4Z3EA

Crystal structure of the lectin domain of papg from e. coli bi47 in complex with ssea4 in space group p212121
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
197
structure length
197
Chain Sequence
MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate-Lectin Interactions: An Unexpected Contribution to Affinity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords PapG, lectin domain
total genus 44
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3eA00
4Z3FA 1J8RA 1J8SA 4Z3EA 4Z3JA 4Z3HA 4Z3IA 4Z3GA
chains in the Genus database with same CATH superfamily
1M1XB 1A9VA 1CGXA 3GLDA 4JDVA 5CEZD 1KELL 4UDTB 4ZXBA 3GRWL 3OB0H 4EZMA 5ID0A 4NT6B 2GFBB 5EC2A 3F7VB 3SCMC 3OF6A 5IUSA 1IMHC 1BQRA 3FBQA 5DVKA 3MV7D 4PRHB 1HEZA 3EDJA 3GJEB 3MRKA 5DJ2A 1IIKA 5G5DB 5DHVA 3NFPB 2QTVA 1FPTL 2X9YA 5ANMA 3KPSD 4LMQI 3NG5A 4H88H 4UTAA 3MNWA 3SBWA 3UTPD 5MP6L 5I26A 1PY9A 1CICB 3ZLQC 5C0GA 1XGUB 3C9NA 3ARYA 3QQ9D 2P8LA 5HVGB 3TNMB 4X6EB 2DKUA 3GLZA 4XNZC 2E7DA 4JFZH 3EJUA 4LLYB 1NMCC 4NWUH 2D3VA 3ESOA 4MVBC 4F7PB 1ZLEA 3QZLA 2NY0B 4NRYB 3WNKA 1N5AB 4IRSD 4PJ8C 4HS6A 3LQMA 4G42A 4Q52A 1FVCA 2W94A 3GC3A 3MMEA 4I0PD 2JJUA 2XPGA 2VDRL 4PJDF 4CW1A 2C3WA 1E8ZA 1ZMYA 3VFOA 3QUYB 3WUZA 4E9TA 2FX9L 2QJDA 1YLBB 4JRXD 1MJ7L 5T5FA 3KGSA 2V0AA 3WFCL 1KUMA 3NBNA 1JGEB 1E3FA 3ARPA 4ILDA 1VZIA 2ICWA 4JRXE 4K2UL 4LLMA 3OKKB 5F9OL 4HKBA 1IM3A 1BJ8A 1RUMH 3S4SB 5BRZB 3BZEA 2P7TB 1R19A 4PCSA 3H4FA 3ENEA 2OMNA 1ND0B 1GYCA 2A7BA 4NQCB 5FYJL 5B1JC 2DH2A 1D5BB 1WGVA 2AJSH 1T7YA 5BS0A 1JK8A 4Y16B 5CU5A 5B3JE 3MRJB 3EYOA 1KCVL 2C4FU 3ARQA 3RWIA 7TAAA 3ARBD 4XI5C 1EJOL 4PJGB 2VOTA 2I5YH 4PFEA 4N8PA 3WEXB 3NPSC 5LG6A 1S7XA 4YDJA 3VFGH 5HPOA 4FQXA 3LNIA 2LLLA 2D7MA 1S7TB 1AYOA 3SDXF 4QLWA 5BJTB 1WD9A 4U4BA 2ZD0A 4LSRH 5DO2C 4PRID 3DO4A 4JKKA 3SKJH 1KGIA 2R23A 1TSHA 4AQ8C 4FYSA 2YMXH 4UUJA 5AVUB 2KERA 4HPOH 5T5FH 4LRIA 4TV3A 1BAFL 4LQ1A 5LHDA 3WUWG 4FHBD 3RX8A 1H5BB 4FCAA 4GQQA 1PKQB 4B9YA 2OMWA 2C9XA 1DL7L 3PP4L 2OTUB 4P2QE 2QR0B 5F9OH 1TU2B 3OHXA 3ZSTA 1MI5E 2FBOJ 4HS8L 3T4AB 3WFCH 5HVHB 2BXZA 5E2JA 3TYFB 1J7VR 1X7QB 3WNPA 4PWFA 4JZNB 4DEUA 4DW2H 3DVNB 3C5ZA 2OCFD 3I6LE 4AENA 2VDKL 1EMTH 3N1PC 3VFMB 4WW2B 3EIFA 1KXHA 5CEXB 4X6CF 4NCC1 2ETWA 1L0YA 4FTVE 5KANG 2ZXAA 3OQ3B 4FQQB 4MKMA 5IHHA 1KBPA 4I3GA 3F7KA 4Y2NA 5E9DD 1FFQA 2VLLA 4GP5B 4FTVD 3OAYH 4OAWA 2R56L 4LNRA 4OCSL 4YHLH 1YY9C 2WXFA 4G3YL 4WHCA 3M07A 1U93A 2ODIA 4GFXA 5E9DE 3K2UL 3ECUA 3VACA 2X7LA 4UNUA 3KWTA 3F3HA 4Z6AT 3QEHA 4LSDA 1A1NA 2HFEB 3L6FA 1IAIM 5L2KE 4F91B 1INQB 5B38B 4HEME 4N90D 3B3IA 4PHXA 1SHMA 2FGWH 3ARGA 3MGOA 2DLFH 3HVDA 3P4MA 3QI9C 3NJKA 3FB8B 4FQ1H 1TQWA 1JWMB 4DCQA 1QBLL 1DLHA 3UEZA 1MCIA 3BLBA 3D3VA 4O58L 4F92B 4RGNB 3AC0A 2K7QA 3GFUA 3RUGA 2YKKA 4IIQB 2PKDA 3D1MC 4PJBF 2O5NA 2WWKT 1UM5H 1MW0A 4J7RA 1LILA 3AXLB 5JIDA 1E2VA 5HVFB 1ZIBA 5GJSH 3IU4H 4UT7H 1R3IH 3EG9B 2V5SA 3G6JB 4HW6A 2V5MA 3C2AL 1UCTA 1JNHA 2PTUA 1CLZH 4XTRC 3EO0A 2WLIA 2OA9A 4X7FC 4YBLB 4MAUH 1HE7A 4JX0A 5BZDB 1D7BA 1U8PA 2ZSVA 2D7QA 4G70B 4JKWA 1ZT7A 3T4AC 4WKZB 2X9WA 3SIKA 3QG6B 3PLYA 3JZYA 3SE8L 5DD6B 1DJXA 1G9MH 1WRFA 1AXSA 4ACTA 2BIIA 1G94A 2WPGA 5I1DB 1ORQB 2DYSB 4AQEB 3CQPA 3O0LA 4A39A 1M7DA 3KYKL 4JM0A 5E8DL 4JDTH 4RLDA 3EYQD 4Z7NF 1KLGB 4WHDA 2J57A 2PCXA 4WI7A 4X42A 3SDAB 4N2CA 5EZIL 1SM3L 3BXNA 5F89B 3AABA 4ZXBD 2VC2B 1J8HD 1OPOA 4UNVA 1J1XL 3REVA 4AMKH 1E9OA 5DFAA 1JGDB 5I1GH 2YQ3A 1ORSA 2OXHB 4UQCA 5EZPA 3EJPA 3K74B 4LKXA 2CQVA 3K6SA 1I85A 1MH5A 2A1WL 3KLSA 4GG6B 1AZBA 1XF3B 1OK0A 4DKEL 5IM7A 1FFNA 3U79A 3H2QA 4HULB 5DRWA 5BZZA 5EIIB 3UGUA 5C0BE 3F7VA 4G11A 4MMXB 1LNUA 1F11B 1K2DA 2YPVA 4RAUA 1KTDB 4AM0A 2WLJA 4Z5RB 5B4MC 5IK3B 2KDGA 3ALXA 2DQTL 2P8MB 2PO6D 1PYWB 5LGKA 1OM9A 1ULVA 4HBCL 2ORBL 2L0DA 4NYLA 5IIEA 3PWLA 1DSWA 12E8H 3GMQB 4UM9D 4N1HB 1XCTB 1Q9WA 1MQKH 3SYOA 1FNSL 4QKTA 1GZQB 1Z5LA 4AEEA 4F5CE 5KVGE 3SGKC 3AG3B 4XO5A 5I6NA 2GCYB 4M5ZH 4X4ZA 5KSAB 1SGKA 2VDLH 3BWZA 3ARDD 3CHQA 4BFGA 3WS3A 3BZFA 1KTLA 1N0LB 4NQXA 2CRIA 2QHRL 1MLCA 1UC6A 4I18A 1B4JL 5JOFA 3DGDA 4I3SL 1NC4B 1HKFA 2WXMA 1BQHB 2HPTA 2A6KB 3V0JA 1E6JL 1X5AA 1G6RH 4UOW1 4IRSB 1KNOB 1QUNB 4HX1B 4WU5B 4M7JL 3TT1L 1IAII 3RZCD 2XDHA 4AUYA 3GSQB 4FXKB 4UB0L 4CJ1A 1NWPA 4AYDC 3AY2A 3BD4A 1EVUA 3GSNL 4QUOA 2E0PA 4XP9L 1F1GA 2YD2A 2PO6A 1OZUA 3ES6A 2XXCB 3X2QB 3CUPB 5D7IB 1FLRL 3W1ZA 3HS8A 4ZMZA 4PJHB 1H3UA 3SSGA 2A9NL 3WTUA 4P2OD 2PYEA 3NCYP 5C0AE 2OLDA 3KGRA 1FFPA 3A4DA 4G8EA 4PLNC 3DJTA 3IDXH 4OIIH 3A22A 2VXTH 4RA3A 4YGVB 2WAHA 1QLFA 3MZGB 3J07A 2RCSL 2JKWA 1A3QA 3B6SA 2XT1B 1CGYA 5AZUA 4XPGH 1I4FB 5EF0A 3BZ5A 5EUOE 3ZHKA 3KXFD 1D5MA 5IVXA 2GY7B 1Y1UA 3V52L 4Z7UA 4XXDB 4HJUA 5BOJA 3BKYH 1RU9L 1BLNA 4A7UA 5K9KB 3HI1A 4F7MA 1UUNA 4TNFA 2IOIA 2Z31D 5F71A 1WFIA 1QSFD 4I0CC 4EKXA 3ESVF 4L9DA 5JIHA 4LOUC 1U4FA 5FUZL 4A1RA 5DJ8B 3AGVA 4BK5C 4M1GH 3UBXA 3GHBL 3G04A 4UOJA 2K6WA 2JKSA 2Y07L 5AUMB 3EDDA 1T5XB 1E50A 2W9LA 4R90L 3TEUA 4PCYA 5G2NA 4Y2LA 4GRLB 1NCBH 3PL6D 4HJ1A 1JERA 1U3HC 3LRKA 5C70A 2YEVB 3NCFB 4S10A 4M9OA 2A4EA 5D7SH 3WFDL 3NGBB 