 3FSWA 5HGGS 2WJ7A 3DVIA 1E50A 2G75A 4HWNA 4OFVA 2FJSA 1TMQA 3FQNA 3VFRB 5A3IC 1FNAA 4WHYG 2FO4A 4YDKH 1T03H 2CHZA 4PG9B 2NCEA 5IF0B 3L3HB 5L2KE 4NO0B 2YRPA 4XMWA 1OVZA 2CO1A 3FFCA 5K1VA 3MRBB 3FU5A 4UQ2B 3O0RH 3RKPA 3B9KD 1WG3A 1KTDA 4ONGH 3ESMA 3WTUA 2VQUA 1UKQA 1UA6L 4BFKA 4L8CA 3P9MB 4Y9EA 3HAEB 3PCYA 1AQHA 3VXOB 4C56B 3GUFA 1V54B 5C07A 2WUCH 4JFDB 4LLAA 1YPZE 4MB5A 1WEJL 5I71B 2OCFD 4YHIA 2ZX8A 3EDFA 4TQEL 3DX0A 4MNQB 4A6YA 4BYHA 3TZVA 3LRGA 2WVSA 3NSCA 1PG7X 1INDH 2J57A 2WBJB 2Y36H 4R90L 5AOMA 4DN4L 3NA9L 2PCFA 3SYOA 1NCHA 3CDGA 3OQRA 3PWJB 4NN7B 3K46A 4YUEL 1CGXA 3ECQA 2H4EA 1TUPA 2PTUA 1UJTA 5JHDD 4JDZB 3TNNB 5BRZB 2B1HH 1VPOL 2GEEA 3ILDA 2PPCA 2X9ZA 2YD5A 1UXSA 2CDEA 2KZWA 1LDSA 3ASWA 1AGFA 1BA9A 5I0VA 1N12A 4IBQA 4CBPA 5HJGA 2GJZA 1H8NA 3L1OH 1N4XL 2XSKA 2ZOTA 4P3DB 3TN0C 3V55A 1MCWW 4PTTA 2JCCB 1A6UL 4XB3A 1CVSC 1IGCL 2CJUL 3LEYL 3B7SA 2AK1L 4MS8C 4W4OA 3VTAA 1TO5A 5IKCB 3DMMC 4Y19A 1B4LA 3EJSA 1I1AC 4NRZA 2A4ZA 3ZY7A 4HW6A 4XPBL 2AI0L 3VDBA 2ARWA 3BOVA 4AY0A 2ARJQ 2R1WB 5CEZH 4PGCB 2IADB 4WZ9A 1AHKA 1AOHA 4W68A 2HSIA 2WWMC 2AQTA 2BOCB 2AJUL 2WBXA 1RPKA 3H3KA 1DBML 2EVJA 3GF8A 1XF4B 5L0QC 5EF1A 2UZIH 3PG2A 1IQWH 3LKSB 3J7HA 3ZL2A 2BXYA 2A9ML 5D71L 1G7LB 3IFOA 4KVNH 4NWUL 5KBMA 3T4YB 2WWKO 4F7PB 4X8JA 3HNTL 2P5ED 3EH2A 4PJGF 4Y2DD 4LSVL 5D7IF 5E1GA 3CTTA 4WEBL 3A24A 2OR7A 1NBVL 2ATPA 1A5FH 2YGQA 4ZMAT 2ZCHH 1HWGB 5D7JA 5HHMB 3JWNC 1ANUA 1TSHA 2PYED 4GP8B 4ONFL 4M3KB 4HPOL 5JYMA 2EDDA 4JG0H 4G8FA 4XP1L 3E2HC 3LHAA 2VR7A 1CDJA 1M05B 4OLVH 5ERWA 1NLBL 3GJFK 3NJVA 4Z7VE 2DZEA 2IXQB 3BGMB 3G5YB 1HKLL 4JKNA 3OKNA 1HQRA 1XGYH 1G9EA 1S7QA 2IG2H 1KLFB 1HYSD 1UH2A 4IKNA 3R7QA 2ZG2A 2OPCA 3BT2L 3DOHA 4P23A 4W6WB 3U2SA 1UUNA 4ADIA 4PCSA 4JL1A 4S2SB 1RXLA 4M8UA 4JDTH 3BSGA 2C3WA 1G43A 1TXKA 3KLSA 4HWZB 5GRUL 2EUVA 5J57B 3T8XB 3NZ8B 3E0GA 4ZUUB 1J0YA 4XGZB 5EU7E 3EGSA 4FL4B 4NQVA 3LKOA 3C2SA 1IAMA 2IWEA 2XN9D 4G9DB 4PRIA 2SEBA 3W0WB 3CSYB 1UZ8A 1ACYH 4XNUH 5JOPD 4WCYH 2WNXA 1WC7B 4G7QB 1G1OA 4RGNE 3LRHA 4JY6B 1IC5L 1U9KA 3ALXA 4XP9L 4CN4A 1DL7L 1PKQA 2CO6B 4OTXH 1GHFH 4CNIA 3D9AH 3OX8B 3TYGH 3QQ3B 4UUJA 1DQMH 3TPKA 4WSKA 1IAIL 5I1CL 1MVUA 2BP8A 4L5FE 4ZTPH 1E8WA 3NABL 5DGQA 3I9AA 5F7LB 3T2LA 3SDCC 2WBKA 2AV7B 3FT4A 3EOAB 7CGTA 5FOBA 4AQ1A 3QJHA 1EFXA 5F7HA 3BVNB 3W56A 3VFOB 4HZAA 4QO1B 3V6OC 4AZ8B 5KTEH 1I8IA 4I0KA 1AZRA 5GZOA 4MCMA 1U3JA 1CYWA 1Z5LA 1T21A 3EH4B 3KPNB 1IEBB 4FE9A 4WTWA 1NCBH 3QQDA 1HNYA 3F12B 3CCHB 3KBFA 4R97B 4Y1AA 3W37A 1MFDL 4U1HB 1TLKA 4BUQA 3FFCD 2B59B 2XXFA 4IS6A 5D2LA 3GBNL 1MIML 2X40A 3FNKA 4P2YA 4Q7DA 3VWKC 2PPEA 2KPNA 3CQFA 4PGDA 1HAUA 5T1KB 5E4AA 5TFSL 4KROC 1R3HA 4UTAH 2E74C 2AEPH 3ARGC 3WUWB 1JGVL 1YDPA 3QDJD 5EA0H 5GRZA 2QELA 5DD3H 5FYKE 3CN3A 3TBWB 3VXSD 5FCUH 3HS8A 3ZDYF 2QQKH 2I26N 1T83A 4GXUN 1UA6H 3TZVD 4ZG1A 1U8PA 2GSGA 4UZUA 4MJ6B 3D69B 1JIBA 3WS6C 2WLZA 2CHDA 3FH7A 4NNXA 5DMIL 2XUWA 4X5WB 2BNQE 1C16A 5CR1A 3LQAH 3NSYA 2FSEB 3QO1A 3DPDA 2WK2A 2A1WL 1EMTH 3B2UC 4G1EB 4JZOA 2J55A 4X6EB 1A2YA 1AXIB 1RUQH 4R90H 3C6SA 4PSRA 2IQ9H 5T3ZL 4HKBA 1E5ZA 2ITCA 2IV9A 4UWQB 4B41A 5CU9A 3VUAA 1R6VA 5KSAB 3MLXH 4L29B 5IROA 4MCYB 1TFPA 4P46B 4Y19D 4D9QE 4HAKA 4LCUB 3L3OC 2V7NB 3GSNB 2CIKA 5I6PA 5KVFE 4XWOC 1ZHBB 3PJSB 2Y2WA 3KWXA 1PFOA 2AK1H 4WO0A 1KYFA 1U3HC 1CFNB 5E51A 2DW5A 2NYYD 3QXDA 2NY5L 1F4WL 2IANB 1AGEB 1XTMA 2AI0H 3DTXA 3KGRA 2UYLA 3FCTB 4KTGA 2GG1A 4PWIA 1KIRA 2CD0A 2YZ8A 3QNYB 4JM2A 2AQNA 4Q74A 1A7NH 2I60L 1ZSHA 2NCMA 4HQQH 4YXKL 5IR1A 2O1AA 4HJ0C 1JZHA 2X4UA 2FT8A 4WW1B 4BFJA 3QIBB 2E27H 2RIKA 3VQMA 3T0EB 4GRWB 1WZMA 2DD8H 1NMBL 4QRRE 2HN7A 3GLZA 4LOVA 5D7JD 1GC1H 1BOYA 4NWUH 5DRZB 3FPYA 4FFYA 1JI2A 1IIIA 3OKLB 3TCLB 5IFHL 2J88H 4C55A 3RIAF 1AS6A 1NOAA 3DVNB 4X50A 1G5AA 2XG4A 3MRFB 3OR6A 3WFDH 5EFIB 3G9VA 5HYQA 1NBVH 1XB3A 2QZQA 2Y2YA 3K2UL 4OBRA 3CDZB 4ONFH 2JI2A 5DQ9A 3O4LE 2QQLL 2ESVD 5C0IA 4NWTL 3C5JA 4W9DC 1TYRA 4PJEE 4UOQA 4XP1H 3U0WL 1JWMA 2ED9A 2CU9A 2FX7L 4HWBH 5HYJA 1QRNA 2AK4B 3KYNB 1F6AB 4FC3E 1I8AA 1HL4A 3HLAA 2WNWA 4G8GD 3Q5TA 5AAMA 1TZHB 4LLWA 3LPOA 4NC1E 1LL1A 1UM6L 2Y6SD 1CICB 4OVVA 4TLSA 3MFFB 4A7QA 5MHSD 5L4MA 4P2OC 4WV1A 2H1PL 4XCYB 3FUIA 1A6ZA 2CUHA 3BT2H 1AGCB 3C5ZC 1OSZB 4PRID 3LVTA 1W0VA 5JIQA 3HKFA 4YHNB 2VLMD 1JHLL 3NIGB 4U3SB 2VDOH 3OR7B 1Z9PA 3J07A 1WAEA 1YEHH 3P77B 3VXTA 3LS4H 1OCWL 2YKLH 4BRJA 3B43A 2KHAA 1MCIA 5EBLB 4KXBA 4ODTH 1LVEA 4G70B 4PVNA 4Z0XA 3WOVA 3ML8A 1E9PA 1D7CA 4PJDE 3SSGA 