4Z3EA

Crystal structure of the lectin domain of papg from e. coli bi47 in complex with ssea4 in space group p212121
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
197
structure length
197
Chain Sequence
MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PapG, lectin domain
publication title Carbohydrate-Lectin Interactions: An Unexpected Contribution to Affinity.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3eA00
4Z3HA 4Z3FA 4Z3IA 1J8SA 4Z3EA 4Z3GA 4Z3JA 1J8RA
chains in the Genus database with same CATH superfamily
3SGJA 1EXGA 3VFUA 3QB7C 1ZV9A 3B7YA 3MRFA 4KPHH 4NQVA 4TUJB 1ASOA 1EUTA 4YDLC 3QXDB 2PNDA 4PLKD 2O5NA 2YIHA 3SKMB 1ACXA 2ZYSA 4PI0A 1RJLB 4LOFA 4NBXB 4PYGA 3WFBL 2XWDA 4X6EA 3BLKA 4Z95H 3AU0A 3LTVA 1MXDA 1C16B 4MXVF 1BZDA 4EI5C 1JIBA 5C86A 2GW5A 4KUZH 3ZO0A 4EN3A 3MV9E 4BK5A 4AZUA 5I73C 4Z8FL 4KZDH 2YC1B 3AREA 4KUZL 5F88B 4MD0B 3VDCA 4OV5A 1GTNA 4JANA 1B3JA 1YUHB 4XNQB 3VH8A 5BOPA 1SHSA 2FJSA 3RZCD 4K9EC 3GXPA 5F0MB 5F1IA 1J9SA 4PWHA 2VZTA 5IB5A 3T4AB 3AU1A 4EIBA 5AW2B 2GUOA 4FI8A 5I1IL 1M3JA 5AOKA 2E46A 3ARGD 1EQWA 2DTSA 4KKAD 4NUJB 4NO5B 5C71A 3RA7H 1CFQB 1KEGL 4YFDB 1KTDB 4QKXB 5B39G 1JFQH 1Z5HA 3AS1A 4EUPH 2Q1EA 1CGXA 1AQDA 3EZJB 1KT2A 1AHKA 3RA7L 3OX8A 3VFMB 3IDIB 4MD4B 5D1XA 5ADPH 2JF1A 5DJ0A 5IVXF 3SPIA 1YY9D 1HXMB 4UYPA 4OJDH 1XXDC 2XZAH 5DA0B 4I1PA 1IEAA 2P26A 2XZCH 4I48A 4A7VA 5ADPL 4WW1A 5LAXA 5FYJD 3QEQD 2HCZX 2WGXA 4X9YA 1T20A 4NRXB 2MCAA 3NAAL 3KPTA 1O6SA 4XE0A 4A7UA 1NLDL 2CDFB 2FR4B 3CXFA 1KBKA 3GS4A 5D1QB 3IDUA 3T1FA 3FH8A 2XIIA 4KNQA 4YLCA 1AOZA 1UKQA 3OXSA 1K85A 4HFUL 1ZGLA 4IRSD 5F1NA 1YEIH 4JM4L 4NQSB 3VRLE 3TBVB 1R0AL 2IWEA 2ZP0T 4XVJL 2FQFA 4ZO7A 4PJ7E 4I77L 3SCMC 1NEPA 1CI3M 1NM9A 4UV4H 1R75A 5IEKA 3WYRA 5D72H 3WNMA 2ZAHA 4FD0A 1NWPA 4O2FA 1CBVH 4E0RB 1PSKL 1PKQB 4WFGE 2YD1A 4DAGL 3KR3L 2ZXQA 1Q38A 2MOQA 3FDWA 5GJSL 4CSTA 1F5WA 4YE0A 3L3IA 1RIUL 2MQGA 4PJGF 4L3CB 4HXAH 5LGHH 1T1WB 5DJZB 1AGBA 4I88A 4PB9H 5EU4A 5J6SA 2K3HA 3P30L 5C0DA 2WQ8A 4GJTB 4ZSOB 2FATH 1WIPA 2Z8VC 4YSEA 1YAZA 3V0WH 5KSVA 3JTBA 3QJUB 4DZBB 1Z7JA 4JCMA 4MASA 1RULL 3SKOA 2FATL 2WQXA 3BPLB 5AENA 5I18H 4BIKA 3O3AA 2E7BA 3WOVA 4EDXA 1AC6A 4KTDH 3ZHKA 1ICTA 4IRJA 4YZFE 1XEDA 4KKAC 4YHYC 1EO8L 1C1EL 1OLLA 5DD0H 3GO1H 1HILA 4LVEA 2W80C 3NACL 1EEYA 2GITA 4W9FC 4F93B 2BVQA 4RQQB 3LNFA 1T1ZB 1I8MA 1EHXA 4BZYA 3AWGA 2MCMA 3GO1L 1KIPA 3BC9A 3UZVB 5IJVA 5KS9F 3MU3A 1XGUA 3GKZA 5IY5B 1PBYA 2OCJA 4AH2A 1UD2A 5F7WC 3HC0B 2RCSL 5BV7H 1A1NA 5HDOA 4ZFGH 4KV5E 1NCUA 3LXBA 4TVSa 1Q9WA 1MN4A 4R26H 4N3UA 2EE3A 2NMSA 4ZFGL 2CO3A 1J5HA 5GGUA 2JKRM 4N0YH 3A21A 5DQJA 1TZIB 4AYFB 4R26L 3DRTB 3HR5A 1FNEB 1OT4A 2ITCB 3EO0B 4P8QA 4IRSC 3SO3C 4F7TB 4YQXH 1N4XH 2UY6A 1QRNA 4JS7A 3CN2A 1QLFA 2W95A 4RX4A 4LCIL 2MRYA 5LGKA 2HN7A 3ZK0A 3D4YA 2Z92B 4NQCA 3MGTA 1HSBB 5HD8D 3WIIH 3DXAE 3IS1X 3ZXAC 3RWFA 3MRBA 4AE0A 3KW8A 2NPLX 1T4WA 3HZKB 5HY9B 2L7UA 3H7LA 1JE6A 4LO9A 1UWYA 3EZ8A 4FOMA 4JN1H 2VSDA 3FT4A 3Q8FA 3QYNA 1ADWA 2A74B 2EDEA 5INCB 1E8ZA 4A7SA 3H3PL 4QXGH 4JN1L 3H3BC 4XP5L 4C55A 4XH2B 4IBLT 4EDWL 5I19L 1UXWB 4N0FB 2Z3FA 2FX7L 5SWQB 2E9BA 4ZG1A 1NLBL 4R9HA 5C6WH 1XL4A 4P2OA 1OZTG 5HHOE 4LCCA 2BC4A 3SE4C 4R0LC 1OSPH 3N5AA 5LBSL 4ZDHA 5FXCH 2OXHB 3QJFB 1HYSD 1IQWH 1WGOA 2BLFA 4UQ9A 4ENZA 2XWXA 1BF5A 1OSPL 2BFVH 3PHOA 2IEPA 5TE4H 2MCPH 1CLYH 4N2BA 1IQWL 1M1SA 4FI7A 1TPXC 3QI9B 1M57B 4RH4A 2MCPL 4LT7A 2BW5A 3WY3A 3CZSA 3FAXA 5KBMA 1EPFA 4YXKH 3RY6C 1A8ZA 5FECB 5ID0A 2GI7A 4HDIB 2E8YA 4MBOA 1K5NB 3LPPA 2FEJA 1JF6A 4YXKL 4ECNA 2NW2A 5BS0B 1WTLA 4JFDD 4NCC2 2UZYA 3DUUA 3H9SE 1JJUA 1ZANH 5LQBL 4XGZB 2X42A 1NA8A 2F54B 3MGOA 1MFBH 1OKEA 1VADB 2RHEA 1FJ1B 4XOEA 2IXQB 4PV8B 5AW4B 3DURA 4EI6B 1E6OH 5DS2A 2GEEA 2J21A 2QVKA 4BKLA 4ZZKA 4FQHA 2R69L 4ODHL 1S6NA 1SQMA 4K5LA 3NCYP 4ODBD 1E6OL 1ID2A 1U8KA 3VGDA 4TLTA 1D5RA 2X7LB 1Z3GL 2VQTA 4M29A 3IS0X 3ZDXE 2IH1A 1UKTA 3AQXA 2CGZA 5JXEC 4PRHB 5LLIC 1JCVA 5E7FA 1JWMB 4PREB 2V2XA 5HD8C 1M42A 1SEBB 1ZXKA 2NYYC 1FNSL 4LSUL 1W15A 4MTMA 4D9RE 4WUUB 4Y19A 5IOPA 4P48A 1ZWIB 1WH0A 3S8WA 3ULVE 4YFLI 1TLKA 2K9FB 1KV3A 1A3RL 1MHCA 5AYTA 5L4IA 5KVFE 4I3GA 3NT0A 1JGVL 3N44B 1U2YA 4FLSA 4HIJA 4OZHA 2EDJA 1FGVH 3VSQA 3DGGB 3HN3A 4KGJA 2FLBT 1IAII 3L3KB 1OB0A 1KBPA 4OJFH 3X11A 4XBPA 1KJ2H 4Y4FB 2EDTA 4L1DA 1RK0A 3AT8A 1FE8H 4PB0H 4OJFL 2FJGB 4NCC1 1CUOA 2XDHA 1KJ2L 1Y6NR 4MDJA 2NNAB 5IQ7H 2AXGB 2OSLB 1TUPA 4K71C 5AB9A 4K7PX 5ERWA 4DK5A 3G5XA 3HNSH 3P9LB 4W9ZA 1A7PL 5IQ7L 4YHNA 3W5NA 5DEGA 4NWUL 3HZVB 5GGTH 1IUZA 1HYSC 5IMMA 3NZ8B 4BFEA 5MHSE 2VDMH 5GGTL 2BIQA 2FH6A 5DJ8A 2R56L 4J7RA 3L5XL 4HS3A 1UA3A 3L3DA 4MWFA 2DTML 4NP4H 3LV3B 5EUOE 2VDML 4W9IC 5KAQG 1I8IA 4WK2B 3PWJB 4MXWL 2WIMA 4IBSA 1Z2KA 4YBLB 1UOLA 2H26A 3GXNA 5BVJA 1F3DJ 3NSXA 4PJGE 2ZXBA 3ME0B 5AB1A 5CHNB 3QHTC 4L9LC 1KN4L 1ZT4A 3QJRB 5CS7A 1IILE 2UXVA 3AS2A 4CILA 5I1LB 1S7TB 1UZGA 2MKLC 1F1GA 4FHJA 3QDAA 4OF3A 3TNNB 4Q6IC 4TUJA 5EBMA 5KVDE 2DWDB 1AXTH 4FX5A 3QXDA 1FPTH 3SKMA 1ASPA 1RJLA 4OV6F 4HWNA 1GGBL 1AXTL 5JQIB 2Z93B 4FFZH 2CCWA 1NCDH 2VSKB 4CN4A 1C16A 