4Z3EA

Crystal structure of the lectin domain of papg from e. coli bi47 in complex with ssea4 in space group p212121
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
197
structure length
197
Chain Sequence
MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PapG, lectin domain
publication title Carbohydrate-Lectin Interactions: An Unexpected Contribution to Affinity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 44
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3eA00
4Z3HA 1J8RA 4Z3EA 4Z3JA 4Z3FA 4Z3IA 1J8SA 4Z3GA
chains in the Genus database with same CATH superfamily
4NGHH 3K71B 4PRBB 2VSDA 1QWHA 2L04A 2VDQB 1MCSA 1TENA 3CSYB 1JMZA 2X4RA 2PPCA 4K71C 4IBZA 4IRSD 3ZDZB 2PABA 2N1KA 4F7CB 1OAYL 2LVEA 1I9RH 1ET5A 4WJG3 4AIOA 2AK1L 3E2HB 1MQKH 2CQVA 2D3VA 5I18H 5J1TC 1LO0L 4S10A 1F1AA 3FCSB 4UIKL 4Y7OC 3GSVB 3LPPA 4UAHA 3VFMB 4DGVL 2ZWNA 5I8KH 3DHPA 1A3LL 3VXUE 3W5MA 2PW1A 3HI6L 4Y5VC 2YRPA 3VFSB 1ZAGA 4Y4FB 5CFAA 4LVOB 4HWEL 5CU9A 1LL1A 2X53A 1NCAH 5FGBA 4BH7B 4G8GD 3EBAA 2WBXA 1JGUH 2XU9A 1M6UA 4Y16C 4XN8A 5BRPA 2YPLB 3V6FA 4U7SA 4HJUA 1YEEH 3IYLW 2A73A 5TE7H 3UJTH 1ACYL 3WO4B 4RNRB 1JK9B 4NN7C 3OZKA 4NAJA 2HKAA 2DH3A 3U25A 2Y2YA 3S36H 4ENZA 1WC7A 3H6AA 3DX2A 2B8OT 4YN3A 3VWKA 1NCNA 3CC5A 3AAZB 4J3OG 4OGXL 4QHLB 1IRAY 2HKFL 1TFHA 5GGVH 5DK2A 5TF1H 3WTUA 5AZEL 4UTBA 1D5BA 4BYHA 4AIXA 1KYDA 3FFCB 5DDHB 4P3CL 4OLVH 3U4KA 4DTGH 3S88L 4I0PB 3P2DA 4K8RC 3TBYA 2WLIB 1M7DB 2FEDC 1IQWL 1HZHL 4GS7C 4TULL 1EJFA 1E4KC 3Q44A 3PNRB 2K7QA 1DBML 3JXAA 3TT1H 2LTQB 3EG9B 4D9RD 1S9WA 4UILH 3CFIC 4OF5A 4XMKH 2H6PB 4LCWA 3EDEA 3KBHE 4GG8A 1I8MA 1UASA 2EDEA 1C8QA 1M1SA 3WNKA 1F13A 1JGLH 2IANE 2Z91B 5TE4L 3VFOB 3BP6A 3LN5A 4NZFA 1EEZA 1HAUA 5FK9B 1IGTA 1HEJC 3PXLA 2AFNA 4LBAA 5AOKA 4Z7QB 5DO2C 2BVYA 1SVCP 1B4JL 2PWGA 2C1OA 3AB0C 1F86A 3PABA 3PREA 5IMKA 4X80L 1CXKA 4Y2LA 2CXGA 1KGUA 3V5HA 3DGDA 4KNTA 5FUZL 3U0PA 2BY3A 3BVNB 4XT1C 4K23H 3L4ZA 3TU6A 4N8CH 4Y4HC 2XC8A 3PNWA 3EYSL 4DETA 2FJFB 3VH8G 2A6IA 3TJHC 3UABA 4BRVA 3HB3B 4IBTA 3X1BA 1TJHH 1TZGL 3BUYB 2V2XA 4MD4A 1BZDA 3M8OH 1TVBB 2APVA 2YMXH 3FL7A 2WNXA 4YXHH 2CRIA 2ZAGA 2YEZA 4FFWC 4TL4A 3D39A 1KGXA 2EDBA 1LP9F 3FJTA 4X7SH 4HOWA 1IGFH 1RP8A 3VGBA 3WGUB 1JZGA 5T1DH 2NNAB 3OB8A 1BZOA 3RWJB 3EFFA 2FSDA 4GG6F 4TUKL 3QR0A 1CGSH 4ODTH 4NRZB 4APXB 3NIFE 1BJMA 2JB6B 4NFBA 2VO8A 2PYEB 3H54A 3LXCA 2GHZA 2X1OA 2M83A 3QJOA 1TKWB 2B5IB 3M07A 1CL7H 4JO1H 1AHWB 4ZAKD 3REWA 3BQUD 3ZE1B 4JDVB 1CF8L 5F0MB 2NY7H 1UCTA 4NKMA 1BQHA 3WDHA 1QEWB 1DVFC 2FLMA 2ARWA 4MA1B 1UVQA 1DN0B 1A3QA 3UTPD 1V10A 2XA8L 3F00A 3UZQB 1HQRB 4Q9QL 2X44D 1TTCA 4R97B 3VCLA 3KPLA 1A6ZB 1SXCA 3S2AA 1D2OA 5EDSA 2AS5M 2QLVB 2P43B 4P5TD 2D2CC 3II2A 3SDAD 2W60A 1TJGH 4MRCA 5IWLC 1P4BL 1UM5L 3HG0A 4G8FA 3MUGB 4JM2A 1AO7D 1H15A 1PNCA 4JFEA 4DKAA 3QBTB 3IDUA 5IOPA 1MUJB 2KPWA 2ZOOA 1JI2A 2H32H 3QZMA 4I9WD 4WK0B 3GSNH 1MAKA 1JXGA 3MXVH 2VMCA 4L29B 1ACXA 2CHNA 4QCIB 4JAMB 4LAQL 5A3ID 3FF7A 2X6MA 4LAJH 4YNYB 4M7JH 4Y5YA 3U0WL 3AXLA 1REIA 3MZGB 2Z31A 3HZKA 1IAII 2N59A 4HPYH 4MCZA 1PY0A 2X6CA 1Y18B 1V7ML 4YZFF 2VR4A 1T5XA 3K1DA 5CXPA 2HRPH 4JY4B 5C6PB 3MLWH 3BGFC 2FE0A 1P7KB 3T3PB 5AENA 2JV6A 4RAUA 5I0YA 1ZPUA 3AACA 3BWUF 4WU7B 3DX4A 2NUPB 2OSLA 1U8PA 2UZYB 2AVFA 3EOAA 3LJ3A 3QE5A 3MBXL 1MI5D 1IV8A 3LEYL 4N0CD 1T6WA 4YPGB 3G6DH 3N40F 4N85A 1E28A 2ICWA 1A6VH 5I73B 1P53A 3CHRA 4UZUA 5K59E 2H9GB 1IL1B 2PKDA 4MXVE 5AKTA 4F7EB 3MBEC 1J9QA 5ITFB 5B7MA 3DMMD 1VKXB 4JL2A 4TQ8A 2YQGA 2BNRD 1P6FA 5DZ9A 5GGUA 3VG9C 4MJ6A 2VZSA 1B9ZA 4LOFA 3DX8A 5DMIH 1CU4H 1EHXA 5GXBB 3FB8B 5K9JH 1RUPH 2A0LC 1C5DA 4DN3L 3MKGA 3KPRD 4WY7H 5L0QC 4PJ9D 1BQLH 4OD2A 1UM6L 3QCUH 2F53A 5KSVA 3RX8A 1G4RA 1INQB 1M6OA 3CFJB 1S9VA 5AQ0A 3IJSA 1CC3A 3G5ZA 1OAJA 2F6AA 4OFIA 3UYPB 3BE1L 3L5WB 3SGJA 2H32B 3GSNB 4PGBA 3OHXC 3P4MA 5DRWA 3E6FA 4MB4A 2CO3A 3I3EA 3NCFB 1MVYA 1GPOL 2L7JA 1P1VA 1UXMA 1XR9B 3B2UC 3QEQA 5HYEA 1AIFA 4OM0L 4XCEA 4QTIH 3VYOA 1IEHA 1WFTA 3WMPA 1NOLA 2ZUSA 2JCCE 3MXWH 4LRNH 1G7HB 1MH5A 1O9VA 4N5EC 5F89B 2WXKA 4TMPA 5E5MB 2BRRL 1EJOL 1GCYA 1WGOA 4Y19A 1YCSA 4F1ZA 4MVBC 5KVEL 4B95C 1R4XA 1MCWM 4PMEA 4DUXA 2EH8L 4H25B 5J6GB 5FDWB 3WIIL 3MLXL 1CLOL 2HG0A 4NN6C 2JH2A 1Z0NA 1A4JB 4W81A 1RZ8A 4BH8A 5F9OH 4JDEB 2A6JB 3NACH 3ILDA 1DLHA 4UYQA 4ZQTA 4HX1A 4Z7VA 1F6AB 3CFEA 2M26A 3PWNB 1DCEA 1FWXA 5CILL 2RA1A 4Y2DB 2PXYB 3VXRA 4OCNC 3ZTDC 2D4FA 4LEBA 5CEZE 3AUVA 4HXAH 1X5AA 3US1A 1B4LA 2B77A 3UDWC 2ERJC 1M2OA 4NHCH 3NN8B 1NGPL 4HWZA 4DO4A 1BQHG 2JI1A 3ZDXE 1DO6A 4M62L 1V3MA 3G6AA 4UQ3B 2OMWA 3WI9A 1TXKA 5KVFL 3II1A 5DJZA 3B2VL 3EDDA 4XBPB 1A47A 1IBDA 3FUMA 3QQNA 4LSVL 4HUXA 5AVYB 2DLHA 1ZT1A 3CFCL 3FB6A 4JDZB 1EERB 3B7YA 5C0BE 1L0XA 2EDKA 3MLYH 1LMIA 1JPGA 1G9NH 4X5XA 3TCXA 5CSGA 4NZUH 4PS7A 4PV1C 3NGBB 2NZ9C 5LBSL 3L48A 4ZTOL 3RY6C 1AGDB 2NSXA 1ZANL 1QTPA 4LLVB 4Q9RH 5EORL 2EACA 2J8UE 3CG8A 5E8PB 2UUDK 1DBJL 1MCLA 3OL2A 5EEWA 5AB9A 4P49A 5D5MF 3AC0A 1MLBA 3DK0A 5D93C 4XP1L 3WFDL 4U7MA 4NUGH 2H1PH 2MHAA 3L2LA 4NDMA 3W9EB 2H2PD 1JRHL 2XV0A 1EDQA 3SDDC 4WO4D 2ZQKA 3RFZC 3VYNA 