3IJ7A 5EORH 2O1AA 1DZ0A 3MVSA 5IQLA 2EEFA 5ADPL 2OCCB 4XTRD 5E5MA 5HHOE 4B9IA 2HH0H 5IMLA 4KFMA 2CA3A 5JZ7C 1JYXA 3HE7A 1UFGA 1I8MB 4YSCA 3VFUA 2F53B 2YJQA 5DHVB 4G42B 3DRTB 4EUPG 1U58B 3O41B 5L88H 4A2FA 5EU6E 2IPKB 3MLRL 3N1GC 4D7PA 2D7OA 5EN2A 3MCLH 2ITEA 3AT0A 2R4SL 4KTYA 5JDJA 1HCZA 2W65B 1CGSH 2YEZB 5K9OA 3WFZA 1UA7A 1UA3A 2EABA 3RPIB 2DEWX 1ROCA 5FO8B 5I6KA 3BP4B 2L04A 1JN6A 4Y5YA 3C09C 1L0XA 3BZEB 4OLWL 3L3IB 2GUYA 3ECVA 3LHPH 3COOA 1IM9D 2XPGB 4JFDD 3L3OB 2WQSA 3A6OA 4HWEH 3FU7B 1F3JA 5DJ0B 4LK4A 2ZSWA 1PJ9A 1FIGL 1J0IA 4RGNC 4JKPL 4OFPA 5BUAA 3FRUB 1QO3B 3HPLB 3PFQA 3KL5A 3N0AA 4KZEH 5TQ2H 3WIHL 1PD6A 3PCYA 3F85A 1E3ZA 5D6CB 1A6WL 1S7TA 1RLBA 2IOOA 5C0BD 5J89A 2F0CA 2FVNA 4MZIA 2BIMA 4CILA 4D9RD 5D72H 5E08H 4OLXL 3P69A 2VITB 2QTEA 1WIOA 1R17A 1WAAE 3NACH 5MERB 4D9RE 1AGDB 5T1KD 1QTPA 2ZUUA 3D2UD 4AXWB 4L3EA 1W15A 3WE1A 1ORQA 4DH2A 3BLPX 4E9SA 2DD8L 3FUKA 1S7SB 5D72L 2WLNA 4RRPG 5GJTL 1U8HA 1LQBC 3JTBA 4H2AA 4I5BA 2L8AA 4FX5A 1ZSDB 3NRPA 2QHLA 3V9FA 2BC4A 2NSQA 4C54A 1RSFA 3OB8A 5F89A 2OMVB 3KJ6L 4MJIB 4QRQB 2QLVB 2EINB 2HVKB 2IGTA 1ZV5A 1RZPA 1XXFC 3D09A 2VLKA 1DQLH 4M9PA 1SEBB 1AIFA 5DC4B 3QR2A 3CFBB 1HNYA 1SJEB 2ZOKB 3CC1A 4HUNB 1U3JA 4XMUA 4BYHA 3GRGA 1ACYH 3BKJH 1DSFL 3VFMA 1T22A 1OT1A 4X8JB 2BW5A 1AGCB 4M00A 5E03A 3ULUH 5T1KB 2IDUA 3T6QC 3MRGB 5EIIA 5DRNA 1JZ8A 1FC2D 4BWTA 1AYRA 4Z5RA 3EOAB 3CSTA 2PW2B 1E9QB 4OAWB 1K8DA 1WA2X 2XWXA 2D8KA 2H3NA 3AS1A 4GBXD 1E3XA 3VB8A 2CR0A 3QJVB 4GS7B 4LE8A 4HG4J 2LU5A 1VFAA 1JS4A 3FU8A 5KW9H 5EO0A 3L6FB 2B15A 3IEAA 3L7EA 4WW2A 1Z32X 3I9GH 5BQ7B 1L0QA 3CGTA 5GS2D 5HYJE 3UZVB 2J4WL 1WITA 4H20H 1XGQB 3RY5A 1X7SA 3OTTA 5FLVA 4GO8A 4L0YA 3Q8FA 3WTTA 3KPTA 5DDHA 1EXUA 4Q6KA 2VISA 1E9PB 3WV0A 2D4FA 43C9B 1CD1A 1NDMB 2A6KA 1QFUL 3HFMH 1TG8A 1DVUA 2X0UA 3DOHA 5FYKH 4X8CA 2BSDA 3G5YB 4UZSA 2IALB 2GEEA 5E0QA 5AL8A 3N1MC 1HVXA 5E4AA 3LKOA 2WLIB 5FUZH 4H0HB 2PPDA 3CU7A 1KFAL 5BV7B 1FZMB 2ITDA 3K5SA 1NBZA 4NQEA 5D1XC 5AW0B 4ZTPL 3KPOB 4Y5VA 1JTTA 5C0BB 1T7ZA 1AXTH 4JPIB 3VXRB 5IKCB 2TAAA 5HHME 4M4RB 3DHJA 5ACZA 1T6VN 3KPQA 4HUKB 2J6EA 3PIQB 5IQNA 4NB7A 1SXBA 4K3EH 4WWKA 4KZDH 4FQLL 3UZQA 4FNUA 3TVMA 3IDXL 4OIIL 3CH8A 1IGYB 4DP8X 1BCIA 1E8YA 1F6FB 3GM8A 5DC0A 5DD6A 3RDJA 5DR5H 5DZLA 4KJWD 4MJID 4JRYD 3OAZK 4Z3FA 2JIXD 3TJEH 3I3EA 4OBRA 5SWZD 4XMKL 1W8EA 1LO5A 3LQZB 1TJIH 4GAGH 4XPFH 2QVMA 3M45A 3U36B 4LP4A 3LY6A 1CURA 1KLGA 3ARFA 3D0LB 4MCNA 4JPVL 2IANE 3VXQB 4GKSB 3B2VH 3QQ3A 3TCXA 2C1OA 4F57H 3WOVA 4UB0H 5DHEA 5HHOA 4PU2A 1K3ZA 2WKOA 3RJOA 3GEWB 1D6VL 1NIAA 2OQJA 2ZCHH 4NN5C 3WBDA 4PWHA 2OR9H 4QXTA 1KG0A 2GAZB 4F7KA 3FL7A 4I3RL 4H8HA 3S2AA 5JR1L 1R24B 1SDDB 2LW3A 2OX5A 4L9LB 5LNGA 5EOCJ 4NO0D 3FQUA 2BRQA 1RZFH 4LCVA 2B1OA 2J20A 3DGCR 5I0VA 3LS5H 1KCBA 3LRLA 4KQ4L 4XCYB 3FMGH 3WS3B 4M43L 4IRZH 3IFOA 3Q48A 3ZE0B 4G9FA 3TYGH 2C9QA 12E8L 1OGAB 4ODWA 1MDAA 3N85H 4D8PB 2HTLC 3MUUA 2ORBH 2DMHA 4HBCH 2DRUA 3MUZ1 1ZT4A 2CNZA 4CVUA 1MHCA 4QRBA 1YN6A 5F3HA 1GC1H 2IDTA 3DPBB 2BY3A 2Y7LA 4LZKA 1ZLUK 3WS6C 2OK0L 5BMFH 4XXWA 4HDIB 4M7ZB 4PJFF 4QOKA 1EDHA 3S9DB 5F7MC 3IFNL 3HHSB 1Q0YL 2PCFB 2VRQA 4RCAA 3QFJB 2OZ4A 2P47B 3OHMB 1IFGA 3MXWL 4KVCL 2WQAA 1AO7D 3HJ0A 3S88L 1RZGB 1KTRL 4JPWH 5DJ0A 4IRSA 3ZL1A 2FRGP 3BKMH 2W60B 3OMIB 4DZBA 1WFOA 1OAUH 1ZAGA 4QXVA 1QRNA 2A73A 4K7FA 1TETL 5KVDH 1X4YA 4G72B 3QULB 3CMOL 4RBPH 3RWDA 3S2CA 3O6LL 5EOQL 5GS0H 4E42B 3FFCE 1GYUA 2IC2A 3KYKH 5FHBL 2BSSB 3BHBB 1DN0A 2O5ZH 1MFAL 4Y4HD 2YPVH 5JPMB 1Q1PA 4F7MB 3WEMA 3FQWB 2QPEB 1IC0A 3OGCA 2CO4A 1HHKB 1BMGA 1WSST 4GUPB 1A2YA 1MJ8L 1V3MA 1WHPA 1ZTXL 3C2AH 4N9OB 2OMBA 4KVNH 4O02B 4X7SH 5GJSL 4XODA 6FABL 1I3VA 5E94B 5SWSD 2CBMA 1U21A 3B9KB 1IX2A 5F97E 1XF4A 3KPRA 3X3FH 4H26B 1BQSA 1GKOA 5D7JD 1WLHA 2IFFH 4BKSC 2DDQL 2VXQL 1ILUA 3AGWA 3T8XA 5F6IB 4KI5C 4EUPH 2MRYA 3E3QE 2DL9A 1IT9H 1TKWB 1UT9A 3QDJB 1DBAL 4UT9L 4OGYH 5ICZB 3EJYD 1AZCA 4N3UA 1AGCA 2DLFL 2QBWA 3NSYA 4MXQD 5IHLB 3T0EE 1YMMD 4X6DF 3IAPA 4LEBA 4QOKE 1NLBL 3L3OC 3OKDB 1U58A 2OR8A 3O41A 2X4OB 3IXTA 5LXGL 2BIQA 5IJKA 3BPOB 3ULSA 3BPCA 1MCPH 1TVBB 4M6NL 4NKDA 2PXYD 1JRHL 4M8QA 3VD4A 5DUML 1H5BC 1VACB 4I0KA 3ARFD 4YHLL 3EOYG 4ONGH 1D5ZB 5I1KL 1G9NL 2I07B 4M6MH 2CZNA 4HWBA 5SX5H 3SPHA 3FT3B 3VWJD 1PZ2A 3ROLB 3RZCB 4DVRL 2H0PA 2IAMB 4MDJA 3FYIB 3Q43A 3VD0A 3VXRE 2BVUA 4Z0BH 4AVKA 5DS1A 3MNZB 5DDHB 4L4VA 1E4KC 4IKJA 3ARDB 2ZXEB 4K94L 4MJIE 1YYML 1BZEA 1E28A 4R4FL 2W65A 2Y5EA 3FRUA 4ZUWA 1C5BH 4N2FA 4XHJD 1DJIA 3NK3A 3MFFB 1FFOA 1P84J 5FM8A 2XPYA 4L3FA 5IB5A 1DE4B 3A4FA 3O2VL 2DH3A 1UFUA 4XXCA 2ERJC 4Y9FA 5D6CA 5FEBA 3C6LB 4CN1A 4G8FB 3OV6A 1X5MA 2F74B 3L3KB 1HWHB 4PD4J 3OKNA 5E9DB 1VLXA 5T5FL 4PJIB 3LNHA 3NIDF 4JK0D 3F8UB 3FU7A 1NSNL 5MERA 4JFYB 4KOCA 1BBJB 1FNFA 5CD5C 1KBBA 2NYYD 3BGMB 5IQ9A 1I53A 2PXYC 5D2NC 4QY8B 4ZUVB 4LSTL 3VFWA 3QHTC 2AJ3A 4X4YA 1KOAA 2AQTA 1YCSA 4UTCA 2KS0A 3GMMA 2V2WA 1TQBB 4UIMA 4LSTH 3K2KA 2IWFA 3TA3A 1J0YA 3ZQ9A 4BDVB 3RUGE 3DO3A 4NRXA 1GCFA 1D5RA 2YD7A 3MRPB 3WJMB 2P4AB 1XZWA 2VLKB 4KK5D 4BJLA 2L7QA 4P46B 4JFEE 3DXAB 5ELIA 4GJTB 4WHTA 3AAZA 4PJIE 1OP9A 