2F7IA 3PFQA 2CPUA 1TCRB 1Z5LB 1X9UA 2DJUA 3QFGA 3KZ8A 5FLUA 2CMRL 1GGIL 1UD8A 2YC1A 5F88A 5C08D 4MD0A 3RHWF 3AY4C 2Q7NA 3MBEB 2P1YA 1YUHA 4XNQA 2CGRH 3LRHA 1GH7A 4Z3EA 5F9DC 2QVMA 4PCTA 2ARJB 4AUJA 3WAJA 2F58H 3T4AA 3MVSA 1EO5A 5JW3L 4BEIA 4G2AA 2NY5L 3IN0A 3V4LA 2Q3ZA 1CWVA 2N0KA 4NUJA 1COBA 4NO5A 3BPCB 4AJ0A 4AMWA 1CFQA 4CRPA 2HA1A 1KTDA 3WXWH 2BVUA 1IO4C 1NSNL 3NIDE 1CYWA 4FFVD 3V79C 1M9WA 3LCYA 3VFMA 3MFFA 2AQRA 3IDIA 1L9QA 1SJVA 2C9RA 4MD4A 2DPKA 1BLIA 1HXMA 1P7QB 4BFGA 2M1KA 2FX9H 1A7OL 4KI5D 2OMTB 1NIAA 4OZGE 2JKTM 4RWYH 4HUWB 2WN2A 3OMZA 4CJ0A 3BAYA 3QIUC 4IIQB 4JFXB 4NRXA 3D3VD 4ZTEA 2CDFA 2OMBA 4CGUB 4FERA 2VLJB 5JR1H 4JRXE 3C5XA 4NUGH 3S37L 3MV8B 1CK0L 2WYHA 3F05A 4NWTH 4XP6H 3RYMA 3KLAB 3WUZA 5IGXH 1UURA 4NZ8A 3IMSA 5DZOA 3NCJL 5EDXA 5HYJD 1CDCA 4FFZA 4NQSA 3TBVA 2Y06L 3N41F 3QDMB 2JIXD 5CZRA 4N2KA 5T1DL 4F8QA 3VMOA 3BMVA 1L7IL 2O5YH 3BP4B 1TVHB 4XMPL 1J1OL 3VRJB 2V5YA 4ODWB 2BNRD 4E0RA 4FQPA 4LHUG 4XI5D 2BVOB 1QX1A 2BP3A 4NNYB 4LPCA 1F2QA 2BHFA 3L9YA 4YSDA 4B97A 2AJVL 2LVEA 4Y9FA 2PPEA 2E7MA 6PCYA 5JA8B 1U3ZA 4L3CA 4ATWA 3TVMC 3ARXA 4UTAH 1TETH 5DJZA 2HT3D 2P5EE 5FKAB 5KUMA 1WZMA 4HKXA 4PS8A 3RWDB 3EDEA 3U6XS 4DP6X 4F9LC 1E9OB 2UY7B 1GW6A 1AKJB 2WO2B 4DZBA 4ZPTA 4TTGA 2H2PD 4Y1AD 4NIYE 2LABA 2EIMB 2PWEA 4JUTA 4ONGH 1WFUA 3FB5B 3LKPB 2ENYA 4OLYL 2OMYB 4X6BA 4F7MA 1JZJA 2DMKA 4F7PB 1JYWA 1Z66A 5C6TH 5DURB 3O4OB 5KSAD 2J6EH 2BVEA 4Z7UF 1IBZA 3MLYL 3HAEH 5EG6C 5I0XA 5A3IC 2IG2L 2HFGL 5C6TL 2V5MA 4X80H 4Q4IA 1E43A 4M3HA 4XNDA 3M7FB 4Z7WF 3EJQA 4HCRA 3FZUD 4RQQA 1T1ZA 3SYCA 1C7SA 4FFVC 5C09E 5DI8B 2J73A 5BOJA 5ABZA 4J2QA 3UZVA 3QCUH 3CPLB 1E5BA 3ASWA 3ZHDA 3F7LA 2ZOOA 1F42A 4DQOL 1B0GA 4G7YH 3FU6A 4LSQH 2IAMD 1MCOL 2FNWA 4OQTH 3L4VA 3HC0A 3Q7JA 2WP3T 4OUOA 4OGZA 2JXMB 5D70H 5GRJL 1A6TB 4QXVA 3BISA 1RY7B 1A65A 2CG9X 4PW4A 1SHWA 4TSCH 4I9XA 5G2NA 5T1MB 1TZIA 1SHMA 3B2MA 4AYFA 4P4KB 1RSFA 3DRTA 3E3QC 1DVFB 1I3RB 1FNEA 3EO0A 2ITCA 4TSCL 4F7TA 2Z1KA 2XIDA 3K81A 2X1XR 1SBBA 2V5TA 5GRXG 3V6OE 4F57H 4E9RA 3PQYD 4Z18A 3NGBB 1QFWM 1NBVL 1PIFA 2Z92A 1HSBA 3NRFA 1GYUA 1SMAA 3EJRA 4L4TD 4XI5C 1NKGA 2GEQA 5DCCA 5G55A 3HZKA 4G6JH 4UMGA 5DU7A 1P84J 5HY9A 4FADA 4EI0A 5AKRA 1MCPH 3WKPA 5EBLB 1XGPB 4G6JL 1IKFH 2Z0BA 1A4JA 2A74A 1PF3A 2ZKWA 1LQBC 3KPSE 3BLBA 1MJUL 3LNDA 4GP8B 2UZXA 1JGUL 2FSEA 2HX9A 1IKFL 4GIOA 4P07A 7TAAA 4C4UA 4XH2A 4M1DL 3QYMA 3C6LB 1F41A 3MZGB 4N0FA 3VYNA 3W0WD 2IGFH 2YK1H 5SWQA 3QPXH 2DYPD 2IQAB 2H2PC 4YL9A 2KDGA 1JV5B 4JPWH 5HJGA 1HT6A 3SY6A 4FABL 4BRJA 1G6RH 3QPXL 1CF1A 2QT6A 1R5IB 5BXFA 3NIFB 5KSAC 3TEYA 4OQTA 4JPWL 3S2CA 2HUEA 1FORH 2OXHA 3QJFA 4RGOL 3W39B 1L0PA 2NY5C 2VLRD 1JXDA 1CFTB 3H56A 4JM2D 5A2CA 5T3XE 1WD8A 1CD1B 2ALAA 1FORL 3K7UA 4FFYL 4LLDB 4E41E 4H2AA 2QGCA 3FZUC 4R7VA 4BUHA 3LYRA 3QI9A 2QKSA 5GISH 4IW4C 5GRUL 3BLPX 1U58B 4PLJD 3QFJE 5KSBE 2KLTA 3KLLA 4QAWA 5FECA 1AOHA 2R29L 4HDIA 3FB8B 2IAMC 1KYOK 1K5NA 4RMRA 1QSFA 2WLIB 2X53A 3WO3B 4HUCA 4AOFA 4X5LA 5FO7A 5BS0A 3BQUD 4X5XB 4KRPD 1SDDB 5EFIA 4LL4A 5LDSA 4XGZA 1YYLH 3TT1H 2F54A 3SDAC 1VADA 4PEEA 1ZDQA 2IXQA 4PV8A 5EV7A 1DJGA 1D3CA 3OHMB 1E5UI 4EI6A 4HSCX 4JMXA 4X7CC 3LZLA 3OC5A 2XI9A 3QHFH 3U9PL 3VWKA 4FLHA 4F80A 1ZRUA 2JKWA 1TEFA 5AOZA 1TKWB 3SDDB 3FQ4A 1MHEB 3F5WB 5FHBH 3PUUA 3BZEB 1J5CA 3L3GB 2X7LA 1M6UA 4TNWK 3CXDL 5DZLA 4EQ3A 4OAWB 3FU5A 4PRHA 5FHBL 5LN8A 4NC1E 3ZTJH 1JWMA 4PREA 5D7LD 1YNTB 4WV1A 1SEBA 4ZFOB 1U3HA 3H1ZA 1UXMA 4M6OH 4LZKA 4NFBA 4XX5A 1LK3L 1OGTB 4KUCD 4WUUA 5A1AA 1ZWIA 5DVLA 3SDYL 1OP4A 4TLKA 3RPIB 3FSAA 1CL7I 1NM4A 4M5ZH 4UM8B 1I9IL 1IFHH 3DGGA 5JW4N 4DUXA 2MTAA 3LAFA 3L3KA 4OI9A 3EW3B 4Y4FA 2IGLA 1B2YA 3WLBB 4QRPB 2WBJD 4X7SH 4A2GA 1T7ZA 2FJGA 4W6WB 2H4EA 3BKYH 2NNAA 5JW5A 1EDQA 2AXGA 2D3VA 2OSLA 3R18A 4GG6E 1NBCA 5FLVA 2VO5A 3HHRB 5CJBA 4K3DH 4AYMC 1J5OH 3EH5B 5EOQL 4GUOA 3BKYL 1OGAB 4JJHA 2X2YA 3PIQB 2DLTA 3JWNG 3GIZL 4K3DL 2G5RA 3HZVA 2Q8AL 3V0AC 5AUMB 3O45B 1V8HA 2V7NA 4LP5A 3FBQA 3NZ8A 3BT0A 4FQ1H 3SYQA 3VGBA 1DVTA 2C34A 2Z31B 2VYRE 4JM2C 3PDDA 4MNQD 4MMYB 4FQ1L 4TOYH 1MDAA 3LV3A 3VFVB 5EF2A 4U0RB 1SQ2N 3PWJA 3GWJA 1UFGA 4UM9B 4MD5B 2WY3B 2X1QA 3LN9A 4PLJC 4TOYL 3ZZSA 2Y24A 2NY4B 3HBGA 3ME0A 3DPBB 5CHNA 4X5PA 4YPGB 5LGYA 5E8DL 2N56A 3CFMA 1INEL 4NN5B 5I1LA 1S7TA 3BQUC 3TNNA 2JCWA 4KRPC 1JGLL 2DWDA 3AITA 2V6HA 2W92A 2CIIB 3TO4C 2UWEB 4OLWL 2MQ3A 4U1JB 4OZ4B 5IHUH 5C07E 4FQLH 5C1MB 5DJDB 5L2KD 3FQYA 3W2DH 4ZS7L 1MCCA 5IHUL 4FQLL 5C0AD 3W2DL 1TCRA 3TBTB 1Z5LA 3K91A 2E4TA 1BP3B 3RGVD 1QUPA 3MFGB 5IV2A 4PRPB 1TSRA 1VFBB 3SDXF 3MBEA 1NPJA 4BJLA 3KPPA 2MNJB 2I60H 2ARJA 2VC2L 4JFPB 3QUMB 3LH9A 2A2QT 4GKSB 2VZVA 4XMVA 5J6HB 4NYLB 3ZKMC 4NNXB 2Z7WA 1I85A 2B9AA 1ZV2A 2DWYA 2YQBA 3F7RA 4KJYB 5JW4Q 5TDOB 2Z4QB 4JDTH 1IKNA 4KX7A 5BRZE 1TVBB 3DHPA 4NKDB 4WO4A 1KTRL 1J8HE 1IEBB 2WBJC 3VMPA 4RCAA 1QATA 2NY0B 4YDJB 4H13C 2P28B 4Q9RH 2Q3XA 1DJYA 1P7QA 3ABKB 3ABLB 2P8LB 1RV6X 4D3CH 3TESA 2OMTA 2EICA 4HUWA 4O58H 2D73A 3MLUH 4FYSA 3BHBB 1GJWA 4IIQA 4JFXA 1YAIA 4DKFL 2BP8B 5L9DL 1KDIA 2YKKA 4C8XA 3KM1A 4NP9A 1MFDL 2VLJA 2WLKA 4UQDA 2O26U 3D06A 