1AE6L 2OSXA 1A2YB 4TRPL 4OCLC 1SHMA 1VF5C 3EYUL 3HE6B 1E4XL 4NJ9L 4UB0H 1JGEB 4XPTH 5D7LD 3WIFB 4NUJA 3P0VL 4POZC 1J48A 4P9ML 4LSSH 3MNWB 2C9RA 3N44F 3FOLB 3PGFH 3KZ8A 3ZSSA 1LM8V 4N8VB 3QZNA 4KGLA 3UBFA 1UWGH 4MBOA 5EF3A 4APQC 4QHKJ 5AVUB 3SOBL 4E9YA 3IRZA 1E9PB 4I1NB 1OARH 5CZXC 4XNZC 4U6YA 3AXHA 4K55A 3UO1H 1NAMH 2W9DL 3OAYK 2KZ1B 5F7EH 4XNYL 3X14A 3QFDA 4HIXH 1N12A 3FCSA 5F8RC 1G9HA 2KL6A 2FEDD 5HHNB 3BIBX 4M1GL 4AYFA 4LPUA 4XHJD 2HJFB 5TQ0H 3RJOA 2CKBL 4ALAL 4OGYH 4AIZA 3MRMB 1F5WA 5TJWK 1S3RA 3CK0L 1QYGL 4QGYA 4HGKC 4IKKA 5EOCL 5AVTB 3UJIH 4BH7A 4PJCE 1I1AC 2QTVA 3DRQA 2YEVB 2WUBH 5B4MD 5IROA 1ODUA 4FNSA 1QASA 4NQEB 5D6DA 1JZ3A 3MCKA 1W72H 1X5KA 3L5XH 1GZHA 4L8CB 4RNRA 3GSQB 3HC4L 3TIDB 1RH8A 2KC0A 4IKIA 3LKPA 1F1GA 2KKQA 4MA7H 4Z76A 1I31A 5BZDB 3U1QA 3X13B 32C2A 5ICUA 2V9TA 3CLEL 4CJ0A 1J1XH 3NCEB 3FT2B 5E4EC 5T3ZH 2C3GA 5KSBA 4LNVA 5IFJB 1XGQB 2MNWA 1DBBL 2Z35A 1R19A 3OAUL 3BT0A 2ZT9C 3BVWA 2XETA 5J9PA 5DDHA 1J5OH 1JPTL 3H9ZA 3KWXA 4BJLA 4Y4HD 4TQIA 3OJ2C 1F4WH 3D6GA 1N70A 2HN7A 4HH8A 1EPFA 2A4EA 2H3XC 2VLLA 3ARGB 4M5TA 3RG1C 5BMFH 1KPUB 1OP9A 3RP1A 5EU3B 2EYSB 4QRTB 1IE4A 1T7WA 4CBZA 5KJRL 1KCRL 2OMZA 2WQWA 3HLAB 2YFOA 3BSGA 1U30A 1E4WH 3EG9A 3I9PA 5DGQA 3QUXB 4FL4C 4JKPH 4OJFL 1HT6A 1YEHL 4HS6A 5I17B 1PCSA 1SXSA 4KKLC 2Z93B 3DETC 1SFHA 1WK0A 2ZF8A 3WN5B 1E3XA 1IO4C 3SB3A 1Q38A 4LCUB 4LPTA 2WQ8A 5I9QC 1U58B 4G6MH 1C12B 3LD8B 3SIKA 1Z0MA 4HYTB 4AW4A 5J7CC 2XWTA 1V54B 2OJEB 3NRFA 4Z9KB 5BPPA 1KGIA 2RBLA 4B0MB 2C7UA 4BKTC 2FL5A 3D2TA 4XO9A 2QTEA 2P5EE 2IPUK 2PPEA 2ICEA 4LOUC 3F7YA 6TAAA 1O9ZA 2AEQH 4PJ6A 3RDTD 1D5RA 5DI8A 3T0BA 3ZE0B 1K5NA 3MRFA 4Y5XA 1EDYA 3U9UB 1D5XB 3CPUA 2WWOA 1XH2A 2A9MH 4OCWL 5A2IH 5FB8B 4EZJA 1MJ8H 4OKDA 3MLUH 4NN5C 1TVBA 5IESL 3NDYE 4JZJB 2AQNA 3HBPA 5CD5C 1TQBC 4PJBF 5IMOA 1TU2B 4GIAA 3TONA 2AXGB 4F80A 2F08A 1QR4A 3X12B 3D30A 5AW4B 4QYAA 5ANMB 1FLTX 3JWOL 4RZCA 4O4YH 4C59B 3QIWC 4WV1C 3ZTEA 1R46A 3Q3GA 5HJDA 3DWTA 3A4AA 4WNQB 4JFDB 2XI9A 2Y24A 2R2BB 1PYWA 3WHE1 1U6AH 2DBJA 5E5LA 2OJZH 4JQIH 1TKWA 2G0KA 3JWNH 4R4NC 1AHWA 3KL5A 1FO0L 4J5VA 4ILDA 1TZOA 3LH2L 4YHPB 5ADPH 3QNZA 4PBXA 4P5MB 2XVBA 1QEWA 1TUPA 1XBRA 2LR4A 4KUZH 1NANI 3Q5TA 4XP4H 1W2KT 3G08B 1S3KH 4PS8A 5LWYH 3UZQA 5LQBL 4E9LA 3QEHB 7FABH 1A6ZA 1MCFA 3BAYA 2MPAH 4S2SA 5E03A 1K72A 2KMWA 1EHLH 1MNNA 5IEKA 3MBED 4Q74A 2XY2A 1LO4L 4DKFL 1OGAA 3BLBA 3RY4A 4L05A 3AQZA 4P4RB 3KXFD 3ZHDA 1QG3A 1RIUH 1GOFA 1TTFA 4PBWD 4W9IC 5GJTH 1MUJA 1H3UA 5E6RB 1BVKB 2NY6C 3RYMA 2OK0L 1XCWA 2YXFA 3EJUA 2I07A 3O81A 4N0FB 4NRXB 3B1UA 4YNYA 1BDYA 2R39A 3UJJH 4I3GA 3AWFA 1MWAH 2A4CA 2NLJB 1BLNB 5E56A 1GAFH 2AKRB 1MAML 3P0YH 4G8IA 5J8OA 2G5BB 5JLZB 1ZV2A 4NQUA 1NIFA 2IGFH 2NUPA 3DX9B 4CDHA 5ICYA 3W57A 1JTPA 1AQKL 5EU5B 2Z1KA 5DHVA 3UEZA 4P2QD 4N4YB 1DVZA 4LXFA 2IAMA 5C97A 4FQ1L 2ZP0T 2H9GA 5CCKH 5D2LB 3GM8A 3EDFA 5EIIB 3EOYG 3PL6D 4AJVA 4BFFA 1A3RL 4QHKI 3D0LB 3CSFA 4PD4K 1CWVA 4MVBD 3SQOL 1CD8A 2BSDA 2Q3ZA 3DX7B 4PV8B 2ATPB 3LNHA 5TK2A 1KGJA 4HWBL 2VZVA 1UGKA 3MLSH 4HK3J 4Z7NB 3HZVB 4XNDA 1W0WB 4JM2C 3KVDD 1A9EA 3OQ3B 3QJSB 4HKBA 1ZLVH 5EF2A 5L7XH 2MH4A 4XPFL 4OCYL 2DMGA 2UWEB 3CDGB 4L37A 3CZEA 5GS0C 4NNPH 3DUUB 3UYPA 3L5WA 3QFJD 1YUHB 1OT2A 1S7QA 1NMCB 2CKBA 4N2BA 1DUYA 4Y5YC 5EU6E 3NSXA 2Z31C 3D34A 1BXXA 4YIQB 1J5IA 4RWYL 5BS0B 1GA2A 1UXSB 2YSSB 3WELA 1OT1A 4PI2A 2FLRT 5DMGC 4FABH 5I1CL 4BFKA 5I0WA 4OLZH 1PZUB 1IBBA 2ED9A 1Z9PA 4L5FL 4U3SB 1QRNE 4XBEL 1K8DB 3U7WH 3H4FA 4ZODA 5DK0B 5E5MA 1RJCA 1UZ6F 4HU2A 4LSQH 4M8QA 3RAJL 3D06A 5AW8B 1IC4H 1KG0A 3SHSA 3V4UH 2ALAA 3N1PC 4HG4J 1UOVA 3ATBA 2L8AA 1FORH 3I6GB 4GAGL 5J6GA 4YBQC 3QWRA 3S0PA 2HVJB 4J3OD 1FFNA 3V52H 1QTSA 2HPOA 2APBA 2Q5BA 3NZUA 4FA8A 2NZ9D 4X5LA 4EVNB 1MCWW 4JDEA 4DOHB 1WYJA 3EUDA 5HYQA 2ZOUA 1K6QH 5H94A 2EILB 3VA2C 5DEFA 5HJ3A 1L5GA 2GAZA 4HS3A 3SDYH 2ENSA 3WE1A 2AV7B 2G5RA 2NY0D 3VFVB 3L16A 1JD9A 1LE9B 3U82B 2VDKL 3SDDD 1KB5L 4HUCA 1RZJL 5TE6L 3WJJC 5DJYB 3IDYC 4PRDA 3QDJB 4NQXA 3TFKC 4FNQA 5CP3A 1N5AA 2DOCA 3ARDB 4FTVE 2O5YH 3WFZA 1KJ3H 1VCBC 1WS8A 5CD3A 4UQ3A 1HHGB 1Q94A 1NL0L 4GIPD 1CBVH 1EANA 1WZAA 1OANA 3QHFH 4OFQA 3EFOA 3I74A 2VL4A 3IETA 1RFDL 1E7VA 1XH3A 4APQD 4ZFZB 1A7BA 4YUEH 2XZQL 3MLTA 4JE0A 4N2OA 4AKPA 3VG0L 3EO9L 1V5JA 2VIRA 4JO2H 4URKA 3QYMA 4LVEA 4CILA 4OCSL 4MX7B 1WIUA 5FYLE 4A68A 2ICWJ 4XN5A 5L6YH 3U4EB 4LDCA 4NP4L 3F6JA 5CKGA 3RQ3A 1G7QA 1XAUA 1LMKA 3OZ9H 4O2CA 4F2MB 4I2XE 2KERA 3FRPB 3W9EA 4NKIL 4IIQB 4OLWL 1RUQH 1A2YA 2Z1PA 4X50A 4X7CC 3U0TA 1MLCB 2ADJB 3WIFA 1IB5A 3KPNA 1WVZA 4PP2A 3GFUA 3QFGA 4NPYA 3KWUA 3INOA 1F45A 5D71H 3FOLA 4J3BA 3ZRCC 1P0SE 2BNQA 1KJMB 5DHYB 4DKDC 2R7EB 2VLMD 3NCJL 4NQSA 1NAKL 4U49A 4X6DA 1E9PA 3IFLL 2WQRA 1ZHLB 2OZ4L 1UD2A 4M5YL 5ICXA 3CVIL 1IKNA 5LGHL 1LXMA 4HIHA 3ME0B 2N1TE 2HVKA 3PWPB 2F2HA 4CW1A 1G84A 3ZVVA 2PCFB 3GIZL 3I6KA 4X6EA 4JO4H 5PAZA 3S48A 5L9DL 3HG4A 4UM9A 3W0WA 1GJUA 4W4NA 5BUPA 3MLZH 5EULV 3TEUA 5T1JA 1RUMH 1XF2B 3IE9A 5ALBL 1XTMA 4ZK8A 4C56B 2IPUG 1RURH 2FDBP 1G4MA 2V17L 4W6YB 2W95A 5D1ZB 1KTJA 2DQEL 3RVTD 1E4JA 4NM8H 2EDOA 3RUGA 4L9LB 4B9ZA 