4Z3EA

Crystal structure of the lectin domain of papg from e. coli bi47 in complex with ssea4 in space group p212121
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
197
structure length
197
Chain Sequence
b'MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PapG, lectin domain
publication title Carbohydrate-Lectin Interactions: An Unexpected Contribution to Affinity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 44
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3eA00
1J8SA 4Z3JA 1J8RA 4Z3HA 4Z3GA 4Z3IA 4Z3FA 4Z3EA
chains in the Genus database with same CATH superfamily
1D9KC 1E6OH 1JSYA 1MIEL 1HIML 1UWXH 2VMJA 4F2MB 3KPNA 2A74B 3EOBA 4NX0A 1G5GA 2FUTA 1LLAA 4HPOH 3O41B 3RTQD 1SN0A 3DX4A 1I85A 4M5YL 4AM0A 5D4HA 2OJZH 3U48A 2EECA 3QUMH 1I53A 3KDMA 4OIIH 3M8OL 2OX5B 3IGUA 3PCYA 4X5LA 1X3DA 4Y7MA 2OK0L 5DC4B 1N5AA 4XX1G 4X8GA 2FD6L 3OKOB 4F9LC 4TS6A 1CE1L 1F11A 4IBWA 5I1CH 1FZJA 3AXLA 2QQLL 4FNLL 3VFOB 4B9FA 3FO2A 2B1HH 3L6FB 5CZXC 2Q76B 5EZIH 4RFNC 1PYWB 1UENA 3W2DL 3QFJA 3VFPB 4KNTA 2XWTB 3L4TA 2ICWB 1DQLH 4ZTOH 5IT2L 3B43A 4YAQB 4Q6KA 1V3JA 3LNDA 2P8LB 1RJLA 4GO8A 2X70B 5GIRB 2EIEA 3RTLA 3DUUA 4LIQE 4O2EA 2WLYA 5EU5A 1PKQB 3T2PA 3WTYA 1FYTE 2FX8L 4XNUL 4UTAA 4F3FB 3O4LA 1RZ8A 2DWYA 1QRNA 5DJZA 3HC2A 2CUAA 2GK0B 5K59F 2J2ZA 4PLKC 3DWTA 1FVEB 4DGWC 3FOLA 2EDMA 4G9FB 4ZAKA 5JPMA 1MI5B 3GSVA 2LABA 3HE7D 4XO9A 4JPKL 4N90E 4PJXE 4AQEA 1OCRB 5C6TH 5KSUB 1SMAA 3A22A 4IQHA 4LO9A 4TRPL 3W9DA 1T6WA 3M1OA 3OKDA 3MOBL 3NTCL 2P46B 1JJUA 2MOGA 3HNVL 5GGRB 4JFOB 3TTYA 4LP8A 3OAUL 5D1XC 4ZODA 1VDGA 1USZA 5K1VA 4UM8A 1HESA 3FSWA 2YPLA 5KG9A 4OFIA 2QPUA 4L8SC 1BQHA 3OXSA 1WV7T 2KUTA 5GRZA 3KPSB 5IW6A 1U8OB 3VFNB 1II4E 1BFSA 4L8DB 3HRZA 3AREA 4OFVA 3R7QA 1GMIA 4S1DD 4WW1A 3JUZA 3WGUB 4FA7B 1EO7A 3VFSB 3HBGA 4FQ1L 5FGBA 4JM4H 2J1WA 3QXUA 5CSZB 4BHUA 1MG2C 2XN2A 3GUFA 2DWDA 5K9QG 5MEND 2F18A 3TV3L 1XH2A 4WHCA 1KIQB 3MNZB 3QZNA 1PD1A 1OAUH 3ARBD 1EA9C 4HUVA 4ZS7L 1Y18A 3CUPB 3KYOB 5JDSB 3QHFL 3LKQB 2VABA 1H6FA 5J6GA 4LDEB 5EU6D 4DEPB 4N0FB 2IV9A 3W0WB 1EAPA 3WN5B 4WV1B 4HISA 2HG0A 4KK9C 3BQUB 1MREH 2AW2A 2LU3A 3DETC 3MLUL 5AVUB 5GGVY 4YBLB 3TL5A 5ITBH 2WXNA 4HKZB 2PR4L 2GJZB 3GNMH 4XTRD 3A6CL 4JPVL 2NXYB 3S37X 4B5ZA 1KEGL 1DSWA 4NNXB 3RVXD 1HKLL 2Z0UA 4DP0X 2VXUL 3HFML 1VENA 1U8QA 2BCMA 1N26A 3BPOC 2JB6A 5DJXA 5C2BH 5CR8A 4PJBE 1J0HA 3EUUA 4ZRGA 3FQWA 1RP9A 3I75A 2UXTA 3GM8A 1X5LA 2B59A 3MJ9A 3J2PA 4Y89A 4YHZH 2HX7A 4I5BA 2GJ6A 3QQ3B 5AKTA 1MCWM 3NCXA 4JRXD 3KE0A 2PW2B 1IILE 1U91A 4JG0L 2NY3B 2X0UA 4XXCC 1ITCA 2WUCH 4H0IA 1EFXA 1OGAD 2YMXH 3S36L 3DPDA 1DUYB 3OKMB 1XF3B 3VTTA 4OCSH 1OTTC 2RA1A 3TCLB 3MCLL 3VA2C 1MLBA 1ZXQA 2OV0A 5DUPL 1MIMH 2VLRB 1ROWA 4A6YA 1Q0YL 1NICA 1Z9LA 4PJAB 4NNPH 5FGCE 4NN6C 4NLAA 4DFIA 4TNEA 2R69H 1KEMH 5G5DA 1UH3A 1T2QL 3U4EA 4PRDB 3ROOA 1XB6A 1GW0A 2EXYC 1B3IA 1OOWA 3K91A 2QQKH 1XF5B 2WBKA 2BOLA 4BFOA 3X1NA 4F7TA 4XMLH 1DVFC 4HK0B 5ICXA 3QCTH 1T4KA 3SHSA 1VF5C 2HRPH 3D3VD 1P84K 3O0LA 3UYPA 2XV2A 4P3CL 4APXA 3DIFA 4QCIB 4DGIL 1U8PA 1S8DA 3T6XA 1IAKA 5CLZA 5C09D 5E8OA 2B14A 2WVVA 4GY4A 5HHQA 1OPGH 5JW4R 4X6BA 3O3EB 3WNNA 4HC1H 1DBBL 3WLBA 1OVZA 5DRXB 1A5FH 3CU1A 4G59C 3EBAA 4Z3JA 5IMKA 1SBSL 4X6FA 3ZYJA 4CDHA 3LH8A 4O02H 1WPCA 1CLOL 5IMLB 2Z35A 4OZFG 4PWEA 1DANU 1EAOA 2VYRE 2F54A 3TIDB 2VUYA 1UG9A 3O3BA 3H0TA 3GBEA 3NH7H 3MRKA 3UO8B 3DK0A 1LO3L 3FYEB 4YSUA 2KZKA 1A22B 4AYSA 1RJZA 4NJAH 4XVTL 1ICTA 3GZKA 4IBUA 3P3TA 4JFXA 4KMTL 5FS5A 3IN2A 2NY2D 