5D5MF 1UWEH 4MD5A 3GZQA 5IG7A 1EDYA 1LO5B 1AACA 1E67A 4E9WA 3G5ZA 4F8OA 1J0ZA 4O5LH 1TVHA 4WF7A 5IMMB 4NQEE 2DJMA 2X6BA 3D39E 2H6OA 4S1DC 5I8CA 2R59A 3GMOA 4XP1H 3CJJA 4YHML 3VWKC 4YDVB 2BC4B 3QAZC 4NKOB 3WO4C 4G59C 1U8JB 1CLOH 3S36H 5ANHA 1Q90A 3TBVA 2L3BA 1YYMH 4KO5A 1MJ7H 4WFEE 4FMVA 2IWGA 1CT8A 1MCWW 1F86A 2OQJB 4FFVC 5CN3A 4FQJL 2I27N 1E0OB 4ZS6D 4BA0A 3SJVA 5E4IA 4HU8A 1NINA 1PNDA 4I13B 4IBSA 5M94B 1QWUA 3QXAB 4KK6D 3RILA 4LARH 4R5VA 3NIDB 4NWUL 3SPVB 1MCNA 5DFVD 3ZT5A 2VSCA 3NZSA 1AHWB 2XWBA 1A4AA 1E5YA 2EO1A 1EWHA 2E27H 4LRIC 3HCVB 3HPJB 1K5NA 1VKXA 5GS1C 3O6ML 2EQDA 4AG4H 4JM4H 1QSVA 2BP0B 4RZCB 2EKSA 2YAMA 4TNGA 5FA3B 2P43B 1GIGH 4DIXA 4PJ7A 5AW1B 4WTQA 3G5YA 3FB7A 2R29L 4KU1A 4M5TA 4YFEA 3B34A 4MZ2A 1PY4A 2R8SL 3CVIH 1TZGL 1WBXA 3ZGIA 1U2HA 2BOBB 5IW6B 4AT6A 5F88B 1JPTL 2ZOWA 3KLAA 4JLRB 1IT9L 3RDTA 3IMSA 2A6DA 2NY2C 3N1QC 4AL8C 4W9IC 4N2OA 3IMUA 1DFBL 4AQ1C 2E7LA 4LIQL 1RZGA 3IRPX 2VQTA 4JPIA 3T77B 1WT5A 2JB5H 6FABH 1GGBH 1ZANL 3GMPA 4NN6C 4X7SL 5D7JB 1WC7B 2VH5L 4BSWB 3HJEA 1KIUA 1MRCL 1IC4H 2MNUA 4DTGH 5EHFA 3A67L 1Q72H 2VJ8A 1OAJA 2BNQE 1MJ8H 4ISVA 4MAYD 1X9RA 3CLFH 5DRXB 2E86A 4XXCC 3B5HA 1HFUA 1SYSA 2MOGA 3VGGA 5BQDA 4C55A 3FN9A 2UY7B 2WINB 3S96B 4OJAA 3S8FB 4YVNA 1N19A 3BAEL 4JQVC 3RNQA 3U7AA 3AM8A 2YXFA 2YAFA 4YBHA 5AAPA 2N0MA 4QMEA 2RB8A 5FDYA 1TT6A 4ENEC 3E8VA 4XPAL 4WUUA 3W37A 4PJ6A 3FCSA 5CWSB 5FHBH 3OXRA 3INUL 1E90A 1HU8A 3VH8G 4UTAL 3ZDXE 1TETH 1QYGL 2CRYA 2AGJL 3LKSA 5AVVB 3UC0H 3B4NA 1MAMH 1T7VA 1ETB1 2AJXL 3D6GA 3MCKB 3TO4C 1RLWA 4FI6A 1J8SA 3P2BA 1GZHA 4OQTA 4KX8A 2ICEC 4X4MA 1RUAH 2JJWA 2XG5B 3MLTA 4WW2F 3V8CA 1NMAH 3EAKA 4G5AA 1JSYA 1Z6JT 4KNTA 3MXWH 3RRQA 5KJRL 1MZYA 2DWEB 2DM4A 1ZK5A 3IFNH 4NWTL 4W4OA 3U36A 2J8OA 4XGZA 1KLFB 2QPFA 3L2LA 4ZPVB 3BYTA 5TE4L 3BVWA 5ERWA 4XMVA 5IB1A 2FATL 3X13A 1FGNH 4YC2B 4MA1B 4ENZA 3RURA 5FPIA 3IF1A 2BHFA 1J05B 2CGRL 2GSIB 3MRQA 4IEFA 4U1JB 2NTFB 1GRWA 3N85L 3B8SA 3LN4A 4OD1L 2NCEA 1OOWA 2MQGA 2PP7A 3TT3L 5LG1A 4U1SA 5FOJA 4IRZL 4KK5C 2PYFA 4RGOH 4EXPX 3DO7A 4XNAA 2DM2A 4UILL 1OALA 4PGJA 1DUYA 3KL0A 2SEBA 2GSMB 3NFSH 1FZJA 5FC9A 5ISZB 4UQ2A 1RZFL 4NLAA 1P1ZA 4F7PA 4KKZA 1EVTC 1SY6H 1BM3H 1G6VK 2XV0A 4UIKL 3JV0A 2VN6A 4K9EH 5IVNA 4XAKD 1NGPL 1FYHB 1L9MA 4P59H 3IFOB 3EH4B 2QVTA 5GRUH 5JR1H 1OF0A 5F96L 1J0HA 2YPLA 2VR4A 2X2IA 4U1MA 3X1NA 4P23D 4ONHB 3AG1B 1OPGH 2F5AL 2EIZA 3KBFA 1GW6A 2O61A 1NL0L 3B2DC 3KCPB 1L9SA 1EAQA 4HKBB 2DTML 1YMME 3QEUA 4K55A 2GI7A 1B0GA 5LGJB 3STZA 4CMHC 1EUTA 1X6NA 4UYPA 4Y1AB 2PCFA 4B9CA 3UJJL 1JF1B 3SE3C 3UDWA 1WG3A 3KLHD 3FO1A 1H3TA 1MCSA 1KBGL 1X5HA 5FHAL 1JNNH 1JG9A 5IQ9B 2MSPA 2V8MA 3Q3GB 4WWOA 4PJDE 4APXB 3K80A 1KJ2L 1QP1A 4XN8A 1T20A 3LZNA 3NH7L 4AQAB 3TS8A 2F54B 4GMSL 1KTKE 4HJJH 5J6GA 4Y19A 4UIMB 3U9UB 1MF2H 4PJDA 4YHKL 5KAQF 2N7BA 4PS7A 1AXTL 5IMOA 1ERNA 1T89A 4CJ0A 4DK5A 3RWCA 2VR5A 3OGCB 1A6UL 1BFOA 1DVYA 2B0SL 4U7SA 5CF3A 2JKRM 4RWYL 3RTQB 4BFIA 1KB5L 4XMPH 3HLAB 1OAXL 1WZMA 3ZKMC 5ICZA 3Q0HA 2PMZA 3ASWA 1Q9KA 1KEGL 4S1RL 2MHAA 4KTDL 4HA1A 3BP6B 4LF3B 3AUVA 1HC1A 1TTFA 5I5MA 1XB3A 3FQ1A 5EPMA 4WSGA 5FYKL 1OP3K 1OTSD 3BP5A 2JIXA 1ETZA 4JY5L 4W9KC 1Q8MA 3GPSA 5C0CD 4AGLA 3L13A 2EVFA 4NFCA 1OHZA 3H53A 2X4PA 2E8YA 3HMXA 2AITA 1GGTA 1B0IA 3ESUF 3NAAH 3VG9B 1J8HB 4QRPB 3DIDA 1O6TA 1NQBA 1Q94B 3NDYE 4Q8BA 2FJUB 4ZSOA 1A7BA 1A9BB 1I7RA 4LPXA 4PD4K 1RVFL 1EJ6A 4TS6A 4XB3A 3LRGA 2AEWA 4APQB 1ITBB 3GINA 1BIIA 1WISA 4X5WA 5EU7C 2A4ZA 4Z7VE 2ZWZA 1HHIB 2FL5B 5KW9L 2H7WA 4W9FC 3TP4A 3U0TB 3N44F 3TU6A 3HAEB 4UYQA 2ID5A 4QTIL 4R97C 2DYPD 3ATAA 3D18B 3QIUB 1CI3M 4PJCA 2R7EB 1HWGB 4JKMA 4LLQB 2F53D 4JHAL 5J1AA 5T33L 3VCLA 4A7GF 2YLKA 3ZGHA 3WNNA 3ZKSD 4JNXA 4GLRH 1WBXB 3RP1A 2H1XA 1WUNT 2VUYA 2ZUXA 1CLYH 2IEPA 2GQHA 4JQVA 3LN5A 3VQ1C 1SXNA 3LKQA 3QDMB 4WFED 5GZND 1IGMH 2QADC 4ZDHA 4R3SB 3FNKA 3L9RB 5HJDA 3TCLB 4GQ9H 3BVDB 1DQLL 1E28B 3HS0C 2IH3A 1R4XA 4WW1B 4P5MA 5EIVA 1IL1A 3EH2A 2EC8A 2C9VA 4PJXB 1GS7A 1YC7A 1P4IH 4I85A 5IQOA 5ALCH 3MXVL 4UV7L 4F80A 1S7VA 2CJUL 1YUHB 4G6ML 4XBPA 3C6LA 2HKHL 3WYRA 3ZHNA 2NYZA 2J44A 3SD5A 1NIEA 5IT2L 5A2FA 2WO3B 3QNXB 3I6KA 5JORA 5KBKA 2L7JA 1BBJA 3FRPA 3I6GB 2EIKB 4HUUB 3RI5F 4AQEA 2Q3AA 4BSJA 3KCWA 1H6UA 4FQXD 3MMEB 1JXGA 2AJ3B 5GS0C 4CAGA 2EDLA 3ZE2F 1IAIH 2BXYA 1NEZG 2AK4B 2D0HA 3J7HA 4RRPM 3DX8B 2CLZB 3MCKA 4CKVX 1SEQL 2VMFA 4DKFL 4KZEL 3T3PB 2GG1A 3MV9B 3BVXA 4JKPH 1SJXA 2AV1A 4XOBA 3ML8A 4JANA 3IDIB 2XQYK 5AALA 2LR4A 3DXAA 2WB7A 2N3JA 4AK1A 3NJHA 3QISA 1KGWA 2V3EA 1HHJB 1P7QA 4EZJA 3VVVA 1NCWL 4XGZB 5BPPA 2HJKA 2Y7MA 3B83A 3F01A 3NJMA 4PY7A 1J1PH 5AYUH 4NGHL 4K5PA 4Q7DA 3QB7C 3HB3B 2DV6A 4GW1A 1N4XL 4HOMA 4HHAA 4PJGA 3BZDA 1K5NB 1RURH 2VDNL 2EC9T 3PHAA 3QUHA 1AZZC 3D2UA 4X9FA 4YMPA 4PGBA 5EZLB 1W0VB 4PP1D 5C0JA 4ODTH 1S7QB 5AVYB 1KJ2A 4QT5B 1QBMH 3CN1A 3V6OC 4N0CD 2WIIA 3MRIA 1MWAA 3FH7A 4I1NB 4KXZI 1RZ7L 1BBDL 1DDHB 5HDQH 4P5TD 1ZK9A 1C1EH 4TNVK 4ABVA 4N24A 1PPIA 2XWCA 1BJMA 4JE0A 1M9SA 1E4XI 2DQDL 2DLEA 1L9NA 4N2EA 2WC7A 5I6XB 4YIQB 4LL9A 3IPEA 3WFDH 3QNZA 1DEEB 2CUAA 3KPSA 4IOSA 1NCBL 4S1QL 1OP3H 1CI5A 