3CFDB 2WLJA 1ODAA 4BWUA 4N90D 2IQAB 3K6OA 4F7TB 3DBXB 5IVXF 3D4YA 4ENED 2ROXA 3WBDA 2P1YA 4Q6IA 5J5EA 2VXTH 3AQYA 3FT4A 3GMPB 1OO2A 4Y1TA 1QEXA 3KM2A 4LOUD 3WS6A 2CRZA 3WS3B 5AAWC 3LEXA 3NH7L 1SOQA 4MAYB 3RVXC 3VWKD 1MFCL 4TLUA 1MHCA 1D7FA 1HFUA 2HTKD 2JI2A 3UTQA 1T21B 3QQXA 4ZSOB 1KPUA 3QQ4A 2PCXA 1JK8B 2YAFA 3VJ6A 3D48R 1EXUA 4FXGA 3KCPB 1JZIA 4FP8L 4QXTA 5J06A 1CDBA 3DXAB 4B27A 2YAOA 1WBZA 3O3AA 2CLRB 4JO3L 1A9BB 5DD1H 3MFFB 1UOKA 2CNYA 2GITA 1X6LA 4D7PA 4NQVB 2J5WA 5CD5D 4TVPE 3KVQA 4DUWA 3LQAH 2H0EA 3ESVF 3WN5A 3GJFH 5SV3A 2I7SA 1OF2A 5GZNC 3S35L 4LCUA 5CZVH 1TMQA 1TVHB 1EMTH 4HWBA 4BFIB 1U58A 4LCWD 2DJMA 2DRUA 3NIGB 3ECUA 3OLDA 2Y7OA 3SODB 3GKWH 1QBMH 5LAXB 2OJEA 3ZDYF 1YN6A 4JFFB 5IUSA 5D6DC 1LJMA 1GZHC 4O2FA 1E6JL 2MEJB 4PLNC 4FG6C 1DEEA 3WY4A 2H1XA 1NWPA 1PLGL 4M3HA 5CO1A 2DQDL 4H8WH 4LU5L 5A2CA 3PWLA 3BH4A 4NS0A 2B1OA 1FL3B 3RVVC 4J12A 4YO0B 3BKCH 3KPQB 5HYSB 2BERA 1XVSA 1UWYA 3GTNA 4AY0A 3SKOA 3NEXA 2I9LA 1KJ2H 1URLA 1EGJL 3SDXB 3BSZL 1GYCA 4BUGA 1SHXA 1A4KA 4QRBA 5ETUB 2XKNB 4FLQA 4HBCL 4KVNH 4AV0A 4PJGF 1F11B 1BG9A 1KENH 2A7BA 2A4ZA 3CBKB 5I6LA 3MJ7A 2E8ZA 2ZWKA 3MX0A 3A6BH 4NJAH 1YMMB 4WVRA 4ZOAA 2R29A 3TBSB 5L8JB 2R2BA 3D39D 2XZZA 4Y2NA 1NPNA 4UDTB 5I1GH 5TDNB 4D0BB 4ZZKA 2ESVE 1GY2A 4N8VG 1E5BA 3TV3L 3QPKA 4K3JL 4XPGH 5F7WC 2R0WH 4LLUA 3GJFB 4Z7OB 1MRCL 4XNXL 1FGNH 4P5SA 2WBJA 1FYTA 2FT8A 4EJ1C 5FO8B 1KB5A 2X6BA 2WCGA 4FYQA 3GMNB 5F7LB 4I89A 1CFQA 1G7PA 3VXQB 2BC4B 1U8LA 1H3VA 2E5EA 5DZOA 5I1LA 2JJWA 1M7IA 5I5RA 3MV8B 2QQLL 4KKBD 4Y5XC 5C0JB 1MFUA 5KBMA 1SPDA 4KKAD 5I6MA 2ZG2A 5IB4B 3EW3B 3EHBB 2FH6A 5DD3L 1ND0B 2OMNA 2ORBL 5DRZA 5HPOA 2APFA 2DQIH 3LVEA 3MRQB 2ZZUT 1DR9A 3HCVA 3BZEA 2ZOKB 3L17A 4ZQKA 3VE0B 1IGMH 1KCWA 5FHBL 3MRIB 3A6CH 4JM2D 2ICWI 5HYJB 3O2VL 1IEBB 4AL8H 2IWGA 1L9MA 3UO8B 2EO9A 4YOKA 4HCFA 2Y07H 3WMQA 2BVOB 5AW6B 1AGEA 5GS0D 5F3FA 3LRKA 5DJXB 2G5BA 4ZUTB 4HC1H 1QR1A 1CGWA 2BOCA 5I0DA 2H26A 1KTCA 3G6JF 2Z31D 4QRPD 5FO9B 1GW0A 2ODIA 1B0RB 4KO7A 3FCTB 4XRCA 1F3JB 4TUUA 5CR8A 4JFEE 5DMGD 4CA4A 2AK4A 4IRZL 1PBYA 3TV8A 4P2OA 5BO1L 5EIIA 3VSUA 3GSRB 4XPAL 4FQLH 3KCWA 5IQ9A 1Y7VA 4EOWH 3B43A 4ZBJA 3D0LA 2NDGA 4PRHB 1FNGB 5C07A 3LEVH 3VGHA 5T8IA 1T1YB 3VX1A 1FLRL 4BELD 1KBPA 2AQRA 2J57A 2OZ4A 4J6RL 2WLKA 1NFDA 3F7VB 3KLLA 5I6PA 1W0WA 2QPFA 1E50A 1XX9C 3BX7C 3MJGX 4Q2ZB 4WI0B 4Z95H 5KWYC 3LS4L 3MRBA 4HOMA 3U7YL 2OMXB 4GINA 1EUUA 3QAZB 1PX3A 2R2EB 2CXKA 3ZHLA 3G3LA 4WFHE 1A6WH 5IK3A 3T0EE 5TH2B 1BGXL 5KYXA 2J8HA 3UTZB 1MJJB 1ZIBA 2F53D 5B3SB 1YPZE 1KN4L 4JPWL 4BSVB 3B7UX 5KAQG 5DWUL 1K3ZA 3CZGA 3JVGA 1TTGA 3P3UA 5E0FA 4HDIA 4N0UE 1DN2A 2K4AA 4GPVA 3QG7H 3JV6B 2YUVA 3ILQC 4QUOA 3VGGA 4E5XB 1L3NA 2Y3AA 2PETA 4ZYKB 5KUMA 1MPAH 1HAWA 4ODWB 3BN3B 5CBEB 3QEQD 2MOGA 3O4OB 3MRLA 4KK8D 4X9GA 3KE0A 2F53E 2XY1A 3TASA 2IAMC 5I66A 2HPTA 3LSOB 1USZA 3SJVE 1QQDA 3I6GA 4NKOB 5EZIL 3V7MA 4ONGL 3F65A 1EK3A 2XNAA 5DJ6A 3W9DB 2K3HA 1EEUA 4WNJA 3WFBL 4Y19D 1JL8A 3TA3B 4PW3A 4L1HA 5EB9A 3P77B 2XRAL 3DK2A 1UB5A 1R1CA 3DX6A 1R3KB 3R8BB 4DPBX 2O5ZL 4FHJA 3V4PH 3QQ9D 3HUJB 3FMGH 4DNLA 1IBGH 3T04D 4FXKB 3EJPA 5BQ7B 4FS0A 4YDMA 2NY4D 5F6HJ 3FCGA 4QDGA 3GBNH 3QEGH 4PJ5E 2LFGA 4JN1L 3PDDA 5GGSY 3UBXI 3ZYIA 2FJSA 4LSRL 1T3FB 2C9VA 3MC0A 1PG7X 4HKXB 4MZ3A 1OCCB 2XIDA 4X7TA 3X1NA 4KK5C 4G6FB 3THMH 1XFPA 1IM3D 3AG1B 3VXRD 5CN1A 3L5JA 1AS6A 1AJ7L 2AXFB 2VLKA 4XO4A 5FCUL 1B4TA 2ADIA 5D7SH 3KGSA 4WJ5A 4ZFOL 2E9GA 4OI7A 4X6CF 4GUOA 2MSPA 3NFPB 4LDOB 2G4GA 2P80A 5E8EB 1J9RA 4G6JH 5E8NB 3DO7B 4KH2A 3VXRE 4M7LH 3DDGA 2RFXA 4XO3A 3C8KA 4ZMNA 3BPLC 1DANT 5E6ZA 5H4YA 4ODSH 3GB7B 3TPUB 1IBFA 3QUYC 5C08E 2HFGH 3DUSA 4U0QB 3F7QA 4YE0A 4QWWD 3D18A 3JUZA 4UT9L 4PCYA 1SZNA 4DVRL 4D8OA 4FKEA 5C70A 1USQA 1KJVA 1WAEA 2KH2B 3NJLA 1RUAL 1MLCA 3RWEB 1QTYT 2G60L 2WN2A 3V4PB 3HC2A 5KOMC 1EGJA 3I02B 5EV7A 3RTQB 4BXVA 5GGVY 2WY3B 1HKFA 4XPBH 4H40A 1S9YA 5F9JB 4PCSA 5HGHA 4JPVH 2NYYD 3E3QC 1RJLB 4JG0L 3JWNG 2RAMA 3RKDD 4JRYB 5T1LA 5EIIG 3SKJH 3EKCA 1NDTA 2CCVA 4UTAH 1OM3L 1J9SA 3I84A 4W9LC 3HLKA 4BINA 3H6JA 5FOBB 4Z7WE 3QYNA 3K0YA 2P7TB 3L3HB 5MEQA 4KQ0A 3ROLB 2EEXA 2Z7YA 4RESB 2WVVB 2YD8A 4FNLL 2UY7B 2BIQA 5KVGE 2H0JA 5EC1B 2QPDB 3MNZA 4H1LH 4ZW6A 1EAOA 4TSCH 4BSJA 4DP1X 4U1GB 2CALA 1NGQH 4FJZA 5D8JH 4X83A 1YJDL 3ZDZE 4JRWA 1BOYA 3MLVL 1NCJA 5HGGS 3PY9A 3BJLA 5KJ4A 2UVFA 4A6YB 3LNIA 1KMGA 2X6UA 1HEZB 3GHEH 2J88L 2X05A 5DA0B 5IROD 1IUZA 2F74A 1RHHA 3K2MC 3D4CA 3NK3A 3FQNB 1RP9A 2R4RH 3B9AA 3JWOC 2CMRL 1CXEA 5AVXB 2OSWA 2WQUA 3NRQA 5FV2A 4OZFH 5EZJA 1P7QB 4DCQA 5A40E 3BLKA 4AENA 2C1PB 2CZNA 1N0XH 1S7VB 4ELMB 1A7RL 1SJHB 1E90A 2YPLE 1AG6A 1SN5A 2FJGA 3CFBB 4OSUL 3RVVD 5IM7A 1KBGH 1CR9H 1GS6X 3H42H 1ZCRA 5DUPL 3LXAA 4IRZA 7CGTA 5I15L 2CLRA 4LIQL 4GKOA 2OR9H 4J1UB 3QQ3A 1H19A 2XTJB 3GSUA 1FNFA 4RVBA 2I5YH 5IF0B 5JXAL 3VD2A 1OAXH 1XZ0A 4JPKH 2AXJA 4NOBA 5IQOA 1H5BC 1NCCH 5TTRA 3WSQL 3ARQA 1GC1L 5DYOB 2P5WB 4PRIA 2CU9A 3MJ8A 3L3GA 4JVPA 1UCBL 3FFCE 5C0IB 1IAKA 4NZRH 2EVIA 3CIAA 2P45B 1ZVSB 3QA3A 5ADOH 4JFFA 1WZLA 5L88L 1G1KA 3VA6A 1PZ2A 1T20B 2WHVA 4JR9L 3CZFA 1N2RA 