5FUCC 4KX7A 3CFCH 2DD8L 4RVBA 2OR8A 2ROYA 4Y5XC 2RALA 5CJBA 3MRFB 3VI3A 2EUWA 4WQOA 4PB9L 3WJMA 1AXTL 3B9AA 3HI6H 4P5SA 4UTBL 4ZD3H 4ADJA 3CZFB 1JGVH 4GS7C 4U6YA 3U9PH 1AZVA 1FO0A 5EA0L 2X2HA 5T1MB 2NNCA 4U6TA 1FQ9C 4MX7B 4ZSOA 1O0VA 2EEAA 5I6XC 1F97A 3ZHDA 1HHGB 1RPKA 2DQGL 1P6AB 4JK0D 3QFJE 5D2NA 2FEEI 4FQ2H 4PJEE 3HNSH 4PRBA 3QUXA 2ETWA 2N7SA 3K1DA 3QIWC 4GG6E 4EI0A 3FYIB 5SX4I 4DP4X 3VD9A 3GUTA 4R96A 3DXAA 4D8PB 2QMJA 1RJYB 1KBGL 2R0ZH 5JIQA 3UTSB 4LSPH 3F62A 3FQNB 5EIIG 1GS7A 4I8DA 3SY0B 1UFUA 3P9MA 2J25A 4V1DE 3TJEH 4N9OB 4K3JL 1RLWA 3DKHA 3ZQXA 4PWHA 1U92A 4G8IA 1O6VA 4NBZB 2C4FU 3K8LA 3SYQA 3MUGB 5F88A 4N0YH 5C70A 4WK2B 4AM0B 2WKGA 3C60C 4JVPA 3VSVA 2UXFA 1XR8A 2VM4A 5JDJA 1KFGA 1QAWA 3K6SA 4IBYA 3BKJH 2YRBA 1AP2A 1G7PA 1W2KT 1QR4A 2QFRA 4HK3J 1FIEA 5KVEL 4WDIA 1F11B 3EFDL 3QNXA 4XB3A 1Q9KA 2XLLA 1FZJB 3SDAA 5IV2A 1MAJA 4TQEH 2DWEB 3CVCA 2IDFA 4X4ME 6FABH 1ZS8A 5D5MF 1QHOA 3DX6A 3GBLA 2X4QA 4TKWA 3GBNL 4PWFA 4XPGH 1JV2A 4DKDC 3D0AA 4D9RE 4P0DA 4FZEH 4LLWA 1EJ6A 1MUJB 2OMUA 3BAEH 3FU8A 1NGQH 1J0JA 1JDDA 1D2OA 1FHGA 1OAZL 2JJTA 5CU5A 3TEYA 1MXGA 1MKFA 2ZWSA 2A7BA 3H7LA 1GZHA 4H26A 4MZ3A 1JWMA 3G6AA 4O2EB 1ML0A 3HG2A 4J3OD 1LO4L 3O4LB 2B0SL 2P5EE 1H8NA 4N24A 1QRNB 2M2DA 3NGBB 5DJZB 3MR9A 2VM3A 5EG6C 1UH4A 4CMMA 3IU4H 3ARDC 5IKCA 4XO4A 5CIPB 2K78A 4YPGB 3FOLB 2NRDA 4MXVF 4FABH 4K8RD 4N2GA 4ZAKB 5JPMB 5CBAA 1ED3A 1G7HA 3MCYA 4AQEB 3H56A 3ARFD 4WVRA 3G6JF 5E6ID 3U36A 4JO5A 3W9DB 1JNJA 4X6CB 3OKDB 5E56A 3L3GA 3QI9B 4MZ2A 4G9FD 3C6EA 5HGBB 5LN4A 1E9QB 1OANA 2D3JA 2VO8A 3BWZA 3DX1A 2OI9C 5C3TA 4HPHA 2Z34A 4IOFC 3EYQD 4G7RB 4UM8B 4IBVA 5C0JA 2BMKB 1OSZA 2FT8A 4K3HA 4P2OA 3US0A 5IW6B 4WFEE 5DD0H 5AVVB 1XHHA 2R4RH 5FB8B 1X44A 1ZDQA 4HV8A 4KPHL 3UBXI 1KIUA 1JZ2A 1FL6A 1KTLA 2DWDB 1KSRA 1DQVA 1Q1JH 4B9JA 1BSIA 1R3IL 1PSKH 4POZD 3FPYA 3FTVA 2WD0A 3B2UC 1NDMA 2VLLB 2F8XC 1F1DA 1F4YL 5JQHC 2VABB 5J6GB 4HPYL 5I9QB 3SQBA 5T3XD 4ETYA 4UILL 4AX3A 1EAPB 3N9GH 1R24B 4TVPE 1XWVA 2H2SD 4HT1L 4LPXA 1UD5A 1XL6A 3QUZC 3DV4A 4CAGA 3UCQA 2IPUG 5BQDA 1DCEA 3JZ7A 2DH3A 1JZDC 3O6FA 4LCIL 3UJIH 3FTGA 1RZGA 1SY6L 1QFUH 4YBQC 1U8QB 4NUGH 2JB5H 3EO1A 4GAFB 5DJXB 2AC0A 2WY3B 3I75B 4UOW1 1SHSA 3MRHA 2R7EA 4AYFA 5IGXL 2WWNA 2WXIA 2GJ6B 3EYVB 3NJNA 4I5BB 1K5NA 1LP9A 3BAJA 5GRVK 4PHZA 2PP9A 1U91B 4DUXA 2CWRA 1I8MB 1EFXB 4OFYA 4NUMA 4F8LA 3R1GL 2O6EA 3FCUB 3Q0HA 3QZWA 4JFEB 4YHKH 3SQOL 1CF8L 2FX9L 2WQAA 2GEQA 2JKIS 3VUAA 1O7DC 2LAGB 1QWHA 1IZKA 2X38A 4OJCA 4B7LA 43CAA 5DRWA 2FIKA 1QMUA 2MPVA 4WO4A 1NLBL 1MFVA 5ERWB 3KLHC 3HKZA 5BVPH 5G5DB 1F58L 2BO0A 5FCUL 3HG1E 3US9A 1QFWI 3PHAA 4E9QA 3U4EB 3T1WA 2C9RA 4HXBH 2GSGA 3I6KB 3ROOB 5LDUA 3GRWH 1YAZA 4PMFA 2IDQA 2NLJB 1XSKA 3FAXA 5CWSB 5BS0D 5DHYB 4CL7A 2WIIA 2R15A 4PJ7B 1OSEA 2H2PC 5ICXB 5L2JA 4Y9EA 1CD8A 1E2VA 3SDCB 4KKLC 1JPGA 1WCQA 4JREC 1S8DB 3MREA 3G08A 1MNUH 3EYSL 2GYSA 4XZ4A 1IAKB 5EOCL 1JZ7A 4LSVL 2RH0A 3UC0H 2WVVB 1OO2A 3MRBA 3PGFL 2Y06L 3LNEA 4LSRH 1XIWD 4XNZC 3WIHA 4EVNB 5HHQB 1EZSA 1RUKH 2E46A 4LFHG 5KZCB 2X87A 1BDYA 1HI6A 4FLOA 1EO8H 4IGBA 1MCNA 2RACA 5CEZE 4RRPG 2VDQB 4LCCB 4IKLA 4R7XA 2F08A 1ZPLA 3MRNA 4XPTH 1T20B 1E50A 2EINB 1F86A 4H8UA 4NPKA 4AW4A 3UACA 3ULUC 2F54B 4OGXH 3TJPA 3O3BB 4Z77A 4HWEL 2V3FA 3BKYH 3K7UA 4QRRB 4H20H 3APFA 4YR6B 2DI9A 3QXDA 4PCTA 3FT3A 5E1GA 1EVUA 4S1SL 2GI0A 4WWPA 5ID0B 3L4ZA 1RJZB 4HQQL 4P4KA 3KG5A 3ZL4L 4ZI8A 5LUMA 4KMLB 3VH8G 2O4EA 2ATPB 5BCAA 4NP4H 3JWNG 4NXKA 3GXDA 2NX5D 4YDKH 1YEJL 3DX2A 3WJMB 1OSYA 2CRYA 