4AGNA 2ZCKH 1TNNA 3MV8A 4AG4H 4N2LA 5FO9B 4XMTA 4NZUH 3KLAA 3QNFA 3MREB 4IK7A 1AGFA 3IJ8A 4AG4L 3U7WH 3LPOA 3QDMA 2BSBA 1XDTT 4A55A 3IDJB 4BBWA 3SBQA 3UTSB 2HFEB 2W65B 2AI0L 1UOWA 3BP4A 4XBGB 1TVHA 4JFFE 2AJSH 4ODWA 1UJ3C 2WW8A 4LEBA 5KBDA 2BVOA 3BUDA 3QNZB 4NNYA 2AJSL 1EZVY 1OD9A 2DWEB 1X9RA 2XNAB 4BKTC 2EVGA 4K0OA 3TCTA 2QR0B 1GZHA 1TJHH 4OIBA 3SOTA 3IPFA 1QSZA 5F7EH 1RSYA 3VE0B 3QJSB 3RGVC 5GGRB 5FKAA 1V5JA 3UZEA 2SODB 2WXFA 3RWDA 3HHSB 5LG6A 3VFGH 2FQGA 1X5XA 2UY7A 1E9OA 1AKJA 3MROB 1IVTA 1D5XB 1A1MB 1GPOH 3P9MA 4BFRA 1QHQA 5IQ9B 3ROOB 4QLRA 5SWZD 3FB5A 2ZSVB 3LKPA 1NFKA 1R9FA 1GPOL 2OMYA 3KGTA 2YMTA 4F7PA 2HFFB 4YHYB 3V7MA 2X2HA 3C9NB 2DQGL 1MEXL 2CJUL 3KPMB 3H2PA 2WZ0A 4S2SB 3CFNA 3MJ8A 5DI8A 4NGHH 2XQBH 2H1XA 3CNKA 5JUEL 1RUMH 3CPLA 3D4ZA 4YXHH 5ELIA 5GRWA 4KRMB 5IUSA 4NGHL 5GRVL 2XQBL 1A4BA 4QTHB 4F8PA 4YXHL 1BM3H 2DQJL 4MS8D 2JXMA 4YHPB 1A6TA 1QAWA 4HXBH 4UTBH 1BM3L 1E4WH 1VGEL 4XVTH 3LN4B 4FGMA 5T1MA 2F5AL 1XFPA 3V5KB 4JFVA 4UTBL 4IRSB 3SO3B 4P4KA 1DVFA 3OF6A 5H94B 1I3RA 2OSWA 3MNDA 1A6WL 4P5KB 3P4NB 3SQBB 3T0WA 3U2JA 5C9KA 2K6ZA 4NJAL 2P5WD 3H6AA 1T80A 4WTQA 3KGRA 4DZ8B 4WFEE 1YNLH 1SVZA 1D5BB 4HIQA 2WXRA 3QDGD 3OAZK 1YNLL 4JQVA 2C9AA 2ZX8A 3P3TA 2WN3A 5A7BA 1K3ZA 4I3RL 2PP7A 4LSRH 3L81A 4OCXL 3MRRB 5JNYB 4NS0A 4NJ9H 3ALXA 1I3GH 3A22A 3CK0H 5EBLA 1XGPA 5CSZB 5M7QA 3Q8AA 4N2EA 1XTLA 1HIMH 3NEOA 3CK0L 4KVPA 1BAWA 3CBKB 2YD6A 3MRLB 1IC4L 4PJBB 5CAYB 3C6LA 3EJYD 5BNXD 1UT2A 5BMFL 4TVPE 4HISA 4ZTOL 1E5YA 2DQTH 3CZUB 3ECVA 5IHWA 3VXQB 3UAAA 3TEZA 2IQAA 1RUQL 5C0CB 4R0LB 3NJNA 3T6VA 1BVLB 1JV5A 4XO9A 3NJFA 3PWNB 4CC0A 4HALA 4J4PA 4O02B 1R5IA 2VLKE 3TL5A 3OB8A 1I7ZB 3ECBB 1JZ8A 3W39A 2A0LC 4YX2H 2ZCLL 1CFTA 3RGHA 1TTGA 2F19L 1OE2A 1CD1A 3HG0A 4DOHB 4LLDA 1TPXB 1S5HB 4YX2L 2WD0A 5DMGD 3OAZH 3F01A 5JORB 4PWIA 3VQ2C 4Z3TA 2VXUL 1U58A 4FHBD 2Z65C 3HJEA 5AYUH 2L0DA 1SN5A 3FB8A 3K8KA 2J8OA 4UAHA 5HYIA 2VDQL 2WLIA 3UAJD 1BQLH 1ZLUK 4WSJA 5AYUL 3SDXE 1QBLH 3WBDA 4X5XA 1CDBA 4CSSA 3W5MA 1SDDA 1MLBB 2A77H 1BQLL 4CJ1A 1AZNA 1JXJA 1MRFH 3BH9B 3H8NA 4H1LH 1QBLL 3MCYA 3VQMA 1OPGL 2WM0A 2SEBB 1JMXA 5DFVD 3FS9A 4Z9KB 4NNPL 3H4HA 3VWKB 1E5AA 1XEUA 1SEQL 3T71A 3GI8H 35C8H 4C58B 1TKWA 4JG1H 1MHEA 3F5WA 3LKNB 3N1MC 4JHVA 3BZEA 1JXFA 2R1WB 3L3GA 5E8PB 1WRFA 1HL8A 1CT8B 2VSMB 4JNXA 3HG2A 35C8L 2BXZA 1XGYL 4JG1L 3D85B 4OAWA 1N0LB 4DP7X 1MAMH 3FTSA 1EJ6A 1YNTA 2XACC 2ZOKB 5DJCB 3GYRA 4ZFOA 1OGTA 1F97A 3L1FA 5AOMA 5AW6B 5DT1L 5EB9A 3F85A 3RPIA 4NM8L 2BSSB 5DVKA 3Q2WA 3GUFA 1GKEA 2QSCH 5T5NF 4UM8A 4HAGA 2FD6H 1DVZA 2DH3A 3CWGA 2H3KA 1FZMB 4XX1E 2NY1D 1MKFA 1OW0A 2IV9A 2WZ6A 1VEOA 4N0UE 2B16A 4HPOH 4K55A 5AW0B 1ZLUH 1UC6A 5IIEB 3WLBA 4E9TA 4WW2C 1XSOA 1R3LB 1AQMA 4I1RA 2AZUA 2FZ3B 4K7PL 4K71B 4PJIF 1QFPA 2OMNA 1L7TH 4LEXH 1A14L 2EDRA 3D48R 1EANA 1OGAA 3VI4B 3VI3E 1L7TL 1S7SB 3PIQA 4LEXL 1WK0A 3ULAB 4Y5XB 5AUMA 3O45A 3QVAA 4L2LA 3WEBA 4FYQA 4ZAKD 2Z31A 2CWRA 2RA1A 4MMYA 3WDIA 2KUTA 4I89A 3VFVA 4OCSL 5K9JL 4UM9A 4MD5A 1ZEAL 4L9LB 3MOQA 2N4IA 3AG3B 3DPBA 1RK1B 1TMQA 4YPGA 3KPLB 5D93C 2B77A 4GI6A 3N43B 3LH2L 1OWRM 3V9FA 2CIIA 1KGCD 2UWEA 4JB9H 4U1JA 4OZ4A 1IAIL 5FCUL 3UTTD 5MP6H 5DJDA 1NCAH 4JB9L 5DFVC 3LNGA 2WO3B 2Y5TB 1NCAL 4NQEE 5C0BE 3W82A 3BRGC 3TBTA 1GKOA 1RHFA 4YBQD 3UOAB 1ZVHA 2ZICA 1A9VA 4XNZC 4UDTB 4TS6A 4PRPA 1MCKA 2DM4A 2EE6A 1E0OB 1VFBA 2EDKA 2NQDA 3BI9X 3G5VB 3IKKA 5DHVH 4P5TD 2NYZA 2FO8A 3PL6D 1BFOB 2WINB 2K45A 1V54B 1UZ8B 1DEEB 4MRCA 3FB6B 3UBFA 1ZT1B 2BVTA 3US0A 2OS7A 3DHUA 3K80A 3QUMA 4BA0A 1DE4B 4HU2A 4GKSA 3K2UH 2BIOA 4Y5VC 3BH4A 2R2HB 1KPUB 4NNXA 5JOPE 2BK8A 2ATAA 3KL5A 4KJYA 2A6JB 5TDOA 2Z4QA 2NY1C 2XLLA 3KBFA 2N1KA 2YGQA 2XN9E 1TVBA 2EIZB 4JO2L 4P46B 2GI0A 4PVBA 3NG5A 4NKDA 5IFHH 1IEBA 1CR9H 3FPYA 2XCMC 4Z7NF 4YDJA 3VFWB 1KXTB 1Q9KB 2F8OA 4G72B 3AGWA 3FFCB 5DJYB 5GGVL 4WI7A 5IFHL 5I23A 4NERA 5I0DA 1AMYA 1KEMH 2JNZA 4QDGA 3WMQA 2P8LA 4JJ5A 3R0NA 3QIUB 4TYUA 3UJJL 3ZN6A 3GLDA 4PYHA 4JK0D 4QOKD 3RB5A 5DD5H 5DD3L 1MHHB 2BP8A 4P59H 3X1NA 2NY7H 1RURH 4YVUA 4QRSB 1OOWA 4ZAKC 3QCTL 4RAUB 5CZKA 4APXB 5B7MA 5KJ7E 1XIWB 3OMIB 4P59L 1HNFA 2NY7L 5FO9A 4PJEE 4R7NB 1IT9H 3T8VA 3UJTH 2KYIA 3NJJA 3MREA 2DEWX 5T1LB 3ZTEA 1IT9L 3WE1A 3FUMA 1RVFL 3PGCB 2P8PB 1I9RL 3IDJA 2YRZA 4RMTA 3UTSA 1CDJA 2HFEA 2W65A 4XBGA 3NQIA 3S34H 3QK0A 3MLVL 5GIRB 3S5YA 1U9KA 2NY6C 3VMNA 2VQUA 2WWMD 4EXKA 3QNZA 2A99A 2TRHA 1CZ8L 2XTJC 2DWEA 1N8ZB 3TWYA 2XNAA 2I26N 3TVMB 4HPHA 4S1DD 1A8JH 4LPWA 2IBZX 4FTVD 3BIAX 4MJIE 2QR0A 3EH2A 4EVNB 3IMVA 1AE6L 3BZDA 1EDYA 1GCFA 1HI6B 4J3OC 4I8DA 2Z35B 4YBQC 1ORSB 3VE0A 5C08B 2JB6B 5GGRA 1A02N 3QZNA 1SJHB 4PD4J 4K94L 4PGEB 3HHSA 2WB1A 4GUQA 5TGBB 2YGOA 3MROA 4U49A 1D5XA 3GMOB 1A1MA 5IQ9A 2UXTA 4ZI8A 3ROOA 2C3VB 1IGIL 4XRCA 2Z8SA 1BV8A 2YPLB 2ZSVA 3O6ML 4QXTB 3T8XB 3ZTCC 1KB9K 4LDCA 5MEND 1OAZH 2HFFA 2JJUA 2ITFA 2B9BA 5CEZL 2QQNH 4FKEA 4P2RD 4XO3A 5IJDC 2IAAC 4NSKB 2WUBH 2H32H 4FRWA 3C9NA 1KGYE 2OK0H 1BQUA 3FQ1A 2QQNL 3KPMA 4R4BB 3U4EB 4TLSA 3TO2B 2WUBL 3JVGC 3KS0H 4S2SA 5CLXA 3OC8A 2EEXA 5JIIA 3D69B 5IJBC 5JHAA 3P0YL 4Q52A 5SWSD 