2VQTA 5CSZB 4OQ1A 2XWEA 1P69B 3DRTB 1WA0X 2QBWA 2FYVA 2H4EA 4XVOA 5LCVH 4P5RA 4EKJA 4EE2A 2D8KA 3PHQB 2VDLH 4E68A 1OZTG 2YPKB 1X5IA 1WAPA 4YO0A 1CIUA 2NXZD 1SBSL 2J6WA 1NANH 1QBAA 2PMZA 4JHVA 2HMIC 2HJKB 4AEHL 5I1AA 1NICA 3LHPH 3CAFA 3FRPG 4Z7QE 1NCDH 4L3ED 5CBAA 4FXGC 1XGPB 1A22B 2BZCA 4ZT1A 1NMBL 2NXYB 1MCPL 1W9XA 4KTEL 4PWIA 3H4HA 5AW3B 3SBPA 4RSYA 4GSDL 1E4HA 3CDZA 4U1LB 2B59A 5J6SA 1QP1A 3H3KA 2VM4A 4PJIA 4XODA 4XMUA 1M1XA 3B83A 2GJ6D 3IVKA 1MCKA 1ZLSL 4D0BA 2IFFH 3LB6C 3QORB 4UV7L 3R4DA 5CU5A 2DEWX 5DJ2A 5F6HI 1IQDB 5C6TL 1BBDH 5SWQA 3HHSA 2IALB 1AKPA 1J8HB 3MRHB 1P5VA 3LH9A 1XDTT 4NLHA 5DS2A 5E1HB 3N42B 2VLJA 4BQ8A 1X5GA 5JIKA 4XWGH 4A1RA 2WMPB 3JUYA 2EC9T 1ZY9A 2MOQA 2WSKA 2WBWB 4IBQA 3VNYA 1OZUA 1J87A 1ZV9A 2DQFB 5J57B 2EIZB 3CWGA 2PTTB 1VEOA 4ZFOA 3L7FB 5B3JF 2YFNA 2PYEE 4ZS7H 4ZFGH 4PRNA 3TPUA 4UQEA 1HXKA 4R8WH 3L3JB 4IMLB 3ZE1E 1OGAD 1QSEA 3KPMA 1E4XI 4DZ8B 4I4WB 1WFMA 2VDRL 4JM2F 4QT5A 1U2HA 2CIIB 5DK3A 4LGSB 1IC0A 1IEBA 1U8IB 4EDXB 5KBDA 1NC2A 1T89C 4G6KH 3BXNB 3MMEA 3ATAA 3MCLL 3QJXA 4HCRL 3OR7A 5AOLA 3LDBC 1J1PL 3M7FB 4UT9A 2FGWH 3ZGHA 5K9QI 1PQZA 1MXDA 3QIUA 1WUNT 4G6AC 4NOFA 3V0GA 3LX9A 2V4LA 3B5TA 2IOMA 3P3SA 2WKGA 5GGQL 3KPSB 2XWJB 1CICC 4WW2A 5C86A 3ILQD 2ZXWB 2W80C 1WAAA 3DVNA 2ZAHA 2B2XL 1RZJC 3H2QA 4M7KH 3VD0A 1XIWB 1IFHL 3QDGB 2IAMD 5I74C 4K3DH 3WUWB 4ACTA 4YHOH 5AVVB 4XOEA 3GSOA 1H8NA 3VXMA 4C4KT 1W0YT 4BCYA 1QO3A 5LGYA 3DJSA 4KMTL 3KPOA 4S0TD 3T3PE 4KZDH 1EX0A 2Z4QB 4BDVB 1ROWA 3TNMB 4U05A 4A2EA 4OGQC 4JFZH 4J6IA 4GH7B 5I30H 3PP3K 1C08B 5K9KA 3WGVB 1EVTC 1X5XA 1C8PA 3UAJA 1OB1B 2YC1A 3NJGA 4JB9L 4IBUA 5EIVA 1MW2A 1ETB1 1UKTA 2XZAL 3PG2A 5DUML 1R3HB 2YAMA 1H3PL 4HGWB 4J3SA 1AANA 5D1QB 1XCQA 5F3HA 5ITBL 4L4VA 4MNQB 2FWOB 3JTTA 3LRGA 4KK5D 1JCVA 3DX1A 4FD0A 1WO2A 3QJQB 4GAYA 4ZMXA 1BV8A 3HOGA 3LAFA 1AR2A 2GK0A 5DHXB 5FHAH 4PJFB 5F44A 3I50H 3MHZA 2IQ9L 3BDYL 4CMMB 1DEDA 1JBJA 3MRPB 5HYSG 3D0AA 3VGAC 5IEHA 3K2IA 3QP3A 4PY7A 1RPKA 1FDLH 3V0FA 3C60B 1CYGA 1V27A 2VITB 3O6FB 4OLXH 5HHXH 3K2UH 1HWWA 5CMAB 3W9DA 2ZCKL 3LH8A 5F7AA 2CGRH 1T6BX 3TZVA 2DD8H 3V5DA 2NY3B 2OMTA 2KLRA 1Q9KB 5I1DA 4OZGF 1M3JA 4LPCA 4XI5D 1K8IB 4IOIA 5IJKA 3QWRD 1ZV5A 4JHUA 2ATKA 3QUYD 4TNFA 3L3KB 5KN5A 5C9JB 2WXHA 3IJ8A 3NSCA 4F20A 2Y6SD 2J12B 4ZW3A 2B0SH 3FPYA 2VQUA 1SVZA 1T3FA 2G2RA 2EDWA 2IXQB 4JREB 1MRDH 4M61B 3OKNA 4J7RA 3FF8A 2VWEE 2NX5B 2ZNWA 3DI2B 4YHNA 5C2UB 1W16A 1I7UA 1ONQA 4G82A 4LCYB 1KTDB 4FQJL 1IX2A 1HJBC 1OQOA 1ZD6A 1U3HC 4XMLH 3N6YA 1VHPA 4R96A 4IKNA 5I8KL 3Q9PA 5EO9A 1SRDA 3NFPA 4P2CG 4G5ZL 3L5IA 5E8EA 4O2EA 1M71B 3R7RA 2HRHA 1T66C 1TPXB 3ZMEA 3NPSC 1NLDH 3NSDA 3RTLA 5EOQL 1RZKC 4GRWB 4IW4C 1YEEL 4M6NH 4DAGH 1FZKA 4Z0BL 3INUH 1AGBB 1TJIL 5FECB 1G87A 3T8VA 4NO5A 1KXTB 4NM4H 3S36L 3V0DA 4HUVA 1QD0A 2XYBA 3DHUA 4ZO7A 1FG9C 3WLWC 4DEPC 5F96H 1T04B 4MASA 3NVQA 3FN0H 4KOBA 1NBZA 1DJXA 3U46A 4CKVX 1EHNA 5TF1L 5GGVL 1CFTA 3IFNH 5FM5M 1VDGA 1AVAA 1EFXA 3FSZA 5E6YA 2WLLA 3HNTH 4OLVL 3VI3A 3MRDB 3FU8A 2P44B 4EUPH 1S7WB 4L0ZA 7PAZA 5SWQB 5DURB 1VEPA 4DTGL 4W9EC 2FUQA 1KTBA 1QPPA 2AJYH 2FECL 1KCSH 1YECH 3PHOB 4JRYA 4QY8B 2JKSA 4MQXC 4TVSa 3DX3A 3BDXA 3R19A 5B22A 2V2TB 2BNQD 5FYKH 3TT1L 1EAPA 3N41B 2X3BA 3QWOB 3BHBB 4XMKL 4KRMB 4OZIB 1VGKB 2CDEA 5DT1H 3EOBA 2VLRB 1IGCL 3RGVA 4ICWA 2P7TA 4GW5A 4U1KB 3OF6A 4K7PX 3BVUA 4M8RA 2B4CC 4B96A 5FW6A 2EJ1A 5LDSA 2X1PA 2Y3NA 4JFVA 3VTMA 2VSCA 5ERWA 2J4WH 1BZ8A 1AD9A 1RULH 4X4MA 4UV4L 1EO5A 3O0RH 3U9PL 4AI7A 2OR7A 3D85A 5FGCB 3QK0A 5I1EL 4UM9D 3TVMB 2VXSH 1I3VA 4YHZH 3ZL4L 3LKOA 3W0WD 1QZ1A 2SODB 3IKCB 4LARH 4LVNB 3FYEB 3IDIB 4MDIB 1D5ZB 4K23L 1HL9A 4N8CL 3VFUB 5DD0H 5JUEH 4A6YA 2OMVB 1X5YA 1FAKT 4PGDA 3ARSA 3K2KA 4OD1L 4N68A 4E5XG 2COQA 1ZTXE 5GISL 2XV2A 3ISYA 4PJEA 3OZLA 1Q0YL 4LF3B 3DJTA 2B14A 1TJHL 2YRZA 3WEOA 3FQRA 3NSYA 4HCRA 2LE9A 1B0WA 1PGRB 4BFEA 2PLTA 4XH2B 3I75B 3O2DH 2YMXL 4KXBA 5DUBB 4X2UA 1ZXKA 4ZNCD 2C1PA 4MYPA 1IM9B 1BBJA 1NDGB 5KSBF 3NESA 4B9IA 1IGFL 3QUMB 2QFRA 3FK3A 3QZBA 2JI3A 4Q7DA 5T1DL 1MFDH 2X6AA 1U92B 2VN7A 4NQEE 5AZ2H 3L45A 4DSYA 2BP0B 2JKNA 1CGSL 4ODTL 2UY6A 1PDKB 2XWXA 5HHMD 4X5WA 5MERA 5GSRA 1YEJH 2V9QA 3BAJA 4AJYV 3HE7A 1ZOXA 3QO0A 3F62A 1CL7L 4MSWA 2IH3B 2A99A 2YJQA 1U8MB 5IUCA 1CLZH 2APTA 2NY7L 4X5QA 3ULUL 3FN3A 5FWQA 1P4LB 4L8DA 1UACL 3LV3B 1A1NA 5C0IA 3JVFC 4BEIA 1EUTA 4JHZA 5DLML 1FC1A 4N22A 4UU9A 1JI1A 1S2EA 5EF0A 2FYYA 2QDVA 3AUWB 4AYSA 3LB6D 2HZHA 1CD1A 1P84J 3QEUB 3CQQA 4R3SA 4F91B 1AXIB 3H0TB 2QVMA 4LL4A 5CSZA 3CFKB 2HJLA 2O6EA 3UCRA 5E2TH 3TX4A 1BSIA 4LQFH 3EAKA 4JQVC 4BFRA 3OKLB 1XGYH 5J12C 1B90A 1MREH 3APCA 5BZWB 3QNYA 2V5YA 12E8H 5DEJA 3ZIMA 4Y9GA 4PN6A 5L2JA 2WGXA 1ZA3A 4YSRA 4L48A 4HCIA 2F19H 2RCSH 4PIBA 1HXMA 3MXVL 1DUZB 3PAYA 4BZYA 5MEPA 1SMDA 3QRLA 5ALCH 1DDTA 3LZNA 5EUKA 3V7AG 4AXWB 3WCYA 1CT8A 1U9KA 2ZUWA 4DEWA 2HRPL 5EU4A 3MLWL 3LPGA 1ADQL 4H8HA 5F9DC 2E7MA 2ZJSH 3MGOB 4WNSA 5C0CB 1JYVA 1NLBH 1AGCB 3PWVA 4U1LA 3PGDB 3CLWA 1BVOA 4L18A 1FHGA 4LGRB 1ZSHA 3ZE0E 1CGTA 2AJZA 4E9QA 1LWRA 1A6VL 2QHRH 3MSPA 4FQQB 4OZHA 1RZIA 1IQDA 3CTTA 4PJXB 2E7DA 1F6FB 