4F7CB 3CLEH 5FK9A 3VXRB 1C9SA 1YCSA 1J8HB 5CZRA 4DSYA 2MSPA 3P9LA 1MCQA 3B5GA 4IMLA 1N5YH 1I8KA 2GEEA 2A6DA 3OF6D 4OJFH 2Y0SA 4PJ8B 1MFAL 4ZSOB 4U1LA 2R56H 3TBBA 1H8OA 2BIPA 2A6IA 1X6NA 3NQKA 4ODTH 4DQOH 5L4JA 4AUYA 5FDYA 4NHUA 2E4FA 4UIKH 4YDIL 3C5ZA 5HY9A 4Y4KD 4PRBB 3QUXB 3EXLA 5C1MB 1I4FB 3TA3A 2JNZA 3MCKA 3PL6C 5DD0L 3RDTB 3QPKA 3GUTB 2QJDA 4Z7VF 4ESKA 2GW5A 2Z1PA 1P9MA 1L9NA 3DXAB 3VI4E 1K2DB 3FONA 1MW3A 1FCCA 3W11C 4RFOH 3TBSA 3NZUA 3LJ3A 4M8QB 5F7KC 5SWZD 1XGRB 3P9MB 3RPBA 4MNQD 2R0KL 2WB7A 1QI3A 2GIMA 3H9SA 4ANVA 1MCOH 3ET9F 3WTTA 2BERA 4G8IB 4PRID 4BYHA 5BO0D 4YJZL 5L6YH 4UTBA 3S7GA 3DTUB 4OF8A 1MPAL 3NFNA 4ZX5A 1JK8B 3OC5A 3GSQA 2VE6B 3GHBH 1XR8B 2C7FA 3L5XH 2QKSA 5E2WL 1FDLH 1KT2B 4HLZH 3V7AE 3K6SB 3QJRB 3F8UB 1AP2B 2Q86A 5DFAA 2VAAB 4WDIB 2AP2A 1NAKL 1TFHA 3QNXB 3S8GB 5IV2B 1I3GL 3RY6A 4QNPF 3MLRH 5B38A 3BIKA 3UJJL 5TPWH 4FKKA 1ZS8B 3N40F 3DX6B 2X4QB 1NANH 3CZKA 5CEXB 1NCCH 1UJ3C 2CK0H 4A7VA 1VFOA 3CVIH 3EJYC 1Z9PA 5CU9A 2CG9X 2ENQA 4FYTA 5E2UL 4KQ3L 3L8QA 4H1LA 1CQKA 2OMUB 3IM1A 1Q9OA 5A2JH 2EDOA 4X7CC 1E6JL 1NC4A 2GBVA 3X14B 2DICA 2E9BA 1NOAA 1O7SA 3BN9C 3QFDB 3EH1A 3TYGL 4AT6A 1MRDH 2I9LA 4G8FB 5I75B 1Z0NA 5GGSY 4MCZB 4L9DA 2VJXA 3CHSA 1EEYA 2V7HA 3VWKD 5IKCB 5SWSE 4LCUA 2AV1A 2X09A 3ZDYE 5E23A 4NP9A 4I0PB 3RVTC 5CBAB 3CVBA 1ED3B 5CNHA 3IFNH 1G7HB 3P9WB 2EDWA 2FBJH 4EUPG 2EDNA 1J5DA 4HCGA 4K8RL 2GQHA 3VSUA 4PY7A 2XV3A 4TUKL 1XDTT 3L3GB 4OIAA 3KS0J 1D7DA 1IBGL 5MHSD 3WKNA 1W8OA 3B34A 5IBTL 4A55A 2MPAH 5E4EB 3BFWA 1QSEA 2AQNA 5DQDL 5ESVA 1GGTA 4M5SA 4ELDA 4OKDA 5C0JB 4FRWA 1OSZB 5TDPB 2BVOA 2A4CA 4P2OB 3ULUF 4LSRL 4MMXA 4ZQTA 8FABB 1QPKA 2PXYC 2VR6A 3ARGC 3D7PA 5DS8A 2K9UA 3HNTH 1RUKL 3BMVA 3FUJA 4HV8B 5BMFH 4MA7L 4TXVB 1EXUA 4WFGD 4QXGH 4MASA 1FL6B 1H6EA 1KTLB 1OAXH 3WSQL 5L4FA 3ZDZF 3MXVL 4OQTH 4W4OA 5L7XL 3ME0B 4IKNA 4XPTL 3V52L 3VRLF 4GAYA 4KZDH 3PNRB 1QEWA 1J1PH 2DMKA 3FT2A 3C08L 3L95B 3NCCB 4WFHD 1NDMB 5BW7A 4FP8H 3OAYK 2HKHL 3E3QC 1OW0A 2YOAA 3IMVA 4NJ9L 4YHML 1YECL 4GAGH 4OV5A 2NY4D 3GMLB 5T3XL 4QWWD 3DV4B 1IGCL 1QPXA 2APTA 3O6FB 5JW3L 2XCMC 1DFBL 1RZGB 1TTFA 2E9GA 1E2ZA 4U6VH 2CJTA 5J12B 1YHPA 3T65A 4QXVA 5FYKH 2NY1D 3EO1B 2FECL 1IX2A 4E41D 5A3IC 1ZY9A 3AQZA 4NKQB 5TF1H 1NDGA 3KEHA 2ERJB 1PDKB 3MRHB 5DC0A 4AYFB 2DKMA 1K5NB 1LP9B 5MERA 1L9OA 4FQPA 2EE6A 4R8WH 3TEUA 2ZE0A 1BBJA 2ZXBA 4YC2C 3SZKC 4ZFOL 3AC0A 4G5ZL 3BH8B 3U1QA 4N8CL 3HBQA 4GXVL 4PV9A 5MENA 2IPTL 4OCWH 1HJBC 4OY9A 4QYOA 3PAUA 2B4CL 3MI6A 3ARBA 1YNKH 2RFXA 1I9EA 3KVDD 5ADPH 4JFED 1IFRA 4WO4B 2ESVD 4XCCL 2F19H 2KLSA 2V6HA 5JA8B 5C0NC 3FB5B 1SXBA 1SUJA 3FT0A 1GYWA 1LO0L 2EDJA 3T4YA 4YGVA 5TQ0H 1QFHA 4H4NA 4Z7WA 4HKJA 2CZNA 2APFA 2WIIB 5E94B 5JHDD 2W5PA 4HD9A 1HINL 5EC2A 1YEGL 4K7PH 2VXQL 3DV6A 3RA7H 4OT1L 4OZFA 5GXBB 4M9OA 5I73B 1S2EA 3AY4A 3RYMA 3MREB 3E8UH 1IB5A 3G08B 4YDVA 3SGKA 2VDPL 3MRBB 4QHMA 4U4BA 2X2YA 5CAYB 6TAAA 5IJVB 4JPWL 1NFDF 3QWOB 3IGAB 1WAAA 2H0JA 1DVSA 1BJMA 4HXAL 4JRXA 5C0AD 3G5WA 4TLKA 2C4XA 4NLHA 3QEQB 1VIWA 3M7OA 5I74C 1JPSH 3ZMNA 1NWPA 5EU4A 1F4HA 5CCKH 2JCCA 1RY7B 3FUMA 3IDXH 4RWHA 4X7TA 4Y88A 2NQDA 4Z77B 2HXAA 3QO1A 3EH4B 3EHBD 2IQAA 3QRGH 5D9SB 2IAND 2UZXB 4UMGA 3FT3B 3T0BA 2Q87A 5CM1A 3ESPA 4I3SH 3S3CB 3F00A 2WUBL 3MJWA 1CLZL 3S36X 2IBGA 4U1MA 5J13B 3U7WL 3O6LH 4NWUL 4KQ4L 2IBZY 1LNUB 2F53B 2E7LA 5F7DA 1HNFA 1DQKA 1X9LA 5FK9B 3OL2A 2AQTA 4L4TD 4OFQA 5B21A 3Q13A 2HFFA 1BIHA 3AT9A 3K6OA 4KO6A 1PLCA 3D3VA 4FCHA 4P2AA 4NQQA 3ASNB 5AOIA 2VLMD 4ZFQA 3S88L 1A02N 