3V0IA 4LLYB 3QEQA 3HZYB 3K0YA 4KBPA 4QTHA 3ZU8A 5IK3B 2G30A 3OJMB 5JW4R 4ONFL 4JKMA 4F7KA 3D34A 3CUPB 4YHPA 1A64A 3B6SB 1K8DB 1N64L 1SBSL 5E0QA 2FWOA 1J48A 4XWGL 1E2WA 5ECJE 1TQBC 3V5KA 2XIBA 4IRSA 3II3A 2JJSA 1MI5E 5H94A 4NKMB 5EU7C 5HYJB 4NI3A 3UGUA 1KBGH 4P5KA 3D39B 2A9MH 3SQBA 2YXVA 1KLFA 4HHAB 1DBKH 2X6VA 5DA4A 4UZUA 5EZPA 3V4UH 2XFXB 2A9ML 3VW3H 4DZ8A 3C87A 3PJSB 3DLQR 2R9HD 5IFAH 4KH2A 1V3LA 1Z9PA 1D5BA 2VZUA 3CDZB 2AAAA 4MCNA 2F7PA 2ICWI 1XCQA 4PJIE 1B3IA 1LWHA 5IFAL 3I6LE 2D03H 1C9SA 2WWMC 1KMGA 3VU1A 1KYUA 1FP5A 3AM8C 2HWZL 2YD0A 2FWSA 3ARDD 3MRRA 4X8GA 1YPZB 1AY1H 5JNYA 5CIPB 4TSBL 4N2GA 1NOLA 2PPFA 3TWCL 2ZZUT 3D05A 5CSZA 1WWBX 3WGVB 4IRZH 6TAAA 1AY1L 4D0BB 1A7QL 1N0XH 4U1GC 4L0YA 1X3DA 1C8PA 4UNTA 1BXVA 1IGML 2EAEA 3INUL 2KBGA 3MRLA 4PJBA 3A4AA 2JTYA 5KN5B 3K6NA 5EU6D 3KWUA 1X7TA 4PG2A 1N5YL 1E4XH 3NUKA 4XNUH 1IRAY 3VXQA 1LLAA 1I8KB 3SE4A 3GXTA 1BAGA 4WWKD 2PO6D 3M07A 5C0CA 4R0LA 2GJPA 3HI1B 4XNUL 4XVSH 1QASA 3PWNA 2CM5A 2OW7A 3GJEB 1MG2C 1OSEA 4O02A 2ITDB 1I7ZA 3ECBA 4KMTH 1BEXA 1L9OA 1VGKB 1RUAH 4QRRB 5HDBB 1F58L 2VLLB 5CEZD 3SZ6A 2GK0B 4OB5H 1OD7A 3UROR 2NY2D 3HCVB 2DMBA 1S5HA 4KI5F 4MA3B 5HHME 2RBLA 2YO3A 1NJ9B 1TYRA 1NAKH 3AG4B 5D8JH 5JORA 3RY6A 1OM9A 3K2IA 4WWOA 4HGKC 2XG4B 2HX8A 2H2SD 4L3EB 5KOVC 4POUB 1E4KA 1JPGB 3SGDH 1FYHB 3SPCA 4PRID 3SDAB 1MLBA 2OI9C 5CGYD 3BH9A 1QUNB 3TIEB 5DZAA 4BZ1L 3U48A 5L4JA 2CXGA 5IJKA 4L0PB 4R4ND 2SEBA 3B2XA 2B2XL 4DN4H 4WJKB 1QRNE 1S46A 1CB4A 1B6DA 3G3LA 1ZSHA 4LU5H 4TSAH 4LDOB 4XOBA 4KX8A 2YD3A 4ODUB 3S0PA 4HG4K 4HHWA 3BZFB 3PQYB 4YE4L 4KJWD 3B7TA 3LKNA 3EOAB 3QZOA 4LU5L 2R1WA 4TSAL 5E8PA 3ZT5A 4KFMA 5IWLC 3I50L 2BSDA 5JXEA 1CT8A 2R9HC 4NQCE 1KYAA 4OI8A 3D85A 1E40A 1N0LA 1BDYA 2W59A 1S3KH 3T0EC 4QTIL 3IJ7A 4QRQB 4Z7NE 3GSNB 4AL8H 3ZDYF 2ZOKA 2YGPA 5DJCA 1KFAH 1K4DB 5CEXB 1S3KL 4YSOA 2W94A 5CN1A 3ARDC 2NY3C 4PJXB 1ZTMA 2RB8A 4ANVA 3TC9A 5L0QC 4PVNA 5BZZA 4PMFA 3ECQA 5C70A 1FZMA 1JRHI 2J88L 4Q0XL 1QBMH 4A6YB 1V3KA 4ZOBA 3NFPB 2Z64C 2VW6A 5IIEA 2CRZA 1MUJB 5FDYA 3T3PB 3F6LA 1R3LA 1ZLVK 2EEFA 1Q0XH 2FZ3A 4K94C 4M8QB 4ZFFB 1UWGH 3NFSL 3PG2A 1D6VH 4WWKC 2PO6C 3CFJB 4BD4A 3VI4A 1RZKC 1EUUA 2FX8L 1S7SA 3C2AL 1AYRA 5E5MA 1OARL 4TUKH 3P4LA 3HG1D 4Y5XA 3TYGL 4RGNE 3RGBA 1T7VA 1TR7A 1UYWL 4AQ1C 1FVCB 1CXFA 2IDUA 2K6WA 3RG1C 2PR4H 4N2HA 4PSRA 3ELAT 4HLEA 2VH5L 3P2DA 2WLNA 2PR4L 4XZ4A 1YMMD 4UIKH 3MV7E 4L9LA 3I9PA 4PS4H 5EH1A 4G8FA 1RK1A 3ESMA 4FXGC 5L8JB 4PS4L 2F8VA 3HNVH 4JFDA 1CL7L 2BFGA 3TO4B 4NPJA 4OBSA 5ALCL 1FG9C 3K46A 5J56B 4P5MB 5D6CB 2YSTA 1K6QL 3CLFL 3FBKA 1FFQA 4TRPL 1JZ5A 2ZAGA 1NBYB 4JVUA 4KK5C 4M48H 2Y5TA 5J06A 3IGLA 1UASA 4G8GE 2YOCA 4UT9H 1KCLA 1P4BH 4XAWH 4KJWC 1UB6B 4FNTA 1HYRC 5FFGA 4OD3H 4M48L 4UDTA 3QIWD 3AY4A 2CLRB 2KKQA 4XAWL 1MVYA 3G5VA 4Z3GA 4OD3L 1IJNA 1BFOA 5IZ7A 4BH7B 5FV2A 1UZ8A 1DN2A 1DEEA 4Y19E 3FB6A 4R7DB 3IRPX 5JIHA 1J5IA 1DE4A 3PXLA 4GUPB 2R2HA 1KPUA 4TULH 4OZHE 5MI0B 3JXAA 3GHEH 2AJYH 2PCFB 3FQNB 3C2SA 2A6JA 4EKJA 4KKPA 1ODAA 1MDTA 3WELA 5IF0B 1BQRA 2H0FA 1TJGH 2B1AH 2J7LA 3GHEL 3LVEA 4N86A 4JREB 4WEBL 2WBJB 2EIZA 3FTXA 4P46A 5F7UA 5SV3A 5L2JB 4JFZL 5E6UB 1ACYH 1UT1A 1S2EA 2B1AL 3HG5A 1DQIA 3VFWA 1KXTA 1Q9KA 1V7ML 4YUEH 3FFCA 5DJYA 1ACYL 2EINB 4AV5A 1R19A 1P4IH 4E2OA 4ERSH 4YUEL 4MMXC 4JM2F 1E6JH 3QIUA 3IM1A 2HLFD 1TSHA 1P4IL 4LCYB 4ZMLA 3HS8A 4OZFG 3H2WA 4ERSL 4L8CB 2AJZB 5AVWB 1MHHA 1NBZB 1R3KA 5LBSA 3L45A 3UO1H 4QRSA 1YQVH 4YSUA 2XTSA 5J5EA 4APXA 4EXPX 4AQEB 4FZ8H 5EUKB 3TA3D 2BWDA 4KKLC 3CD4A 4R7NA 3PP3K 1EVTC 5E1AA 3ZE0E 1G1YA 3S8FB 4E9QA 4KHXH 3D0AA 1IC5H 3DK2A 3NEEA 4RZCB 1W0WB 3PGCA 2BERA 4H4NA 5CGMA 1V3JA 2P8PA 1JNJA 1G7PA 1UJ3B 2YGNA 4KHTL 3KEDA 4L5FH 5GIRA 5AW3B 1HQRB 2CALA 2XV0A 5D4QA 2EIKB 2IDTA 4IOSD 3SSGA 1UCBH 2OZ4H 3PWPB 4WGWB 1G84A 1N8ZA 1JHKL 4JO4H 3TVMA 4AM0B 4F58H 3HB3C 3Q2VA 4WNSA 1QSED 2KPWA 3VXSB 2OZ4L 2B5IC 4EVNA 2WSKA 3TNMB 2R69A 1HOCB 1HI6A 2WV3A 4HAFA 2Z35A 3OD3A 1ORSA 1T2XA 2JB6A 5C08A 1KCSL 1SJHA 3AWEA 3QIWC 4PQXA 1WFOA 1HZLA 2EYRA 4F9LA 2AQSA 5D6DC 3MCLL 1P69B 5E2UH 4ELMB 4PGEA 1RZJH 3CJJA 1NCWL 4BZ2L 5TGBA 1JPSL 3R19A 3WIHL 5CD5D 1ZIAA 3GMOA 2BWIA 1EFQA 1FVDB 5E2UL 5EA0H 1DJZA 3FQWB 2C3VA 5CILH 3MUHL 3FTYA 3PP3H 4KK9D 2YPLA 4QXTA 2IH3B 3T8XA 2R4SH 2Y23A 4IEFA 1MAJA 5E03A 2MCG1 2MJWA 3MLRL 4PUBL 5J13B 2IPKB 3SQOL 4DGVL 4NSKA 3HN8A 1BBDH 1P53A 5AVQB 3LQAL 1HNYA 3CVDA 4R4BA 4HJSA 3U4EA 1CIDA 3TO2A 4XC1L 1F4YL 3VWJB 2KH2B 4HD5A 1MFVA 1JGDB 3D69A 4Y16C 4WEUD 4XCNA 4DVRL 1WWAX 3ARVA 4LLYA 4NB7A 3FUNA 4Y89A 1FNHA 2MSPA 2PCYA 3HZMB 3HZYA 3N44F 4Q4EA 3NCCB 4X42A 3GMQB 1P6WA 3D3VA 3B83A 3CC1A 5IK3A 2HLFC 4WHYH 4U1IB 3BXNB 2HH0H 3CUPA 5D1QE 3VUAA 3B6SA 3ZDYE 4PY7A 4GO9A 1MCSA 1KOAA 4AGMA 3BDYL 3TA3C 3ISYA 3DA0A 2Q8BH 1DQQB 4JQIH 3WMPA 4ZX6A 5HYJA 4DPRA 3O2DH 3D39A 1QNZL 4K5OA 2PCPB 2P24A 3IKCA 4HHAA 4LHUD 4UQ3B 4DKEH 1XD1A 2IAND 3A67H 4JQIL 5DUBB 4KKRA 1SM3L 5IMKB 2XFXA 3S35H 1O5DT 2ZOLB 2W81C 3PJSA 1OANA 2GABA 2VIRB 4WTZG 3N3EA 5ICXB 1FWXA 1FZKB 5KUKA 2BNRA 2JCCF 3QSKB 5JHDD 3CDZA 3M46A 2OCFD 1GYVA 2XZQH 5FYLE 3VFPB 4A7TA 1PKQE 