5GGSA 3F84A 2IALA 3N85H 3UTSB 1NCWH 1IAOB 3TLRA 1U4FA 4G6AD 3ARTA 5DJAA 2ZXBA 2D0FA 4Z0XA 4BBWA 2PYFA 4EI6A 5B1KA 1R3JA 5KYYB 1CU4L 3ZTNH 4JN2B 5K9JL 4N8PA 3W37A 2HG5A 5ANME 5D2NB 5AKRA 2CLVB 4WY7L 5D7IB 1BQLL 5IHZB 2WBJD 2VJ8A 1FYTD 4MWFA 2DQFA 3TH3T 1R24A 1U8QA 3O9WC 3QCUL 3AY4A 3IRPX 3NJXA 4B3EA 3WLBB 1J9TA 4JFDE 1QFWM 1OXYA 5DVPA 3GLEA 2C9PA 3JV0A 1IAMA 2WWMC 2NW3A 2DW5A 3O8XA 1DP0A 2QKIA 1BQUA 4UQDA 2DJUA 5K93A 3EBGA 4NEHB 1UD6A 4HJSA 4XN9A 2NZIA 4GUCA 3UH8A 5EA0H 1LNUB 2CIIA 3O6LH 3MREA 1DBKL 4JKLA 4TPRH 5EUOA 3UAAA 1F3DH 3CHPA 5MEOA 2F1AA 1DO5A 4QTIL 4ZMYA 5ILTH 3BXNA 2ENJA 2VR5A 1J5CA 4PVMA 3IKKA 4K07A 4YDLC 2C3XA 2FB4H 4AE1A 5C6WH 3SGKA 5KYWB 4RCAA 1UZ8B 3L4YA 4DP0X 4A2DA 2WZ5A 3J2PA 3RL2A 2CO7A 4PI0A 1EHAA 2DWYA 2WP3T 2Z92B 3BPNC 2XQBH 2FVNA 4JS7A 4LQ1A 1LP9B 3MUZ1 3POCA 4GAAA 3ZKND 3NACL 1XIWA 5HDLA 1IIIA 3VMNA 5ISZB 3ILPA 2A9BA 3D08A 3U36B 4Z3HA 5JZ7D 2AK4D 2MOVA 4MD0B 4ZDHB 4P06A 2DPKA 1NC4A 4P2OD 1UYWH 4UQBA 2J2ZA 3IAGC 1JZ4A 1AR1B 1INDH 2YBGA 3S9DB 2Z4QA 3QI9A 5C07D 3BAKA 2ADGA 1D5MA 3H9SB 2OTWB 4NHCL 3MLRH 1KNOB 1OB1A 2DTSA 2BIOA 3R8QA 1NGYA 1JPFB 3FYIB 3JWNE 5D2LE 4ZRGA 1R3HA 2VDMH 3M6DA 1RL1A 3GXFA 4TM9A 3VGFA 3IBEA 5I0XA 8FABB 5GZOA 3TT3H 3AWGA 4MCYA 3SZKC 3T2QA 1E67A 4M5SA 2F8VA 3MLYL 4P4KA 4HKZA 4ODVL 1G9NL 4JFXB 4GRLB 4JFQA 4NZUL 4OF8A 2CHDA 2HKHH 3GLDA 1V3JA 1DL7H 1D9KA 3QIUC 4URTB 5DMYA 1NCBH 4Z7NE 4TS6A 2ZIDA 2IMMA 1U3HD 2F1EA 3APDA 2XVLA 4QLRA 1UFGA 2UWEE 2VITA 3H9YA 5JIDA 3RPBA 1OOWA 1LK2B 3IXAB 2C34A 5IMLA 5KJ7E 4AH2B 3ARWA 2IWKA 5EZPA 3A23A 4QRSA 4KFMA 5DVNA 1T66D 4WI8A 4XPTL 4UB0L 3DLQR 4F7MB 2GT9B 2E6QA 4CVUA 5BS0E 4PHZA 5K59F 1FIGH 2CCLA 5D1XB 1RJYB 4P23B 3FU0A 4MQSB 3NCCB 2VMFA 4UI2A 2GY7B 3KM1A 3IJEA 3CBJB 4P5KA 1ZK9A 1IAIM 1Q4NX 1KYUA 5CJQH 1YN7B 3AADB 4R7LA 3RBGA 3GRWL 4Q89A 2GSMB 3ARBB 1UWGL 4FFZH 3WLWD 4ABQA 4FLOA 4NENA 3UAJC 2BWDA 1H6TA 4X4XA 2FBRA 1OARL 3C5SB 1PZ5A 3FU5A 2HH0H 1P6AB 3UO1L 4QYOB 1NAML 1DLFH 1KN2L 3PJNA 1PX8A 5F7EL 35C8H 2VDMB 4DOHE 1JV5A 3CFTA 5C0FA 5HHOB 4YSPA 1YJDC 3VMOA 1GOGA 2BPBA 5D55A 4AMKL 1DQQA 5JQ6L 2VLKD 4I1PA 4HFUH 3AMKA 4OGYL 1X5LA 1E5CA 3GHPA 2BHYA 2F7QA 1AP2B 3V6OE 1UJTA 1NQBA 4LASH 1R34A 4RFEB 1JWMB 3QDJE 4IEFA 5DFTA 2E27L 2WUBL 5SWZD 3VFRB 2P80D 4FC3E 4J8RB 4PJHA 1W72L 3L5XL 3JT0A 4JCMA 2NQ3A 1JGVH 3TZVC 2YD0A 3KBEA 3VXPA 2NW2B 4MA7L 1I1FB 2EO7A 1CI3M 2JQAA 5IJKC 4NT6B 4F5CE 3Q1SH 2PPDA 4LCCB 4Y1AA 1P5UB 3OAWA 1NKRA 2YSTA 3ZTCC 5T3ZL 4BXSV 2WM0A 1ADQA 1A6AA 1J5OL 3D0VA 4FXLA 1A8ZA 5FPIA 4I48A 3DURA 1WFOA 1F4WL 3QIBB 3ZT6A 1C16B 2DV6A 3B3IA 3QYCA 5KVDH 3CHQA 5SWSA 3T0EC 5B39B 3T65B 4OR1A 5GRJH 1ZDSA 3GLZA 2VR8A 1JDDA 4PJ8B 4QY8A 5L8KB 2D7QA 4GEJA 2X4PB 1U8HA 3G9AB 4F2ME 4FA6A 5IT2L 1E4WL 2VN3A 4HUWB 3WUWG 4C83A 4WHYH 3FFOA 3FO0L 2PUQT 3HFMH 3HEIB 1Y1DA 4X6DF 3ZDXF 3DIFB 4HZLB 1MHPH 4K4KA 4WDIA 5DRXB 5T1LD 3HVNA 4LSTH 2WQSA 4XX5A 1Q72L 3RZCB 4G9FA 4CNIB 3P3TA 3MNVB 3H9HA 3IU4H 4HJ0D 3VXSB 1Z9NA 1M42A 2P24A 1UXWA 2A74B 2AI0H 4WTXA 4Y88A 2WANA 2FT7A 3DSNA 1YNTA 4Y1SA 4TSBH 2QPSA 2VDOH 1QAWA 3OKKB 1MF2L 1BZEA 1B9KA 5AYTA 4BUQA 2UXVA 1KELL 4KROC 4TUJB 5D7HA 2OR8A 4YL4A 5GQBA 2E3VA 5CEXA 3PWPE 2ZXQA 5JR1H 1CO1A 4AOFA 4NRYB 1DQJB 5G4MA 5D70L 5F71A 5HHVL 1N59A 1OTTD 3RUGF 4XNQB 2IDSA 1XH0A 2Q8AH 3QPQC 4FQXA 4QTFA 3NFSL 2OYPA 4C56E 5BVJB 1HILB 2OA9A 3NIDF 1NOFA 2CA3A 3VACA 3WY3A 1HDMB 2CBQA 4JRLA 4JY6B 2I27N 3KYMB 3MACL 3OKMB 4XN1A 3KDPB 4R7DB 1SJEB 3MODH 2Y6TE 1I9JH 1Z9LA 3FB5A 4HIPA 2QKSA 2Q7AA 3BUTA 4O4YL 5AUMA 1XR8B 1EFQA 3PGCB 2ZYSA 1VESA 2VYRE 5LBGA 3RGVC 4LHJB 3N44B 1FRGH 4KNSA 1BAWA 3QJHB 2IVFC 4KRPC 5DZJA 2OJZL 4XMZA 1BYOA 4RFNC 1QLEL 4X0NA 4DWHA 3S5LA 5ADPL 2YRBA 2NY5H 4HIIA 2FBJL 3LV3A 4MNHB 5IV2B 1K2DA 2E76C 2JTYA 5LWYL 3MAWA 1SYSB 1G9MH 4J28A 43C9B 3CN3A 4DF9A 3V79C 4QTHA 2EIJB 1R9FA 4ZSOE 7FABL 4XVUC 3M1OA 2AXWA 4K2UL 3HR5B 5JPNC 1BF2A 2MPAL 3LY6A 4PRID 3RB5A 1EHLL 1HSAB 2W0KA 2DWDA 3DXAE 1A64A 2WCSA 3QDAA 1WP6A 3H3BC 4FFYL 3WL9B 3EOTH 3JBG7 3OKLA 5DA4A 4AUJA 5GS1B 4QRFA 2CBOA 4JFFD 5IGXL 3VFWA 2HWZL 1RIUL 1TQTA 3QXAB 4K5OA 3RWHB 3AABA 4FNTA 4G8GB 3I6LD 2VABB 3APNA 1G7IB 2Y5QA 3UC2A 3VO0A 3ZE2F 2FK9A 4CKQA 2PW2A 1PX4A 1EO8H 4P46C 4V1DA 4DPRA 3UJJL 3O9WD 3NIGE 2WUCH 3SGEH 2IBZX 4AXWA 5IZ7A 1MWAL 1QFWH 4JFFE 1GAFL 4PGCB 5SX4H 4AK2A 2E9JA 3DYMA 3MGOA 1SOSA 2EC8A 5I0VA 3HBQA 5DMKA 1EBAA 2VRAA 1IGJB 2IADB 2IGFL 3Q6GL 3WHXB 3SEPA 3HE7C 4I0CC 1A0QH 5DTFB 3L13A 3ZKXC 1RSYA 1JZFA 4R4BB 4FQQA 4G8EB 4MA8H 5CCKL 1OEZW 5HVHB 1KZYA 2JXMB 4JJOA 4WW1B 1OD9A 1HNYA 2C7FA 2XA3A 2X6VA 2X2YA 1A7PH 3GRWA 4M00A 4K9EL 1PG7H 1X9RA 1WCBB 4P2RD 3UGEA 2ZXEB 5HTSA 1B3IA 3AY2A 5D9SB 1T0OA 5C09A 1IE5A 5KYUB 1G6RH 3SDXE 3KWVA 4WU5B 1U8CB 3RLSA 3HS8A 1MFVA 1I7RA 2QQKH 3MLSL 4KQ4H 1GZPB 3VNZA 1NAMA 2WXQA 3F5WB 5FYJL 4LKXB 2VLJD 1UC6A 5L7XL 4UIMA 4GJTB 3MV9A 4X7EC 2N0KA 1YMME 3BN9C 3GUTA 4Y4FC 3ZR6A 4NNPL 3K91A 2H6UA 3HRZA 1QUNB 2R4SH 4IK7A 5B38A 3WJMA 1JZ2A 1WZ1L 3O6MH 5ICZB 1RLWA 1UJ3A 4Z7OE 2IO5A 4JFPA 4ANKA 4LGPB 1WDAA 5DVMA 2G0LA 3LKQB 4Q56A 3RIAF 2X2IA 3ZLQC 4OLZL 4IBWA 5AYUL 1A14H 