2W91A 1J8HD 3E9TA 3QK0A 2XTJC 1N64H 1VAHA 5C09A 5JIMA 3TM6A 3RVUD 3JT2A 5EIIA 5HVWA 2IAMC 1YEHH 1W0VA 3LTVA 5IVXE 2TRYA 3A4FA 3C5ZB 5HY9B 2AJZA 5DMGC 4F9PA 4JHVA 4L0YA 4QDGA 2YJLA 2CSPA 3DSNA 3EDKA 4B3EA 2MQ3A 5T3ZH 1EHLH 1NBYA 2HJKB 4JMNA 4YQXH 1ZTXH 5D1QE 4G6AC 2XVBA 3J8F7 2HWZH 5HI3C 4B27A 4N5ED 5D2LB 2J73A 4QTIH 4RMRA 4MQXD 3H9SB 1K85A 3JZYA 5F3BB 1OP4A 3NK3A 1Q0XL 2A9ML 3HR5B 4Q9QL 4F93B 5KVEE 3NFNB 3VWJB 2CLRA 4FXKA 1TJGL 4R4BB 5FM5O 3GSQB 2FSEB 3Q1SL 1M6OA 4AVKA 1GS6X 4Z8FL 2Q7AA 3MNVA 4NXSA 2WAQA 3NABL 3NP4A 1OE3A 4DOHE 3FXIC 4JFFD 4MLSA 1I1AD 2Q86B 5IEKB 2YAEA 3APCA 4PCYA 3H2QA 4HMEA 4BZ1A 1ZV2A 1AZCA 2BDNL 5LBSA 1RZ7H 3BIKB 4JN1L 5AB9A 3MOAH 1ORQA 1WFTA 2Q7NA 2GY5A 3P02A 4B9KC 4KITB 2P8MA 1SNRA 4LEBA 5GZNC 2BSRA 4R90H 1F00I 2OMZA 1YN7A 1Q9OB 2XTLA 4W9FC 1NC4B 5DVKA 3MNWB 4LQFH 4N87A 4TL5A 5KBKA 1MHHB 2N0MA 2DAVA 4J3SA 3L1EA 3QEGL 3BPCB 2I9LB 1B4JH 2VDQH 3MXWH 1SVZA 1OP5K 2DJ4A 2TSBA 3L7FA 3GS0A 3HUJF 1FVDB 4G7SB 4JM2A 2DZEA 1IQDA 1JHLH 3UH8A 2HUEA 3CFJA 4LCUB 2AV1B 5EOQL 4QRAA 1L7IH 5C7XH 4WHYG 2DIAA 4PJCA 1CTMA 4YHOH 5TD4A 3TJHD 2V8MA 3LKSB 5A7EA 5I0WA 2C9XA 4JFTA 5FFLA 1SOSA 2Y1AA 3DX8A 3GDBA 5TQ0L 3W9EB 2EDRA 4PY7B 4U05A 4YHYB 3IS0X 4HIJB 4PGBA 1OTSC 3QGVA 1QSEB 5ESVB 3ULVC 3D06A 2H1PH 3K2MC 4O5LL 4PRPB 2BVOB 3EDDA 4OZ4A 3A5VA 3VW3H 2CGYA 4NAQA 4MMXB 4Z0BH 3GS7A 1W80A 5DS8B 1GY2A 1QHQA 4FI8A 4WJG3 5MENE 1INEH 1EXUB 5KYWA 1KJ2L 2G75B 4XP4L 2DKSA 4QMEA 2XXFA 5DEJA 2EVJA 5EU3A 3Q8AA 3PPSA 5EBMA 1WZ1H 4KOBA 3NFSL 4QJ4B 2BK8A 5HHME 4I77L 2WLMA 3FT2B 5EU6E 4LSDA 1K4DB 1KXVA 1CE6A 4LK4A 1BM3L 4XBGA 4E42A 2VDKL 2LFEA 4NO0A 1BFVL 2A2QT 3LXAA 5D7LD 1TZGH 1V10A 3NA9L 4M29A 3OLGA 4DTGH 5LNGA 5F6IB 4ABWA 5AVWB 1VEOA 4K9EL 3U1SL 2WLNA 2WVSA 4MD0A 5CP7A 3ZKXB 1SEBA 3LQAL 3ARFA 3RIKA 3VNYA 4JO3H 5FWQA 3BD5A 1DLHB 2E9JA 3ZT7A 3C09B 5F9OL 3T65B 4WTXA 3AS3A 2DYRB 3CZUB 3VD1A 4JRXE 3KYMA 2GUOA 4YSEA 1JNNL 1A6AB 4OJDH 2Z64C 3QNFA 3KPPB 3CFMA 2ICEC 1OGAE 4OUUB 2YPKA 4B3VA 1IEBA 1BBJB 1G87A 1TEFA 4N2DA 4P06A 5KYUA 1OT2A 4PW3A 5DJ8A 4XN9A 3TFKC 1EHAA 1MCHA 1TPXB 5IROA 3GLEA 4Y4HA 3D51A 4P3DA 3D33A 1FE8L 5AW3B 3RZCC 1AQMA 3WIFA 4QYOB 3VXNB 1VGEH 3MA7B 2RFXB 4OCYH 3FCSA 1UXWB 3QIUC 4PP2B 1JDAA 2HT3D 4XNYH 4PJFE 4ABQA 4I87A 3T4YB 3MRIA 4LESA 1CL7H 2FJHA 3CXDH 3ZW3A 2JJWA 2CCVA 3PJSA 4LHUD 4Z7WB 1PFCA 4KC3B 3GINA 3C87A 4Y2DB 1SRDA 4XCEA 5TTRA 4O9HH 1CU4L 2X5PA 1PTZA 4PD4J 4FQCL 4HH9A 4JM0A 4MKTA 4OZFB 3ZIMA 1KN4L 2XU9A 2NZ1A 1MRCH 1HXYA 3PAVA 5JZ7C 1IT9H 3MODL 4QHMB 1KXQE 1HHKB 2W94A 4U3SA 3QCUL 4EZLA 1MSPA 3WHXB 4RISL 2CUMA 3OAZK 4GG8B 4S2SA 5CJOH 5DJAA 1EDYA 2JJVA 1RZ7L 1W8NA 5CMAA 4EBQL 3MRQA 4NO5A 5EU4B 2NTFA 4LNRA 1BEXA 1J7VR 2JCCB 3D4GA 4LZKA 5GRXG 1K6QH 1PY0A 4KK8D 4FYQA 4X7TB 2YQGA 1C8QA 3JWDL 3QEQD 4NGHL 2A6JA 4C8XA 3TXAA 4Y9GA 3KW8A 3LH2L 2ARJQ 1MJJA 3SDYL 2PW1B 1HVXA 2ZUVA 3T8VA 2ICES 1R33A 5LCVL 1EHXA 5FYLD 1TNMA 4U1MB 3UTTB 3N1GC 4NQCB 3P2DA 3GXPA 4PRAA 1U93B 4QR7A 5F7YC 2ZCHL 1NCWH 5F7DB 3AG4B 2VDMB 2QHRL 3RAJH 3QIBC 3BZDA 2G5RA 1CLYH 4YXLL 2NUPA 3WFHA 5CLYA 3UZVA 2WLZA 4UQAA 5KJ4A 1F4XH 2XG5B 2XYBA 1C16A 2X2UA 5EZOL 3UROR 1BJ1J 2DEXX 2VC2B 3V6OA 2XYCA 3QFGA 1JWSB 4FQQB 5B4MC 1WD9A 4IBTA 2CKBB 4PI2A 1J1OL 4NQVA 4R7DB 4C56A 2OTWA 1J1XL 4Y2LA 1KB9J 3BIAX 2DTMH 5EIIB 1NIBA 1HL9A 1KCUH 3A23A 3TN0B 5KYYA 2UX6A 1W0VB 1UB6B 4EKXA 4EQ2A 1B0GB 1Y1DA 4X8JA 2AJZB 5KVFH 1IL1A 4Y4FC 5I1AA 2FNBA 1UA3A 4TTDC 5JPNB 4J23A 3LSOA 3K4AA 4I2XE 4TVSa 3T6QC 3DSNB 4BKTC 5IQ7H 5J11B 2DMGA 1I1YB 