5GZNC 1NPUA 2X2HA 1S3KL 1KBVA 3AT8A 2ZCZA 1RZGA 4HJTA 2DWDB 1OKEA 1IZKA 4MWFA 3GMPB 4NIKB 5TQ0L 4WJKB 1EFXD 3EFFB 4FXLA 1RCYA 3QEHB 1G0YR 3TP4A 1DBKL 2OBGA 2UWEF 3JVGA 4KUCD 2H6PB 3ZDXF 3QR1A 3VFRA 2EILB 5ILTH 4JKMA 1OM3H 4JDEA 2WZPA 2IEPA 4PG9A 3SCMA 5GZOD 5CSGA 5IF0A 3DX7B 3L3HA 4NO0A 5KYXB 3O3DB 3GSNH 1D9KB 2OW6A 2X9XA 4Y5XC 3BAXA 1HK6A 4UQ2A 2A77H 2OX5A 1JFQH 4BFFA 4OCMC 5CM1A 4NI6A 4PQXA 2UXGA 3RTQC 4Y1AD 2BPBA 4LPUA 1GPOH 3OG6B 3BZEB 1I8LC 1NFDB 3P9MA 1KXHA 1MDTA 2VYRE 3G3LA 3RJQB 1OF0A 4C56A 1WT5A 4N0RA 2AQ3A 4AMXA 4JFDA 1WFTA 4GSDL 3D5OF 3QDME 4LQFL 4G6ML 1UOKA 2QMKA 3SO3B 3MGTA 1A22B 4OIIH 4OJCA 4APXB 4S0HA 1WSST 2J25A 3C60B 3PQYB 1NCGA 3QRFM 4Y2NA 2WBJA 2XCMC 4UU9A 5HVGB 4YBQD 1JJUA 4LLUB 5IMKA 4ZYKA 3IAGC 3QJOA 3WEOA 3PWJA 4Y5YB 2HT4D 4K5OA 1VFMA 1MW1A 3FTGB 3V0FA 1CFVL 4BWTA 4JDZA 3MRJA 1UEMA 3TNNA 3VW3L 3JWNH 3QC5X 1JGVH 3T65B 5L4FA 4BQCA 2A74C 5EOTB 1K85A 1T0OA 2BHFA 2OZ4H 5D7LA 2IWGA 2YAHA 3HBZA 3BUTA 1BEXA 1XSKA 4WEMB 1UATA 4GRLD 3ATFA 5HDBB 4A1RA 3IJ8A 1U8MB 5TH2B 2WXJA 5A1AA 4NYLB 3GBLA 1UC6A 3IM1A 4DPCX 5IKCA 5HHPA 5GISH 3ZGIA 2DQ6A 3E3QC 4NPJA 3ZQXA 4E5XG 5KANG 1N0XL 5AZUA 3PU7A 4H0HB 4EUPH 4WO4D 2X4NB 3L5IA 4MXQC 2R1WA 4KKPA 4PGCA 3LB6C 3CU7A 4MQ7A 4BQ8A 4EN3D 4JB9L 1PQZB 2YEQA 4PJFA 5T3ZH 2EKSB 3PP3H 2VKWA 4M6MH 4UQBA 2CR3A 4KRPD 3U25A 2P3YA 1WBZB 4KQ4L 1AP2A 4N1HB 1XF4A 4M1DL 1RSYA 3G6JF 3S88L 1Q94B 4K7PX 3IPEA 3LKSA 3OB0K 1I53A 4NQEE 2EVFA 4P5RA 1KPUB 1T6VN 3CHXA 5L4IA 3F7VB 2O93L 3T4YA 1NH6A 4X5QA 4F7PA 4YFEA 3HC2A 4KGJA 5EU4B 3FH8A 3FUMA 4TRPH 1UD8A 2CKNA 4UTAA 3CFDB 4IIQC 3UO1L 2VUYA 2RCSL 1KFAL 4YS4A 2VDMH 5CP3A 2FJUB 1N64L 4OD2A 1NCUA 2IFFH 2NY4B 1ZDSA 1A9VA 4FXKA 5G4OA 4ZZFA 5TF1H 1HHKB 5C9JB 3QUML 2WQSA 5LNEA 3G5VB 4JZNB 2DKSA 1MY7A 2GY7B 2YSTA 5FA3B 3WYRA 2QQNH 3UJIL 3KE0A 4B96A 4ABQA 5BO1H 3BGMA 2HVBA 3G5YA 2X89A 5D6CB 4GB9A 4HZLB 1DYZA 4U49A 1KLFA 3FU0A 5D93C 4HDIA 2RR3A 3N42F 4FQXD 4F7TB 4TL5A 4NQQA 4F2EA 3ARXA 2VSMB 3HVDA 2Y07H 3MV9A 1IFHL 3IAQA 3NZ8A 4OJEH 4ZUUA 5DA0B 4IM8A 1QRND 2FH6A 5CLWA 1NCAL 1QX1A 2WLMA 5B39G 5DC9B 4WNSA 4M8RA 3RWIB 1D7FA 3K2UH 3O3UN 4DO6A 4HH8A 3L4YA 4JZJB 4G9DA 4N0CC 3W0WA 4LVOC 3WXVL 3JTSB 3GD1C 2ODIA 3AS1A 4RMSA 3EADA 4PJGE 1KBGL 4HOWA 1KCUH 1IM3B 1WC7A 4DT2A 5I6OA 2C4FU 4JY6A 5FYJH 5CEZD 1O7SA 4O4YH 3BH8B 2CZNA 2YXVA 3Q8CA 4KJYB 5F9DC 2CO6A 5CXPA 4M56A 2RQEA 3F7YB 4FQQB 2ZPKH 3B3IB 1PAMA 1AHWC 4PP1D 4Q6KA 3MBXL 3CX5K 1OAUH 5L88H 3OX8A 3E6HB 3V0VB 2E86A 4QXWA 2H1PH 2JJWA 3K1KC 2CJ3A 2C4FT 4JG9A 4BELD 4Q6IC 3P1VA 5JOFB 2XZCL 1RURH 4XMXA 5C0AA 2NNRA 2AV7A 4ZMQA 3EOAA 1N7ML 5C08E 3U6XS 3WY3A 2NNAB 3NFSH 4AQ8C 1KB9J 4RRPG 4BKLB 2P8LA 3IMUA 4QO1A 4K0OA 2CBTA 2WXFA 1OCWH 4L4TA 2XA8H 5F1NB 2HT2D 4OAWB 4YH6A 5SWSE 3HN8A 4QF1B 3GT6A 1DFXA 2KT6A 3HI5L 3LH9A 2LAAA 1JZ6A 2QKIB 3KPNA 3I3EA 1UZ6F 4PS4H 2H26B 2WZPD 3SCMD 2IBZX 2BZ7A 3F12A 3CCHA 2OP4H 4XVSH 4U1HA 4BK4A 4D7PA 2B59A 1A7QH 3WENA 3FB7B 1EGJH 5IFAL 2R29H 4Z7OB 3B9DA 3QUMB 4FULA 2DQDL 3CE1A 2F1EA 3BXNB 5LGHL 1B0GB 4NP4L 1UJ3B 1ZVNA 1XGPA 2AGJH 2N59A 2Y1VA 5F1SA 3WUWA 3RJOA 4IJ3B 2K8QA 4FNQA 3TBWA 2EECA 4WFGE 4JKLA 4HIEB 1Q90A 4H5SA 4EDXB 5I8KL 1PLAA 3BZDA 3UTSE 2YGVA 4FQLH 2LLGA 3INUL 3MGOB 4MJ6A 4LE8A 1WZ1H 3D69A 4DH2A 4XVUC 1X9RA 1W72H 2QADC 4X5WA 4ZRGA 3LNGA 2BY0A 4K9EL 3I3BA 2FSEA 1UWXK 1FL3B 3QJQB 4X6EA 3UMTA 1YECL 5D7LD 1W0WB 3VQ1C 1T2XA 3VFPB 2P48B 1E5AA 2RMNA 2M26A 1MSPA 2Z0BA 5LAXA 2BY1A 5JZ7D 2WC7A 2DLGA 3N44B 4UTBL 3JUYA 3IKKA 2HUEA 1PJ9A 2FSDA 5KSAA 3VDCA 2HCZX 2F7IA 2HVJB 4LLMB 3DDFA 4P46A 4G9FE 1ZRUA 4GG6F 1FNEB 3NOIA 4XMPL 3AGWA 1J1PH 3RVVD 2GUOA 2V7NA 4NUJB 3GSNA 4TM9A 3IN0A 1XIWC 2E0PA 1DE4A 1T2QL 1ZHBA 3PJSA 2KERA 4OSUL 2OTWB 2Z8RA 1ML0A 3V0JA 3HG4A 5C97A 4PJ6A 1Q9KB 5GGQH 3U0TB 4BWUA 5DJDB 3ZDYE 5H8DA 1ES0A 4KOCA 4WGKA 1BD2E 1AGEA 4KFMA 1SOQA 2ZG1A 4YN3A 3FCTA 3UC0L 1FL5B 3E8UL 3DOSA 1BBDH 3QNYA 1L9TA 3NIDF 3RI5F 1E2WA 1OGAE 2X3AA 4WW1A 2VGLM 5EC2A 3ULUD 3QIBA 1HZLA 2BMKB 1NDGB 4GEIA 4U1KA 3A6BH 5CSBA 3F62A 1DDTA 1H3GA 4JG1L 4GW5B 5B7EA 2WSPA 5DRZA 1G9HA 4OM1L 2WVUA 4M02A 3OKLA 5G2NA 4AJ0A 3D39E 3T04D 1JHTB 3DVNA 3VH8B 5EFIA 1AO7B 2RCSH 3NJKA 3PHOB 4PGJA 1ZVHA 1A6VH 3ATBA 5AZ2H 3QYMA 3CDZA 2BIQA 2X89D 2XPZA 4LVNC 3FSVA 1WV7T 2IBBA 4NPYB 3B9EA 2DKUA 3KYNA 2AK4A 1F6AA 3BYYA 4HEPA 1LO2L 1QSEE 2N1TE 4G42B 4UV4H 3VD1A 3MV9D 1T3FA 3MFFA 4N2HA 4BZYA 4EUPA 2VNCA 5ICZB 2F7RA 2VXSL 1AGCA 5E94A 2M83A 3WXWH 1OSZA 2EYRA 2V4LA 4YHNA 