1SHWA 3NA4A 1N26A 1QSED 3ALPA 3RWCB 4LDEB 1F4XH 1W72A 4K3HA 1AQDB 2VDPL 4LSQL 1IC5H 3KH4A 1UZ8A 1NC2D 3MV8E 3TCLA 3KLQA 1N5YH 2WKLA 3BP4B 3FUEA 3V8OA 3BEVB 2GB2A 5KVMC 5ES4B 5IKCA 1QA9A 2ITEA 3JTSA 4Y9CA 2G5UA 4I0PC 2VISB 4MMZB 3QIUD 4OB5H 3EFDL 2X4TB 2ZX7A 1OPOA 5HYJE 3WU1A 4GG6A 2O61B 2EE0A 3IMRA 1F1DA 1FA4A 1O7DC 4GBXA 4WHCA 3ZPDA 2VZTA 1LO5B 1KSRA 3ZU8A 2WWKT 4KX9A 2GI7A 2DYRB 2VMEA 3AY4C 3G7TA 1A4AA 3PYCA 2O72A 2NTFB 5JNYA 3VI4F 4M56A 3BQUB 1GYUA 1HH6B 4KQ3H 1BFOA 4MJIA 3RU8H 3R4RA 2HT4C 5JPMB 3O8XC 2QKIC 5MENA 1MVUA 3FQXB 3VXMD 3NG5A 5I6NA 1TCRB 5BZZA 1NFDF 3HHRB 5HDQL 3EYVA 2V7HB 2PR9A 1CBVL 2AJUL 3QHFL 5I2IB 1NBYB 3NZ8B 1S7TB 2IH1B 4W68A 1A7OL 4HJGB 4AC4A 5E9DA 4P5TB 4ZW7A 1ZLVK 1ILSA 4G7VL 4PRHE 4R0LB 5HI5D 3UAJD 3SDAB 4CSSA 2VM3A 4OV5A 2VB5A 1MJ7H 1AO7B 1ORQA 1XMEB 2YKLH 3SGKC 3O41A 3FT9A 4JO2L 2C4XA 4F8QA 2D03H 5K39B 4YPJA 3LN4B 2XFXB 3ZHNA 5ECJE 3ILEA 4L4VD 4H20H 1HOCB 2FWLB 1N64L 3UZVA 1OAZH 1DQDL 2Q2LA 4DN4H 1OSPH 1D6EB 3OZ9L 2F54B 1CD0A 2WXLA 3X17A 3U2SA 3V0WH 4KI5D 1O6SB 2VJ0A 3OPZH 5KS9F 3IXAA 5ID0A 4AH2A 3HG5A 1RUQL 2WVSA 3U4BH 5KBPA 4AX3A 4GQ9H 4JKKA 3FHAA 3S34L 3DV4B 4QRQA 4V33A 2NQCA 3IGAA 4P23A 3P11L 1WPCA 1P2CA 2J5LB 3KPPA 1ZJAA 3VFPB 1QSFA 5D71L 1B0GB 3TZVD 1JHTB 3QI9C 1I4FA 1MI5B 5CEZH 1MKFA 4CVXA 4FZ8H 3K72B 3CHXA 2WBKA 2C9XA 4IM8A 4H26A 4LKCB 4IGBA 2Y0SA 4IHOB 3DPBA 1JDCA 5FWRA 3DMMB 2CGYA 1KIQB 2IPTH 2BNRB 4L8BB 1HS6A 5TQ2L 3STZB 5GZOC 4S1QH 3V9EA 1DFBH 5E4OA 5CAYB 4P4KC 3KPRB 5HHOA 4LNRA 4PJ9B 2Q7YB 3GZOA 3IGUA 3HUJE 4G72B 4F8TA 4EXKA 1QUPA 2AMUA 1LWJA 3S3SA 1CE6B 2AANA 2EE2A 4HSCX 1A1MA 3MLZL 3R0NA 4I8DA 4KJYB 4RZKA 1RUML 1CDGA 1Q9OB 4GKZA 2VDNH 1NFKA 1NSNH 1RURL 4FFYA 1VGEH 2WNKA 2Z34A 5B38G 3U6XA 1JWMA 3DTUB 3U30B 4ZNEA 5E94A 3MJ9L 1AGFB 4J8RA 1FBIL 1PKOA 4N0YH 3BI9X 4D7BA 4YDJB 3NBNA 1I7ZB 3WKYA 4AQ8C 4AQZA 3WY1A 2KPNA 2F58L 5JDSA 2DAVA 3GHBH 3G5VB 4R2GB 2FJUB 5E0QA 4F33B 1X3DA 3ULVE 1MWAA 4QF1B 3F58H 2ODHA 2SEBB 1D7CA 1T7XA 1HTYA 2MQ3A 4LEOA 1BQRA 4KZ0A 2X4SA 4CVZB 2AW2A 1H8LA 2VXUL 8CGTA 4HLZG 2CGZA 1UH4A 2X0WA 4MA3A 1JNHA 3RBSA 1EFXD 3G04B 4O5LH 4MMXC 5J0BA 2J6EH 3TS8A 3SCMA 3IDMB 2VR6A 3Q8EA 3V7AE 5IW3A 5CJ8A 3QPQD 4HUWA 3DHMA 4NZJA 2W88A 1A1OA 5F70A 3ZOAA 5DRXA 1XCTB 3IPBA 1OM9A 1YAZA 3HBGA 3LZRA 1TZAA 2V7NA 5KG9A 2R0ZH 3NK4A 3OC5A 5B21A 4IRJA 3ZRFC 5CZVL 2BO0A 2CO4A 1NCTA 1JNLH 3K6DA 3KLHC 3H7LA 2A74A 3RGVD 2VAAA 1W0VB 1MCHA 1QBML 1YEGH 1IIKA 3FC8A 4ZOEA 5BXFB 1JV2B 2VOTA 3C6LA 3OF6D 4CJ1A 4LL1A 4JRYE 5T1MA 4E0RB 1VACB 1A3ZA 2G2NA 4K71B 1OV8A 3Q6FA 5IMMB 4O02H 2EEAA 2WV3A 3L9YA 3LZFH 1AXSB 2QL1A 4QHPA 3D85D 1M2VA 4H8WL 3RIKA 5F21B 2UZXA 1BX2A 5HDBB 2X0VA 2XXCB 3BKCL 4LFHG 2FQGA 4XVUD 4D8PB 5T1KA 2EUWA 5D7JA 4XNQA 4K73A 4YDVA 3MO1B 2AAVA 5IHUL 5D5MA 4GP5B 2E9BA 2RIKA 1PEZA 4X4ME 1KJ2L 1GGCL 2VWEC 1FC2D 4XCNA 2DQCL 3Q8AA 1HILA 5JIHA 2DWEB 3V95A 1PZAA 3FQTB 4JM4H 1BF5A 4FXTA 4R7DA 3N9GH 2IV8A 3GIVA 1RZFL 4L2YA 5D7LB 3QUKB 1K4DB 2TRHA 2YHGA 4KOCA 4PUBH 1KENL 1F0LA 2BW5A 1DJIA 2WXJA 1V3LA 1JHLH 4NJAL 4AUYA 1MDAA 5AOMA 4FJ6A 4Y2DC 4NN7B 3VFTB 3HC0B 4XNMB 1BJ8A 3KLAB 4YHYC 2AZUA 2BJML 4LEEA 3ENEA 4K3GA 4PG2C 5JOFB 3TF4A 2EVHA 1IAIL 1R5VB 3S37L 1WTGT 1FGNL 1I3RA 2ED7A 5CNHA 2F18A 3WD5H 1IZKA 43C9A 3HE7D 4LHUA 4ELME 3QH3A 3T0AA 3HR5A 4RMSA 5EEYA 5GSVB 1S8DB 5IB3B 2X4NA 1IT9L 2YIHA 3FULA 1R5WA 2XTJE 4AYMC 1UA6L 2BXYA 1JVKA 1J7VR 3EYOA 3RWHA 1NKOA 4D3CH 2L4OA 3WAJA 2VABA 4FQXC 3MV7B 4XX1G 5DMJB 4EXPX 2P5WE 4Y9FA 4I77H 3A6CL 3EGSB 2WB7A 4HW6A 4EZMA 4AL8L 1G1YA 3VSVA 4IOFC 4ZJ9A 2AJVH 4JHAH 3ISWA 4I7ZC 3LXBA 1UB6A 3QZOA 4HC1L 3GO1H 5IVXB 3QG6A 1EV2E 2V8MA 4JFOA 3HE6C 3AB0B 1IGJA 4NUPA 3BP7A 1EZVY 2IEPA 3KYNB 4ODUA 4QXGH 3N3EA 2NXYD 4XBGB 1RJZB 4R4BA 4Y4HB 3N1QC 1E8ZA 3L3DA 4QIRA 5A16B 4DGYL 5B39G 4PJIF 5C0AA 2DIAA 3F7PC 2GABA 3H3PH 4IJ3B 2B15A 1MNUH 4S1DC 3S4SA 4ZMVA 5D9SA 5CINH 1MFAH 4WU5A 1QKZH 5JOPE 4HSAC 5TDOB 4DQAA 1KFAH 1Z3RA 3F5WA 2UZIL 2DMHA 4WI9A 4Z95L 4IDLA 4LE8A 5A2AA 3RA7L 5CKAA 5JORB 3O3EA 1U3JA 2UVEA 2OULB 5HY9B 3W2DL 1G9NC 1BREA 4E9SA 1QUNA 2R23A 2ZAIA 3RWGB 3ZDYB 1QBBA 4I18A 4QRRA 4K5LA 4X98A 2P8LA 4OH2A 4GW4B 3CN4A 1J8HE 1ZT7B 5GJSH 2QV4A 2X40A 2KLTA 5IG7B 1CYWA 2HT4D 3O8XD 3RDTB 4OGAC 1QABA 3QG7L 1DVFB 3MJ9A 5JW4M 3SGDH 3UOAB 1AQDA 4M03A 3CU1A 5E51A 3BRFA 2A83A 2DL2A 4NWTH 1TQSA 2OM5A 4S1SL 2BSSA 1KTRL 1S7SA 1CZ8L 2AV1A 3KW8A 5IVZB 1AXTL 4PJBA 4KVPA 2VC2B 5CN2A 2X9YA 5FCSH 3BKYL 1U95A 4MNGB 1AQMA 3MCG1 4HV8A 1T1ZA 2YMOA 5CJXA 4L1SA 4DP8X 3N5AA 5EZLB 2O93L 1NBQA 1IBGL 2O61A 2BH0A 4N6QA 1YO4A 4RDBA 3OXRB 5EBMB 4BZ2L 1FFOB 3NZHH 3GBNL 4KMLB 3QEGL 5FF6A 1KCUH 4YK4C 2X2UA 2FSEB 4U1JB 2NTFA 2GY5A 5IP4A 4TF4A 2XPGA 3BD3A 1IC7H 2P47B 3BGFB 5JPMA 1S7RB 4NQDB 2FJHB 3C6EA 1RK7A 3FXIC 2R1YA 4K7PH 1NC4D 4OJDH 1W15A 3KPSE 4P9HH 4Y89A 3THML 1KXVC 3V0VB 4ZPTB 1OIOA 4FI8A 3QI9D 2IBBA 4KUCD 5D7SL 5AAMA 4AQEB 5LVEA 1S7TA 5EO0B 4AVHA 4BA0A 4H7VA 4JHWH 4HJGA 3UAFA 2BY2A 3T9WA 2QR0A 3GXMA 3MBEB 3QDGE 3DTDA 1PLCA 3ECVA 2ITFA 2HFEA 3IEAA 4O51B 3CZJA 4XZUA 3T0XA 4XWOC 3KXFB 3TBWA 3VG9B 4M7LL 4TLSA 3L7EB 1KLGA 