1NBYB 2BW5A 2A83B 4ONFH 5FUOL 3EXJA 1IBZA 1D3CA 2W80C 4KRPB 5I16B 4APQB 4U1JB 4ZO7A 3BEVB 1ZMYA 5FO9A 3W38A 2EC9U 1KPVA 3KL0A 4J4PC 4UQDA 4F2ME 5IJDC 3V4VL 4F80A 3I02B 4FXKB 1OK8A 4DZBB 3VXUA 3ERXA 4AMWA 1WSST 3UG4A 2NXZC 2V37A 3UTQB 3OJDA 1E4XL 3KGRA 4KTEH 1NGWA 4FQIL 3VXTA 4EZKA 3B56A 1LWHA 4W9JC 1PX3A 1FSKB 2FO8A 1JZGA 4GRLA 3D0VA 5K1NA 3VFUA 5DMIH 1A3ZA 3BPNB 1C5DB 4CVUA 1UOLA 2ENJA 3IJEA 2IPKA 3C5JB 1A7PH 5AAMA 1AAJA 4B50A 1UASA 2J44A 3HLAA 1OZTG 1MF2L 2APXA 2E7HA 2F0CA 3V4PL 3D05A 1OARH 1ORQB 2VAJA 1CZ8H 4PJXF 5AKSA 2P8MB 4Y4KA 3BEWA 3S6CA 1H5BB 1P5UB 2CBPA 2OMZB 5EPMB 4KDTC 4FNQA 4LVNB 3WIHH 1OCOB 1NBQA 4XP6H 1A7NL 2EZ0C 5T5FA 2NR6D 5E00A 5FKPA 2X10A 3TT3L 1AVAA 4OLXH 3HC4H 5SWZA 4ELKA 4Y5YC 3FQYA 4MNQA 1KJMA 3LQZB 1IQDB 5E8PB 3CFJB 4RGOH 2XBDA 1OP3K 1XGQA 2R2CA 3MUJA 4KRMB 4PJCB 4PRIA 3F7QA 3SKJL 1NUNB 4K3GA 1X5XA 3CX5J 1C5CH 3DX8B 3O11B 2ZXCA 4G9FE 3S5ZA 4AGPA 2YD3A 1T7XA 3FCTA 3HBZA 3FUNA 5C2UB 1UEYA 3UBXG 5DGQA 3L4CA 4N85A 3TONA 1RCYA 4QRPD 1N4XL 4PGBB 2V2TA 5A6IA 4NWTL 5CJQL 2F61A 2ZPKH 4MD5A 3VJ6A 2AGJH 1MWAB 3V10A 2A99A 1KFAL 3ZDXB 2FR4B 1XF4A 3X13A 3TVMC 3MRCA 4Y16B 3ROLA 4K15A 5KYWB 2HMIC 2XSKA 4RGND 4P48A 4PJBF 4NZ8A 4GIAA 5EU3B 3L2LA 5AZEH 2E7CA 2ZOUA 2ID5A 3JV6A 5F9WB 1NPJA 4HOXA 2J88L 3HB3D 3UJTH 5T3XE 4OZIF 2A6KA 4OCXH 3OB0K 1IEAA 4NO0B 4YEFA 5A2LH 1NL0L 1L6XA 4ELMA 3GSUA 1HFUA 2YJQA 5EZLB 3TZVD 1O6TA 4XH2A 1BREA 1JHKL 1N3NB 2J6EA 4MJIA 5JMOC 2DV6A 3NK4A 5CP7B 5LAPA 1WZLA 1F3DH 1SEBB 1UD3A 3IRCA 4PGEA 2RCSH 2D0HA 4Z6AT 1I9JH 2FX7H 3GSRA 4EJ1C 3VFGH 3FDWA 3EG9A 3MBEC 3ILQC 5DVMA 5ECGA 4I3RL 1D9KD 3VMNA 2GUOB 4YMPA 5FHBL 4Q58C 4PRHD 1OM3H 5JR1H 1CS6A 1OB1A 4GLRI 2EDHA 2B2XH 2YPKB 3FQRA 4X5WB 1IEBB 2Z92B 3W56A 5C97A 4C4KO 5KYUB 1BQSA 5DJ8B 3ZRFC 2XRAL 2OSLA 1FNFA 2OCFD 2YGQA 4C4BA 4Y4HB 1E65A 3IXTB 4P3DB 4HSAC 3IJ7A 1EK3A 1VACB 3SYCA 3PWVA 4FKEA 1H8LA 5E08L 1DZBA 1YEFL 3KR3H 1G84A 4UQIM 3QPXH 2AJXL 1DLFH 2VLRE 2Z8VC 4H1LH 3T3MB 3NSCA 5F9JA 1M7XA 3IMBA 1UWGL 2YRLA 3CFQA 5BS0E 3P11L 5GGVL 1X4XA 3TO4C 1ZLDA 3MA9L 3T2NH 2FJHB 3HRPA 4LASH 3GI8L 1F1AA 2ZAHA 3ATFA 4OLVH 2W8CA 4TUOA 4N68A 2IFGA 5CSGA 2F5BL 5D8JL 3BSZL 2DM7A 1IM3A 2DEWX 4XCEB 1OHQA 1BZEA 3NESA 4ALAC 3BP6B 3POCA 1UWYA 4MDJB 1U95A 1CGYA 4FG0A 4W9KC 1ZGLA 3X17A 1HXYB 4GOSA 4DP7X 2WYHA 3WHE1 5FLVA 3TH3T 4Y2DD 4E41A 4HHGA 1HCFX 4P5KB 4DVBB 2GC7C 3BT0A 4LPCA 4U3SB 3B5TA 1IGMH 2R2HA 4HUMB 1QSFB 5D7IE 5LG1A 1X5YA 4M3JA 1BXXA 1G9MC 5EC1B 2OCJA 3JTBA 2XG4A 4TQ8A 2XQYA 1YAIA 5MEPA 4V2BA 4FL4B 3VH8B 2EDQA 3MRQB 3LXBA 3U25A 3VQMA 1NAML 2NTFB 3GO1L 4XXWC 3ZTNL 4JRLA 4PJIB 4ATTA 3WTUA 2XFGB 1FZOA 2YSSA 4MA3A 2JF1A 5IB2A 1HQ4B 4HFUH 3TBTB 2A6JB 4AXWB 5DHDA 4PJEF 3RGHA 5I18L 3F04A 1HDMA 3B7UX 5EUOE 5CJXC 4J3WA 2J8HA 4GG6F 1JK9A 3AXIA 3H2PA 4L1TA 3D34A 2NX5E 2YPVH 4Q6IC 2QMKA 4Z7OF 4R6UA 3T09A 4P46C 4PRAB 3DJTA 2ADYA 2CNZA 3CXHK 4DN4H 1UB5B 5FYLL 1AIZA 4ODWA 4BELD 2WINB 2ZF9A 2EIMB 3SGEH 3UTTD 2NUPB 3UZVB 1PF3A 1Z5YD 3VXOA 1RMFL 1U3HC 3ULAB 2QKIC 2YUWA 3UDWA 3K5RA 4IRZA 4J6RH 5B39G 2MQCA 1FN4A 3FO0L 1JL8A 1F4AA 4K94C 4C56B 4DGYL 2OTWB 1MCPL 1YDPA 1J9RA 4GP4B 4UNUA 3DPBA 3TYFA 4KK9D 3C6LC 4AQ8A 3GSNL 5KBPA 4J7RA 2ZTBA 3DETD 1WC7A 3T4AB 4CGTA 1A6ZA 1IL1B 2YRZA 2YWZA 2DQFA 4L5FH 5I1AB 4PM1A 2DYSB 2CJ3A 3AQYA 2NZ9C 3FCGA 3MROA 3TN0D 4K3DH 4GW5B 1O6SA 1RZJC 4AYBA 3B2PA 4H88H 1U3JA 2Y7NA 3CFEA 4DKEH 5IBLC 1YNTB 2DJUA 3JSSA 3RURA 4MNQE 5FM8A 4AIOA 2IANA 5TDOA 4IJ3B 4QRQB 1RUQH 4JFHD 3S3BB 3ABMB 2AI0H 5GRUL 3ULSA 