3W0WD 4U3SA 4DGUA 5B4MC 2DQIL 3EYUH 3SJVB 2UX6A 2J8HA 1MNUL 4FHBD 2PXYC 3P77A 2JQAA 5I6XB 4ZFOB 5I6NA 2MCPL 1HSAB 5AOZA 3TT1H 2NQCA 1RP8A 5F9JA 3CXHK 4HC1H 4R5XA 4G1MB 1YEDA 4ZW6A 1TJXA 4AEIL 5DMYA 5AVXB 4E9VA 1LO3L 4MMXB 5I1IH 3MLTA 4RA0C 5BJTA 4MDIA 1MRFH 2X0VA 5E8NB 3MVSA 2B77A 4HBCL 2GJJA 2XPGA 1OANA 2ZYSA 2XN1A 1XCTB 2DWDA 5C0AD 2XC8A 3PL6C 1PEZA 1YEFL 3GMPA 4G2AA 3EFFA 3FN9A 1UWGL 4CC1A 3GWJA 2OYLA 4U6VH 3QEHA 4BGLA 3NCXA 3O9WD 5IUCA 3ZE2B 2CHNA 1JRHL 2H6PA 2JTDA 4L4TD 1OOAA 4OLXH 1KB5B 1MHEB 2J73A 3UBHA 3NRPA 3DX7A 4KKQA 1H3UA 4FFWD 5D55A 2APTA 3O3DA 3LNFA 3VXUB 5KYXA 1ZSDB 4NZRH 1A6TB 1D9KA 4NUQA 5EOQL 4ODXA 1Y0LB 5GGVL 4QXGL 5CGYC 2J21A 3F7RA 4B3VA 3K74B 3F7QA 4C4KT 2B15A 3BZEA 2VDRH 4H88H 4QHLB 4DFHA 5CZVL 4X4XB 1NFDA 4NEHB 2X7LB 5A3ID 1E2VA 2XRAL 5INDB 4FQ2H 1R5WA 3GRWL 3OM3B 5IB4A 1OARL 3PV7A 1Q4NX 1QBMH 1UM4H 3SE4C 4OF7A 4APQB 3IVKB 3EYSH 1JZ7A 1R3KB 1NKGA 4APXA 3JYBA 3ARZA 5C0JA 1QI5A 2NSXA 4QHKI 3C60A 2R69H 3PQYA 3VSQA 4HOMA 4XZUA 2WYZA 1BAFH 2FH8A 3BVDB 3H54A 4U6XA 6PCYA 1C8PA 3AQYA 3AB0B 1F4HA 1Z0MA 2K78A 3LMJL 1E9OB 3WY4A 3BWUF 1AXSA 4Y5YA 3RB5A 2A9NH 4NP4H 4CN6A 1ULVA 1QPPA 5LCVL 3BKYH 3VI3B 3M8OL 1ZLUH 1S5IH 2EH8L 1P5UC 4JG5A 2UWEE 5EOTA 4XPGH 3ZDXE 3VXMA 1NGWB 1IV8A 1CK0H 5JO5A 4DESA 2PR4L 3T3MF 15C8L 1EFQA 5TDNA 5AB2A 3QZOA 1U8MA 1MN4A 1UA3A 4NYLA 4X4ME 3SYAA 2MFNA 4IRJC 2FGZA 2ZOLA 3X11B 1G9ML 4ZK8A 2V5SA 2D8KA 1PW3A 3JWDL 4KU1A 2G5BB 4JRXA 2X4NA 4DAGH 4UQAA 3L95A 2E6JA 1WS7A 2MPVA 2WCGA 2XWTB 3TN0D 1DVFB 2EKSA 3RIAK 4U1JB 4PD4K 2WLNA 5KBNC 4HPHA 1THAA 5J6GA 3FU8A 5IVXF 3GZPA 3BH9B 4MS8D 1Q94A 4JFFB 2I24N 3IETB 3DMMD 3P4NB 4KKBD 3ZSTA 4GMSL 4ICWA 4C8XA 4N2OA 4GIOA 3BQUA 4OJAA 3AXIA 1EGJA 2C4XA 1KPUA 2R29A 4XE5B 2OXGB 1U8CB 3F7VA 2LV4A 2VT0A 4IRZH 4A2MA 2X05A 2Q7AA 1T20A 1HXMB 3PGFL 1T80A 1LEGB 4AGPA 5EU4A 4QAWA 2R2CA 3LXCA 4EJ1C 1U8NB 1IAKA 4XC3L 3ZE0B 1CXFA 4WI7A 3UAJA 3ROLB 4RAHA 4U1LB 5CN1A 4KVPA 1HHKA 3C09B 5E5UB 2Q1EA 1KB5H 4ABVA 3G5VA 4JZNA 5MENA 3MDJA 5FA3A 1GJWA 1A47A 5D6CA 5DFVD 5JXAH 5C3LD 1P4BL 3ZR6A 3Q05A 5T5NG 2A38A 3D4YA 3NJXA 5L8LB 1MCHA 4HZLA 2FK9A 3GXPA 1RLBA 5HYIA 5L9DL 5KSVB 2X44D 1KG0B 4F7TA 3WTSA 5ANME 4CJ0A 2NY0B 2W38A 1AR1C 1K3ZA 3VFTB 3A4AA 3WS3B 3G6JE 3QK0A 3VQLA 5CO1A 1I7RB 2VXUL 3RWIA 5HYFA 1LJMA 2ITDB 4YC2C 5E70A 4JZJA 3UACA 3BIKA 1B9ZA 1EJ8A 2DLEA 2XWRA 3JTSA 1Q1JH 3EJTA 5FYLL 5H35A 5A2CA 4KHXH 5AKRA 1IM3A 4IMLA 1ZV9A 1FE8H 3S37L 4N0YH 5F9OL 2WP3T 3KPPA 4KJYA 5DT1H 3ULSA 3UP1A 1P4IL 4NZUH 1MCEA 4P2OA 3VB9A 5E6IB 2AJXL 3STLB 2EDKA 1IGIL 3NCBB 3E6HA 3V0VA 5G4MA 3VG0H 1KN4L 1UXWB 3UJJL 2FWUA 1S9XB 5JOFA 2Z31C 4AYBA 2ZYRA 1NMAH 4AEHL 1GR7A 3Q9PA 4HJIA 3TBVB 3L6FB 1E27B 2NNAA 1RIUH 3OLGA 2R0LH 4MJIB 4OZ4B 3SPCA 3SDDB 2LTQC 4YWGL 1ND0B 3HG1E 4DZBA 1DTUA 5F1NA 2RB8A 2AJYL 1CXHA 1VADB 2X4QB 3AM8C 4OAWA 5CINH 4QF1A 4AEIH 5HHVL 3AY4A 4LPWA 4OB5L 4D8PB 2XQBH 4ZS7L 4LPYA 2LT9A 3SDCD 1YEGL 5J6SA 2H26A 1KCRH 3CUPB 3AU0A 3ZKMC 3HHRB 3GTVA 4N2CA 1TZIB 5E9DE 3VMPA 1OPGL 4FP8L 1QKZH 2EIZB 1KACB 4OKVB 1CU4L 2EDQA 3V7AE 1NEZG 4CGTA 3FB7A 1M2VB 3DYPA 1JRHH 1VA9A 2MIZA 5I1EL 3QUMA 3FQ1A 1P84J 3FO2B 4AX3A 1ZK9A 1CLZH 3BXNA 3AREC 2MJWA 1B0GA 1E7VA 1UJ3A 2OMBA 3QZWG 4FEIA 1KTLB 2ZCKH 3FU9A 2ZICA 2BLFA 3P30H 1IE5A 5DK3A 1RK7A 5FKAB 1L9SA 3ZPDA 4CKVX 4TUKH 4QXGH 1BSIA 4M6AA 4TNFA 4HMEA 4ODUB 1OB0A 5D4HA 5JQHC 5CZVH 3ZRCC 3VWKD 3MGOA 5HYEA 2F54E 3L2MA 1TTAA 2MOVA 2NT1A 4KROD 5CN3A 1QUPA 3ARGD 1KV7A 4LSSL 4RGMB 4LL4A 4Z9KB 2DIAA 3MLSL 3O4OC 3FCUB 3FFDB 2DM4A 3KNBB 1IBBA 2GQHA 3KLHC 4PJ9C 2UUDK 4KK9C 1FL3A 2ZKMX 1JDAA 1HQ4A 2EINB 4TVPE 3FU7B 3WFHA 3FQUB 3O41B 2ZXAA 3VXMD 3VFPA 3RHWF 1NSNL 4XNZC 1E43A 4JVWA 1QZ1A 1FAKT 5D7HA 5I26A 4S1RL 2TRYA 3P73B 2VLJB 3SYCA 1D2OA 1G1KA 1BAWA 2KQMA 7TAAA 4S1DC 3F01A 4J3TA 1XB6A 1UB6B 2HVJA 1DJYA 2WXOA 4Y1TA 3B2UD 4RISL 4CILA 3ETSA 5EIVA 3VMOA 1JL8A 3BKJH 3MRPB 2IGFL 4OCXH 5JLZA 5C7XL 4JRXD 4ATTA 5M95B 4U1GB 5KVMC 1RK0A 2GCYA 3H3PH 3GXDA 3NDYE 3PNWB 3SBRA 5EO9B 5ISZD 15C8H 3ZHNA 1HT6A 1PLBA 2OTWA 1DEDA 2NDFA 2FZ3A 1Q9KA 1LO5B 2DQEL 3U0TA 5DJDA 4UZSA 4DETA 4ES8A 4YQXL 3KLAB 1CFSB 3I84A 1JV5A 1CZ8H 2CGYA 3JZ7A 1PCXA 5D5MB 2C3VB 1ZTXE 3BQUD 3QJVB 3MODL 4MMYA 4P9MH 2ZKYA 2NY6B 1CB4A 2ZAGA 3MRGA 4XWOD 5EF3A 1NDGA 5D2NB 1U3HD 2R69A 4IRSC 2F1BA 4LHQB 2WLIB 3O6FB 3UYRL 3L16A 5F7KC 4YSSA 4D7BA 4E42B 4L8BA 2EEXA 3OHXC 2J7LA 1OSPL 2H32B 4ORGB 4M7JH 2NY4D 4WF7A 3LZNA 1JHTA 2VO5A 3VH8A 1HXYA 4HJ0D 1D5BB 