4JY6A 2WVVA 1CYWA 5IV2B 3ELAT 4NQCE 4N5EC 1XCQA 3WSQH 3B43A 1JFQH 2XFXB 4P3DB 4D0DA 2J5LC 1C08B 1M1SA 1FFTB 2EIBA 2AXFB 3UPCA 4ODVH 3MACL 1YRKA 3L7FA 1AR1C 2D3LA 2WVTA 3O6FA 1UM4H 1ZA3A 1DBKH 5BZWB 3K71B 1J8KA 3ZTNL 5ANME 2CWRA 2BSRA 2DJ4A 4GSUA 4RMSA 3B7RL 1I85C 4PAZA 4R5XA 3VI4F 4I0PB 4H8UA 5IHZA 3N55A 4OZGF 1FL6A 4NZTL 2VLLB 4ZUTA 1FJ1A 1S9KC 2AVFA 2JKTM 3I85A 5IFAL 1XR9B 1CXLA 3B6SB 2KPWA 1MY7A 1I4FA 2GBTA 3THMH 5IHWA 3PNWB 3ME0B 3GMRB 4Y19B 3TN0C 4XX1G 1HAUA 3IE9A 2ZPKH 1CIDA 3R1GH 4LSPL 5F8RC 2UY6A 4OF6A 2WLZA 2Y2WA 3VGDA 3PQYD 1S4IA 3AREC 3JWDL 5JPMC 5FX3A 1XXDC 4O2CB 1TMQA 4O2EA 3GXUB 3V6ZA 4G80B 3TOPA 1G7PA 3AY4A 3HHMA 1IO4C 5I71B 2WTPA 1W80A 4Y19D 5DXWA 1OW0C 4WGWB 1J05A 2APVA 3SKUD 1X3DA 2RQ8A 4U2ZA 1GOHA 5E23A 5F1IA 4U1NA 1IEBB 4FTVA 2YZ8A 4NUGL 2GK0A 3T3MB 5EFIA 1JL8A 5T1LB 4UT6A 2ERJB 1S7UA 3QJOA 3UJTL 3V4VB 4BUQA 3TV8A 3QZMA 2QGBA 1U6AL 2PR4H 3QUXB 3X14B 1T21A 4N6QA 4AEHH 3ZW3A 2DF3A 2GJ6E 3BESR 1MSPA 4G1MB 2J1KA 3UGEA 1C5DA 1TJXA 3LNFA 2P28B 4XPTH 4L8SA 1SDYA 4L29A 5C0NC 1IAKB 3BE1H 1NFAA 3HBZA 3OZ9L 4FXLA 4WEMB 4UWQB 1UD3A 2AP2A 4YX2L 5INCB 4OM1H 3OKEA 3FZUC 2CLVB 3FT1A 4UQ3B 2WSKA 4JGNA 5I1AA 4JM2B 5JIKA 1D6EB 1ZD6A 4XOEA 3DROB 1MPAH 4BH7B 3FUNA 3GZPA 4HIHB 5BW7C 1VERA 3GS4A 4JFQA 4KHXL 4H25B 3ZE1F 3QNFA 4U1MB 1OSZB 1MNUH 4UANA 2C34A 5EEXA 3PWPA 2YRPA 4GQZA 3TH2T 3C5JA 2L7EA 4IQHA 1KB9K 4CDGC 1IJNA 3OKOB 4B9JA 3CDCA 4NO5B 4M7LL 2DWDB 1KGYE 3FQTA 1FVDB 3UERA 4AIZA 3U4EA 2F7IA 1IQWL 1UWGH 2E9GA 3TJHD 2HT2D 4LB8A 1HL5A 3US0A 1S7WA 2BZCA 1CYGA 5C08E 1PLBA 1FVEB 5DJ2B 5H2BA 3MFGB 4N22A 4ZMNA 1ZLDA 5BS0D 4IBTA 3RWCB 3WG7B 3WNJA 3SE8H 1FFRA 4XNDA 1J9TA 4YHYB 1HYSC 3CH1B 4U49A 1TZ8A 4U1HA 4LHQB 4IM8A 3PWPE 5C07B 1KWGA 3D25B 1MLCB 4BCZA 4XCEA 4XH2B 3SB3A 4M02A 1ZLWH 3OKLA 4WI0B 1ZLVH 2NY5C 1B6DA 4UZUA 2ATKA 4Y2OB 5KVMC 2WXKA 3B3BA 1UVQA 1EHNA 3WIAA 2ILLA 2J72A 4JPSA 4C56E 1P6AB 2KL6A 3K0WA 4X6FA 1HXYA 4AUJA 1VGKB 3CFBA 1CGWA 1FIEA 3FPXA 4PGEA 3K1KC 1FI8C 1VZHA 2W1NA 4GKNB 4O51B 1T4WA 1NFDA 3UADA 5GGRB 1PKOA 1Q9KB 2P9RA 5GGSY 5K9QG 2MHAB 1KIQB 4X0KA 3SE3A 3MREB 5B1JA 1UH3A 4PY7B 4ZW7A 2P80A 4Y9BA 1MZZA 5AVZB 1DBMH 4AGQA 1HQRB 1P4LB 4Z9KB 1U8IB 1HZHH 4X5WB 2QQNL 4JJOA 4OF3A 5SWZB 1ZLVK 2FL5A 1K8DB 4J2QA 3RGHA 2WLKA 2HTLD 3VFTA 2W91A 1VFAB 4GW4B 4WTZG 3VMOA 4ZFFB 2YGVA 3ARBC 1T7WA 1JPFA 4RDQF 3U2IA 3K0YA 4U05A 3BVTA 2VLJE 3F7LA 4XN2A 3EFFB 5T3XD 5A16A 3VXNA 4P3CH 1IILE 5EMYA 3UAAA 5FS5A 4QWWC 1JD9A 4U3CA 1KYDA 4DW2L 2DBLH 2D0GA 5AOLA 2HT4C 4P07A 2O6PA 4NQDD 3ECWA 3WO3B 3D48R 4UQBA 2OYPA 4OLUH 5E5UB 3WKQA 4P2OA 4G8GA 2FJGA 1HQ4B 4FA8A 2VZUA 4YHPB 4GRLA 2C7FA 4F2EA 3KYNB 5TDPB 4ADGA 5BV7H 1IRAY 3G5VA 3WXWH 1BAFH 5D9SA 3E6HA 1W6WA 1B2WL 4HPOL 4RSVA 5E5MB 4WENB 1HCVA 3LKQB 2G5BA 2FR4B 1QBBA 4IBUA 3NQKA 3PGDB 1WICA 5K1NA 3PWVB 2YMXL 3HE7B 3R4DA 3I3BA 4FGMA 6PAZA 3FTGB 2D0FA 2RIKA 4ODSL 5F0PB 3NEXA 3VWKD 1VESA 3ARDC 1TZHA 2Q76B 2Z91B 5JW3H 1E4KA 1YUHA 3H1ZA 4G8AC 3SDAC 1R9FA 4FFZA 2ESVA 4HKJA 4BQCA 3QXVA 2GSGB 1JZGA 1I7ZB 1TPXC 5I75C 4HFWB 3I9PA 2X2HA 5ADOL 4F15B 3IXAB 5H37H 1A6PA 1QA9B 2AI0H 2Q6WA 4LDOB 3BRGC 2JK5B 4M5YH 2BCMA 1AR2A 2WXRA 3QFDA 9CGTA 1HHGA 5CJQL 4X6DA 2X53A 2IPUK 4AVHA 3ZY7A 1A7NL 1FO0H 1FH5L 1E27B 3ARED 2IVFC 4N2KA 3VFPA 5CN1A 4Y16D 1CFTA 1DJZA 1P4BL 3TWYA 3UTSA 1EAJA 4KMQA 4R0LC 1RUML 4G80A 2OYLA 4GRWB 4JDZB 3DX2A 5KN5A 1L9QA 3HEIB 5CGYC 1E6OH 1Q9OA 3CXFA 3D51A 1NKRA 1XCWA 4OLZH 1DVFC 4NNPL 3ZR6A 5KYWA 5EOCL 2FX9H 4QRFA 3D4ZA 4U1NB 5CLTA 1KJ2B 4PV1C 4ZFOA 2MQ0A 2VUOA 2DAVA 1XGTB 3QUMH 5ILTL 2J1XA 3ZHDA 3AXLA 2HG0A 3FU6A 1S9YB 2Q1EA 4ETYA 2CR3A 4KMLB 4NQQA 4U1LA 4B60A 2H2PC 3WCYA 4KROD 5AOKA 1S9VA 4JFZL 5KZCB 3QXDA 1U8KB 3D69A 1W8NA 4UV4H 3RWHB 3BWAA 3D0AA 2JFCA 3C60A 1T1XA 4R7XA 2VZVA 5AW5B 5HJ3A 3EOBB 3MOBL 1AR1D 1U8PB 4OT1L 5E56A 2B4CH 4ODWB 1EFXD 2B2XH 3MOAH 1UKTA 5A40E 4I18C 2LLNA 4YSTA 2XKNB 3MLXL 1F4AA 2PXYB 1QX1A 1N0XH 4FXGC 1V7NH 4WK4B 4CL7A 4N5ED 3RVWD 2EKJA 2WTOA 2ADYA 1G6RB 1KSRA 4C4KT 2XSKA 4PS3A 3ZDZF 1KYOJ 3T2NL 4TQ8A 2PCPB 3FT2B 4WW2C 5C2BH 2VXSL 3UC2A 5C0EB 2YGNA 1PSKH 4GSRA 1OCWH 2EICA 1B4TA 1NZRA 4X8JA 2UX7A 3WFEL 1L6PA 5IJCC 4Q6IA 2BSRB 2QGDA 5FGSA 4MQTB 2AJUH 3UP1A 4B9KC 1IM9B 4JFDB 5EB9A 2OXHA 1CXKA 1FYTA 3N6YA 4NRZA 3EH1A 1Z5YD 2J6WA 3EOAA 4QXUH 5EH1A 1IC5H 2JQMA 2CGZA 2CG9X 2Y3AA 4HEPA 1B4LA 2NY1B 5FYLD 5DRWB 2B1HL 3L5WB 3T2PA 2CO6B 3SDDA 3H54A 4DPBX 3L95B 2XHNA 4MBRA 4XO9A 4PRBB 1XIWB 2EXWC 2UXVA 4F7EB 1F11A 4PJ9C 4RAUB 4YQXL 1FVEA 2WYHA 2R9HD 25C8H 2PWFA 3PXJA 4ZW5A 2VDPH 3NSFA 3DV6A 2CBQA 4WRLA 1IE5A 4MD4B 1FSKC 3QQXA 1YPZB 2UZPA 4WQOA 1LEGB 4RBPK 1FL6B 3NSJA 4Q89A 5AVTB 1T66C 1BVKB 3VG0H 4DETA 4O2EB 4AL8H 5CGTA 4BSVA 4R2GB 2VO5A 3QUZB 5EEYA 1KYFA 3ZMRA 2C3VA 1S9XA 3QC5X 4J4PD 4XH2A 4YXLL 4NZJA 4YK4C 2XY2A 3VXRD 3S3SA 3ALWA 4ZJ9A 4LKCA 4MMXC 4K8RD 1RUQL 3PV7A 1O6SB 1XCXA 2FX7L 4MXWH 2FYYB 2CIKA 3PDOA 3Q2NA 5DEGB 3MRFB 4HK0A 2AK4E 4MTMA 4N2IA 4R26H 4WNSA 4WWID 1FO0B 1BQHA 5CR8A 4AWJC 1MRDH 2C9PA 4RISL 5KTEH 1ZLUH 1R5IB 2ZWYA 4YDLC 3WHXA 2RFXB 3Q2VA 5LUMA 3C12A 2EEAA 5E6IC 1O7DE 