2VR9A 2H3NB 3VXRD 1KXVC 1U4FA 2E8ZA 1S9YB 4FA8A 3B2DC 1CE1H 3ET9F 1B9KA 4N85A 1HCVA 4GSUA 3FQTA 1OAJA 1YPZA 2WQRA 1PX4A 2DLGA 3DARA 5CIPA 4B9KC 4RRPM 2DYRB 5L88L 2PYED 1T2QH 2VXQA 4GW4B 4IBWA 2ODHA 2QDVA 4HF5L 2CLVB 4OZIB 1LHZA 1AXSB 1DHKA 2J1WA 3BRFA 2VOTA 3T5WA 3T65B 3GSNH 3FH5A 5EOTB 4ZSOE 4AUYA 2ESVB 4LEOB 3UMNA 5KN5A 3WXVH 2YA2A 5IKCB 3OAUH 5CD5C 2BMKB 3ARBD 3U1QA 1I8KA 4PHXA 2XX1A 5TE7H 3QJTB 1JZ7A 2Y72A 4H44C 5C0RH 3HI1A 2DB8A 4DUVA 1G9ML 2AK4D 3GUTB 3MKKA 5TE7L 2MQCA 2ITDA 4A6YH 1VGKA 3LZNA 4XNBA 5E2TL 1DLFL 4TKWA 4QRRA 2VLLA 3GBNH 2OFQA 3BKJL 1DVSA 3HCVA 5HDRA 3LEYH 4MA3A 2ZSWB 3GBNL 4ZW3A 3RFRA 4UBDC 1BJ1H 1PZAA 3APMA 3TEXA 2IAMA 2XG4A 5IBTH 4L3EA 1D7FA 2OR9H 1JPGA 3OJDB 2C9QA 5K1VA 2WWKO 2AJXL 1U36A 2QSQA 3R7QA 4NO3A 3GINA 5ACZB 3SDAA 2OR9L 3K3QA 2HRPH 4TNWF 2ARJQ 4S1SL 1NCGA 1QUNA 3TIEA 2LFEA 1OK0A 3FMGL 3C5ZD 1NEUA 1RZQA 5K1NA 3GZKA 1NGZB 1XB3A 4TQHA 4L4VD 1IAOA 4ODUA 4NHCH 4Q8BA 2ADIA 3BZFA 3PQYA 3UIYA 3CMOL 1U93A 3EOAA 3G5ZB 5EU5B 5EF1A 5FWQA 3DX4A 3HKZA 4I3SH 4NEHB 4OH2A 4GQ9L 4QRQA 3GSNA 1WA0X 2B08A 1OAKL 3TIDA 1K4DA 5CEXA 4I3SL 2VT0A 1DUZB 1FNGB 2HTKC 4D0CB 5KVMC 1VKXA 2FSDA 4G6KH 5FW7A 1JXKA 2XQYA 4DERA 2XU9A 1J0IA 2DIBA 2IFGA 4PJXA 5K69A 5FGCB 3I6KB 1FO0H 4GW5B 3RPBA 1YEEH 1FHGA 4K5NA 1REIA 1F8TL 1FO0L 1J8KA 3NFPA 4WW2B 1MUJA 5F89B 4E42B 5D2NC 4LEEA 1F56A 4B3VA 1XMEB 4OVVA 3VTAA 5E24E 3HW7A 15C8L 4R5XA 4ZFFA 1YA5A 1INDH 5HHVH 4KMQA 3CFJA 3RIKA 4GMTH 1T0OA 1URZA 1X6LA 4OU3A 1QA9B 4X8JB 5EEUA 5AAMC 1MAKA 3PNRB 4GMTL 5LNDA 4KI1A 4AE1A 4IKJA 4UCFA 4W4NA 1FVCA 1NMBL 3PV6A 4HLJA 4KNTA 5FUZL 1QLRB 3IWUA 4S1QL 2PPDA 1KENH 3IDNB 2X89D 4RFNC 4FQ2H 1UA6L 1ZLEA 3LQAC 4MA1C 5IMLB 4Z23A 1P7BA 2DQIL 2BRRH 4WFFE 1NL0H 2NUPB 2BZDA 1SMOA 3T6XA 4HWEH 4KTEL 5CBAB 4XX1G 3BQUA 5D93B 2BRRL 2R7EB 5BS0E 3VVVA 4QHMA 3D30A 3TO4A 1P2CB 4PU2A 4NLAA 4PFEA 3LZFH 3IU4H 2F53E 3O4LD 4P5MA 3STLB 5D6CA 1MCNA 3AQYA 3RP1A 1P0SE 4LLMB 4URTB 5I66B 1V55B 3C5ZC 2IWGA 3L54A 1TQUA 5I1KH 4HEMA 1NBYA 5F7DB 3L4CA 4PG9B 4O00A 2UZIL 4D9LH 2W0LA 4XNZB 4YBHA 5I1KL 1UB6A 3APDA 3T9WA 5CJ8A 4DQAA 2CLRA 3NA9H 1P1ZB 1YN7B 4OGXH 2Y2WA 1GS7A 2KZBA 4PWKA 4BH7A 1TMCB 3IETB 1WICA 4Y4HD 2CR0A 3HI6L 1FBIH 4WUUE 1BD2B 1WFNA 1Z0NA 4R7DA 4Y5VB 3ABMB 3B9DA 2QSVA 4MA7H 2X4OB 4GUPA 4OW6A 4TF4A 5E1GA 1CICD 1FBIL 2CO4A 2H6OA 2PCFA 2DKSA 1UENA 3FQNA 3T0AA 4MA7L 4X2UA 4JFWA 2FEDD 4ILDA 4YGVB 4A2HA 5IF0A 1XH0A 4I5BB 1AR1D 5EZIH 2WBJA 4R3SB 1PJ9A 5BVPH 4KTGA 4JHWH 4CDGC 5L2JA 1S5IH 3H7BB 3P11H 2DQEL 4NPYA 2R23B 4LSPL 3VG0L 4WI8A 1GZPB 5JPNC 2D0FA 2D7TH 4ZMQA 3IU3B 1A7NL 4K9JA 1EJ8A 4QD2E 5JQ6L 4GSXA 3D18B 1RZ8B 4PJ8D 2BVYA 2VN4A 2D7TL 3KW7A 4FYRA 3NIGB 4LCUB 1FLRH 2CAKA 4IBYA 2VWEE 3O0RH 1CXEA 4LCYA 1P7HL 3IMBA 2BZCA 2X0UA 4L8CA 2AJZA 3GMPB 1KY6A 4K2UH 1GJIA 1G9MC 1NBZA 2AZAA 4JFEB 3LB6D 1BZEA 3O0RL 5TF1L 1CXKA 1CGTA 4AQEA 2JKLA 3B2VL 5EUKA 4OUUB 1IGCH 2A38A 2ETWA 4DETA 3MA9H 4DVBB 4FFYA 2E6JA 5DHXB 2X3CA 3SGEH 1IBGL 1E4JA 4D8PB 4FDWA 1IJ9A 1HSAB 3DX3A 4GRLB 1U0QA 3QEGH 4RZCA 4HUKB 3MLZH 2A9NH 2R29A 5ILTH 1SDYA 4ZNEA 2R0WL 2XWTB 3DJTA 5IQOA 2VDQB 1UJ3A 4JG5A 3GEFA 3FRPG 4JPKL 5EORH 4KITB 2NY6B 3GMRB 1OQXA 1ZE3C 2A9NL 3UTTB 5A40E 2A4CA 3CN1A 1HQRA 2XTJB 4DEUA 5JIKA 1J8SA 4Y5YB 4XCFH 3L4TA 1BOGB 5F6IC 3NK3A 3RWGB 4ZX5A 2W9EH 3CX5J 4AM0A 1KTKE 4NUQA 1MOEA 4W9LC 1I1CA 2QPDB 3S4SB 3VXSA 2B8OT 2VABB 1HOCA 3LMJH 4G8IB 3ATDA 4X6CF 3CDGB 5I17A 3QYCA 4ELMA 4RMVA 5IBUB 3GXFA 1WPCA 1DZ0A 1Y6MR 5JA9A 2A1WH 2Y2TA 3AS0A 2TAAA 4A7QA 5AZEH 4KNSA 1FVDA 3FFOA 4XB3A 2F68X 5D71L 1Q72L 3FQWA 3KJ4C 2ZXDA 2P42B 2IH3A 1GZQA 5DJAB 5AZEL 1CICC 2DY2A 2Y36H 4KVNH 4QI3A 1JZ2A 3RX5A 5IBLD 3ZE1B 1QP1A 2IPKA 3KMDA 1AR1C 1QNIA 3ZKXC 3IFOB 1KB5L 3MOBH 2JI3A 4BK8A 3JWNC 3MV9D 3VWJA 2VXTL 1JGDA 4J6RH 4MVBD 1TJIH 4I18C 4PRDB 2XV2A 2D7OA 3HZMA 1I7RB 4PWJA 3GMQA 3KPRB 2AJUL 4M6NL 4TQEH 1E65A 4U1IA 5C9JB 3BXNA 1IM3D 1PYWB 4IK6A 2VLJE 3C5JB 4PJCF 3MRNA 1KJMB 4H0LC 2VDRB 2YQ3A 4TQEL 1TQBB 2VL4A 3VH8G 1CFVL 3MV8E 2I9LB 4GEIA 2Q87A 3MRJB 1UUSA 4LCWB 1DQQA 2QLYA 5F93C 3O41B 3B1UA 4UOJA 4EIUA 2IJ0C 3WY2A 1ZT7B 2PCPA 3RAJH 3BKCH 3QDME 4LB8A 5FCSH 5DUBA 3QIBB 4M7KH 1O7DC 2R2BA 2XVKA 5IMKA 5GGQL 4J28A 3DRQB 3JYBA 4WIQA 2ZOLA 3EXLA 1L3WA 5ICXA 2QL1A 2V3EA 2VIRA 4CMHC 2EABA 1DTUA 2QV2A 1FZKA 3LRGA 2FB4H 3QR2A 3MAWA 3GMMB 4WI4A 3VGGA 3VFPA 1XF5B 5IT2H 1KWKA 2M2DA 2H3NA 1S78D 1S9YA 1I8LC 2FB4L 3WN6A 5J57B 5IT2L 4JHZA 1UH3A 2P5PA 4YH6A 3K6FA 4GAAA 3BAIA 1ZLSH 4FTVB 3MNMA 1LDSA 2JFCA 4IMKC 4K3EH 1TYEB 3ZIYA 4GW4A 4RISH 3MACH 4XN1A 4P3CH 2CLVA 4OZIA 1AXSA 4WUKH 2E6QA 2EDXA 3T65A 5EOTA 4LEOA 3AG2B 4JMNA 1H3UA 1F6FB 3ZVVA 1B6UA 5IKCA 3NCFB 2C3HA 2BMKA 3VXMB 3LHPL 3EYUH 5IB2B 1IC7L 4U1NB 3GUTA 1A4KB 4OGAC 4WFGD 2VCOA 1MWOA 3KCWA 3L9EA 3N1FC 4WI0B 4B53A 1GA2A 1SGKA 4X7FC 2H0EA 3MJ6A 1NUGA 3HBPA 2DICA 5EEZA 5ID1B 4HUVB 2ZSWA 2YD8A 4OBRA 4FNSA 4TTDD 1I1YB 1DQTA 2R0LH 5SWSB 1N12A 4WKZB 4OCWH 4O51A 1SJXA 2H6PA 4AGLA 1NC4D 1RK7A 1GGUA 4LESA 1AIZA 3PF2A 4OCWL 4OCRH 5I1JH 3WE6B 1SOSA 2NX5B 4HS6A 2OI9B 3TBYB 1K3IA 1LEIB 3OZ9H 5ACZA 1IAIM 2YJQA 