5DJYA 1J5OH 3CX2A 4DKFL 2WAHA 2JI1A 1FORL 3SD2A 4KRPD 1B9ZA 1XFPA 4N2IA 4YHIA 5BOPA 2QEJA 4LXFA 3VXUB 4L4TA 1OTTD 5D96B 3KWVA 4X9HA 3OJDB 1TTAA 1NGWB 3VXTB 4F24A 1JWUA 4M6MH 4XP5H 2WTRA 4GRLB 2ICWI 4PS7A 4PRNA 3VFUB 2YN5A 4FTVA 5BZWA 1DVZA 1DTUA 3CXFA 3IJEB 4QHKI 2IPKB 4K3EL 4N3UA 5CUSH 1HEJC 3HLAB 4KZCA 3DMMC 1AQDA 3G5VA 1CURA 4KZEH 3GSXA 1XBRA 2OMYB 1F8TH 1HZHH 2EXTA 4IDJL 1QNZL 5EEXA 2L8AA 5GSRA 1NINA 4OZFH 3BEWB 4P9ML 4ZYKA 4ZOAA 4Z3IA 3IAPA 4XPAH 3PQYB 4M62L 3ZO0A 5I8OH 4BCYA 1WFNA 1B2WL 4JO2L 4OR1A 1A47A 2N56A 3TOPA 2CQVA 1N0XH 5GGQH 1KXHA 1UA6L 1IBFA 1ZDSA 4MGXA 4QY8A 1TQTA 5E00B 5FKPB 5GS1C 4EUPB 5BQ7A 5JOEA 5CFHA 3EYFA 1PS3A 3FN0H 1B88A 2FVNA 3TPUA 3VFVA 4ELKB 2YK1L 3D4CA 2HX9A 3EYUH 4MAUL 4BQCA 1KJMB 3ZKNC 1TZOA 3V4VA 2EH8H 1GYAA 4KVNH 2VUOA 1QBLL 2A73A 5LXGL 4Q97A 1PG7L 4NQSA 1AOHA 1M9WA 3EDJA 1CGXA 2E76C 2X4PA 4WU7B 4QKXB 5DS2A 3MV7D 2JKLA 2J8UA 5MHSE 5AW5B 5IHLB 3OKNA 1PJWA 2QPEB 3VM5A 1I1AA 1KTJA 1JF6A 2CKNA 3AM8C 3TIEA 2D31A 5JHLL 4X6CE 2VDMH 3HZ3A 3D85A 4B60A 2GAZA 2PYED 4MCNA 2YEZB 3ZY7A 2VRAA 2BNRD 2WGXA 3VJ6B 1DJXA 1G6RL 2P44B 1FL5A 3X13B 4WFGE 1M05A 2YBGA 4O2FA 4V2CB 1XCWA 2OQJA 1QBML 3MRCB 4JFVA 2ZKHL 1KYFA 2CKBH 2YD5A 3MLWH 3P0YL 4MQTB 1A3RL 1WISA 1VZGA 3L3KB 3MLXH 2LLNA 5F1SA 3MMEA 1DJIA 4R3SA 5C07A 3WN6A 4WFHE 3JV6B 4XAWL 3KH3A 4EO5A 4HCRL 3MNMA 1WWCA 1OGTA 1W15A 2A6KB 2NSMA 4PHXA 1IEAB 5IOPB 1EV2E 1TVHA 2WTPA 5EBLA 4ELMB 3MLPA 3ZR6A 3MLTA 3APMA 3QIWD 1LYQA 2F8OA 1NCGA 1N18A 3JV0A 4XH2B 3MRGA 5T1DL 3UZQA 2VLKB 5DD5L 1LO5A 1QLFA 4MJIB 2DQDL 2W0LA 1KJVB 2AJYH 2PO6B 5IMMB 3EUDA 1FNLA 4E41E 2L7UA 4PVLA 3LZQA 4EI5D 1T22B 2EXWC 4TM9A 2DKUA 4NM4H 3B1TA 1FNHA 2IF7A 4F57H 4RWYH 4NPJA 1E7VA 1FNGA 2I60H 4U1IA 4WI4A 4IIZA 3FUFA 4C83A 4JB9L 1M2OA 3UIYA 1UVQA 3FQRB 5TE7L 4IRSC 4E5XA 1AQKL 3F05A 1CUOA 5HDQL 2J1ZA 3C60D 4BZ1H 4K7PX 5B3NA 5I28A 4ZK8A 5LBSH 4TUUA 3BP4A 1EJOH 3ES6A 3V0VB 3PWVB 4JFEE 4GSDH 2ESVE 2DQIH 1YJDH 4TUJA 4OD1L 3EH2A 5I2IB 2CGRL 1NANI 1SQMA 3EGXB 2FYYB 2R29L 3N85H 3W39B 5BZDA 5F9JB 5IIEB 4NT6A 1QFPA 4LF3A 4LVOC 2ODIA 1GC1H 1XO8A 2B15A 4PS4L 3P0GB 1KCRL 4HZAA 4OBSA 2ZIDA 5D7LA 5JHDE 2Y2YA 1BAFH 3V79C 1P5VA 3LXCA 1XH0A 2O1AA 4JKNA 1NKGA 1IM3B 1N2RA 4F7MA 3U0PA 3INOA 4PJ7E 1P4UA 1D2PA 5D7JA 1U95B 1G6VK 3GLAA 3X2QB 2DM2A 3OPZL 4A7QA 5IVZA 3FTXA 3N43B 4HJ0D 4RZCB 5C0AE 4PLNC 1UOVA 5A16A 2B1AH 2P1YA 5A6LA 2HVJB 4HIXL 1CDBA 2K8MA 2VDLB 1GXEA 1IKNA 2D9CA 3R0NA 2WLIA 3T0EB 5KTEH 2XG4B 5DURB 1BD2A 2H5UA 5MEPB 2ZUUA 1F8TL 4LSSH 2DDQH 4JFYA 4Y2OB 3V6BR 2F1AA 5EHFA 1L9SA 1FVCB 5CKAA 4XPAL 3HVNA 2WOBA 3QRBA 4AYDC 1A3LL 2IANE 1U21A 2V2XA 2YSSB 1MWAH 5A6MA 3RGVC 5M95B 3P4LA 1JZJA 4B7IA 4E0RB 1PZAA 3ZT6A 1XXDC 3IFOA 2FSDA 5IP4A 4PJGB 4IOFD 3L17A 1TJHL 3EBGA 1JK9B 4PP1C 4QRRE 3ARXA 4LRIA 4C55A 5ICYA 2IGFH 3CHQA 4KXZH 4KWUA 3FB7A 3WKPA 4L4TE 3VG9C 3I3EA 5EZJB 1TQBB 2D7NA 3VI4F 3BCDA 4NDMA 4A7GF 1BQ5A 4HIHB 4NM8H 4MDIA 1TSRA 1L9MA 2E74C 4XBPA 4Y1SA 1MH5A 3AT0A 2ITEA 2XKSA 3GBMH 3HA0A 3NIDE 2FJGA 1D6VL 2VLME 4N2OA 5EORL 3VXOB 3VXRE 1SDDA 1OQOA 2JELH 2OZ4L 1J8HE 5GJTL 2OZNA 3SOTA 3VXSB 2BXYA 5JLZA 3B2UD 4DK6A 1ECYA 3LNGA 4LCWD 4ZS6C 4PTTB 2XVKA 1UJTA 2Y36H 3DX7A 5JO5A 2ZD0A 3GZPA 4MHHG 4G43B 3ISYA 4RGMC 1XR9B 3FFCB 2CDEA 1AJ7L 1T89A 3EZ8A 5I8CA 1CIDA 4PJHA 3I6LD 5FOJA 1A6ZB 4XC1H 1JGIA 3QUZD 2DQFB 3B37A 4E9SA 2VDOB 2L4OA 5E51A 4KROB 4HGWA 3FT4B 2VC2L 1LO2H 2MJWA 1O6SB 3L3JA 2MH4A 2WXPA 4HUNB 1FLRL 2X4SB 4YBQD 4BRVA 4YO0B 4PFEA 2WO2B 5TDOB 5D1ZA 4K5OA 3DX3A 