3QRFM 4YBLC 1SVBA 3I50H 1K85A 5HYFA 5F7NC 2A77H 5DWPA 5FKAA 2Q2EB 4U6VH 3FUJA 2IGFH 3OBAA 5E8PA 3ZT6A 2B1AH 2ISDA 1GMEA 3ES6B 4QJ3B 4DGWC 1N12A 3VI3E 3VFTB 3LH2L 2YAPA 4NKIL 4EO5A 5I1CL 3BDXA 3BT2H 3BRFA 3PWJB 5A2CA 1ET5A 1G4MA 4GG8B 4E5XG 3V4VA 5JHLH 1CMOA 3MX0B 1OTTC 2XYBA 5BO1H 1NDTA 2XPZA 2HYMA 3OGOE 1PFCA 1D6EA 4KBPA 1EH9A 4WFFE 4BUHA 5I1EL 5I8OH 1P7KA 4ZMTA 2ZXWB 3CSYA 4YDKH 3ULVL 3LB6D 5EO1B 4ZYKB 3GWJA 1ZLSL 1M05B 1AQDB 3DV4A 4APQC 1NGWA 3O11B 3IJHB 4HBQA 5CJOH 3TF4A 4XT1C 4EBQL 2ZXGA 1JVLA 3L4VA 5E2TL 4EI6A 1NUGA 1JGLL 3EGDB 1HQ4A 1MVUA 5CKGA 3TBCA 5J9PA 4QIRA 1QD0A 1AD9A 3QIBB 5IB5B 2H47C 5G4NA 2AQQA 5JQ6H 1L9OA 4PRHE 1EERB 2N56A 3GI9H 4PS8A 1AS6A 2YA2A 5DT1H 1A6TB 3K8LA 3L4CA 2HWZL 4E9LA 5GGSA 4HZLA 1HYRC 5CO1A 2D03L 4MX7A 4NO0A 5KYNA 3IETA 2ZUSA 4XP4H 5K1VA 1FBIH 1NCDL 5I18H 3H3PH 3QIWA 2WXHA 4HXBL 4PP1C 3UBHA 1UACH 3GBML 3VGBA 4TNWF 2KZ1B 1TJHH 2A0LC 2D9QB 5FO2A 1JGUH 4CRPA 1LL1A 1CK0L 2NUPA 5FR3A 5F2FA 3TFKC 3QHZL 1WUZA 4AY0A 1U8CA 3NPZB 3V4UL 4F7TA 3WN5A 1HDMA 4JG1L 4Z7QB 3DHMA 4FZEH 4NRXB 3W9EA 4Z95L 3LV3B 2VL5A 3TIEB 4YFLI 4E41B 4ZFGL 1ZV2A 1SJHB 4E36A 3D0VB 4MJ6B 1AE6L 1TUPA 4XZUA 5GRWA 5T3ZL 1CVSC 2NY7L 3I2CH 3OKKA 4WHTB 4YXHL 2BVQB 3DMMD 1RSYA 4ZMPA 5HYSA 3E0GA 3ZKMD 5ECJE 4WI2A 5GGRA 2O5XL 3ATFA 3UYOD 3W0WE 4DKAA 1CFTB 4ZMQA 1JK8B 4Z18A 3IFPA 2WJ5A 2MEJB 3MV7A 3O4LE 1G7QA 1JVOA 1F8TH 4Y2OA 4OFKA 5E51A 1A7PL 1RULH 4WDIA 5LCVL 1S7XB 4YDJB 1VGKA 4GW4A 1Q0XL 2HT3D 2P24B 4NBYB 5DZNA 3X1BA 2WCGA 4GI9A 1A7QH 5DMIL 2EDJA 1G9HA 1DHKA 2ZF9A 4KRMB 3BO8A 5HP5A 1PS3A 2V5YA 1DN0B 2CNYA 5J12C 1T03L 3LEXB 5FYLE 4JHWH 1YEGL 2IXQA 3ELQA 3SEPA 3GBNL 4XWGH 5EN3A 1FV1B 3V4VH 2ENJA 4RFNC 3X12A 7FABH 3J2PA 4L3CA 3MROB 1G7MA 3HZVA 4FMKA 3IMTA 3MRLB 3AWGA 4R7NA 1M3IA 3FTSA 4MZRA 4QTHA 5GRJH 4EDWH 5GZNC 3FB7B 4XVSL 1DJSA 1MCKA 1IV8A 1E4XH 3STLA 3B9KA 3F7PC 1FA4A 4FQHB 2XZAH 1GVIA 4H26A 3CX5K 2HJLB 1AHMA 1IIIA 2EYRA 2QSCH 4X5PA 3RL1A 1R34A 3CHXA 4EVNA 4K8RH 5AD0B 3EZ8A 1Z5HA 3K4DA 4RAHA 4QD2E 4AC2A 4FP8H 5A2AA 1IGIL 5AWNH 5E6SB 2ZOKA 4DGYL 3NFPA 4ZXBC 2HCZX 1JNLL 3KS0J 3RGBA 3BQUC 3MQIA 2ICCA 5B38G 4BZ1L 4JB9L 5IFJB 1KMGA 3BIBX 2X7LB 1XGUA 3C9NB 4NHCH 4YE0A 2WZ5A 1GAFH 2Q6WB 4FLHA 5EIQA 4TXVB 1UG9A 2YUXA 2H3NB 3EYFA 5EBGA 5CFHA 1BXAA 3JWNE 4OV5B 5KSUA 3ULAB 3MLVH 5B8CA 3GTNA 5D1QD 2EUZA 2IANA 5HPMB 1WEJH 2XICA 1RFDL 1TEYA 5FYLH 2KHAA 4X7TA 1AMYA 3MRCA 5IREA 3QORC 3E9UA 1JHKH 3EYSH 1VDGA 4K5OA 1PW3A 3KAAA 5FW6A 2VLRB 3EYVA 4K3GA 2G9KA 5JXAL 2BPBA 3WDIA 3OLIA 2NUTB 1AFVL 4BM7A 5CCKH 5C09B 2XBZA 3BPLB 3IJ8A 1MXGA 1LWJA 3EJZD 4LSQH 1J9CT 4HWUA 1QR4A 3EG9A 3G6JA 4LPCA 5I8KH 3DA0A 1CG9B 3PREA 3W2DH 1XSJA 4D94A 4WCYH 8CGTA 1GHFL 2EEDA 5HXMA 2UV3A 1ND0A 1BVNP 3JTTA 1KV7A 3SQRA 4D9QD 1ZS2A 4JZJC 5ABAA 2ZSVB 1S5IL 4XNYL 2RFXA 2PWEA 5AW9B 3CPLB 3MGAA 4NXSA 1TNNA 3N40F 3VXUE 4W4OC 2BERA 1F58L 1DCEA 2OYMA 5DJ6B 5EWIH 1TTCA 3HG5A 1FNLA 2ZTBA 4K3DL 3UH8A 4HALA 4AQ1B 1QEWB 2YBRA 2VXUL 4PMFA 4DEWA 3IS1X 4HFUH 1HSBA 1H6EA 4OI9A 3RVVC 4MAYC 1VA9A 2X44D 2C7UA 3KHQA 3MLWH 3VXRA 3RB7A 1LMIA 3MRPA 5D7LE 2E9IA 1I3UA 2H1PH 4UUJB 4KDTA 4NJAL 2Q2LA 3DHUA 5D8JH 4OFYD 5LBSA 1OF2A 3TA3D 1CFSB 1T04A 5H35A 1Y7VA 2NX5A 2NY2D 1F56A 1PLGL 3DETC 5E2WH 3GZKA 1NPJA 3W81A 3VFNA 5CEYA 1AQDA 4LSSL 3MRDB 3QORB 4Y8AA 3HZMB 5IB3B 4P5KB 5CZXC 3DOSA 4E5XA 1KENH 1MEXL 2EXSA 4FULA 2Z8VC 3P0YL 2ZUQC 4YHZH 3RGVD 3FCUB 2VDQB 3T0EA 4P4RA 4IOIA 2CO6A 3SDDB 1RJZB 2PETA 4G7YL 4Y1AA 4CSSA 1URLA 3WL9B 1XGRB 4N0RA 4HQQL 5IBUG 3FT0A 2GJZA 2K6YA 4DZ8B 1CDUA 4I2XE 1KEMH 2V9TA 2OMXB 4KK6C 1DQMH 1M2VA 5GSVA 2XWRA 2FUTA 3L2MA 2XV2A 1L6ZA 4MJ5B 4ODHL 5I1IL 4M5SA 4LASH 4YXKL 3TF7C 3B9DA 2IPTH 4X5QA 2BHYA 3QDMD 4OGAD 4A7VA 5IY5B 3GHEL 3X11A 4PY8I 4Q9RH 1UOLA 1U8CB 2OTWB 4OFDA 3P4NB 2WUBL 2NZIA 4M62H 4NRYA 3EXLA 4YE4H 5IVZA 4N20A 3CXHJ 1YNLL 1SJHA 1XGYL 5I1LB 4DUVA 1JUFB 1OGAA 3P11L 3PQYB 5I66A 2Q8BH 2W0KA 2HMIC 3UGXA 1S7RA 2VE6A 2WMPA 4KK8C 4JFFB 5IEHB 2MNJB 2CUHA 4L18A 4J23A 4F9PC 4ZTOL 4BQ6A 4M48L 4I77H 4PRPE 5LBSH 4HPYH 1SOQA 5GRXG 1MHCB 5F3HB 3VRLE 4PJHA 1BD2D 4LLMB 3KDMB 3MZTA 4FZ8L 2A9AA 3OMNB 2V17L 4OV6F 2BSEA 3S5LB 3UBXG 5AAWC 2XETA 4BH8B 1JV2A 1THAA 2LAAA 4MDIB 1SN5A 4PCTA 5IW1A 3JBG7 4KMTH 4P5RA 1CF1A 3T1WA 3EYOB 1D7FA 4ZS7L 4QXGH 2R15A 2GHWB 4MFHA 4QHNA 3WHXB 1I9RL 4LHJB 2W60A 3QPXL 1Q94A 4WK2B 3BH9B 3BCDA 1W72H 2Z4QA 2HVBA 5BW7A 4DPAX 4HWBH 4ORZC 3BEWA 5KUKA 3H42L 1HKLL 2XA8H 2ZXBA 4PY8J 2OCJA 3X12B 2J6EH 4P9HC 1KF9B 5DVNA 3GO1L 3KWXA 4B9ZA 1M05A 3UROR 3G6DH 3SGJC 2CHZA 3MLUL 3PWJA 3O9WB 4RDQG 2PYEE 3FQWA 1GW0A 5DJ8A 4C4UA 2ALWA 5LLIC 4EIUA 2OM5A 5CILH 3QZPA 2VMDA 2XN9A 4GXUM 4P2CG 5IUCA 4OGZA 5G55A 2WM0A 4OZHA 1IAMA 3LAFA 3O4LD 5I1JL 4S0HA 3MRRB 4OZGA 1E7UA 2ITFA 2KDYA 2EYRB 3VH8B 3C60D 1UM6H 5HHXH 3WXVH 1NGWB 3O11A 2WWMC 1N3NB 3QG7L 3I74A 2KBGA 4MB3A 1NCOA 3BWUF 2OXGB 2CE6A 4ESKA 2YD3A 2OULB 1CN4A 4HIJB 4CC4C 4Z77A 2EXTA 4WEBL 1JPEA 2I9TA 4QRUB 3D4CA 1WBYB 2YPKB 3TN0D 5LDSA 1UH2A 1HYSD 5JPNA 5DURB 4F1ZA 4HZLB 4IBLT 3IMVA 1DUYB 1MHEA 3V5DA 2CSPA 3PGCA 4IOFC 4HD5A 4X9GA 2WXPA 3P73A 1U3YA 