4ZMVA 3ECUA 1AO7A 5MEND 2BJMH 6TAAA 4UIMB 4RSVA 1UUSA 1VFOA 2YD4A 5F96H 3OKOB 1N0LB 1TQBC 2GTWB 4NLHA 2PO6B 4XN4A 1JF6A 4NPYA 5JOEA 1P4LB 1UVQA 1ZTMA 3T77B 2P43B 2VISA 1VFAA 2CLVB 1WITA 1C5BH 4JAMB 4G42A 4PGBA 1P0SE 4WY7L 4M7KH 4OZIA 4TUOB 2X42A 4PJXF 4FDWA 3VFVB 5DHYA 2BHUA 2F53D 1EO8L 3EIFA 1NCOA 2P5WD 4O58H 3JBG7 3NIDE 3W39B 4ABUA 3RWCB 1TQUA 3H9SE 3SJVA 3T0VA 4Q6YA 4XHJC 1FZMB 3QCVL 3ZKQD 4E41B 4ZFOA 1WFNA 1HSAA 5DZLA 2A9BA 4DK3A 1N6QH 2AAVA 4G1MA 4P2OD 1IM9B 2ALWA 4I8DA 5DS2A 3QZPA 5IM7B 1D5IL 3KPSE 3OWRA 3D09A 3X1EA 4MMXA 2AANA 3QQ9C 5SX5K 3C5ZD 4FX5A 3NA4A 2BIIA 1Q72H 2Y23A 2WCPA 4YHZH 3QS2A 5E8NA 4BCXA 2BVTA 4FAAB 1AHWA 4FQ1H 2XOTA 3CBRA 2YMXH 3VM7A 1IBHA 2JH2A 5KN5B 1IGJA 1XCTA 5F6IC 1TO4A 1XMEB 2AJXH 5DEFB 5E0QA 2QGEA 3ZYJA 4X80L 1F45A 4X42A 3VTTA 3K71A 3HE7B 4DNLA 4R7XA 1ZGLP 1RU9H 2UZPA 1KB5A 2WINB 4DQAA 1MHEA 4GW4B 4ZT1A 4AQ8A 3CLEL 4AEHH 1J9QA 3VXUA 3GMLA 1XSOA 1A25A 3FS9A 5GZND 2YEZB 1Y0LA 1N67A 4LCWD 4P57A 4TV3A 2ZKHH 1WAPA 2CIIB 1F3JB 4DKAA 3QHTC 3V0WH 3U4BH 4QHLA 2BFVH 1RHHA 5C6TH 2X7LA 3ZIMA 5INDA 4U6YB 1DJWA 2D7NA 2BS8A 4O2CB 3ZYIA 4APQA 5KYUB 3AS3A 1R3KA 3S37X 2C9VA 4CDHA 4QOKB 4X0KB 1YCSA 2XBZA 3RTQD 3QJUB 3BVVA 1K6QL 2B1AH 3HPLB 2Q0ZX 2MCAA 4MNGA 4B5EA 5ACLA 5GQBA 1OTSC 4IK7A 5AAPA 1E9OA 4LQ1A 5I28A 5D4IA 5BV7L 1GZHA 4HKXB 1GJUA 3QZWB 4MCZB 3SOTA 1KLGB 2EVHA 4X0NA 5I1JL 3JZYA 4PVBA 2YUZA 3NTCL 2EE3A 3TCTA 3ULUL 1NGWA 1MCNA 1WIPA 2R0KL 1BQRA 2FE0A 5JR1L 1JPST 2DBLL 1GZPB 3FT2A 3GB7B 4FTDA 4R7NB 1W8OA 2R0ZL 4WFEE 3RI5K 3W9EB 3NH7L 3OKMB 3WAKA 5KVDE 4PJIB 5ID0B 3PAVA 3T3PE 3OBAA 4ZXBC 5LGJA 4QRPE 2QSCL 3ME0A 3QE5A 4N68A 1KJVB 1XGQB 2QFPA 4YDIL 3X11A 5CCJA 1J9CT 5LXGL 3LXBA 3VFNA 3MV8E 2E7CA 3ORJA 3GLDA 2XBDA 1LHZA 4B9JA 4KNUA 3NIFE 4NGHL 1SJHB 4XCCL 4LMQI 5B7FA 2XWTA 3LKNB 1NSNH 1OSEA 4LDOB 4XR8C 4LP5A 4BD4A 3KWTA 4F15C 4DOHE 2Y7SA 5IB3B 1MHCA 1V27A 2C7FA 1R47A 4NUGL 4JFFA 3P4NA 3VGEA 3HIZA 1SXCA 4GAJL 3QFJB 5GS3A 3L4XA 2K6YA 2C5DC 4MXQD 4QI3A 1IL1A 2OTPA 3CBKB 1HXMA 3LB6D 1LEGA 5AZEH 1E8ZA 2X3CA 4QNPF 5BPPA 1EAJA 5IMOB 1A3ZA 2A4CA 3GKWL 4JE4B 1F1AA 2PCXA 3BMVA 1B0RB 4DKDC 2CK2A 3IE9A 2FAUA 3NJHA 3US0A 1TTFA 4PB0L 3G6AB 2WOYA 1LO4L 1FSKC 2Y2TA 2HJKA 2VN4A 3GRWA 4XVTH 3T3ME 5EPMB 2KC0A 1F6FB 1JK8A 2RGSA 3S3DB 4LCVA 3WE1A 2F8XC 4EIGB 5JDSB 3MV11 3AFLA 4R96B 5IW1B 2C1PA 35C8L 1NIAA 1BMZA 3AMKA 1W2KT 3GZOA 1KG0A 5DO2D 1OP5K 2VLKE 5F1IB 3ZKSD 4K71C 2V2WA 1HEHC 3ILQC 3OLEA 1CD9B 5I9QB 1FIEA 5L2KB 5BV7B 3FUFA 4IKJA 3VFTA 1WLHA 5IVXE 3WS3A 3UX9B 3VGAC 2JB6B 1NANH 4F8LA 2YJQA 1RUPL 3IEAA 5I5MA 4CDGC 5LCVA 3SKNA 4RZCA 2NR6A 1V8HA 2ITDA 3GBDA 1E4XI 1Y7VA 2DM3A 3FUDA 4MSWB 2BERA 4K3DH 2BP5M 4L3EA 1IAOB 5EZLB 5I8OH 3DJZA 1HFUA 5KVGH 3WTWA 2VM9A 3JWNG 4NAQA 1CBJA 3GJFB 1LM8V 1O7DE 1YPZB 3GMMA 1F00I 5E6IA 4WY7H 3STLA 2AAAA 5I24A 4GAGL 5JORB 1A02N 2WNKA 1KF9B 1ZDQA 3FQTA 3S48A 1MCOH 4HH9B 3GHEL 3QARA 4N0CD 1UXWA 1R1CA 2WQUA 3EG9B 2X9WA 2NX5E 3AMLA 3FUEA 3QZLA 4GUPB 3UZEC 4F58H 3TBVA 1UOVA 3L6FA 1BQ5A 1E27A 2X2IA 1QFWH 4MJIA 4OZ4A 1P53A 4EUPG 1UOLA 3SDDA 4HD5A 1CXLA 2PWFA 2Z34A 1PX4A 3HHSB 1EAPB 5FW7A 2X4QA 3H53A 4P8QA 3K72B 5ABAA 5CR8A 4D8PA 5I17B 3KH3A 2ZF8A 3KD4A 4J3WA 1HINH 3TA3C 4MMZC 3D85B 1HE8A 3CUPA 4I18C 4H8QA 4YE4L 1TZIA 3VXUD 1OALA 1Y18B 2EIZA 4OKVA 3KYAA 4KZEL 4Q9RH 2FL5B 3E9UA 3VD0A 2WSKA 3KPMB 4W70A 4W93A 3OJMB 2HKFL 5K33A 3J8F7 4L5FL 3LY6A 4RFOH 4WKZA 1KCLA 4H20H 1BLNB 4HS8H 3FQ4A 2IDUA 3FO2A 3DO3A 4NC0B 1AQMA 1ZPUA 3TPUB 2OMTB 4JO2L 2CJTA 4IBVA 3DXAD 2WLKA 5FHBL 5FKAA 4ELMF 4APQD 2Y24A 2HH0L 2AV1B 5EZOH 3SDXE 1P9MA 5BNXD 2AQ2A 1M2OA 5DHVB 1CMOA 2YOAA 4NZDA 4B9GA 1UD2A 4ZUVB 2YPLE 4YHKL 2VLLA 4NQSB 2KI6A 1UASA 2PPDA 2CJSA 1S7TB 1NJ9B 4TYUA 4OIAA 2OK0L 1BQLL 2ZXGA 2BOLA 2NY2C 3MAWA 3E7JA 1F56A 1RZQA 5KZCB 3KNBA 2PCPB 4NCC1 3SBPA 2MQ3A 3U4KA 3APMA 1DQIA 3DGGA 4BA0A 3FU7A 4IKIA 4QHNB 3ZE1F 5C0BE 2IH8A 2K6WA 4I13B 1ROCA 2VLJA 4Z7VB 1ODUA 3B5GA 2WVVB 1U41A 1MQKL 2D03L 4XVUD 3ULVF 2EDYA 5I74C 5L4JA 2HFTA 2FX9H 2YA1A 5FYKL 3IU4H 3TURA 1UB6A 2OYKA 3FSZA 5JNYB 4HF5H 4M5ZH 3RX8A 6FABH 2VR8A 1G9NH 2X87A 3B2MA 3MRPA 3BP5A 2TRHA 1M3IA 1CO1A 3T6VA 5EO9A 3M1OA 2K9UA 2XTJC 1PG7W 5AG9A 4CADB 1LO5A 5AEAA 3PUCA 4TSBL 2W0PA 3TEWA 4N8VG 1S7RB 5D5MA 1EZLA 3HB3C 3BW9B 1BZEA 5KSBA 4PJCA 4RGNB 1ZLEA 4ZMZA 1R0AL 1W8EA 1A4BA 3CFUA 3GHPA 3NZSA 1MLBB 1FNSL 4NKQB 4N6RB 1XMWA 3O6FA 2R4RL 1KEML 4KZ0A 4RWYL 2JKTM 1QWUA 1U58A 3NPSC 1MUJA 4E42A 2H32A 2WZ6A 4ORGA 