2J56A 3S3JA 3JYBA 4OLZL 3ULSB 5C0RL 3BIBX 2BC4B 4ZX3A 1GHFL 3RQ3A 2K9FB 2I07A 1P7HL 5IREA 4YSQA 4M3KB 1M57B 3GKWH 2QLYA 3QA3B 2WNXA 4QHKJ 3SGJC 15C8H 4OLWH 1XGZA 4ZX4A 1LILA 4N20A 3WFDH 4JFFE 3AG3B 5EV7A 4P23A 4W9IC 3DURA 1JWUB 2GFBB 2WTRB 2I85A 3C8KA 4MCMA 4PRNB 5INCB 4FTVB 4JZJA 4X5QA 3WEBA 5F7WC 3ZDYF 4QOKA 1OTUC 4O4YL 3N41F 1KWGA 2Y22A 1AQDB 3BISA 3F6LA 3G5VB 4RAVA 1R0AH 5I1EH 5HVHB 5HYEA 1AC6A 4MA8H 3UPAA 3EJJX 5JW4Q 1VEPA 4XPBL 5LBVA 4GPVA 4OQ1A 5DD3H 4ZYKB 4EMZA 3OHXA 5FYJH 1YLBB 1HL8A 4PQXA 1YNLL 2JV6A 3L4YA 3L2MA 2BZCA 3C5SA 4WF7A 3LRSA 1AHWB 2ENYA 2DLFL 3D39D 4KKLD 1P6FA 1M1XB 3MV01 2DQCH 3FCBA 2CK2A 1GPOH 3WJLA 3IDIB 4X99B 1U0QA 3LXUX 5GISH 3EYFB 4KXCA 3OSKA 3TPUB 3VFVB 2OTPA 3JWNH 1GSKA 1O75A 2H1XA 1RJCA 3EGSA 2WW8A 3LHPL 4HWNA 2OP4H 3LIZL 3F5WB 2X4OB 3D6GA 4KJYA 2A73B 4JFZL 2VJ0A 3FQUA 3V9FA 2XACC 4IM8A 2X4PB 3P4OA 5ELIA 4FFWD 3MX0B 3ULUD 2J8UB 1QTYT 4PD4K 3IXAA 4NQED 2VSDA 1YYLL 3AAZB 1NCAH 3TIEB 1BZOA 3TBVA 2D31B 4UNVA 3L4XA 1S6NA 1W72B 3D85B 5D1QC 4OI7A 2GAZB 4XNBA 4U6XB 4G6MH 4XBMA 4ZUUB 2XZQH 3FOMB 5B7EA 1NDTA 4S1RH 3RTQC 5B1JA 1TJXA 4BBWA 4PU2A 4FFYL 4L9LC 3VFTA 3VD7A 1A21A 5FFOA 4XPFL 1CWVA 5C07B 5IFAL 1L5GA 1K9TA 2OM5A 2FGZA 3KVPA 2R8SL 4J27A 1GCFA 2BSTB 4G3YH 1AACA 4PUBH 4HJEA 3MKGA 5D93C 1CTNA 4LMQE 1OGTB 5DK2B 3VD5A 1FAIL 4ERSL 3JV4A 2XQBL 4N5UA 3NFPA 3CSTA 1DBMH 1TVHB 2Z7YA 3GM0A 2KL6A 1N67A 5EBLB 4OKVB 4YUEH 2DIJA 3PL6D 1HHIA 4AVJA 3VMPA 3NPSB 1T7WA 1LO5B 1QLFB 5C0BA 1IKFH 1ESOA 3EDEA 4M6NL 3L16A 1BXAA 7FABH 3RNQA 2E27H 3NIFB 2YGPA 3W11D 3DIVA 6PAZA 3VDBA 2BNQD 4FFZL 5AAWC 2V9UA 1A1OB 2P47B 1JGDB 3EJTA 1G6RA 2JIXD 5DZPA 4LLDA 1KB9K 1BJ8A 3RWJA 1A14L 2DTSA 2PO6D 3KYKH 2JJSA 2NY6B 1FNGB 2Y36L 2W92A 1DVXA 3F7YA 1UVQB 3LCYA 4PPTA 2WSKA 5DFVC 3WS3A 1YQVL 2FEDC 4KO5A 5DJ0B 1G1KA 1QWUA 3F7RA 2K1MA 2BSED 3GIVA 5D6DA 4JN2A 2VDRL 1DBAL 2P80A 2DQJH 2DQTH 1RIUL 3BP4B 3IDMA 4HCRA 1TCMA 3ES6B 5J0BA 4TTGA 4AV0A 4TUJB 4XVJL 2ZX8A 5FA3A 4HS8L 2F74A 1N6VA 5D71L 2B5IC 1PLAA 5BZDB 1HOCA 3CFBA 4NT6B 3IWVA 1C1EL 4OCRH 4U1NA 4S1DC 2Z4QA 3WFBH 9PCYA 5BO1H 1R3HA 1U42A 3EJYD 4O58L 4EUPH 4CJ1A 3SE4A 2DMHA 4J2QA 2E6QA 2W59A 4KAQL 4JVWA 3U4BL 1RZFH 1N2RB 1YEDB 2GSMB 4AGNA 1ORSA 5F89A 2WBXA 5E9DA 5D7JB 2IFFH 1CGWA 1B0RA 3HI1A 5C08D 1J18A 5IVZB 5FO8B 3UERA 4AMKH 2RJMA 1VZHA 1YMMB 1AO7A 3MBXH 4Z7AA 1TTCA 3HG5A 4NNYA 4PGCA 1QLRA 1S7SB 4FQXC 2VERN 2WWKO 2UXGA 1S3KH 5EN2A 3L9EA 4BQ9A 1UYWH 4UZUA 1I1FA 1DN2A 2K7QA 1NC2B 3QEQE 3RVXC 5JIIA 5DURD 2HG5A 5CLXA 3TX4A 1F4WH 1FYHB 2R29A 4JO1H 1AYRA 3L2NA 2WXRA 3IFOB 4JKLA 5IVXF 3I9GH 5FYLE 3VX1A 2BP0A 1EWHA 2EE2A 3S98A 3FH7A 3D4YA 4J28A 2GTZB 2ZUSA 3C5XA 3FQ4A 3K4ZA 3ZPDA 1U8MA 5ICYB 4X6DE 5F7HA 4WUKH 2XN9A 2CHXA 3FB7B 2YQBA 4QHLB 4NDMB 2OP4L 4QRUA 5AOLA 4Z7NB 3WJJC 4MDIB 4XBPB 25C8H 3CSFA 5DK0A 1ODAA 4Q9RL 3UBHA 1HX0A 1YEKL 2MQ0A 2FJGB 3VGHA 5JORB 2BHFA 1OSPL 2XICA 5C0GA 4KNQA 2X40A 1RERA 2Q6WA 5IQOA 1YMHA 4FQLL 4BZ2H 1XVSA 3H54A 2J6EH 2YHGA 3DX7B 3UGEA 4D3CH 5AZ2H 4NZTH 3OB8A 2ADFH 1AMXA 3IBOA 4Z18A 3VXSD 2XIBA 2OJEA 4PJHB 3VA6A 2QADB 4W9LC 2Y2TA 2ZYIA 2VZOA 5DUML 4HGWB 3MJ8A 3QAZB 3LOWA 5FV2A 3S4SA 2COQA 1UUNA 2EEDA 5ILTH 1C12B 3FFCD 3BFOA 1QATA 2ZXQA 2OXGA 1V3KA 3RWHA 3FUIA 2HA1A 3GTVA 2K70A 3FHAA 1JTOA 1QRKA 3FMGL 5A3ID 1NCOA 1SZNA 3HEIB 3NCFB 5D1ZB 2ED7A 3ZR5A 5D1XA 2R9HC 5GPRA 4OM1H 4CADB 4X8CA 4CSSA 5MI0B 5C3LD 3IMSA 5T1LD 3DUHA 1QTSA 2B9AA 2I07B 2HPOA 3FU6A 4L8SA 1E28A 3B9KB 2OCCB 1U8CA 4XX1E 2FUQA 1QO3A 3D69B 3VU2A 1ZVSA 3N1MC 