2HXAA 4J39A 1YEGH 1CLVA 3DSNA 5HHXH 5KBKA 1MWAH 1EZVX 4GBXD 4EUPG 5FKPB 1FCGA 2BSEA 4LVOB 5FWRA 1E27B 1BGXL 3RQ3A 4JFYB 4JZJB 1J1XH 3U7AA 4JGNA 1NGZA 1T0PB 1R24B 4XXCC 5C92A 1AJ7H 2P46B 3WNJA 4AEEA 3PHQB 4BCXA 3GNML 1NGWB 4YFLF 3G5ZA 4B60A 1AJ7L 5EU5A 3T0EB 3L4ZA 1LO4L 5D7JB 5A2AA 2NTFB 5HYSG 3MO1B 2EDFA 2P4AB 2O5ZL 3L3OC 3MC0A 3FCGA 1U3NA 1MPAH 1DUZA 1FNGA 2NY3B 1ET5A 2ZWYA 5EOCJ 1IBHA 5H35B 4D0CA 4N20A 2Y6SD 2D7QA 2ZUSA 3RBGA 5L0QB 2K3TA 1FUNA 1JNLL 1MPAL 3IGAA 4MKMA 3I6KA 4HJJL 4NXSA 1NWOA 5B22A 5DMYA 4IKKA 3JVFC 1OSYA 2UXFA 1L5GB 1HEZB 5F9JB 3ZYZA 2BDNL 2LE9A 4WW2A 1GCYA 5F1KC 5MERB 4FA6A 2WZPD 5F89A 1EZUA 5DR5L 4E42A 1OWWA 3WHE1 3ULVH 4AKQA 4F2FA 4NCDA 1RP9A 4WWKB 2PO6B 5AVSB 5AW7B 4NT6B 1MRCL 2W0PA 3ULVL 3DXAD 3WDHA 2X10A 3CDCA 2H7WA 5KVFL 4NO0B 4BDVA 3NIFE 2IPTH 1JNNH 1QA9A 5C2UB 4X8JA 3LRLA 4AQ1B 6FABH 2F8XC 4MKTA 1QR4A 3FQ2A 5IG7B 3MBXL 2NSMA 1QLRA 3VX0A 6FABL 3IDNA 4DP2X 5F97E 4NKOB 4AW7A 3OQ3B 4PH8A 4HEPG 1BJMA 2G3XA 5IMLA 4NC2B 3AFLA 4FXGB 2NUPA 3H85A 5F9AC 2DEXX 5E00A 4X6CE 2BIMA 4DT2A 2R7EA 1CGSL 1FQ9C 3G7TA 3MMEB 5HHOD 1X7SA 1P2CA 5LCVH 2Q6WB 5KTEL 2XBTA 3RKDC 3CN3A 2DDQL 4BM7A 1EEZB 1QG3A 3F7PC 4GBXC 4LLMA 5AYQA 5LCVL 5I66A 3IDYC 1SPDA 2ED7A 3IMUA 4LRIC 5DVNA 1PD1A 4U7MA 4ZO8A 4XN8A 5DC0A 5FFOA 5F7DA 3V6ZB 4TPRL 3V52L 4PG9A 2UVFA 3V4PL 4AQOA 3NP3A 4MQXD 2E74C 9PCYA 3ABGA 3DSFH 3OQRA 4MB3A 3FN9A 1P1ZA 1YN7A 3BJ91 4L23A 5AW8B 4N87A 3ZTDC 2XWRA 2HP4A 1NMCC 1F0LA 2F5BH 2PCXA 5IVZB 3VQLA 1ZXQA 3E2HC 5KVDL 4UT6H 3D4GA 3IETA 1VSCA 4H8WH 4UQAA 1BD2A 1I9JL 2APWA 4IKLA 4OF5A 1MHPH 4Y5VA 1CF8H 2K6YA 3H9SD 2HMIC 2X4OA 3MRPB 2Y6SC 4FQIL 2VDPH 1AHWC 4YGVA 3DVNB 2HVBA 4I5BA 2VDPL 3GDBA 3Q13A 4GO8A 4PGBB 4R3SA 4G6MH 4IHBA 4QRPE 4GSDH 3WJMB 1LO2L 4C56B 1X5LA 2EDOA 4G9FB 1Q1JL 2QZ5A 2R23A 2I32A 1GZPA 4R83A 3IU3A 4FS0A 3U2SB 5JOEA 2HKFH 2WOBA 5J6GB 1DL7H 4MMXB 2E3VA 3D18A 2VMCA 3KWTA 1RZ8A 1OGAE 4FA7B 1VZGA 1G9NL 2K8MA 4OCMC 1QWUA 2HKFL 3VXPB 1DL7L 3BAKA 3Q8BA 5B21A 4D9RD 4PTUA 3ULVD 3FUEA 1UM5L 3BVTA 3GMPA 4QGYA 4F5CA 1AKPA 5HDQL 4JFEA 3OKOB 1DQKA 3SOBH 4PJBF 2BY0A 5I76B 4OUUA 1LO3L 4HIEB 5F7LB 2OMXB 4DVBA 5GGRY 5KVGE 2PWHA 4OTXH 3O6FB 4JY5H 3VD4A 4D8PA 5DRWB 4Y1TA 1MRDL 4OTXL 4GRLA 3DNKA 3GPEA 4QRTB 3OXRB 2B3IA 4NQTA 7CGTA 2DQMA 2VDRH 3O3DB 2XWTA 4D8OA 2VDLB 2DS4A 2JE8A 4FJYA 2VNCA 2B4CH 5KW9L 3GMRA 4LQFH 2UWEE 3MNVB 3UTTA 3RVUD 3KPNB 5C3TA 2HX7A 1BOGA 5I1CH 5D4HA 4LQFL 1JI1A 2AEQH 3RWGA 3KYMB 5MHSD 1BG1A 4NZTH 3HB3B 4ZMTA 2CDEB 2B5IB 2OLDA 2QGBA 3LIZL 5DRNB 3WHE0 1LMKA 4NZTL 5HI3D 3K74B 2JB5H 2VABA 4CN6A 4UQBA 4G8IA 4PRPE 3TTSA 1XSKA 3TLRA 4HMDA 1A6VL 3CDGA 1FIGH 3PGFL 3RIFK 3BGFC 1GMIA 3GKWH 1CFSB 2VR8A 3WFZA 3AACA 3PLYA 3DYPA 1GW0A 4XP4L 1UCTA 3GTNA 4DP8X 2PKDA 4NOBA 2KHAA 5DJAA 4XPFH 3FT9A 1S7VB 1HWHB 4MXQD 2GBTA 2EXTA 2QV4A 3PHSA 3D5OF 3VU2A 3TJEH 5CCKL 1SOKA 1X5AA 1JYNA 1LE5B 3JVGA 4LFHD 2WBKA 1FC1A 3IFOA 2WSDA 3OPZL 3WHXB 3MNWB 4XPGH 4Y16B 4UV7H 4OIFA 3JWOC 3MUZ1 1U42A 2VL5B 3QWOB 2VZOA 1ADQL 4UV7L 4PRDA 1HCFX 5I74C 3FB7B 5ISZE 4B9JA 1E4HA 5JTWA 2K4AA 5A43C 2LU7A 4UF7C 1UKSA 3KPRA 2OTWB 2GBUA 3QUYB 4Q97A 5C9JA 1PYWA 3DO3A 3C5JA 1KJMA 2C3GA 3TA3B 4U6XB 3T6ZA 4GXUM 5IHZB 2BRQA 5E9DE 2I9LA 1EDHA 3B9KB 3MRJA 1WDAA 5H37H 4MAYD 1NMAL 3L1OL 4Y2OB 3O41A 4ODSL 3U1SH 3RX7A 3MTRA 2A9BA 3VGAC 1XF3B 1Z32X 4JVWA 1ZT7A 4Z3JA 1IM9D 3QIBA 2X9ZA 3VCLB 4R7XA 3DRQA 3CIAA 3UTSE 1GL4B 2VDNL 2HVJB 3IB4A 2JH2A 1FH2A 3MRQB 4A38A 3S8GB 3GMMA 1LWJA 1KG0B 4ONOA 1XF5A 3AVEA 3VA2C 1LP9B 2ZPKL 3RVUC 5HI4D 4DW2H 3WLWD 4ZT1A 5LKNA 4QXUH 2YMXL 2F61A 2WQSA 3SD2A 4FTVA 4JRXD 3FULA 3OKDB 1OP3K 2PW2A 4JKPH 3MLWL 2XWZA 5IMOB 1VENA 2GG1A 4MZRA 4KK6D 3EYQD 4F24A 3BP7B 5EEYA 1HU8A 3SBPA 4J1UB 3N6YA 4L8DB 1X5GA 4MCYB 2FT6A 3SE3C 3ALWA 5E99L 3VXMA 4G71B 5IB2A 3MGAA 4U1NA 5EEWA 1RZFL 1A4KA 1NCTA 3EBHA 4G1MB 4J8QA 4XPTH 3N55A 3D9AH 4PJ5B 4MXQC 4S10A 1H15B 2FEEI 2Y1VA 4FNLL 1KTCA 1J7VR 3ARZA 4WY7L 4QRUB 5DJ2B 5TPWL 5C3IA 5IVNA 3D9AL 2TSAA 3ZT7A 3HI5H 1A7RH 3MJGX 5ID1A 4HUVA 1DBMH 4OD1H 1ET7A 2P5ED 1W72B 1SN0A 4WKZA 5H37A 5SWSA 2QVTA 4CC4C 3FO0L 4QT5B 1AFVL 3MXWL 2HZHA 1OP3H 1T03H 4YDZA 3BH8B 3G9VA 2NX5A 3WE6A 1X4ZA 1L9SA 1YEJH 2WCSA 5T3XH 3TBYA 3U0PB 3WNIA 1G9NC 3JZ7A 1LEIA 1R46A 1T03L 3QR0A 1M05A 4JGUA 3X3GL 1XTMA 5E6ID 3QUGA 2WXQA 4PRAB 5FKPA 1HWGB 4R2GD 1E27A 1ROWA 3QDHA 2YXMA 4JFYA 4JZJA 3GJFB 3HLAB 4MAYC 5E8EB 1R24A 4X5RA 3V6FB 1ES0B 2IALB 3LQZB 2GJ6B 3NYKA 1U8QB 5DFTA 1EXHA 5IWLA 1FZOB 1BEYL 3PHQA 1NGWA 5C09D 2BSTB 3DX0A 4HK3N 4YDMA 1UACH 2ICCA 4FI6A 5I6PA 3T0EA 4KDTC 2WAQA 5JHDB 4AT6B 2NTFA 3HN5A 3MO1A 4QYOA 1R47A 5CJQH 2PWDA 4MYWB 4FEMA 2IIJA 2CZNA 2A9DA 3ARDA 4QR7A 1F3DH 5H35A 3WLWC 4QPEA 3FUJA 2HTLD 1Z5YD 1PQZB 1EBPA 1X5KA 1SXAA 1WHOA 1L5GA 5F9JA 1HEZA 3EYQC 3V4VH 3M1CA 3OVUB 1J11A 4PJBE 4PRBB 5D2NB 3BSZL 5MERA 3CFCL 3V4VL 5B3SB 2YAPA 3EFFB 4HC1H 4WWKA 4QEGA 2PO6A 4I2XB 4YWGL 2ZT9C 4NT6A 5C0CE 5TJWK 4HMCA 2AK4B 4PJHB 4GXVL 1M9SA 3HMXH 1RJCA 1XZWA 3TZVB 5SV4A 5PAZA 5I8OL 2WXMA 4FCHA 2GSIB 4AQ1A 1IGTB 1E67A 2E7HA 4EMZA 2ZTBA 4RFNB 4DOHE 4XWOD 5IG7A 