2P8PB 2Z1KA 2DQUH 4XRCA 1NOAA 4OW6A 3UACA 2W0FA 2FLMA 3KGTA 3QDGE 2MCPH 2R2CA 4O4YH 1PTZA 1G7JB 2G3ZA 3VGAB 3W3BA 2WTRB 1B3IA 2FEEL 1R0AL 4KO9A 1F3JB 1FRGH 2BIPA 4R2GC 3SPCA 3UCRA 3O3UN 3KR3L 4TVSa 4HOXA 2ZKXA 4NZRL 5KAQG 2DQIH 3BC9A 2RTTA 3LKPA 5EG6C 4XP5H 5I15L 4JANB 4KI1A 4X9IA 2ZKHL 1R3KB 1TR7A 3H9SE 4W1TA 4YWGH 2V9QA 4P2RD 3EJQA 4FE9A 4GS7C 3JV6A 4IMKC 5A7EA 5I0WA 1A25A 2OBGA 1COBA 5D4HA 3QPQC 3SDCC 1FFOB 3CHOA 4PJ5B 5C0AA 5AW2B 2WLYA 2AKRB 2XWDA 3G9VA 3JT0A 4HC1H 1FV1A 1E43A 3L5XL 5CIPB 5D1XB 4BQ9A 5CHNA 3C5SA 1K6QH 4PV8A 3WENA 1F4XL 2BMKA 2WD0A 5K9JL 2AQPA 2P24A 1KPUB 1YMMA 2VKXA 2Y36L 2WWKO 2M8XA 5D5MA 4MJIA 4QRQA 3PE9A 2NY5H 4PJDB 5FWRA 3O2WH 2ZYIA 1KJVA 1RZKH 1XD1A 2EDHA 5K9KA 1MJUH 1WA0X 2IQ9L 4JN2B 1PZ5A 2FWOA 1I3GH 4H8QA 3CZFB 1CFSA 1F4YL 3HE7D 2HUHA 3HLAA 4XBEH 5AW7B 4MD0A 2DQJH 5GGVL 1ZTMA 3MRLA 1ACXA 3MKKA 3LQAH 4OM0L 1MIEL 4RFOH 5AOMA 4DOHB 4TUUA 1JGDA 4PJAF 2ZJSH 4Y1TA 4MJ2A 1T0MA 2W80C 1P69B 5E7BA 1F90H 3SE9H 2JELL 3QNYB 2A4CA 3BP5B 1MH5B 4Z23A 4GG6A 4OCYL 3RAJL 4J6RH 1TLMA 3GMOB 2MOQA 3L7FB 4IRJC 2OTUA 4J3UA 3WL9A 3FH5A 5E1QA 4MA8H 2FGZA 4EI5B 5TJWK 5IMLB 2YMTA 4HEMA 1X9QA 3PU7A 3HBQA 4Z78B 1IFHH 4AJYV 1PYWA 2VR8A 2CDEB 2F8IA 3LKRB 4N6RB 4TOYH 1K8IB 4YBQC 4M7LT 2AMGA 4DPRA 3GMNB 2APTA 3BCFA 1ASOA 4XXWC 1KLUA 3ZK0A 3BGFB 2XRAH 5I0YA 3APMA 3L5JA 3NZ8B 1BW8A 2Y1YA 3UPRB 3BIKA 3LEVL 2IFGA 1FORH 3DMMC 3B2UC 3QXAA 2Z8RA 1HL4A 5ALBH 4LQFL 4XVJH 5E4EC 5CLYA 5C0IA 3KXFE 3FTZA 2F6AA 1SQ2N 2NMSA 5HHVL 1VFUA 4P3WA 4PM1A 3ARBB 1JPGB 2C3GA 2H1LM 2K9FB 3VI3B 3JWOH 1AY1L 2EKSB 3FF8A 4B7LA 1S7RB 2VE6B 4JHUA 5IW3A 4OJYA 4TMPA 4ERSH 1EV2E 1NCNA 3O9WD 2CJSA 2ZYHA 2VAAA 4PTUA 4PW3A 1KNOA 1QUNA 2V33A 5FM5O 5LGHH 2JJTC 3V6BR 3HI5H 1RCYA 1FG2B 3D39D 1M2OA 3Q1EA 4PQXA 3STBA 1LO2H 2BOCA 4Z7AA 4LVOB 4DCQB 3BH8A 5DRZB 1E5CA 1W0YT 4BGLA 4N85A 4EOWL 1BQUA 1Q1JL 4TPRL 2X6AA 3J8F7 4LSUH 3HN5A 1SBSL 4NUJB 5I19H 4NQDB 1QAWA 4JM2D 1F18A 2WQXA 1A65A 4ZMLA 5KVDE 4GFTB 2BO0A 3FUMA 3IDJA 1JHLL 1PLAA 4CDHA 3HBGA 5CEZH 4HXAL 3A6BH 3ISRA 5IFHL 3FCGA 1RMFH 3TO2B 3EHBD 2Q3XA 4NNYB 5BO0D 2FSEA 5DK0A 1WVZA 3CHRA 1AMXA 4L8DA 1H3PL 1SYSB 3LQZA 3L4YA 1KCKA 4QRSB 5EV7A 1KC5H 1OO2A 5F6HI 5G4MA 4L29B 5DURD 3IGFA 3FJTA 3O9WC 4PJ8A 43CAA 3MRDA 3QORA 5IB3A 5CZVH 3PQYE 1MHPH 1OSPL 5FYKD 1WTLA 1JNJA 4TUKH 4HCRA 3RI5K 1A6AB 3FK3A 2Z31B 1IC7L 4WO0A 2VAJA 4JPKL 2R2EB 1WPCA 3SKMB 2FYVA 4ZO9A 4N87A 4ZAKB 1MIML 5INDA 1JZFA 4CMHB 3QHFL 1WZLA 3CQFA 2YD8A 4JFQB 4QXTB 2QPUA 4X80H 2BNRB 4I8DA 1DQDL 2YD5A 2GJZB 3C5ZC 3H7BA 4OIBA 1B4RA 4OGXL 4EKJA 2EIMB 4LCWA 3OKMB 4NO5A 4YBQD 3TWCH 1OGTB 4MJ5A 5EA0H 5CCGE 2F1AA 1EEYB 4IHOA 1JYVA 1FWXA 3DHPA 1TENA 2B4CC 4ZPVA 2XQBH 3T71A 5IJVA 4MMXA 4TNWK 3KPSE 3HC4L 2Z34A 4OCNC 1JPSH 2X05A 4TLUA 2Y06L 1YN6B 3IDYC 4IK6A 2XN2A 3I3DA 3B1UA 3WAJA 4HT1L 3BJLA 3IS0X 3ARGC 3D87B 4KDTC 1ZTXE 1WDAA 3IKCB 1A4JB 4DGIH 3MBXH 5SX4H 1ZHLA 1LK3H 2A9MH 3EO1A 3WHE1 4AIEA 4HCFA 3F7RA 2EYSA 1A1MA 3WMQA 4IDJL 3DI2B 3HHRB 15C8H 3HRZB 4FLRA 3IJSB 3V4PB 3QUKA 1DJYA 2ZICA 2VM4A 1IGJA 3U7YL 2EEBA 4I18B 2TSAA 3OR7B 3QZWB 2UYLA 4X6FB 5IMKA 1LK3L 1QRNB 2A73B 2CAKA 3CFQA 3QPKA 2WMPB 5MEOB 3O3EA 4LLAA 2SODB 2VXVL 3IU3A 1Z9NA 4PR5A 3ZQXA 1HH9A 1PCXA 4OJFL 2O61B 3QO1B 1G43A 1KIQA 4OTXH 4X0KB 1OCCB 2AV7A 1CDIA 4HCRH 4OF7A 5J8OA 2O6FA 4JZJA 3HC4H 2BFVH 3KVPA 1EA9C 2PO6B 3AY4C 2AQRA 3ARUA 3C5SB 1Q4NX 4HIPA 2ZYSA 1TJMA 3PIQA 3ULUC 3ALPA 2GBVA 2YPLE 1G7HA 3CXHK 3GSOB 4H8WL 5EA0L 4DOHE 3F65A 4ES8A 2VN7A 3PWPD 4OQTL 3UZQB 3QDGD 4DUXA 3S5ZA 4ZUUB 2YRLA 3WIIH 1GGCH 2VSDA 3OC5A 3WD5L 3ULVF 4MNGE 3GUFA 4KXCA 4P23B 1WHOA 1T3FA 3MODL 4OCWH 5I8EA 4RMQA 3KXFA 1V8HA 5DD5H 2F54A 3T8MA 3QHFH 5C09D 3T9WA 5J6GB 4TF4A 2QKIA 2X1WL 3MRHA 5H8DA 5GRZA 4EN3D 4GKSA 4BUGA 2VRKA 2G4GA 4X6BA 1JZ3A 1CS6A 3AS2A 2APSA 3TCTA 1AQKL 4XB7A 1CXFA 4YR6A 2BWQA 2AEPL 1KC5L 2L4OA 2BDNH 3MJGX 3ULSB 4HV8B 4AZ8A 3AQYA 3ZHLA 3G04B 5EFIB 5T1LA 4G1EB 2X09A 1KJ3H 1SRDA 5DQ9A 4Z3TA 2VR9A 1XL6A 4AM0Q 4XMTA 2I60L 2PW2A 1HSAB 2FUQA 5MENB 2HKFL 4WWNA 3FT3A 3SBQA 3ZN6A 3RZCA 2CDEA 4N6RA 4PIRF 3APNA 4G1MA 2YN3A 2YWYA 4XCYA 1J9SA 3F2LA 4PB0H 2ICWJ 4URKA 3EW3B 5AFAA 1GR7A 3UTOA 3II2A 1BREA 1PZ3A 5KANI 3EKCA 2MCG1 3RYMA 2WNKA 4UINH 4ATWA 4N9GB 3ZUNC 4GOSA 4ZUWB 2DY2A 2R0LL 3MFFA 2QVKA 4I48B 3VQMA 3ZPDA 2IQAA 1O5DT 4X6DB 3L8QA 4HISA 3RKDD 3V6OE 4WWKC 5LGHL 2P7TA 5I1AB 3ARBA 2D2OA 2NZ9C 4G6KH 4QOKB 5A2IH 3VAEA 3T4YB 1TMCB 1J12A 3NTCH 3FRPG 4YJZL 3TTYA 3MJ7A 5JOPD 4TVPL 4LQFH 4XVJL 1RJLB 4HIEA 4A7QA 4J12A 5FCUH 2IDSA 5FW8A 1FORL 4Q9QL 3Q2CA 3MBEB 4U7MA 3U4EB 1KCRL 4LCIL 2RH0A 1KPUA 4G7SB 1DVFA 4NZUL 4Z8FH 3GB7B 2ZXQA 2V2WB 4KRNA 5DJXB 3FOLA 3U6RB 4TOYL 4YAQB 3GDBA 1U33A 1RUKL 2R23B 5H2BB 1HOEA 2F8VA 3APCA 4R7LA 2JI3A 4XCNB 1A3LL 3S36X 3GJFB 1AQMA 1MREL 2PF6A 1FZKA 3VX1A 3WTYA 1MWAH 2UZYA 1OGSA 3PL6A 3W0WB 3OR6A 2FSEB 4X5XB 1L5GB 3V9EA 4A2MA 2NQ3A 4M7ZC 1EEZB 5DHMC 3V0DA 2X89A 3P0VH 3HNSH 3SE9L 5A2BA 4WV1C 4L3EB 1DFXA 3PXHA 3IB4A 1YEFH 1I3RB 4NP4H 4FL4B 1PG7H 4OM0H 2ATKB 3TBBA 1XF4B 5F0JB 1CFVH 4DN4L 1MW3A 1CGUA 3FKUS 2WXNA 4H0GA 3APDA 