3ZGIA 1OP3K 2XFXA 4WK4B 5GZOD 2BX5A 1OAUH 1D5IH 2F0CA 4BKLB 2LQRA 4HJJH 3UYRH 4P4KD 4OLUH 5L0QB 1D6EA 2F54A 2PR4H 1Q1PA 1T6VN 4QJ4B 1FL6B 1O6SA 2DF3A 1D9KD 3M45A 4JZJC 4ONFH 2OQJA 1EZSA 2ZONA 1QLFA 4AT6B 5T5NF 1KJ2A 5D1QE 3K0WA 4XXWA 5G55A 4N9GA 3KYOB 5B8CA 3OHXB 2HT2D 2WK2A 4MNQE 3GS7A 3G6JB 5FW8A 1E65A 5ESVA 3KYKL 3GBMH 5I76B 1I82A 4L0YA 4K5PA 4K5NA 4P2QB 5KZCD 5E6UB 4J3OH 3K72A 3BPCB 4PJFE 4Y4KA 1H0DA 1GGYA 4JPVL 3PJLA 4HIJB 4N3UA 1YEDA 3X1EA 4LKCA 4IHOA 3BVDB 4H8PA 3FSWA 3WTYA 5CUSH 3GXNA 3PL6B 5C7XH 3SOTA 4U4IA 2E8YA 3BIKA 1FIEA 3UGUA 4L3AA 4POYA 4PS3A 1G7MB 1XSKA 3S4SG 1NDMB 3BFWA 5CEYA 4LLYB 3EJYC 5BRZA 2LT9A 2ZUUA 3FSAA 2IWFA 2Q7YA 2N7BA 3KPRA 4NN6B 5FLUA 4U1MB 2X9XA 2DQ6A 1YPZF 2I24N 2P8MA 2YAQA 1OSEA 5C2BL 1SEQL 4XB7A 1WT5C 3ULUD 1MHHB 2B1HH 2NUTA 2LLGA 2EDRA 3T09A 1NEPA 3QFJB 4TSCL 3IU3B 2J7LA 1NGQL 2ZOTA 5D8JL 2XWBA 4HGMA 5CP7B 2G4EA 2NX5E 1VSCA 1AIZA 4BFNA 4U6HA 1ZEAL 2GTZB 3IFPA 5F7DB 4JFHE 5AW9B 2F5BH 15C8H 4MZRA 3KLHD 3HAEA 3GSXA 3BZFA 3GHEL 3QDHA 1GYAA 2ZSWA 4F33A 4HIEB 4FYSA 1FZJB 2MKLC 2WO4A 1DZ0A 1DE4A 1M7XA 4HWNA 5FV1L 5JA9A 1NIBA 2SEBA 4HC1A 2BP3A 5DVOA 1U2YA 1WEJL 5C8JB 4IGBC 2RTTA 2D3NA 3QUZA 4L4TA 4Y1AD 4HPOH 3T4YB 1LO3L 4H13C 5ACMA 2YQ2A 4ETYA 2WXOA 2JVUA 3JWNC 3G04A 4QHMB 4GRWE 2MNJB 3UPRB 2Y1AA 2ZUQC 4KKPA 2I85A 2P9RA 4OI9A 1TEGA 1LO2H 2OCJA 1AS8A 4NXSA 5I82A 1YYLL 1MWOA 2NY0B 2OR9L 5MHSD 1HHKA 1K3IA 5SWSD 2I5YL 3EGDB 5GHWL 2AABH 1UEMA 5D7KD 1GZQB 2P4AB 4JPKL 4LSUH 2G9HA 3HC3H 3SDDB 3RFZB 4QHUB 4B3VA 3CXHK 1EAQA 1U36A 5MP6H 3IMSA 1PIGA 3PE9A 2XLLA 3VU1A 4QMEA 3JWDH 4N1CA 2XQYA 3R7QA 4FZEH 4NZRL 4OJEH 3MVSA 3VFNB 1J8SA 1W0VA 1PFOA 3QNXB 3MRRA 4IKJA 1VFBB 3N55A 3D3VA 2BOBB 4G9FD 5D72H 2OXGB 1XF3B 4BK4A 1I9IH 2YGPA 1DJZA 1VACA 2DDQL 1Z9SB 3PV6A 4APQB 1F58L 4X6CB 2O6PA 1JGDA 3X3FH 4XNZB 4P04A 4WTQA 5LCVL 4X9HA 3B2XA 1U42A 4H88L 2EYRA 4OZIE 1O5PA 1NKGA 3BKJL 1FPTH 2VDLL 2VLRE 4ZX5A 2F61A 2WAQA 3RX7A 1JXDA 2IDCA 2ZPKH 3EGXA 2H5UA 1EVUA 1L6PA 2NDFA 2VJXA 4DZBA 3K81A 3QZWA 1A4CA 1AZZC 2DQJH 3MO1A 1VFMA 3NA9H 3KNBA 1NGXB 1MVFA 3V2AR 3LKSB 2R9HC 2XWZA 3LHPL 4PJEF 1YEKL 4Y5VA 4U1SB 3G5XA 3CH1B 5FGCE 1EXGA 1LEGB 4U2YA 2Y5EA 1Y6MR 3BAXA 2IPKA 1O6VA 4FQXD 4PP1C 4PR5B 4NC1C 1L9SA 4NO3B 2ZCZA 4V11A 4Y16A 4I88A 4KKZA 2BCMA 2EADA 1PLAA 3HZMA 4I5BB 2MWCA 1F42A 2ITCB 3D9AH 4CN4A 2Z0UA 2IFFL 3L81A 2P26A 4ZOCA 4IRJC 3KLAA 3V6OC 1MRFL 1BBDL 4AITA 4BZ2A 4Z7WF 4FG4A 4PG9A 3CHSA 2BZDA 5J3HC 3QRGH 3C6LC 5E4EB 3ARDC 1U21A 5H2BA 3IS1X 2MIZA 4NZDA 5I16A 2GK2A 2X4RB 4XWGL 3VD7A 4B5ZA 2XJKA 3N06B 2D3JA 5C0RH 2JNZA 5GSVA 1HHJA 4BA8A 5FYKE 1E4KA 4S1RH 5DZVA 4M6OH 3ZDZF 3L2NA 1T0MA 2FATL 4EF3A 3L1GA 1VERA 2JJTA 5EU7E 4S1DD 4ZFGL 5D7JC 1SEBA 3FUNA 5F0PB 3CMGA 2N4IA 4FL4B 3QHZH 2DM3A 5EFIA 3KEDA 4R8WL 2D7TH 2XN9A 3MV7A 4MDRA 4XR8C 2PW1B 2YZ8A 4JPIA 3S35X 5A2JH 4FHBD 2ENPA 3FUJA 3WTSA 4P57A 1QLRA 4QPEA 4IIQC 5HI3D 2Y23A 1CGVA 1YEFL 1TO5A 3HAEG 3HNSL 2Y7NA 3V6FB 1Q8MA 4V1DD 2P8PA 3RIFF 2A73B 4N2EA 2FGWL 1U93B 2EDQA 1ROCA 4BGDA 1JPEA 4PYGA 3P30H 3VDAA 1WC7B 1F41A 3FU7A 3VWKB 3TEYA 1XF5A 3CC5B 1DFXA 1BVLA 3GMLB 3KLKA 3WTVA 3PQYA 1WBYA 5DK2B 1CUOA 3UTTA 5LXGH 1D5BB 4C58B 1CLYH 1HOEA 2K9FB 2HTLC 2XWCA 4KZEH 1R6VA 1XH1A 2JIXA 2P49B 1UUSA 3IJHA 4OZHF 4NN5B 2YBRA 3NCXA 1S78C 4YWGH 5C0CE 4DKEH 4KZDL 1WA1X 5TDOA 1M9WA 1NEZA 5BOPA 4JFZL 1FFPA 5I30L 3T1FA 1S9WB 5C09D 4WV1B 5HY9A 4NPKA 2H7WA 3E1ZA 4LCWB 4F93B 5H35A 1I8MB 3A67L 4XCCL 1PY4A 1F8TL 2K0RA 1JZ7A 4NIYE 4PJXE 3BP6B 3LN5B 1EEZB 4GW4A 2CAKA 3MV9D 1IGTB 4UOW1 1OT4A 3L95A 1ZE3H 1HKLH 5KEZA 4WSKA 3UTSE 4H1LA 4PLJD 5LXVA 1W91A 1H8SA 1DVFA 2R0KL 3N40P 5IJVB 2ZKHL 3FNKA 2C1OB 2HVBA 3PABB 5IMKB 4ANVA 4TNWF 4Z7QF 4FQIH 4IMKA 5D2NE 3VVVA 4ETQB 5D7IE 3V5HB 1MQ8A 3U0PB 1NBVH 3DYPA 4ANWA 1MELA 3A22A 2FD6H 3BJ91 4KXCA 5DD5L 5J89A 2B1AH 3PNWB 4JPSA 1I53A 2DMBA 5E24E 2A6IB 2COVD 1UG9A 5IWLA 1TOXA 4HJTA 1MCOH 2H2SC 1ID5I 4BSWB 3QXUA 2CGRL 2UZPA 3BUBA 2O26U 5GS0H 5DC9B 2DD8L 4FADA 2X4UA 2V2XB 4WWKA 4MD4B 4O9HL 3RWDB 2OP4L 2NY6B 1RK1A 3STBA 3KH3A 1KGCE 3T0VA 2NY1C 4PJGA 3OXRA 4KVCH 2YEZB 4UOQA 3D39B 4J8QA 4ZTPH 1L7TL 3DOIA 4NBYB 3ESPA 3EFFB 4BK8A 1IMHC 3L5HA 1N8ZB 2D4DA 3EH4B 4GBXD 4M43L 4NQDA 4WUUA 3MA9L 4W70A 4I18C 4RISL 3V0VA 2OXHA 4OBRA 1H3XA 4NCC1 3REWB 4DESA 3GYRA 3IDNB 5TGBA 1JGIA 4PJ7A 1LP9E 4XMLL 4MJID 1RXLA 1FVEA 4NKMB 1BQHB 5MEND 1A6TA 5BJTB 4YDKH 5ISZE 4YE4L 1UVQB 3T6WA 4H0LC 4O51A 1XGUA 3VCLB 3KPLB 4E9XA 3OGCA 3TA4D 2EXYD 4FI6A 1TNNA 1FGVL 3FRUB 3L6FA 3RILA 5E9DD 2X5PA 1YG9A 3EJYD 1NLDL 2IF7A 5LCVA 2X9WA 3H9SE 3LZLA 1LO0H 4G8FB 4M6NL 4JM2B 3INUL 1H15B 4K15A 1FL6A 4QOKA 5HJBA 3BESR 4DGVH 1A3LH 3EJJX 2Y36L 5CJXC 4LFHD 4NM4L 1X44A 2X88A 2E0PA 3WTTA 1Z6JT 5F96L 3HMWL 4DVBA 4Y5YB 4G59C 1NZRA 1YQVL 2Z31B 4QRPB 3HZKB 2CH8A 4TNGA 4MCZB 3MUUA 3TWCH 4XXDA 1T5XB 1KULA 3EBHA 4NO2B 3RJDA 4F37F 1U91B 4RAUB 3LYRA 3LQAC 4P23D 2AJYL 4FNPA 5IVNA 1KCSL 2OSLB 1YECL 1U8PB 3LPFA 4LCIH 4NSKA 4R5TA 5GGTL 1YY9C 1QSFD 3T3PF 3EOAB 4OGXH 4Z78A 3NSJA 5AAMC 4OF7A 3NCYS 2DIJA 2ICWB 2AQPA 3VB8A 5C3TA 2ICCA 4CC4A 1GGBH 5AZEH 3DI3B 