3THMH 1G87A 3IT8D 5HYSG 4M93B 5ESVB 2EE6A 5F0LB 5H4YA 2W65B 3RJDA 1U8HB 2ORBL 1D5BA 4MQTB 3WUZA 3F58L 1HCZA 4CGUB 2C3GA 4UIMA 3MZTA 4BBWA 1SEQH 3ZTJG 4TTDC 3OKOA 4WEEA 1GKOA 3QIWC 2DWXA 1I1AB 2PO6A 4WJ5B 3JVFC 4FEMA 3CC5B 3OKYA 4RMUA 1P4LA 3T77A 4N2IA 7PAZA 3RZCC 4ODHL 2CLVA 4JHWH 3HR5B 4JAMA 3QFGA 4R3SB 1MCCA 1MCSA 3IDMB 4JKKA 4TUOA 5A2BA 4FYQA 1ZHKB 3VFVA 4IHBA 4LP8A 5HDWA 1WWWX 4NDMB 5FDWA 3HE6C 1MCRA 3RWCA 3L4UA 4L3ED 4B9CA 1MFUA 5HY9A 1JZ2A 1FZMA 1NKOA 3GC3A 4E41A 3QEGL 3MNVA 5IEKB 1OQOA 1P69B 2NW3B 1IGML 3OGCB 4L8SB 1FORL 3ARUA 4N90D 1I3GL 1IGTB 1A8JH 1XR8B 4IOIB 3TFKC 5IM7A 1NCJA 3UC2A 2ZOWA 2BDNL 3IFLL 3PPEA 3GXUB 1BFSA 5KS9A 4YX2L 5B4MD 2EJ1A 4JFOB 2TSBA 2PXYD 4CVXB 2BS71 5KN5A 1FHGA 4R0LC 3T4AB 1J87A 5FFOA 1QNIA 1OGTA 5DEFA 2BNQB 2V8LA 1CF1A 3BDXA 3LX9A 2F2HA 4NXKA 3SDDD 3UTZB 4YAQB 2VSCA 2VMDA 3PP4H 3GHEH 4J3BA 4S10A 3BKCH 4UQDA 4Z95L 1WWCA 2EIJB 1PZCA 2WINA 3A47A 2R27A 1T7WA 2DS4A 1KIQB 4HUUB 4LO9A 3A22A 2CBOA 4QUOA 3A5VA 4GW1A 1JXDA 3EDKA 5IESL 2YEZA 4OLYL 3PL6D 3LVEA 3PHQA 3ARBB 1F3JA 2C9XA 2AVFA 5G5DA 2X6AA 3FHAA 5DVMA 1YNLH 1JV2B 1OD9A 3DV6B 4P4KB 3E1F1 2HRPL 3NGBC 4PAZA 1RERA 4U6YA 1CDYA 3RHWK 4JM4H 1WK0A 1KYOJ 3S96B 1ERNA 4O2CA 3GSXB 1ASOA 1JPFB 2WYIA 5KUMA 4TSCL 4QOKA 4PY7B 5IMMA 3MRHA 1YEWA 3NCMA 4OQTL 3HW7A 4JMXA 5I6LA 2E6QA 3HPLA 1MG3C 5EO0B 4V1DE 3OPUA 5HP5A 3MJ6A 4L5FH 3SKMB 4B0MB 4EN2A 4E36A 2HJFB 2GITA 4MYPA 3WTYA 1RVFL 5ADPL 4HKXA 2DQGH 4MCZA 4R5TA 5EORL 4LSRH 2CO7B 1XAKA 3EO0A 4MHHI 2P8MB 2BVQB 3BWAB 3HBGA 1T4KB 4QRRB 2OMUA 4HK0B 4WVRA 1GGIL 1ZLSL 4JY4B 1KJ2L 3RVUC 3FOMB 2BP3A 1A3LH 3AWGA 1GZPA 3OC5A 2MCMA 4R7NA 3W9EA 4XT1C 4PJIA 5ID0A 5EZIL 4ZO7A 2NY3B 3WKYA 2CLZA 2XY2A 3UG5A 4GAYB 3HMXL 1KJVA 2VC2H 3IMVA 1XH0A 5IQOA 4X98B 5IEHB 3O4LB 4JK0D 1FGNH 4IIZA 5DVPA 1X44A 4PJEB 3WNPA 1C5DB 3MRCA 1FF5A 3U1PA 1LEIB 3KXFE 4NO2B 4NNYA 2EP6A 2PWGA 5DXWA 4ZTOH 1MQKH 3K5RA 2X6CA 4JO3L 4YSDA 4IRJD 3FO9B 1DBJL 3E1ZA 5HHXH 5E9AA 3BCDA 1NZRA 3QFJA 3H9HA 4ZFFA 3RWHA 5E2UL 2WMPB 3AACA 1T0MA 3LPFA 3OAZH 4HIIB 4L48A 3FTSA 3RDTC 3QPQD 1HEZB 4Q56A 4PG2C 4L4VA 5IMOA 5J9PB 3POCA 2B39A 4G72B 3VRJA 4DK5A 4KGLA 5C0EB 4A7SA 1QABA 2CDFB 1B0RA 2WQVA 2X9YA 3V4UL 3OZKA 2OS7A 5ITFA 3I6KB 1OWWA 3ZO0A 3G6AA 4LL9A 2FB4L 3FYEB 4P5TA 4AIXA 1ZOXA 4DGWC 5ICUA 3O2WH 3SGJA 1B2YA 2N4IA 3VSVA 1I9IL 5KAQG 1HH9A 1JE6A 3DBSA 3KDMB 4KC3B 5EPMA 3TH2T 1HWHB 3REWB 4AZUA 4JJOA 3EO1B 5JDSA 5IW1A 1KWGA 4R96A 3P3UA 4LEEA 4FI6A 2IAMC 5D7KE 2UVEA 2OSYA 4Y88A 2VUKA 1PNCA 1QLFB 5AVRB 5JHLH 4JL2A 5DURB 4BSVA 4GG8A 4RMVA 1KEMH 3EOTL 5F1IA 3LRKA 1SHMA 3KPRE 4KXZI 4ZAKC 2CUMA 1HN1A 1WCQA 1RIHH 2JB5H 4TQIA 4G6AD 5L2KA 1BX2B 3EHBC 2GYSA 5F89B 3VD5A 1I3VA 3WIHH 2ZYHA 5IY5B 3EBGA 2X0WA 2JB6A 3UYOD 5KVFH 3FSOA 5K59F 4FTVE 1WRFA 3N9GH 3L45A 2BS9A 2VXVL 2IGLA 2VOTA 5CCGE 5FUOH 1SYVB 3PGCA 4I5BB 5EZLA 1IAOA 1OP3K 3KR3L 3HUJA 3DHUA 2EO7A 3WMSA 1DQTA 1AR1D 3GJFA 2IWKA 1UM5H 4J8QA 1YPZA 1H3PH 3HI1B 3QDMB 2GTZB 1I7ZB 4FNLL 4MGXA 2XETA 1NMCC 5JORA 1SEBA 1TVBB 4XE0A 2VO8A 4HH9A 4JFWA 4DUVA 4NM8L 2COQA 4JQXC 1UD3A 3EG9A 5F71A 3SQOL 4X7EC 3PYCA 5GGVY 5E8EB 1LDPL 1O6SB 1QBAA 3V5KB 2WHVA 1F3RB 2DQMA 4Y5VB 1RZJL 5I16B 5IG7B 4BZ1H 1FIGH 1WGOA 4IOFC 5JIDA 1IGMH 3HZKB 1CN4A 2J3SA 4XOCA 2VR6A 1EAPA 1PU0A 1B2WL 1FORH 4GAAA 4YFLF 1LTXA 3K72A 4KVCH 1X9LA 4NOBA 3WDIA 5I17A 3ULVC 3U0PB 3UFIA 4AK2A 3NVQA 4L0ZA 1HHGB 2Z31D 3D85A 5EUOF 5EEZA 1BF5A 1JXGA 3RVWC 5AWNH 4PV9A 1E42A 1GYVA 3IGAB 5AVQB 1FV1B 1Y18A 2HVKB 2YA2A 3EJZC 1C1EH 4KY1H 3RRQA 3KPMA 4CU7A 1N5YH 3CK0H 4AMKH 4F20A 3QORC 5BXFB 5MEQA 1PD1A 1ILSA 3ARWA 4F2FA 1H6TA 3B9AA 3ZL4L 3TPUA 2OMWB 2ZX9A 2OMTA 2H3XC 2EXYC 5ETUB 5IB1B 2UZXB 4M4RB 1C12B 3ZKMD 1ZJBA 4X5PA 1HC1A 4ZOCA 3BE1L 3QDGD 4X5RA 5I5JA 2AV1A 2VQ1A 1YQ2A 5DHVA 5AOLA 4LSUH 2RACA 3FCSB 5IJCC 4Z8FL 2MQ0A 4XMKL 5EG6C 4ZUVA 2XWJB 1CLYH 2R7EB 3ARED 1O6TA 3E9TA 2H9GB 4N0FB 1S7TA 5EV7A 1NJ9A 1ZIAA 3CZLA 3EJYC 2G2RB 3WNKA 1X5IA 1J5HA 2Y1AA 3OXRB 1RZFH 1A8ZA 4V33A 3IXAA 2G5RA 3WFEH 5GGSY 3OGOE 5F3BB 4NCC2 4QHNA 2CKBL 4EF3A 4U7MA 3NCCB 4RBPH 4P5MA 2M2DA 4EPSA 4N8CL 1DZBA 3LV3B 3QUYC 3GPSA 3IGUA 4KPHL 4OLUH 2VDPB 3TEYA 4ZNEE 3KLHD 4KK9D 2EDHA 1GGIH 1ZLSH 5JQ6H 2VERN 1G0DA 2APWA 2NW2B 3BAJA 5DHXB 3NEXA 3WNIA 2F18A 4MA8H 3WFBH 3MBEB 1F90L 4K94L 2OMNA 5FX3A 3IDYB 4HMCA 4PI0A 3NSJA 4K73A 2YBRB 4L3AA 4ELME 5CJXA 2F0CA 5BRZE 4OV6F 4MAYB 3WKML 4CADA 3JUZA 3L81A 1AFVL 4ACTA 2O4EA 1K2DB 1N10A 4LGSB 2BIOA 1V3LA 2QPSA 