1A6UL 2QVFB 3QWRA 3UACA 4MQ7B 2Q20A 5J0BA 5ADOH 3KPSD 1GY2A 4NKOA 1PL3A 1HHGB 3BGMA 4MA8L 1QFUH 1F4AA 32C2B 4FMFA 5BW7C 3OGCB 3CN0A 1A9EB 1CXIA 4FXGA 3QUZD 4U3XA 2KMWA 4GRWB 4IGBB 3CQPA 2MPVA 1C5CH 3CXHJ 5E6ZA 4R97B 3D7PA 4XMKH 3DBXB 3J8F7 4GAGL 5LAPA 2JJVA 3HAEG 1TQVA 4ORZC 3MMEA 1C5CL 1S7UB 2Q6WA 2F8IA 3ZE2F 4KWUA 1BFTA 5E6IC 1EEZA 1J5DA 1MFAL 4H26B 1NQBA 4L4VB 4R2GC 5T3XD 3V6ZA 4E41D 5DUML 2M83A 4UIMB 5DMJB 1JWUB 4N6RA 4CADA 3EGXB 5HYQB 2CO6B 5DMIL 3GSWB 2W9DH 3L1GA 3O8XC 4NX0A 2CRYA 2DM7A 4MJ2A 3QFJD 1A66A 3KVPA 2J71A 3UDWA 4BKSC 5IVZA 3VXTB 2RJMA 4LKCB 3WKMH 5GS1C 4FQCL 2JKXA 1CG9B 1NGPH 2XJLA 2XFGB 4WFHE 2AFNA 3UBXB 1Y1UA 2PPCA 2VAAB 4ALAL 4DIXA 3MRPA 2J6WA 2GJZB 5IREA 1NGPL 2QPSA 2HTLC 4PCSA 4A7GF 3HMXA 4EBQH 2ENQA 2QTEA 1BYNA 4X5QA 3TU6A 3DX6B 3DVNA 3FTVA 3IFLH 1IGJB 2A9AA 4PGBA 5JPNB 5JIQA 4C56A 2WXHA 1LWRA 4G9FA 4ZW7A 1JPTH 1T7YA 25C8H 4V2CB 2ENSA 2PXYD 2HPTA 4HBQA 2NZIA 1U91B 1OQOA 4Z7OB 4EKXA 1E42A 4MMXA 25C8L 1AIFB 3IFNL 4BV1A 5J6GA 2R83A 3RTQD 3QORC 1YPZF 3VX1A 1ID5I 2VB5A 3OMAB 3VXPA 4HZAA 5D2LF 4ZJ9A 4OF0A 1O0VA 1Z1WA 3O6LH 2WLJA 2ZXGA 5HGBB 1MFCH 3I3BA 1XMWA 1ZVYA 3VXUE 1FGNL 3OKOA 4E9VA 3O6LL 3PXJA 3Q44A 4WDIB 2VN3A 2R2EB 3FSZA 5I76A 5AZ2H 3CFEB 2CNYA 5ESQB 2O93L 3B5HA 3WJLC 1KWGA 1I4FB 2OV0A 3O6FA 4AGOA 5AZ2L 2R0ZL 1W8NA 2D8KA 5DRWA 4W6YB 2NCMA 2NSXA 1YYMH 3HLKA 2NZ1A 3QUZC 5JQHC 1P6AB 3BFWA 3LS4H 4QRTA 3OXRA 3UAFA 2AVGA 1KPVB 1YYML 3O3DA 4JLRB 1IGFH 2OCCB 5TQ0H 1BREA 4POZD 3MNVA 4ANXA 5GXBB 1YNKL 3KPNA 5TQ0L 1CLOH 1F4XL 2P9RA 5T3ZH 3DV4B 1H3PL 3IXAB 3LPGA 4LSVH 2CDEA 4B3EA 1CLOL 4TMPA 1YEKL 2RALA 1WSST 1HZHL 5K59E 2Z8RA 2CCLA 5DRNA 3AB0C 3EOBB 4GEJA 3WS6C 5D6DA 5EZJB 3RVWD 2J8UB 4JPVL 1B4JL 3RFZC 4FG6D 3DVGB 3I9AA 4A2LA 2R1XB 1CFSA 3EYOB 2P47B 3KJ4B 1U2CA 2QLVB 3OLEA 3QDJE 5T8IA 2XBZA 3AABA 1DYZA 1SUHA 3FFDB 4IMLB 4LDEB 1BWMA 1CICB 4UOQA 4Y9EA 4HOWA 1AQKH 5C0FB 4KROB 3KAAA 1DQDL 1S7VA 2CHDA 5C07D 4GP4B 1BZ9A 4LLQB 4PJFB 1AQKL 3ZDWA 1AR1B 4Y4KD 1PEWA 3ZKXB 4DO4A 5B8CC 1QW9A 1T21B 1CLCA 5CU9A 5FHAH 2QQKH 3GJFK 1OAYH 2EO9A 1H6EA 2FGWL 3LKRB 5GJTL 3WHXA 3ZTJG 3MNWA 5FDWB 4Y16A 5T5FH 3W11D 3FFCE 1HDMB 4LOVA 4I18B 1W91A 1L0YA 4Y2DB 2VL5A 3CVHB 3FPXA 3QWOA 4KH9A 3M7OA 4NC1C 2R59A 1NH6A 4Y9GA 5ALBH 3FB7A 4KAQH 3Q1EA 3MV11 1U8LB 2EH7L 4WI5A 5G5DB 2OTWA 3OKLB 4BELD 1S4IA 1SY6L 1F2XK 1U6AL 4ICXA 4UQCA 2WLYA 5ITFB 3TA3A 4U6XA 4K15A 1NKRA 2APBA 2HVKB 3T3PF 4WRLA 1W72H 3B9KA 5LG1A 4KMLB 1H8LA 2MNUA 1J87A 4Y2OA 5BRZD 2DQFB 3C6EA 4FCAA 1T5XB 1XF3A 2FJFB 4X7TB 1J8HD 4FKKA 1G7HB 4LAJH 5I2IB 1PNDA 3VCLA 4CMHB 5GZOD 3HMWH 3MRMB 4JQXC 4RSVA 3HC4H 3SJVB 3EH1A 4APQC 3BPNC 3ARRA 2HVJA 4I0KA 3MRQA 4LMQE 4PY8J 2BHZA 2XKSA 4F1SA 2CBQA 3HMWL 1KG0A 4POZC 3HC4L 4K23H 2R8SL 1LP9A 4IOSA 1PY9A 3GJFH 4YIQB 1MY5A 5D7IF 2A73B 3FUFA 4CKVX 3F58L 1QRKA 3ZLQC 1SOQA 1YC7A 4M43L 1M7DB 2CK0H 4ZZFA 3OKDA 4NZRH 3V0JA 5BO1H 2DQCL 3ALPA 3HE6C 4HD9A 3A6CH 4PVMA 5IMOA 4LOUD 3ERXA 2RQ8A 2RR3A 2AEPL 2K1MA 3Q6FB 3AREB 4FFWC 2EDLA 1JZGA 3QAQA 4FQQB 3QG7L 4J1UA 1UD3A 2I5YH 4LSTL 3RVWC 3V0HA 4Q74A 3LKOB 4AIZB 4HOXA 2CJTA 3B8YA 2QADD 3KWWB 1G1OA 4MCYA 5F1IB 1B4TA 4FG4A 4HWBA 4LPUA 3HE7B 4WSGA 5KVEH 5CP3H 2FHBA 3UBHA 3O6KH 3MLPA 3NK4A 4OLVL 2YPLE 4JFFD 2KC0A 3T09A 3K0WA 1M4KA 3QRBA 3I9GL 3EOTL 4G1MA 2VXSH 2AK1H 4PJ5A 3QHZH 2M8XA 4ALAC 1H15A 2PABA 4LPVA 4KKZA 4Y4KC 12E8H 5DJ2A 5CZVL 4QRUA 3UTQB 4JPQA 1JI2A 1MW0A 4GT0A 5L6YH 3MRCB 2OP4H 3SE8L 4LXFA 3PWLB 4TVPL 5DJ0B 1BCIA 2ZYIA 3K4ZA 4O5LL 1W72A 1PIGA 2BM3A 4OKVB 5DC2A 2ZX9A 4PV1C 4QT5A 3DJRA 1I1AB 4I48B 4NRZB 5FYJU 2JI1A 4TUOB 1QFOA 2WKOA 3BP5B 3EJZC 2W0KA 1IM3B 1VESA 5DQDH 1OM3H 5JMRA 3U0PA 3B37A 4PBDA 2DL9A 3P3RA 1WV7T 3KPOB 3E3QE 3IWVA 1SXSA 3HIZA 1OM3L 1DO6A 3OXSB 4L5FE 3M6DA 1URIA 1QMUA 4PRAA 4M7LT 2XV3A 4P23D 3GJFA 3HLAA 4UQIM 1OF0A 2A3TA 3D39E 5E8EA 2XRAH 3WNLA 3V6FA 1ES0A 2IALA 2VQ1B 3LQZA 1Y07A 2GJ6A 3VYOA 2G5BB 1U8QA 2G3MA 1FZOA 5LGJA 4XOAA 5D96C 2BSTA 5HPMB 5GZOC 5JHDA 1QLEL 4M03A 4N6QA 4AT6A 2KZ1B 4MNGB 3QJVB 2I24N 2B20A 4QHUB 3PAYA 3MODL 4FN0A 1JHLL 5DF0A 1RJZB 4I0PD 1PLGL 4LLVB 4QCIB 3HC2A 1YPZE 4A2EA 2YA0A 4FLOA 1ERNA 5E7BA 1ZPUA 2V17L 4O4YL 1PQZA 3FT0A 4BXVA 3JT0A 2ZD0A 4O2CB 4LOUC 4IBZA 1WF5A 2E86A 4TXVB 4PRBA 4WF7A 5D2NA 1SJMA 4KXBA 4HA1A 1TTRA 2QADC 4JFUA 3MUUA 1KYOJ 3EFFA 2J4WH 3FN0L 4WFED 2YN5A 3U46B 4I2XA 3LOWA 3T4YB 4IU2B 3N40F 3VJ6A 1QI3A 1WFIA 1QABA 2AK4A 4MAUL 4M7JL 4PJHA 2A4EA 4YHLH 4YZWA 2X9XA 3WFEL 2D2OA 3MI6A 3TZVA 1KBWA 3U2IA 2GSIA 3I85A 1ED3B 1IGTA 3WSQH 4EOWL 4QRRE 4KZEH 1HILB 5HDBE 3VB8A 1EH9A 3DC0A 2GITB 3CH8A 4MZIA 4BFFA 1GIGH 3S98A 1A7BA 1I8MB 4AI7A 2CHNA 4KZEL 3S3CB 2GIYA 4N2DA 2DQDL 1YDPB 1YO4A 3ELQA 3EBIA 3G6JB 1KB5B 1HHGA 3NSFA 4AM0Q 2IBBA 1M7IB 32C2A 3II2A 3OGCA 1QW8A 1A9EA 3HUJB 1T3FB 2ERJC 3S7GA 4K3JL 4L3EE 4TVPD 5K9OB 3BE1L 5EZOH 5B1CA 4IGBA 3S3PA 2BW4A 3U0WL 2EXYD 1VA9A 3BAWA 1XF1A 3DBXA 3I2CH 4HT1H 1S7UA 3BMWA 1VZHA 4GBXB 3HR6A 3IDYB 2VLKD 5I8EB 3RWHB 3FUDA 4F7EB 4H26A 4L4VA 3HEIB 1QBAA 3AROA 4HBCH 4YNYB 5EF0A 3KHOA 4UIMA 4MQSB 1JWUA 5HYQA 3EGXA 3W1ZA 4P9HL 3GSWA 