4PVMA 3PV6A 4J3BA 2DLGA 3OF6D 5INDB 4EIZC 3SKNA 1B0RB 2HFFB 1N59B 2XWEA 5BVJB 4BGDA 4HH9B 3RDTD 3RNKA 3VRJB 4CADA 3OG4B 3ZTJG 3T3PF 3E3QC 3N42B 1AJ7L 2B9AA 5KEZA 1U8IA 4WY7L 2C9SA 5K9JH 5FDWB 3SGEI 4X5RA 4L9LA 3LHAA 3L4TA 3CFDB 3JQOB 1L6XA 2OP4H 3FHEA 4XN9A 2YA0A 2NXYC 1UKSA 3QZOA 5IJVB 5EU5B 3H56A 3MLZH 4MGXA 2Y7OA 2OSYA 4LBEB 1TTUA 1J0KA 2QDWA 3D2UB 3SGDI 1L9TA 3CD4A 5IWLC 4JS7A 2YPLD 2Z7WA 5T3XH 2DQMA 3VGAC 1H9VA 2AXGB 1IGCL 3SQOL 2Y5QA 1KLUB 3PJLA 4HJTA 1BYNA 1HIML 3ULUE 1F6AB 2EYSB 3FB5B 3DETD 5I15H 3ORJA 1UB6A 4OZHE 4XAKE 1QKZL 4X9HA 1X5ZA 5DVMA 1ZJBA 2Y1AA 1WWBX 3IJYA 1QHOA 3RA7L 1N64H 1KIUB 1AQ8A 1ZLWK 3FO0L 5ETUB 3VD2A 4ELMF 4TSBL 1G5AA 4NXKA 4GY4A 4UBDD 5ENWA 2MCPL 1TZOA 4JR9L 3EYQC 4XP6H 1IGTA 3MYJB 3BP7A 1IUZA 2UZXB 3DGGB 3U1SL 1KCSH 4HUXA 4JAMB 3U1PA 1MLBA 4NNYA 4JRXA 1A14H 3DVGA 4XNBA 3WFHA 1GZPA 3NP4A 3FTGA 5E5LA 5I0ZA 4L1LA 1CVRA 4FXKC 2ITDB 3WTVA 2OL3H 3K71A 1BZOA 3LOWA 3OM3B 3WIFA 3UTZB 5KVFH 2EVGA 2W92A 3QJZA 4GG8A 2UVEA 4AGPA 5ACZB 3OAUH 4ZUUA 2EH8H 3MX0A 3WXVL 2NDGA 5D2LF 1N10A 2ARJA 2EO9A 3QWOB 4UQAA 4HLZG 2YIHA 4NNXA 2XWJA 3CFCH 4ZG1A 3CSYB 3QWRA 2FIKB 1BD2A 2P44B 1HI6A 5DWUH 4PJ8B 1VCBC 1KLFA 3BFQG 2EVIA 4LCWB 1J8RA 5GRYA 3RVXC 1G1CA 4IIZA 4KUCD 3CXDH 1DO5A 3MCYA 1T0NB 5TF0A 4IHOB 5J9PB 3I75B 3IN2A 1RH8A 3UTQA 3IDUA 2LABA 4LRNH 4J3XA 4NSKA 3G3LA 4L48A 3SOTA 4ZAKA 1RIUH 3QQ3B 2RAMA 4R6UA 4HV8A 2XA8L 4IIQC 5TE7H 1SJMA 3DXAE 3WLBB 2CO1A 2DQEH 3D9AL 3OKDA 5IBLD 3BQUD 4R8WH 2X4OA 1E2ZA 3B2PA 5L8JB 1HSAA 5F1IB 3QIWB 3OSKA 1GPOH 5HHMD 3FYEB 1XGPA 5JOFB 4GPVA 2YPLB 4X4ME 1ZS8A 1CE1L 1I82A 2A74B 1DVTA 1AGBB 4J27A 1U30A 2DQFB 4PGDB 5D5ME 1HDMB 3P3SA 4FZ8H 3P9LA 2VGLM 4LU5L 1Z9LA 2CKBL 4MDJB 5E4EB 4PWEA 1FVCB 1C5DB 4PW4A 5IJDC 2AC0A 4OZFA 2Y2TA 4HPYL 2RBLA 3GBEA 4ONOA 2A6IB 1QFWH 2GIXA 3WN5C 3QR0A 1SYVA 2IF7A 1VGEL 2J2ZA 4NM4H 5DTFB 5IBUB 3GRBA 2DTSA 3IU3B 4PR5B 5FYKE 2H8PA 3FFCA 1RIVL 3F6LA 4YSRA 3K2IA 2GT9B 2R0ZL 2DMGA 2X70B 4WFHE 4PRPD 3CK0L 3IJSA 4JM2A 5D7JA 1BYPA 3KH4A 5EU6B 5BVPH 3KGUA 5F7HA 5SWSA 5DHYB 1N6QH 2BNUA 3TBYB 2XKUA 1OAKL 5KBDA 1XEUA 2XTJE 5C3IA 2P5WB 4AQAA 3S35H 3US1A 1HH9B 4XAWH 3SPIA 4PVLA 1D5MB 5IVXB 5BRQA 3RVXD 1KEML 3L1OL 1QMUA 4XXDA 1T2QL 2MQCA 2DQEL 2WXJA 1T3FB 5EBMA 1CU4L 4JHVA 4MD4A 4HWZB 3L9EA 1AI1H 4K0OA 4XPHL 1N7ML 1KXQA 2Z93B 3LPWA 3HI6H 2FJHA 4GH7B 1BVKA 3IM1A 3OPUA 4HJ0D 1O7SA 2J5WA 1ICTA 3ARTA 3KVDD 4K71C 1U0QA 3UBXB 3MLSL 5HGAA 1HHKA 5DA0B 3CH1A 5EPMB 1HE8A 3C08H 2ZCKL 5DWUL 3O3DB 3BVVA 2COVD 5EZJA 1BP3B 3P54A 4B97A 4NKOA 3HLKA 3E2HB 5PAZA 1Z7JA 2P46B 2R0WL 4EPSA 4WVRA 2AJVH 2EH7H 2KLSA 1DBBH 4ZSOB 3QDAA 2NT0A 3IRCA 3SJVE 3VFUB 3VM7A 3QYNA 1HXYB 1IZKA 4D7BA 3QJUB 4PJBA 4EEEA 5L4FA 4YC2C 3SJVD 1HHIA 4QPEA 5F9AC 1AZVA 1L7IL 3VMNA 1LO4L 2DQCH 2MPAL 4NC2B 3BAIA 1A14L 5CP3H 5DJCB 2VNCA 1KGCE 3PGFL 3QIUD 2YEQA 4OVUA 3D34A 4NAMA 4HGWB 4ZMAT 1BZ7A 4ORGB 1UZ8A 5B7FA 1FAKT 3GGWA 5H37G 2J43A 1DQQB 2F53E 3U2SA 2YOCA 3UZEC 4GO9A 5GS0D 2JCCB 2JKIS 1FUNA 4MA3B 4XO8A 3HG4A 1G9NC 3MRCB 3W2DL 1BGXH 4KXDA 1MFBL 5DC9B 5L7XL 3QEGH 2AS5M 1N64L 2YZ1A 3BVNB 4JRYB 3T6ZA 3AM8C 1F6AA 2G3XA 4LSQL 4ONHA 3BUPA 5LJYH 2UZIH 3KYMB 1PEZA 3LRMA 4UTBH 1AFVH 3CC5B 5C09E 4KQ0A 2JI1A 4YSQA 1N67A 1A5FH 4L1SA 5ID1A 2VLJB 3MSPA 4EDXA 3NA9L 1MCOL 4CBZA 1D5IH 2YRBA 3B2MA 4KDVA 4RNRB 1RFDH 3ZRFC 5TGBA 5HHNB 1KN2H 1CD8A 1IGTB 1I9JH 1O5PA 4JG5A 4PRHA 3H9HA 2K0RA 4GO6B 4ZRGA 1TNMA 2VITA 1OT2A 1FZKB 2EO7A 1YJDC 1R5VA 3EDKA 3V5HA 4L8CA 1PZSA 4PTTB 2OP4L 4JB9H 2Q10A 3ABKB 5DMGC 1KBVA 3S96A 4WY7H 4UU9A 4Y2DB 1GTFA 3DX6A 4PJGF 4BQBA 3RNQB 1DVFB 1ZDSA 4LLYA 4IRZA 4AH2B 3MHZA 3VI4A 3R06B 2WXQA 5D93B 3VWJB 3GKWL 2WQRA 1IKNA 3NCMA 5T1MB 1OB0A 3DARA 4YSUA 4ANXA 3SYQA 4NNXB 5HYSB 3ULUF 4HCGA 2B16A 3LNDA 4XZ4A 4YHIA 3PHQB 3VRJA 3BP6A 1XF2A 2ICWB 5I9QB 3FH8A 4FQCL 3LN9A 4Y88A 1CL7H 3DOSB 3KLDA 5DRNB 2DYPB 3LCYA 2ED6A 2XZCL 5JHAA 2VN3A 3HNSL 5D1ZB 4HKZB 2XZQL 4AI7A 1XF3A 3MTXA 5F7LB 2OZ4H 4HOZA 4LEOB 5C08B 5BS0B 3UTSB 4KY1L 2BJML 2XIDA 5DD0H 3PJNA 1DBJH 1U8JA 1NBQA 3TTSA 1MREH 3GBNH 1K2DB 1N59A 2H0EA 1A1OB 1FG9C 3T0EC 4M7KH 2K3TA 3WTSA 3JUZA 4XBMA 3W82A 2XTJD 1BEXA 4M3KB 2ZOLB 5GSVB 3M88A 1YA5A 3O8XB 3BFOA 1H15B 3PJSA 1XCTA 4G6AC 4G9DB 4BZ2L 4Q9QH 1VADA 2O93L 2JI2A 5FCUL 4DUWA 5F1KC 3PPEA 1EEUA 4PJAE 3A6CL 1DANT 3LZRA 3WAKA 4PJEA 3VSUA 3L5HA 3BSZH 1E40A 3CBRA 3QIUC 2N0KA 4OB5L 3ILPB 4MNGA 1MCJA 3OAWA 4FQIH 5D1XD 1KPRA 3KLKA 3STLB 2VDQL 3Q06A 1UHVA 3NMEA 5IB2A 2WGXA 2WUCH 2N4IA 1OT4A 5TQ0H 2MNWA 4PJ7B 2QR0A 4YXHH 2QQKL 4MB5A 5FGCB 3O6FB 5BZWA 1AE6H 3K6DA 1CDBA 4ODUA 2BZ7A 2BOBA 5DMYA 5CUSL 5F7BA 3JV4A 1MLBB 4Y4KC 2IG2L 4FZEL 3WFHB 3H9SB 3FQXB 5I2IA 2MQ3A 3N9GH 1S5HB 3I84A 4LAQH 1KV3A 3I02B 4KROC 5CMAB 2WQWA 3QHZH 1QFPA 5C0EA 1WV7T 3L3JA 4S1SL 5ICYB 1JGUL 4UMSA 5B1KA 1F00I 4YDIL 2B39A 3PWNB 5FV2A 2GB2A 1DQJA 2BX5A 4U6YB 3GMPB 5HHOD 2YK1H 4NRZB 3L9YA 2IAMD 2I60H 4XP4L 4DGUA 4ZBJA 3QWOA 4AGMA 7PAZA 5DI8B 2HWZH 1WZAA 2KLRA 5DT1L 1OXYA 1TZIB 2D7TH 3QR1A 1FQ9C 3O3BB 3QEHB 2UY7A 2WINA 2J56A 2DQGH 1V7ML 5FFOA 3F12A 4A38A 1AQKH 1O6VA 2HT3C 3Q44A 