1JYXA 1S7RA 2FBOJ 4OUUB 4PJGB 3BW9A 4WW2C 3QFJD 2YQGA 5IQLA 5HHOD 4XH2A 4W9EC 3RWJB 3EBHA 1FFOB 4ODVH 1A4KB 3ETBF 1YC7A 1MLBA 3AITA 4L4VD 2W0FA 1ZVSB 4HT1H 4YXLH 4OLWH 3CVDA 3ZMEA 3O45A 1MJ7L 1DBJH 2DPKA 1A7OL 4K23L 5E2UH 4MBRA 2XN0A 4L1DA 3V0HA 2A74B 2QDVA 4N2BA 2VTFA 2JELH 4P5TD 5C08B 5ESVA 1O7VA 1BVOA 3D25B 2D7TL 3IJSB 2W65A 4DP6X 4OZHF 3Q2VA 4JPVH 3QG7L 2IQAB 1S8DA 1WD8A 3KVPA 3I50H 2Y7QB 4IRSD 5FHAL 1VGKB 5SWSB 4IDJH 4WGVB 5I15H 3BPNB 2FATL 5IK3B 5DJXB 3WJJC 3T5WA 1GYCA 3SQBA 3N40P 1IMHC 3EYOB 4G6JL 3HR5A 1KGYE 4WTXA 4Z0BH 5L2KD 4WI6A 3QP3A 3IDMA 1BVKB 3QI9C 1CGVA 3L5WB 1ZHKA 2XVLA 1CTOA 4LCYA 2I07B 2IV8A 2A9DA 5KVEE 1TKWA 3ZKXB 1FCCA 1JGUL 2PCYA 2AEWA 3ESOA 2CKBB 2P44B 4DSYA 3VMNA 2MNWA 2Z7YA 3M17B 5F88B 4PB9H 5IEKA 3EGDB 2ADIB 3U4AA 3HZMB 3Q6GL 2VB5A 2NW3A 1RY7B 1YEEL 3I9GL 4R7DB 3RGHA 2VXVH 1DLFL 4L8SA 1IGTA 4J3XA 5DQDH 1XR8A 5CUSH 1KLUB 3M45A 3VXPA 4HUWB 5BW7A 4TULL 3V95A 1VF5C 1MJUH 1QEWB 4XAWH 3C2AH 3B56A 4JFOA 5FUCC 4XHJD 5K1JA 2G9HB 4CVXA 1KN2L 3U46B 4Y9FA 5JUEH 4X6BA 1S46A 4F33A 3T4AA 2J8OA 2DTMH 1ZT7B 5IT2H 2BNQA 1SXBA 2I85A 2Z64C 3QUXB 2VDPH 4PU2A 4YAQA 3BN9C 3O3AB 4P2RE 3Q43A 2OYPA 3K4AA 1MCQA 1MFVA 4ELKB 2DBJA 2FWOB 3QQ9D 1AQKL 3B6SB 1CT8B 1KIQA 2B2XL 4HUUA 3MLUL 4E9SA 4O51B 4FXTA 4ZS6C 3KHQA 1BF2A 5A16B 5B38B 4OCYL 4WK4B 3ARBA 1KCVL 4L37A 5JHLA 4OCRH 1UWXH 1RZKC 4ERSL 5IQMA 4LZKA 3DV6A 4TSAH 3EJCA 4P4KA 3TA3A 3BDBA 4U4BA 5DD6B 3C8HA 5DRNB 3WIHA 2OULB 3GSXA 1JPFA 3RL2B 3LH2L 3QH3B 2D7MA 4PY7A 5DC2A 5IHWA 3ZDYB 3EH1A 4OGXL 1BD2B 1MI5E 1F11B 5IGXL 1MKFA 4HXAL 4MA1C 2NYKA 3VRIB 2LQRA 2CRZA 5E2WH 5T33H 4FG4A 2QFRA 1OGAB 3C5SB 1JZIA 2Q8AL 3R4DA 2BHZA 5F7UA 1XHHA 1EZVX 1VEPA 2P8MA 2BVQA 2BVYA 3BE1H 3OWEA 1T4KA 5FUZL 4QRRA 1YAZA 5D7EA 4HK0A 4PPTA 4XBEH 4Z7WF 5BUGA 3FOMA 2AJVH 3TH3T 4F8OA 4LRIC 3HRZB 1S9VB 1OTSD 3D39B 4K3JL 1EERB 4MA3A 4C58B 5DZJA 3H9ZA 4Z6AT 4F8QA 4JRLA 3OKKA 3D3VD 2KKQA 5ALCH 4XX1G 4FXGA 3V4VH 3U1SH 3LS5L 5DJ6B 5B8CC 4KKLC 1M1XB 1BZ9A 2CSPA 1YQVL 3L4CA 1DBAL 5IEHA 5J13B 1N3NB 3O4LA 5I1AB 1T89A 3AROA 4PJEA 5SX4H 3SGDI 1C5DA 2M8XA 3CFMA 3LJ3A 1ZAGA 1LEIA 1QSEB 4NO2A 1JGEB 1NICA 3NBNA 1EVTC 4M43L 1NC2D 4ZXBD 4EI6B 4XXWA 3X14B 2GSMB 5I2IB 4N8CH 3NJFA 1L0QA 2N0MA 2EDFA 3FO9A 3GSUB 1FFPB 3MRMB 4KPHH 2NXYB 2XZQL 1E6JL 4ALAC 2WMPA 4ZUSB 2Q87A 2XZAH 3KJ6L 2E9BA 2QSVA 1JK9B 1IE4A 2XY1A 3BISA 3L48A 5DUMH 3O2DH 1XV8A 1FBIL 5DWPA 4Z18A 1MXDA 2X1WL 2ZSVB 1EANA 3O3BA 4I3SL 4K94H 5ICXA 4A7GA 4B60A 3KCPB 3BKML 2CDFA 2WGXA 4EE2A 3DWTA 5I19L 1UWYA 4BINA 3I6KA 2OA9A 3JTBA 4G71B 5BRQA 2QADB 1NCCH 3P2BA 4YVNA 3U48A 5KW9L 4HG4K 3HTLX 2VKXA 3QJFB 3MMEB 4PJDA 5GS0C 1QFPA 1QPXA 2AXGB 1QHOA 1BOGA 1JOIA 4PRHA 5GRWA 3REWA 2JVUA 3VFSB 3MNWA 2PETA 1V7NH 3PDGA 4OQTA 2DWEB 5T5FL 2GI7A 4FNTA 4WUKH 1DQVA 2OV0A 3EXLA 2Z93B 3B83A 2YGNA 4PBWD 1I9JL 3UZVB 1SOSA 2D0FA 4FQHA 1BX2A 3RAJH 3QDAA 1TG8A 5DS1A 3QG7H 3MCKB 1XIWB 2BVPB 2JFCA 5LWYL 1DQQB 5JQIB 4M5TA 3T0EE 1BDYA 4NKDB 4IU2B 3DJSA 2FJGB 5A6LA 1SYVA 3DK2A 4I5BA 3HFFA 3UTQB 1P2CB 5E7BA 5E4OA 3VFGH 2AXHA 3ILQD 3MLVH 5IB5B 4IGBB 1HH6B 2IPTL 4UT7H 1J8KA 2A9AA 2JI3A 3FXIC 2GTZA 3QDMA 1I7ZA 3ARRA 4HJUA 2IF7A 4YBLC 3VDAA 2JQMA 2OW7A 4PRPE 4UYQA 1L6PA 5ELIA 1TVBA 3L1GA 3ATEA 3HS9A 4EI5B 1UZGA 4AE1A 1HVXA 1MFAH 5GS2D 1W6LA 4BXVA 2R0WH 1EUUA 1JPSL 3BP6B 3L1FA 4PJHE 5E8EA 4KK6D 4Q58C 3G5ZA 4Y5VA 3V5KA 4PGEA 4YLCA 1AY1L 1Z7JA 4DP7X 3ARSA 5EDSA 5J1SC 3PWVB 5I16A 4FMFA 4G6FB 4PW3A 1X5MA 2C7UA 1W91A 3U30C 3I9GH 4GIAA 4CVZB 3DX1A 2UWEB 3ZDXB 2DL2A 3CH1B 2F5BL 2O6FA 3KPTA 3U0PA 4GXVH 5D1QE 4QD2E 2DEXX 4RLDA 1FDLL 4YDNA 3A6CL 5IQNA 3SZ6A 5A6MA 3QULB 2YPVH 1HNFA 4WDIA 5CD3A 1KN2H 3CZJA 4I0PB 2X4PB 3AS0A 2XQYG 2IVFC 3CVHB 3IGAA 1FV1A 2HVKA 3SDYL 3HC4L 2D9QB 2FR4A 3VNZA 1YJDL 1KC5H 3RWEA 1EH9A 2JXMB 4MA7L 5MP6L 1KCSL 1BPVA 4AC2A 1SYSA 3TA3D 2G0LA 2HG5B 2OMWA 4GSUA 5ETUA 1ADWA 5IV2B 2UZXA 4M4RA 1C12A 2NY7L 3WNNA 4BHUA 2X0UA 4I9WE 3NJNA 5GGTH 3TBYB 4KZDH 2EUWA 1WCBB 4NQEA 2Y3AA 2AMUA 4OD3H 3QG6A 4ZW3A 3VG9C 1X9QA 2Q3ZA 4OM0H 1ORQB 3CFJB 3X3GH 4LK4A 5I66B 1HZHL 2XDHA 5F0MB 1YYLL 2X3BA 2XWJA 1E5BA 3BPCB 2N56A 1MW3A 4UT6H 2R7EA 3APNA 4OGZA 4UOZA 4N0FA 2H9GA 2GB2A 3QO0B 2CGRL 5IVZA 2G2RA 3VYPA 4A7TA 4ZO6A 3OXRA 3D18B 2IH3B 2D7OA 2DN7A 1KXVC 5INCA 3ROOB 1CL7I 4HXAH 2VZ1A 1XB8A 3IRCA 4HS3B 2Y9RT 4DGIH 4S1SL 4PJAF 2BNRA 1J8HD 3NCWA 3PHSA 5FR3A 3WIIH 5B3NA 2WQ8A 2EDLA 2EDEA 5DMGC 4D2NA 2X4SB 4JFZL 5CJBA 3L4ZA 4ZQKB 1Y6MR 3LZFH 2RHEA 