4ZFQA 3T77B 1XF4B 1KIRB 5JHLH 3E2HB 4OJCA 3RDTC 2NW3B 2KI6A 3HFMH 3QWQB 3VXTA 1FDLH 1WUZA 4LKCA 1OGSA 1BOYA 1CG9A 4RA0C 5E56A 1LQSR 5I5RA 1PX8A 2ZYRA 4I0PC 3B56A 3UBXA 3RL2B 2CCVA 2VAAA 1ND0A 4PBXA 4PJXE 2GJZA 4WK4B 3L95B 2GC7C 4QO1B 3OZKA 5LVEA 1X44A 2PR9A 1TQCB 1ACCA 1H8SA 4PJ7F 2F18A 2YZ8A 5I24A 2EUXA 3BCDA 3ES6A 5E23A 3DX6A 2F7RA 1MCLA 5A2JH 1IGJA 4U33A 3T3PE 3JV4B 5JPNA 1GTFA 1MF2H 2ADFH 2EEBA 5LJYH 1M2VB 5I28A 1BAFL 3F12B 1U91A 4UUJB 3ZL4H 4DSYA 4RAVA 5A2BA 1MF2L 1FYTE 4LCCB 3DXAB 3FC8A 4PW3A 1AIFA 2YPVH 3CFIC 3APNA 1T5KA 3V7AE 4AEHL 1USZA 1R5VB 4LASL 2YPVL 3RUGB 4DP4X 4YN3A 5BZWB 3VSTA 5HGBA 4WKXA 3PHOB 3BQVA 1DCEA 5HGDA 4OZIF 4HIXL 3ULUH 4N0RA 1WFJA 5CKAA 1XBDA 4N4YB 4WDIA 2R2EA 2AVFA 4NN6C 3QCVH 3CFEA 1YECL 1UATA 2XYBA 3CVHH 4HWZB 4KY2A 5ESQA 5KOMC 1I4FA 1QEWB 4K7FB 4BCYA 4Q9QH 3JYCA 2GTWB 1X4YA 1VACB 3SKUD 3D2UB 1WAAA 4FQJH 4YDIH 4ZUWB 3GSXB 2EXYC 1KPVA 2G9KA 3DUUB 4HX1B 2WXIA 4JLRA 5I75C 4Q7DA 5JHLA 1B88A 1RU9L 2J43A 2OSXA 3WUWG 3KHQA 3DBSA 3IXAA 4XXDB 1KCKA 4XB7A 4K3HA 1UADC 4GI9A 5ENWB 1WJ3A 3EOBA 3G5YB 3MRDB 4X5WB 1EFXB 1NANI 2NXZB 5EZJA 2X41A 3BGFB 2J8UA 5DHYB 2V2XB 5E2WH 3DVGA 3ZY7A 4UB0L 3QA3A 4OJYA 5J1AB 3FF7A 2R1XA 3KYOB 3IJHB 2YFOA 3H9SB 3FFDA 1GSMA 4H2CA 4IMLA 3HOGA 4JAMB 5I1GH 1CICA 4W81A 3KYKH 3LH8A 3MNZB 4M5YL 5C0FA 2HT4D 5C0EB 1OCRB 4AJVA 4LLQA 4PJFA 5B1AB 2QHRL 5J12B 4XBPB 1CDGA 1EGJL 1KDJA 4DTGL 4NQED 1T21A 3A4EA 5C0BD 1D9KD 2EADA 1KULA 5EO0A 3EDJA 3LKRA 3QQ4B 1Z3RA 5SX4H 5FDWA 1HXYB 1MFMA 1HDMA 3MRHB 4I18A 4UNVA 1KELL 5ERWB 3CVHA 1KCVL 4M9OA 2VXVH 3WFDL 1NDTA 5IVXB 4AVKA 1L6PA 1U8LA 3PY9A 2EXWD 2VXVL 5G5DA 2JKNA 2VDOH 1ZA3B 4DEWA 4YS4A 5JOPD 2BOBA 3OV6A 5ITFA 3L3DB 2H8PA 1DQVA 2HVKA 4QHNB 3ZGIA 4RFOH 2B3RA 4FQXC 4OSUL 4LPYA 3VGAB 3RX8A 5CP7B 2DQFA 2XN9D 3C08H 5CJ5A 1T5XA 3IMRA 2WWNA 4QRFA 4UOW1 4RFOL 4X7TA 3C60D 2EDMA 3OG6B 2B7DT 4DGIH 5I2IA 3C08L 2DV6A 2HKAA 5JXAL 3MRMA 4ZNEE 3IRCA 2WVSA 4NM4H 4ADIA 3SJVA 4B9YA 1UXLA 5TK2A 5EBMB 4A2FA 4J3VA 4NZJA 1OP9A 3GSRB 1I8LA 4F9PC 4KPHL 4OFPA 2JSFA 4B50A 4YIQA 3PWPE 2A73A 3N42B 1K5WA 4JBSA 2L4OA 4IMKA 3E7JA 5CO1A 3QAZC 1M7DA 4Z95L 2C3XA 3VXSE 5F72S 1PG7H 2O5XH 4HZLB 4PJGB 3Q6FA 4FQQA 4QKTA 4AQZA 2O5XL 4N5UA 4KZDL 3LKOA 4FJ6A 4AIZA 1GYWA 3FL7A 3DJ9A 3U0TB 1KCUH 3KWWA 3MUJA 4P9HC 1HWWA 3HE7A 3TFKC 1ET8A 1HNGA 3JSSA 2BCMA 5C0JB 5GGSB 3UEQA 2J20A 5T33H 2NNXA 5TDNB 3RI5K 4GSQA 5DJXB 3QW9A 4YSAA 1V7NH 2HT4C 1NUDA 1S7XB 5F2FA 3WNPA 4BFNA 1KGXA 4AUUA 3KBEA 4M5SA 1V7NL 5EHFA 2E7CA 1YEFH 3ESUF 3ZDXF 5EEXA 3UTQA 2FAUA 5EIQA 3ZOAA 3MRCA 4MJID 1JVKA 1YY8B 3BUBA 3WL9B 4EN3D 3MFFB 3ARFB 3NH7H 1JFQL 3PWLA 4BQ8A 2XVGA 3CZGA 4Z77B 2E9WA 1WAEA 3T6QC 3S5LG 3N04A 4CSPA 2F2HA 1NGQH 3KXFB 4OKVA 3ULVF 1BZ7B 3NH7L 5I15H 3P3SA 4LLWB 1I1AA 4NRZA 2OM5A 3IDMB 4TUOA 5KS9B 4X0NA 3BP5A 2XZAL 4H7VA 4OCLC 5EEVA 1IM3A 4UILH 2G4EA 2XZCL 4ZO6A 2EXWC 3V5HB 5I15L 3GRGA 3NCEB 4NO2B 3ZHLA 2DI9A 2CJSA 2ZOWA 5IQNA 2ZG1A 1MXGA 4LAQH 3KPOA 1CVRA 3NJLA 4QF1B 2W91A 1EHLH 4MAYB 1SUJA 4NFDA 4G3YH 4OF8A 2KLSA 3C8HA 4EO5A 4FMKA 3UG5A 2IH9A 2Z7ZA 4XXCA 5ANMB 5FOBB 3D0LA 3KL0A 3ZZ1A 1EHLL 1IM9B 3AQDA 2VQ1A 4OLUH 1YEIL 3C60C 2G5BA 2VN6A 8PAZA 2EUVA 5E1HB 3NIGF 4F2ME 2QBWA 2X05A 5HPMA 4OLUL 5DO8A 4BSWB 2ZX5A 1SYSB 2L04A 1RZ7H 3QJZA 4MNGA 2WHVA 4PLKC 4UV4L 4QHUA 1M71B 1GRWA 1TT6A 3EFDH 4M02A 5D72L 4E9WA 2FEEL 1RZ7L 1RJZA 1Z6JT 1PDKB 1CBVL 5EUOF 4G11A 5BZXA 3EXJA 4LLVA 4QCIA 3EFDL 4X83A 2GHZA 1QHOA 2YD5A 4EN2A 3I84A 3UO8B 1E3FA 2ED8A 5GQBA 5IB1B 4MNHB 4O2CA 5MEOB 1MI5D 3A6BH 4PGCB 2GFBB 4HKXB 4HXAL 4OZIE 1AS7A 4JRWA 5LGHL 4U4IA 5F6HI 3BWUF 1ETJA 1QO3A 4O2EA 2ESVE 2PTTB 4U7KA 4PB9L 5F7AA 5CMAB 5CM1A 3RZCC 1QYGH 2W07B 1PVHA 3LNIA 4FP8H 1KLGB 4U7SA 4ZPTB 3GZQA 3RJQB 3TFBA 3K5SA 5A2IH 4J5VA 4C57C 2BCKB 4YVNA 3U46A 3ZZLA 3SGJC 3T4YA 4IU2A 4JFTA 2OMVB 1QYGL 4FP8L 3V0WL 4X6BB 4F7MB 3DX2A 1SXCA 1IBDA 1U8CB 3ARGC 2GY5A 5I71C 3I6LD 5I18L 3VACA 4PWFA 3BWAB 1JTPA 4FE9A 4KTDL 4YC2C 1SXBA 3TEUA 1ED3A 4L05A 1ZLDA 4UOW0 3P3UA 4PS7A 2CDGB 5ICZB 2P45B 1JF1B 5DD0L 3OHXC 3Q1SH 1YDPA 1I75A 2E27H 3G6JA 1KB5A 1YY9C 1M7IA 1B0GB 4X4ZA 4W9KC 2E27L 3HUJA 1T3FA 1L0QA 5K9OA 4OF6A 3VD9A 5BJTB 1WFTA 4MJ4A 3LN5B 2Z1PA 4YJZL 2XN1A 1OHQA 4C59B 5BV7L 5HXMA 4C4BA 4GBXA 4IRJD 5LXGH 3NIDF 5I8EA 4CDHA 1LO0H 1QBBA 3RWHA 1OHZA 6PAZA 4F7EA 2Y07H 3ASOB 4LRIA 2WXNA 4N0YL 1T22B 3WIFB 1YHPA 5B1BB 4YNYA 2AQ2A 3DDGA 5HHMD 4YQXL 1N4XL 4ZMWA 1OK8A 1WE5A 3O8XB 4OZGF 1RI8A 1XCTB 4C54A 4F15C 4ODVH 4UQEA 1J12A 4WEMB 1E3ZA 3T77A 3FT3B 1XF4A 1KIRA 2G2PA 2NW3A 3ASNB 5GS1B 1J9TA 2EE9A 2ZOUA 3BAJA 1XSIA 4TV3A 2WXGA 5I1HH 3VFRA 3WIIL 3WO4C 2D3NA 2EQDA 1ZY9A 4MZ3A 3RL2A 1ZS8B 3SY0B 5BUAA 1PZCA 4L1BA 1EVUA 5FGCE 3L95A 5FGRA 3UADA 4QO1A 1F02I 1A4JB 3CFTA 1IQDB 2LAAA 4OLZH 4YHKH 2UZXB 4AJYV 3UJIH 3QS2A 2FSEB 2N59A 1QRND 1BQHG 4U6VH 3WG7B 3ZKND 4YHKL 1H8OA 5FW8A 3JV4A 4QXGL 3UJIL 1TZAA 2ZP8A 1PAZA 1Z9SA 4CW1A 1M2VA 1RMFH 3P3YA 4K3GA 2ZUQC 3F12A 4TM9A 4GKZB 1VB9A 4UUJA 1BYPA 2FH8A 4NQCD 3QORB 4GT7A 1C5BH 3DXAA 4F91B 1QFHA 3N85H 4MSWA 1IGYB 1MG3C 5EZLB 5BXFB 1YJDH 3H42H 1C5BL