3VD7A 2WWOA 2G30A 1F41A 1G7PB 2HPOA 2R1XB 3VTTA 1OAYL 4JFFE 4ZOCA 4QJ4B 1DVXA 2X4QB 3BPNC 1KT2A 4Y4FA 5L2KA 4I1PA 2ARJB 1BX2A 3ULUD 4MAYB 1ZLSH 4XPBL 1PDKA 3GYRA 2GK0B 4OZGB 2DZEA 2J8HA 2FBJH 1TSRA 1NJ9A 3JTTB 3ILQC 4FHJA 2BY0A 4C56D 4QYOB 4M8RA 2I25N 1D7CA 3ZKNC 1OQXA 3NN8B 5MEND 4U6HA 1S6NA 4OUUA 4OD2B 1G7LA 3L17A 3IJEA 3V0GA 4BFJA 4PUBL 2HLAB 3BT2L 3I75A 3T0ED 4F8LA 3ZDWA 5BZDA 1R5IA 5FUCC 2LFGA 4GG6F 4PJGE 3HBPA 5ERWB 3HFFA 1LO0L 1AKJA 2B1AL 4C4KO 3W38A 3NEOA 3QA3B 1WE5A 5KVEE 5FXCH 4MA7H 3V4LA 4OJFH 1F1DA 4FG2A 4POZC 2YAQA 3VD5A 3L4UA 4WHYH 2Z65C 35C8H 4KOBA 2J8UE 3PNRB 4GXUN 4I88A 5HYIA 3MYZA 4TTDD 3QFJA 4H13C 4H25A 4WK0B 4C56A 1FZJB 1O9ZA 3BVNA 4JRYA 4PBXA 1OSZA 3SGKA 4D0BA 3BKCL 1YEIH 1F42A 5CCJA 5GIRB 1PQZB 2EYTB 2VR7A 3RY6C 1YEIL 2G2PA 3OKOA 5EU6A 3LKPB 1NLDL 1R3JA 2J8UA 3U9WA 5KS9F 4N25A 5JMOC 2E4FA 35C8L 3GSXA 4GAAA 2EIZB 1RJZA 2JTYA 2E56A 3T65A 4KO6A 3TZVD 4AW7A 4MMZC 4MA7L 4AM0B 3V4PH 2RJMA 1JPSL 2NY1C 2APFA 3DIFA 1UXSB 4MCZA 4IGBD 1Y18A 4XX1E 4YQXH 1FNEA 1OTTD 1DLFH 3ASOB 4PTTA 3LD8C 1UZGA 4ZUTB 1TTRA 5C07A 1MNNA 3ZE0F 1TQVA 4GXVL 1QVOA 1M71A 2PWGA 3WEOA 5KVGH 3G7TA 3EFOA 4OF8A 5D71L 4A2LA 2P45B 3PPSA 5SX4I 2F8OA 2EDQA 4DP1X 5J11B 1LP9F 3S37H 5IVZB 4AUUA 1F0LA 3WGVB 1CF8L 4YPGB 4HLZH 4KHTL 2YJLA 1ZSDA 1PZ5B 1ID5I 2W07A 3N04A 1MIMH 1OVZA 2QV4A 2QQLL 1ZWIA 2VLRD 1HEJC 3II1A 1CZ8L 2BLFA 5CAYB 1KGJA 1OAYH 5J12B 1W9XA 3MRBA 2DIBA 1LEKB 4JN1L 2JB6A 5EU3B 1CB4A 1SJEA 2UXTA 3IWVA 3U9PL 2DQGL 1HHJA 1P7QB 3T6XA 1OTUC 4Z7VA 1T22B 3APFA 2HLFD 2YR3A 3CUPA 3IPFA 2P5EB 3WEBA 3QJFA 4MJJA 5CZKA 2ZXCA 3L5IA 3RIFK 2BS9A 1WD8A 1RMFL 3HMWH 4UV4L 1S7UB 2BSCA 4FADA 4HHAB 3IDMB 1S8DA 4MBOA 4PI0A 5FECA 3IFLH 1YECH 2DMKA 1S7QA 2NLJA 4NO2A 4PJBB 5T3XE 2E9BA 3VI4E 5SV3A 1GYWA 1J48A 3SY0A 5IOPA 1N5YH 1T0OA 1ZE3H 3CU1A 3DYMA 2ADGA 1LO2L 2VZ3A 2Y4SA 2WANA 2CLRB 4OLZL 2FZ3B 5IQ7H 4UQDA 2ZNXA 4FG4A 5DLMH 4B3VA 4D0CB 4AKPA 1IKOP 3EH3B 4K23H 4L3CB 2N1KA 3B2UD 3OXSA 1D9KC 3FZUD 5AOJA 2X3CA 3VMPA 3SDYL 3B5TA 3KPSB 4F9LA 4G8GD 2E8ZA 1ECZA 2V6HA 4FQIL 1ZOXA 5I17A 2M83A 2QKSA 1WIPA 2DI7A 4KO7A 4PJ7F 3UO1H 4G6FD 3W0WD 2W9DL 3QI9D 4AGOA 5LQBH 3BWUC 4TLKA 3K81A 2BZDA 2O5YL 2QSVA 2W38A 5ALBL 2NY3B 3Q1SL 2AXFA 4FFZH 4P2RB 4LIQE 3V0HA 2OPCA 3LEVH 2YMOA 5I30H 2G60H 2OMTB 4W6WB 2W9EL 4J4PA 4KTEH 5ESVB 5IBTH 5J0BA 2VCOA 4NQVB 4XCCL 5TGBB 4NP9A 3RIKA 3M8OL 5SV4A 3W39A 5C0DA 5LAXA 2BNQD 4TVUA 2XN1A 1I1YA 1IFHL 3I9IA 1EZLA 5HI3C 5EEVA 4GAJL 3F7QA 4HKXB 4ZQKA 4MA8L 1X5FA 3IGAB 3MNDA 5DA4A 3WXWL 5AQ0A 2IWEA 4L8DB 2X10A 4YHIB 1JZ7A 2OZ4L 3H3KA 3P4OA 3LXCA 3PHQA 5ESAA 3VDAA 2Z1PA 1OP4A 4G5ZL 1H8OA 5HI4D 4G6AD 2R1XA 4TQEH 4JDZA 1WS7A 2PN5A 3G5XB 3DBXB 4BKLA 3CVBA 1ASPA 1TXKA 5F9DC 3QCTH 4LPYA 3VXPA 5T1MA 3BUYB 3MRNB 3PRZA 4DJMA 5GRVK 3ZDZB 3SDDC 2F54E 1PDKB 2ZCZA 1QUPA 5JXEA 3MJ8A 4UCFA 1ZPLA 4G8IB 2XNAB 1T1ZB 1S9YA 4FJ6A 2CUIA 4WI8A 3X1GA 4F33B 4U1LB 5F72S 2ZOLA 1S9VB 2ZXDA 5SX5K 3OKMA 1YEHL 2Y36H 4HZAA 2AXHA 2VR3A 1WJ3A 4WO4B 5CIPA 4G9DA 2BRRH 1A8JH 1X5JA 1JZ6A 3NJFA 3UG4A 3Q6GH 4L4TA 5CBAA 2QQNH 1NPNA 3BDYH 3ZRCC 5HBBA 3BUTA 2ATAA 4V1DA 1A1OA 1M56B 3AS3A 3QO0B 1S7SA 4DP6X 1I9JL 2AK1H 3FQRA 1XH1A 1AZRA 1IKNC 2D7NA 2YBGA 3ZYJA 4JO3H 3O8XA 4Q56A 3RU8H 1CO1A 1N8ZB 4PH8A 3LEYL 2AEOA 5EUKB 5LBGA 3DLQR 1EHXA 3VDBA 2ZKHH 4K5NA 1ZSHA 3EYUL 3CWGA 3VA6A 4CNIB 2CLVA 3JV4B 1P7KB 5DMGD 2UZIL 2EDOA 3KR3H 3QRLA 5C0CB 3U6XS 5BOPA 4YIQA 4BZYA 5ABDE 1R3JB 4ZZKA 1DUZB 3DDFA 5FWQA 1MAKA 4MS8C 5GGQL 2NQDA 3OAYK 2EUVA 3HE6C 1TQSA 5D2LA 3WKML 1ZEAH 3FHQA 4QRRD 1XSKA 5E1AA 2HRHA 4Z78A 5FYKU 2CBOA 4KKNA 2Y7QB 5GZOC 2YQGA 2MPAH 4EIBA 2JJTA 3GSNB 3O3BA 1A66A 1L7TH 5MEPA 2HG5A 1C5CH 4JFSA 3F12B 3FUHA 1LWRA 4GXFA 4Z7IA 3M17B 4WUKL 4YHYC 1JFHA 3QUZA 1W0WA 5F1NA 5AVWB 2B8OT 2EZ0D 5I74C 4W6YB 4JFUA 2EH7L 3GI8L 1EBAA 4GUPA 4HIXL 3IDNB 5C0IB 3ZVVA 1MNUL 3MV11 2UX6A 2E7BA 2AEQH 1XR9A 3D25A 3G9AB 2ZX8A 4K8RC 2DWXA 4MNQA 5E6ZA 4ZX3A 3BPLC 1BFVL 3X11B 3ZDXB 2GTWB 2Z92B 2W07B 3TVMC 2JCCE 1SXAA 3GXMA 3UJIL 4HEPG 1A0QH 2NR6C 4W9HC 4FQXC 4YPJA 3VQLA 3NN8A 3CTTA 2C3XA 2Y25A 5IB1B 1QFWM 4CVZA 5I1LA 4AYSA 5KN5B 2UY6B 1DQKA 3MRBB 3PQYA 4NKQB 1NM4A 4HP5A 3IBEA 4L4JA 5HJBA 4ADIA 4ZFQA 1RZQA 4GKNA 3BD5A 4Q2ZA 1NAKH 1CR9L 4XNMA 1QI4A 4UM9A 5KBLA 4XPTL 4EF3A 1YEEH 2BP3A 2F1BA 2R9HC 3H0TA 3GMLA 4JZOA 5C7XL 1HKLH 2IADB 2JE8A 5C0FB 1VFBB 4BD4A 5CD3A 4AEHL 1P4LA 5EUOF 2MIZA 3R19A 3NIFB 5SWZA 4KI5E 4XC1L 1JVKA 3BPCB 5AZ2H 1NOLA 3KPQB 4X50A 3LRSA 4MDIA 8FABA 5AW8B 1J1OL 4NJ9L 1ED3B 1GTNA 4AKQA 4XR8C 4XB8A 4KMTL 3KMDA 2R0KH 3HRPA 4RGMC 4NUGH 1JXDA 2EDRA 4IMLB 4Y5YC 3UYRL 1Z9MA 2IH1A 1U8NB 3JVGC 4LVEA 3ARGD 3QJSB 4JO5A 3BH9A 3ROLA 3O6FD 3ZTEA 3QA3A 4KH9A 3QPQD 4EI6B 3AU0A 3UBGA 2GC4C 1EFXA 5FYJU 5ESQB 4HHGA 2Z31A 4GIPD 4JFED 4JVWA 2GK2A 4XCFL 3GUTA 3GSXB 3RWJA 1TZAA 3ROOB 5F93C 3P11H 5I5RA 3R1GL 4LSPH 5I17B 3OAZH 3PABA 4HJGA 4MMYB 4Q6IB 2ZPKL 1BAWA 1NCCL 4FEIA 5GIRA 5J5EA 3B56A 5IVXE 4Q9RL 4IRJB 4Y19E 5HGDB 5CINL 3LIUA 3CVCA 2CU9A 3MR9B 2Z8SA 1UXWA 5IFAH 2JKXA 4U0RB 4ES9A 1MELA 4ZZFA 1UQSB 3MI6A 4LP8A 5TFSL 1CFQA 3HIZA 5FGBC