2NY2D 3LV3A 1NTDA 4V11A 1YN7A 1AVAA 4MJHA 4KI1A 5F21B 3QNFA 5FUZH 1BVLB 5JIIA 4WTQA 5DR5L 5ANMB 4A38A 4G7SB 3RX7A 7FABH 3MBEA 3QQ4B 1H6UA 2EZ0C 5TE6L 5IQ7H 3G6JB 2YBRA 1QNZH 1EK3A 3I2CH 2B20A 1CLVA 5HJDA 4MAYA 3TYFB 1NEUA 5KWYC 4AMWA 2BSCA 1DBAH 1D3CA 1WF5A 4BM7A 4LLQB 4OUUA 4PJGA 4TVPL 2APSA 2FJHB 3G9AB 2H47C 2ILLA 2YMOA 1L9PA 2FIKB 1G7JA 5FGCE 2QPUA 3RWJA 4M29A 1ZLVK 1EXGA 4HMDA 3V7MA 1PCSA 4GLRH 5FS5A 3TVMB 4QTIH 1ZVSA 2XTJD 4HGWB 4F37F 3KPQB 3L5XH 2ENJA 4LPVA 1F3DJ 4POZC 1A0QH 4JQIL 1MAKA 2H2PC 2EYSA 4PG2A 4XBPB 5BS0D 1U42A 3MJ9L 5IMLB 4WUUD 1FBIH 3GKZA 1GY2A 4JPQA 1EEYB 2R2HB 3PF2A 5C08A 4PFEA 3REVB 3D25A 3IJSA 4F7EA 4G59C 2B9BA 1UWEH 4HJGB 3HG1B 1U8LA 4YNYA 3CVHH 2Y7QA 4PRHD 3N42B 5HD8C 1VGKA 5CCHE 5GIRB 5SWSA 1GW0A 1P6AB 3GI8L 1HSBB 5DJXA 4R2GB 3RVXC 1ZTXL 4MLSA 1EPFA 5E03A 3N06B 2XI9A 3WJLC 2YO3A 3EYOA 2DQCL 4FFVC 1WA2X 1GGUA 5E9DB 2AXFB 4QRFA 4AIZA 4F9PC 3L5WA 5DD0H 3WLBB 1J9SA 2V7HA 4TTDD 2DYRB 2YKKA 3QIWD 1SXSA 3B5TA 4WFFE 5M94B 3IDGB 1FI8C 5F88A 4DPRA 3EGDA 2ADIA 3IGLA 4LPCA 3HZMA 3ABMB 3QRLA 3WAJA 1KULA 3M7OA 1TQCC 4M6NL 4R7DA 2AHIA 3E38A 5LWYH 4CAGA 1J1OH 3EO9H 3T6WA 2EIDA 1KLUA 3VE0B 1J0ZA 4HUWA 4ODSL 3UTSA 4EOWH 3O2DA 1X5ZA 3HE6D 4F7MB 2EDMA 4MB4A 4P06A 5B3JE 4K5MA 4DEUA 2F54B 5TE7H 4OZHE 4ZBJA 2G9HA 3NCJL 1JWSA 3U46A 5BZZA 5CLTA 2R23B 1ZT7A 5BQ7A 2H8PA 4PBVC 4Y9GA 4UV7L 1PLGL 1XBDA 3PGDB 3QUXA 1PJWA 3S98A 5GJSL 3QUZC 1MWAL 2HFGH 1ACZA 4ELKA 3MLWL 3MO1B 3MN8A 1D5MB 2D73A 1CT8A 1FO0L 1UACL 2JIXB 2RQ8A 3B6SA 3EBIA 5CP7B 3UDWC 2XXMB 1FVCA 1MHPL 3L2LA 5A16A 2K1MA 4YFLI 5B38A 5AVSB 3OSKA 1Y6NR 4FMVA 1NLDH 5LBSL 5EU6E 3GTTA 4G9FA 4XMUA 3JXAA 4N2MA 4UQIM 4YC2B 2FWLB 3AWEA 4YPJA 5DRNA 4A7UA 2PP7A 2J5WA 1CG9A 3RL2A 3LRLA 4KUCF 3EFDH 4N5UA 2B4CC 4BCZA 3QH3A 4Z78B 4DPBX 3I6LE 2COVD 4CW1B 2NDGA 1E4XL 1F11A 1YJDH 2OSLA 5J7CC 1B88A 1F58H 2NMSA 3V5DA 4NQED 1I4FB 1LQSR 2YS4A 3VRIA 3FQXB 5IOKA 2F7OA 2OI9B 3QIUB 1BW8A 4H13C 4NBZB 3SYPA 1QSFB 1OGAA 4F8NA 3C5SA 3I6SA 1I7UB 4D0DB 5F97E 5CILH 4KMLB 3ES6B 4HFWB 3MKGA 3QXWA 2CPUA 4Z76A 5C09D 1KIUB 4QKTA 5MI0C 3CLFL 5C0CE 1M57B 3K8MA 5LUMA 2OL3L 1GMEA 1OCOB 5C3IA 3HRZA 1S9VA 5CGTA 4FLRA 3WY1A 3Q7JA 5GS0H 1XT5A 4KMQA 3D39A 1CDHA 2BNRD 2EDNA 5KOMC 3NJLA 4UB0L 3MTRA 3KZ8A 4LARH 2ICWJ 5DJ6A 3H42H 5EWIH 4A2LA 1M1XA 3CN4A 5FA4B 2Y06H 2BSEA 1N3NA 3K8KA 2C9UA 3BH4A 3ILEA 12E8L 5GRXG 3AAZB 3RVUD 1BF8A 5A7EA 3TGXA 3B37A 2WQWA 4MQSB 1YEKL 1NPJA 1JGEA 1G84A 3MJWA 2LHAA 1G94A 4PJBA 2CDGB 4EI6A 2J5LB 2WIIA 3MBED 3X14A 3GK8L 3OG4B 5I2IA 2BOBB 5KYWB 4XMZA 1FFPA 1AZNA 2R4SH 3IDXL 4XTRD 1Z3GH 2IWFA 3N91A 1MWAB 3JWOC 3RFZC 3WHE0 4N1EA 3L4WA 3NIDB 4N22A 1JK9A 3D05A 4B9PA 1XTLA 5BOJA 4D9LL 1FO0B 3H9SB 5C71A 4N5ED 4WI3A 4L0YA 2ZSVA 5DVOA 5TDPA 5KVDL 3P0YL 3HFML 4RDBA 3KCPA 4UAOB 4KY2A 5DK2B 3U7YL 3KYOB 4S1QH 4QRQB 4TQHA 1DCEA 4Z7WE 3QW9A 1I8KB 3MRLB 3PWPD 3KPSB 3RDTD 4TPRH 3W3BA 5D72H 2CK0L 1T5XB 2LU5A 2Q76B 4PJ9B 3QJFA 4NJAL 3VVVA 1IQDB 1KMGA 3C6LB 1TZ8A 3MOBH 2IC2A 1EJOH 4XNZB 5ESQB 1TJHL 1DBBH 2DWEA 4YDJA 4DZ8B 5T5NF 3V8OA 5JHDE 1INEL 4LOUC 2BRRH 3X12B 2Z93A 4AYMC 3UZVA 5I73B 3WG7B 3FZUC 3U82B 1SPDA 2OJ1A 2VDNL 2I5YL 4KTEL 2ED8A 3PLYA 5DA4A 5F7AA 5SV3A 4OFYA 3ZL1A 4QTHA 5K39B 1LQBC 3MCKA 4OZFH 1NKRA 2BVPA 4AKQA 5AG8A 4OW6A 4NKDA 2DMBA 4IU2A 2FJGA 3O6LL 3HLKA 1I85A 1X4XA 3GI8H 1QI4A 4HV8B 3UTQA 2OL3B 1P2CA 4ZPTA 4ZAKD 2BC4A 3B5HA 3DECA 1O5DT 1S9WB 1P6FA 4IGBA 5IB5A 1YMHA 3IAPA 3EHBD 5DEJA 4ZSOE 4AG4H 4OI7A 1TMCB 4HUXA 1CCZA 1YMMA 5ECJE 1OY3B 4EI5A 2WLLB 2X2UA 4B97A 5ADOH 1MCDA 2PWEA 4XN7A 3S4SG 3W2DH 1K8DA 2O5ZH 4WFGD 1ZD6A 2DQJH 4J6IA 3GO1H 4UMSA 2DJ4A 2YXMA 4LLYB 3OB8A 4GFXA 3UTSD 2WWNA 3PWVA 4UCFA 3RKDC 2B08A 1QFWM 4KRMB 1VENA 2P5EE 3VXRD 1F0LA 2A5UA 3MJ7B 5E4EB 1QFUH 2XBTA 1AS8A 4LLVB 4N3UA 2A83A 1QLRA 5EZJB 4BIKA 3HZYA 3CH1A 1J05B 3RBGA 5T1MA 3AXLA 3LNEA 3TZVC 3DBXB 3DI3B 4WNJA 2APXA 1F1DA 1SHSA 4NQDD 1L3NA 4NO3B 2E47A 4GRMA 1TQBB 2R8SL 4HIXL 1OE1A 3R19A 4GY4A 4QRPB 2D4FA 4I0PA 4X4MA 2X4PA 2QVTA 4X4KA 3CVHA 2F58H 4IOFD 3BPLC 1DANU 4QHUA 5LN4A 2JLLA 4MHHG 3MV8B 4GAFB 2TAAA 2JXMA 1UKSA 3Q8BA 3NIFB 3WI9A 2Y1YA 1HEJC 1N8OE 5FAAA 3FRUB 2HWZH 4OJFL 1WISA 1KDIA 4G9FD 5LNDA 3L3DB 5FO7B 2F74B 4ZFZB 5HI4C 1GCYA 3RVWD 3ISRA 4TF4A 2JJTA 1E4HA 1L7IL 3MBWB 5F70A 5F7DB 1DANT 3BAIA 4OLZL 5EF0A 4EAEA 2DYPB 4XPHL 3EJZD 5IUSA 4W4OC 1YC8A 1UA7A 5F9WC 2VRAA 3ZDWA 1II4E 1ORQA 3CFJA 1TTBA 4CSPA 3QAZB 2XN9E 3QORD 5J1TC 4J3UA 3BPCA 3KGSA 4AGOA 