3QR2A 1J05A 2Y9RT 4IGBD 4YZFE 1SDDA 4P3CH 3O2WH 2P46B 1HNGA 4FYTA 1ZGLM 1HXYA 4HAGA 1ZT4A 1NGZA 2QVIA 3BWZA 5D1XE 5GGUB 2H1LM 5GRZA 1YNLH 1DQMH 4TULH 4B9YA 3DX8B 4WKZA 4N2IA 1RULL 5T3XE 4EPSA 1DBMH 3O0RL 1C5DB 4H8WC 4GXFA 4EZLA 3QFJA 5HHOD 2NYKA 4OD2B 3QJVB 1JP5A 4GMTH 7TAAA 4LARL 4H5SA 4DP7X 4UMGA 5KSVB 2D7NA 1M6OB 1S9VB 2IIJA 4ADIA 3BT2H 3IJSB 4ZMLA 3IDYB 3UDWA 4YXLH 3Q2NA 5IIEA 3G5ZB 2YWZA 3GINA 4PGBB 2WJ7A 3QCTL 3P4MB 4FF9A 1ETA1 3E6FB 3GTVA 5DRWB 4YSOA 3QEQB 1B4JH 2Q20A 1AIFB 4XCEB 3BYYA 1NFIA 3GBLA 4Z7AA 1VFOA 2C8NA 3O2DL 1A66A 2FHBA 4GT0A 1MH5B 1NPUA 4G1EA 1CFVL 3T4YA 4POUB 2OX5A 3F64A 3HKZA 4Y19B 3S3CB 1CFMA 4K3EH 2R15A 3SPVA 4HD9A 3T6QC 1X5HA 3VRIA 3UPRA 2ILLA 3LNDA 3LIZA 5AZ2L 4JO5A 4JKWA 4D9QE 4BE5A 1CG9A 5F9WB 2NY4B 1YEJL 4W4OA 4BH8B 1KGYE 2R83A 1J0ZA 1RZGA 1DLHB 4JJ5B 4DH2A 3FH5A 4HX1B 4Z7VB 3SCMD 3W82A 2XKUA 4UQCA 4NWUL 5GIRB 3CFEB 2WZ6A 4ZUSA 4I3SL 2CDGA 4F24A 4PP1D 1D7DA 2DIEA 1FZOA 4KHTL 4KJQC 4LLMA 4QHNA 5KVGH 1T03L 2TSAA 3GGWB 2VDQH 3QAZC 1IM3B 1Y1UA 3S96A 4HOXA 2EINB 3ET9F 3QNXA 4TUKH 2BOLA 1VFBA 3FN9A 4TL5A 2WD0A 4H8QA 4K94H 2CBTA 4IRJD 3IT8D 2FWUA 1IGYB 4HWZB 5E6SB 1FSKB 1BWMA 5E2TL 1F00I 2W59A 5E00B 3HMXA 5FYJD 3G6AB 1XGYL 4RMQA 1CF8H 1MREL 4AL8C 3C6LD 1YNTF 5F8QC 4KDVA 1BQKA 3LNFA 3UBGA 4IS6A 4HUXB 2F19L 2XA8H 1IVLA 4Q9QH 4GXUM 1ZT1B 3FB6B 3O4OC 5E9NA 1JPGB 3NJNA 3QUZC 4HEME 3VXSE 5INDB 1NGXA 3BO8A 1SUJA 3L9RA 1ACZA 3LKRA 2K8MA 1XGRA 2JK5A 1P4BH 4KXAA 5DZPA 1Z9OA 4JMXA 5T1KD 5D7JD 3TBVA 3CZSA 4J2QA 4MQTB 3H1ZA 3C5JA 3TA3C 3WMSA 5JHDA 3IFOA 1MLBB 1I1AA 4PJAA 4NO3A 2MHAB 4TVUA 4NDMB 1J86A 2GHWB 3LOWA 3PLYA 4EI5A 3CPLA 3RRQA 4ODXB 4FXKC 4GAFB 4LAQH 5I1HL 1KWGA 2RD0A 4FRWA 3U0WH 5IFHH 3QO1A 4MAUH 4NUJB 2XPZA 4XXCC 3B8SA 4KPHH 2V6HA 3UAEA 3N85L 4KJWC 1DJHA 3DSFL 3AM8C 4RWHA 1KYAA 2EXWC 3UBHA 2UXFA 5I1JL 5KVDE 2B9BA 5F88A 3MCYA 3MRNA 5DSCA 1AFVH 1VENA 1CLCA 2BFVH 3LEYH 3TYFA 4PBVC 4WFFD 4U6YB 3TO4A 2FCBA 3MPCA 5FYKU 2IOOA 3BAIA 3LHAA 4LHUD 4F9LA 5EN3A 4WO0A 3CLFL 4HG4K 1JZEA 4UYPA 3X14B 1DVSA 3QFDB 1IGIH 1S78D 2EDNA 4XP6H 3L8QA 3WXWH 4AYFB 3CX5K 1GS8A 1R3LB 3UC0H 5EA0L 4DN3H 3RGHA 3IMTA 4TPRL 4AIZB 2EDYA 2GUOA 2YR3A 1UM6H 3GXDA 4U0RB 5ILTL 3ARVA 2Y2WA 1UD3A 4XN7A 3DRQB 3LXUX 5JW4R 3AGVA 3P9WB 2FB4L 1KXQE 1J5DA 1OSZA 4C55A 4Z1PA 4EN2A 2KZKA 3BE1H 1U93A 2X28A 3MCKB 3KS0H 2BSEA 2JELL 5EO1A 4EBQL 4KJPC 2X1QA 2UUDH 3LZOA 3LKPB 4FMFA 4Z76B 1GPOH 2ZSVA 2ZYIA 3IAQA 32C2B 2WXGA 3AROA 3V0AC 4G8GE 3GMLA 2GEQA 3GMMA 2P48B 3UFIA 4ZX6A 9CGTA 5KSBB 2Z35B 4XOAA 2F8XC 4FQCH 5J9PB 4PRPB 1Y6KR 4G1MA 2W0LA 2RJMA 4HFWA 2HN7B 2QZ5A 5KVEH 2VLLB 1HCZA 4AZUA 3ORJA 5GGTA 3TN0A 4UTCA 4OFPA 1UYWL 1UT9A 5C0AD 4IQHA 1RERA 5JIQA 3WIIH 2IFGA 3MLXH 5TD4A 1CLOH 4U1NA 2OMZB 3C2SA 2X3AA 2JJTC 4KK6C 1G0XA 6PAZA 3MLRL 3QIWA 4WV1A 4ORZC 2NY1D 2TRYA 4U6XA 3IDXL 1Z3GH 1LEKB 2XIBA 4HS6B 4QO1A 5CILH 3OAYH 1CVSC 3GQFA 4G7YH 4W93A 1DVYA 4RETB 3FDWA 1ORSA 1OCOB 4MD5A 5D4HA 1ES0A 3ROOA 1JNNL 4JX0A 1DYZA 1J88A 2XTSA 3GUFA 2CJUH 1QI3A 2XWTB 4D9RE 4XVTL 4QRRD 1NGPH 2CHWA 4DGWC 5IJVA 2C7UB 2HKHL 2FL5B 4M62H 4M6AA 2V2WA 4WEBH 3SDCA 4A7SA 4ETQA 1EHKB 1NCBL 3QW9A 2ICEB 1AKJA 1PSKL 2L7EA 2NXZB 3F7YB 3LRSA 2ENYA 1E5ZA 4LLDA 4R83A 3ZL2A 5KVFH 3PXJA 2N01B 1P7HL 5DI8B 2VKWA 3B2VH 5FUOL 5DQDL 2HT3D 1K5NB 3HN3A 2XQ0A 1HCFX 3MRFB 3CFCH 2WYTA 4Y5XB 2BNUA 4MJ4A 4BSWA 4L3EB 2LABA 5FR3A 1LTXA 4MZ2A 1XSJA 1N9PA 1HC1A 3WFHA 2E74C 1MHEA 2BK8A 3O2DA 2RQEA 4TOYL 4ZTOH 4YX2L 5LBSH 3RWDA 5EORH 2CA4A 5G4OA 5IMOB 1DBJH 3BH8B 5DHMC 2QT6A 5JHLL 2GJ6B 1OK0A 1PKQA 4XP1H 4RZCB 2OMBA 3WIHL 1JRHH 4W9GC 4FFZL 1DBAL 1R5IA 3Q3GB 3T08A 3W5NA 1N8ZA 3BAWA 2HH0L 3UIZA 3EYUH 1PYWB 1KIUA 4NJ9H 1BG1A 3RDJA 1S5IH 4M3KB 3O4LA 4P9MH 2AJ3A 4HKJA 3EDJA 3B9KA 1UFUA 2GFBA 3VDCA 3IDNA 3QNZB 1VJSA 5BJTA 4NQCA 1TZHA 4MDJA 1JOIA 2WVTA 2OBGA 1JZDC 3SOBH 4HFUL 3A0OA 4IMKC 4M9PA 3NJVA 4F8PA 4S2SB 3FRUA 5A7BA 4AK1A 1AZBA 1AC6A 1PZSA 4JKNA 4LASL 4Y8DC 5IEKB 1JZ6A 3VW3L 4NKDA 1OGAB 4AEIL 2JJSA 1FNSL 4XAKD 2DYPD 5HYIA 1B88A 2ZP8A 3FT1A 3L08A 1JGVL 2CHXA 4M1GH 3UTPE 3ESMA 4WWKC 5BNXD 5DVLA 2CKBH 4ALAH 2O6DA 3CXHJ 4ANXA 4DO6A 3QAQA 2F54D 5EOCH 1QYGH 1M56B 2I07B 4WUKL 1Q9LB 3ISRA 1HK6A 1BAFH 1BIIA 2F5AH 4IU3A 3TTSA 4QRPA 3TIEA 5JO5A 4D9LL 4IU2A 1AO7E 1SXNA 4G8IB 1F6LL 5EIQA 3ARFA 3HC4H 4NO2A 4F92B 5BUAA 1U91A 3F12A 4I9WE 4A7TA 1T2QH 5GRJL 5ICYB 5DXWA 4EAEA 2EIDA 2F54E 5DHVB 2G3MA 3X3GL 3CLEH 2NNRA 4ODBD 3SKUD 2IAMB 4Y4KD 1JTTA 4GAJL 3PDOA 4LRIC 4M7ZC 1NJ9A 1B2YA 2FIKA 2AEPH 1JPTH 3AW5A 3VYPA 1MHPL 3WJLA 5M7QA 2W9EL 5DJ0A 4X9IA 4XVJL 1JCKA 4IJTA 5D2LF 3IU4L 1ZHBB 5DS1A 4AQ1A 1OE1A 5FKPA 2ZUYA 1MI5E 4B9CA 5KJRH 2X2HA 1KCRH 5BRZD 1U8NA 4FERA 1CFBA 1T22A 1NGWA 3M7OA 5HGDA 1BM3H 2PO6A 1U8KA 3GKZA 3P02A 5C0EA 1A9EB 4HKBB 4TSBL 2VDOL 4OJFH 1BD2A 5DZAA 4DP4X 1TTAA 3WJJA 4DW2H 4L37B 4UUJA 5AOIA 2BNRE 5JMOC 2YA0A 1JTOA 3KR3L 5HHPA 2G30A 4LLAA 1L0YA 1I8UA 1BZQK 1S7QB 2CKBB 3C6SA 1DUYB 3ZUNC 4WFGD 2PF6A 3PHAA 4OAWA 2QJDA 3KPRE 1W6WA 4R4FH 4NI6A 2B20A 4HZ1A 4JRXA 5CIPA 2Q8AL 5DFWH 5AD0A 4XPHH 4A63A 2VN6A 2VAJA 4ADJA 3ETSA 1I1YA 4R2GD