4ZOEA 1UG9A 2FWSA 2EXYD 4JFSA 3QO0A 5JOPE 1WFJA 4G3YH 4W9IC 3S34H 2DIBA 1ZT1B 2ETWA 1YO4A 4Y4HB 2IH3A 2NYYC 3QAQA 3ROOA 4FCAA 1QYGH 4MFHA 5G4NA 4QT5A 5DUBB 3RL1B 3M6DA 1DVSA 5A2KH 1SGKA 3O8XA 3PUUA 3T3MB 4MD0B 5DZ9A 2CR6A 2FIRT 4MQXD 2F8IA 2ICEB 2X4SA 2XIBA 1NAML 4ZQKA 5FWRA 1I7TB 3EJYD 4RDQG 3MA7B 2XX0A 1E67A 3MRKB 1SDDA 1E4JA 4BDVA 1BVLA 2ROXA 4JJ5A 2VLKB 3RBSA 5ANMA 4K3HA 3GUTA 2BSED 2MSPA 2P8PB 5FM5M 5IP4A 1QBLL 2VSKB 2XV0A 4HLZH 5IVXB 2MPAL 3FMGH 3U4EB 3P4LA 5DDHB 1GYWA 2YAFA 4OFPA 3EF7A 2VJ8A 2P28B 5F8RC 1DQJB 1GSMA 4QEGA 1OP5H 4LLQA 12E8H 5T3XH 2FJHA 1BM3L 3FFCE 3CN1A 4CVWA 4P23C 3D8MA 2H45A 5I30H 1YEKH 3MC0A 3MXWH 3IKCA 5AW2B 5DO8A 3TVMA 2AJSH 2OJZL 3GSRB 4DKEL 4HGWA 2Y6SC 3KPQA 5FGBA 2VSDA 4PMEA 4AYID 3IDXH 1RULH 5HDQL 1R5IB 1H19A 1HI6B 4JFEB 4PJAE 4XBPA 3QWQB 3QDJE 2IALA 4D94A 2NX5B 4PJFF 3VXSE 2NT0A 4D9LH 2VDLH 4RMBA 3REVA 1EEYA 2R2HA 5D1ZA 1H5BB 2YJLA 3L54A 2CNZA 1FHNA 4UANA 1W9XA 5GRVK 4HJGA 3H2QA 2X53A 3HG1A 3PPSA 5E08L 4XMLH 3U7YH 2QT6A 4LBAA 4N9GB 1N5AB 3BUPA 4NO5B 1A66A 3INOA 1NGYB 5FB8A 3MRRB 5K9KA 1HSBA 1T1YB 3RNKB 2HKAA 2PWDA 2VDQL 3CZGA 4FQIL 1IX2A 1T04A 1YEJL 1SDAB 3BIAX 3O11B 4M00A 1MFCH 1KGWA 4TNWF 5E9DA 2ZF9A 3VWJB 1OF2B 4JCLA 4AQ1C 3NPZB 3DJ9A 1L5GB 1H3WM 1EZVY 4JREB 5HPMB 1L0YA 3SPVB 4ONHB 4Z23A 2P4AB 2ZUVA 5F0JB 2IPKB 4YOKA 3QXTA 3GGWB 5A40E 3C9NA 5GZOC 5CIPH 1ZLWH 4IKKA 1SJEB 3ARFA 1SBSH 3IDGA 5BVPH 2J1XA 2AJ3B 3WHXA 2B4CH 4ES9A 1NAMB 1F86A 4NFDA 4XCEB 1BHGA 4OCSL 2J4WL 5F1KC 4Y4KB 1YMMD 2CO2A 2XYCA 3VE0A 3WGVB 3DVGB 3SDAB 3CZSA 3GMNB 4F7MA 4P59L 2FYVA 3KDPB 3NEOA 5CN2A 3VACA 4ENEC 4WNQA 3QZBA 2F54A 4RVBA 2BNUB 1CQYA 1QTPA 2AABL 2GIMA 2K4AA 3SZKC 2MRYA 3PGDA 3HNVH 3WMPA 4MD5B 2XV2A 1HDMB 1JZ5A 1QR1B 4X4YA 3BGFB 3MO1A 43CAB 1EO7A 4FRWA 4M7ZC 2GJ6D 4FZEH 5C0BB 1D5MA 5JTWA 2JIXA 4DERA 1YYML 5AOJA 1QLEL 1XQ4A 4HK3N 1T83C 2HT4C 1NFIB 3UMNA 2EACA 3CZEA 2Y0SA 4G5ZH 2X70B 4M3JA 3US1A 3EDEA 1IBGL 3SOBL 3TX4A 3H7BB 2YFNA 1BIIB 4JQIA 1WBYB 3VGAB 2D3VA 1IZJA 1J1XL 1UURA 3BN9D 4NQCD 5JA8B 3QPXH 3LKRB 3CMOH 1EJ6A 3MJ9A 5JPNC 2FEEI 1JTPA 4GQRA 2ZUTA 3NSFA 4FNPA 1I31A 2WKLA 3DHMA 4J6RH 5GS1B 4IBYA 1SJVA 2GBTA 2ESVE 1HL8A 3FCGA 4ZS6D 4ESKA 4E9RA 1QQDB 4Z78A 5D1XC 3QDHA 1BQHG 4OZFA 1FQ9C 1P7QB 4N2AA 5T1LD 2D3JA 3HG2A 1OL0A 3ZYZA 1NUFA 3JWOH 4LNVA 5F44A 3MV7D 4G8GE 4UIKL 3V6ZB 3UO8B 4GQ9H 3HI6H 3GZKA 3GQFA 5CSZA 4AXWB 4F3FA 3K0WA 1I4FA 2ZWYA 5MHSE 5IROC 2VDQB 1T7VA 3D2UD 3FQXA 4ZNCD 2ADFH 3QIUA 5FCSH 3LDBB 4P48A 2WZAA 1ECZA 1YYCA 1I7UA 1EX0A 4X5XB 4Q97A 3TO4B 2GAZB 4D0DA 2VLME 4Z7NE 1WFMA 2LFGA 3ES6A 1KIUA 3FH5A 1YY8A 4N25A 2BSRA 2KZKA 1DQLH 4QLWA 1R3JB 2OMZB 3S36H 3GBML 4WI0B 5TQ2H 5C0RH 1G1YA 4F5CE 4YEFA 1I9RH 4JM2C 1DFBL 3O8XD 3EYFB 2WSDA 4DEWA 3Q3GB 4GKNB 3A4EA 3K2KA 2EADA 1AI1L 5CWSB 4AYSA 2NY1B 1Z9MA 4NHCH 1F18A 2BIPA 3HR6A 4QJ3B 1BIHA 1KJ3H 4X99B 5I1HH 4HPYH 1QR4A 4QYOB 1KENL 3O2VH 5C0NC 3SE8H 2CDGA 2CMRH 3SE9H 1NAMH 5D7SH 2EVIA 2BOBA 4JUTA 3MUY1 4LRNH 2L7UA 1URZA 4KKLD 2F5AH 5AVTB 1EEQA 1KCKA 5ITBL 3FO1B 4TXVB 1MWAA 4NT6B 2DH2A 2VAAB 2IO5A 1FO0A 4JO4L 4YPGB 4K15A 1QLEB 2W91A 3GEWB 2Q7NA 5BRPA 3L8QA 3NZHL 1DVXA 1NAKH 1QFHA 1LXMA 2W9DL 4H1LB 5AAMC 2Q5BA 4QRQA 3CSFA 1QVOB 1I8KA 3MRLA 4I48A 5DU7A 1AGDB 1DCLA 1LE5B 1BM3H 3DV4B 4OI8A 2Q76A 4ZX4A 2IMMA 3C6LA 1D6VL 4GMTH 1BJ1H 2GK2A 3U7WL 1BAGA 3ETBJ 5ESQA 4R6UA 1FVDA 5D1ZD 1YA5A 3TBTB 3Q1SH 2X88A 4DZ8A 2VE6B 1FAIL 1EO5A 4X6FB 1G7MA 1GGCH 3ABZA 5EUKA 1ZEAL 3X12A 1RZ7L 3RU8L 3DSFL 1JPGB 2Z35B 3S9DB 1PBYA 5CHNB 4LIQH 3ETTA 5LQBL 2XWZA 1H9VA 1RHFA 1ZANH 3FQWB 4R2GD 4ZZKA 5GS0D 3P2DA 1CGTA 1L9RA 1PG7L 3ZYOA 2JKNA 1RUAH 3CDFA 4KX7A 2L8AA 3BSHA 2HLAB 2HT2C 4K3EH 4Y9CA 4HV8A 4NOFA 3DUUB 4WWPA 3ECBB 2K70A 3FTZA 3JVGC 2W1NA 4B0MM 4RMRA 3FN0L 1E4WL 2YD3A 3SCMC 4DGYH 3C87A 3HB3B 4DP5X 2WTOA 4YMPA 1TZGL 3ARFD 3BGAA 5FV1L 1NIBA 1IFRA 1X5LA 1XSIA 1L9OA 3C08L 2WZ5A 3D08A 4HIPA 5F0PB 4YSCA 1NINA 3B2VL 2WLLA 2VN6A 1TEFA 2W9EL 4V1DB 3MFGB 3ISYA 3V6BR 4AH2B 4PRNB 4TQ8A 1IGYB 4NQXB 5I0XA 4LSDA 2ISDA 4LLYA 5EMYA 4WHDA 1OP4A 2YR3A 1KFGA 1GGBH 3GS7A 4AV5A 4OGYL 1NDTA 1WT5C 2VN5A 3TEZA 3MJ7A 3L3GB 3QWRD 4JKPH 4LLVA 5EZJA 5LN8A 1SXNA 3MACH 3FB8A 1GIGL 4DN3H 3F6JA 3PNRB 1XXFC 1J05A 3NIGF 4E0RB 4PRDB 3DBXA 1Z66A 4IBZA 3BZFA 5G55A 4E9YA 2VL4A 4MXWL 5C2BH 1MIEH 2AEOA 2WBJC 4KK8C 5I18H 3RNQA 1Q9LB 4QRPA 3MX0A 4PCTA 4NN7C 1JSYA 1O0VA 4HWEH 4PJ5B 3FQYA 3RZCB 3MCLH 4WU5B 3MV8A 3TBBA 1X7QB 1M53A 4YXHH 3IJ7A 4G8EA 2JK5B