5EEWA 1AI1H 3A6BH 4OF6A 2EDYA 1IFHH 3SKMA 1GKEA 5IG7B 4FE9A 1ZA6A 3U7AA 1JD7A 1I7ZB 2VDNB 4P23B 5HYJD 4RAUB 3DURB 5B8CC 1A6WL 1IQWH 5DD6B 2X3AA 5KVMC 1JXGA 1Z32X 3C8KB 5GS3A 4Y9BA 5ISZD 1Z9MA 4QOKB 4BK8A 3SCMB 2NY2C 1X5HA 4RAVB 5C0ND 5C0CD 3HS0B 1CL7I 1ZANL 1VZIA 1CFVL 3HMXL 3OHXB 3DOSA 4YNYA 2N01B 2O30A 4F2EA 2ZXEB 2NYKA 4PB0L 3ECQA 2H3KA 3HLKA 4HWZB 5ALBH 3DTXA 3SODB 1MFDH 1ZT4B 2VDLH 2Y5TA 1GYUA 3EGDA 1EERB 2IH8A 4M9PA 4UV7L 3US1A 1JMXA 3IYLW 3UBXB 5JTWA 1WBXA 2HJLA 4NQDB 4JFQA 5K5YA 3UG3A 3QXVA 1TEYA 3QW9A 4KJYB 4KVCL 1LD9A 3SJVA 5GJSH 4XXCA 4BV1A 4G6FD 3FQUB 4AYID 5I17A 5ES4B 2VZUA 5D5MA 4QRPE 2DMCA 1MQKH 2PWFA 3UP6A 3MQIA 3H53A 4GXUM 2C1OA 3CSPA 1DFXA 1IGYA 2JI3A 3ESMA 3PIQB 3TBVB 1EEZA 4ZX6A 3ULUL 2F15A 4AM0Q 2IALA 3DARA 3NQIA 2VH5H 3T2OA 5JW5A 2ZZUT 3VD2A 2NYZA 1IBBA 4PAZA 5FKAA 4JW3A 4Z0XA 4IRZH 4PRPE 1KCSH 3VM7A 1AKJD 2YXMA 2G5BB 1HXKA 4IDLA 3CDFA 3IGLA 4JJ5A 3VFTB 1D7FA 2FCBA 2X4TA 4LOFA 1LMKA 2A74C 1DVFA 4ONGH 3H9HA 4H40A 4D9QD 3ALWA 2ZJSH 3HTLX 1L5GB 5M94B 1X5GA 3CDZB 3KPQB 3SO3B 4YPJA 3MUHL 3ENEA 1JPST 2ZOWA 3JTTB 3V0WL 1MCBA 2XTJD 3O2WH 5DI8A 4JO1L 3G6JA 1FG2A 1WCBA 3JV4B 4Z5RB 1LE9A 1G0XA 4QRBA 3LMJL 2AK4D 3PNWA 5GRJL 1P4IL 4DP2X 5CGYC 5I0ZA 2XTSA 2XQ0A 5DMGD 5F1KC 2R1YA 1UCBL 1GGCH 2EH7H 2VN5A 3UADA 2EADA 5C0BB 1IGFH 3RNQB 3SSGA 1NGPL 3QC6X 5E2VH 1RHHB 1KB5B 4KKQA 4XE0A 5AYTA 1UM6H 2LTQB 5HI3D 4PJFF 1YYML 4PRHE 2YKLH 2PMZA 1CICB 2QBWA 3A21A 2YKKA 5C0DB 2KLRA 2CO7A 4HJ1A 2ZXGA 3CCHA 3G9VA 3DO3A 1JRHI 2BNRA 3ESOA 1EUUA 4Y1AB 5H37A 3LNFA 3PHOA 2Y07H 2AXWA 3WS3B 4Y5XA 2C26A 1EAJA 2D4FA 2F68X 4RAHA 1I31A 5HHNB 4JR9L 4DAGH 5FF6A 4JNXA 1OAQH 4LRNL 2X3BA 4HWBL 1YVLA 4EN2A 1YY8A 3MTRA 3QUHA 4OJAA 2HN7A 2DQHL 3EYQC 4HUKB 4PVNA 4QT5A 4WHYH 5F7EH 1GAFL 1RURL 4P2QA 1K8IA 4QYAA 1T5XA 3KH4A 3LS4L 4TV3A 1V3MA 4HUUB 2G60L 2EIZA 5GZND 3PG2A 1A4KA 2ITFA 3T71A 3UO1L 1AFVH 2P7TA 3HG4A 2LVCA 4FFZA 3BH4A 1FJ1B 5CO1A 5H94B 3B6SB 4AEFA 1BZQK 3BLBA 2CO1A 5E9DB 5F89B 4POZC 2FLMA 5ANHA 1B0RB 3HI1B 2ZT9C 4JKPL 3WNMA 1QI5A 1JD9A 3QQ4A 4OZHF 4HS3B 1A2YB 1R5VB 3GMOB 1AO7B 1NBVL 4OUOA 5T1KB 4PGCB 1QLRB 3BP7B 2UWEB 4ZPTB 4G71B 4P2RA 1N68A 1KJ3L 5AVQB 3K2KA 1N6UA 1I1FB 4DEPC 1IAMA 3C60A 2Q8AL 3WN5C 4WV1C 5HPMA 4MQ7A 4LOUC 1AD9A 1CIUA 3BQUC 2IH3A 2HG5B 4YBLC 4AUJA 3SQRA 3BYTA 5GS0H 1CBVL 1T6BX 1SLUA 4YFEA 1CD9B 4QXTA 3V0HA 1OTSD 3NSJA 3TNNA 3ULVD 3T0XA 3SE6A 1YEIL 3UPCA 5ENWA 1ZS2A 4OGYL 1MFEH 4N0CD 5IZ7A 5B39B 1OGSA 1EUTA 1U8MB 2VQTA 1LWJA 1EIBA 2DM3A 2XN9B 4GQQA 4P5TD 1ZHLB 3UTTE 4QRUB 3CFUA 4NQCE 3ZYZA 5BOJA 1GH7A 4S1QL 3F7KA 4L1BA 5EO1A 4MJ5A 2E5EA 5F72S 2NY3C 3QUYB 3ALXA 1F02I 3QXWA 1JPFA 1UACH 2GCYA 4P05A 5C0GB 1GIGH 3OQRA 2GVYA 2EDKA 4HKXA 3FU3A 4FG6D 3QJFA 5HSFA 5GGTA 1KGXA 1GJWA 5B3JF 1VFAB 2MNJB 3ARDA 4JGMA 4XOEA 1CFMA 5DDHA 5LHDA 3M86A 4X80L 3Q48A 4JDZA 2IDSA 2PN5A 5I1IL 1UH2A 2WHVA 2YGVA 1GVIA 1NCUA 1JZEA 3PDOB 4FMKA 1FBIL 1XH3A 3IGKA 4YDNA 2PCYA 2EIDA 1E5ZA 4A2FA 4TF4A 2MCPL 3RWHB 3VXQB 3CFTA 3GZOA 1E4WH 4JFHE 3FF7A 4PJ5D 3UYOD 2ENPA 5C0EA 1FPTH 2KC0A 4GUCA 5IW1B 5FHAL 4KHTL 1R3KB 2ZSVA 1BMWA 2OL3B 4PGDA 4P04A 2VDOL 2VWEC 1E28B 5ABDE 2JE8A 4E9LA 4BXSV 1L7TH 3V0EA 5CFAA 1QO3B 2IC2A 1ZVSB 2HTKC 4HJGA 3PU7A 5INDA 2OXHA 1QACA 1T7YA 2R83A 1CGSL 4IEFB 3RZCD 2G4GA 2X1OA 3NJJA 2P43B 1EMTL 4J1UB 5DEZA 5K9OA 1U30A 4N2MA 4N26A 1TNNA 4XN5A 4Z7VA 1JNHA 1Y7VA 4HOZA 1U2CA 2YAHA 3MTXA 3GGWA 1RUML 3Q43A 3LEVH 4NI3A 4RSVA 2G3MA 1CVRA 1JGLH 3NAAH 1DSFH 3L9RA 4M1GH 4RNRA 3S34L 1PZCA 1SYSB 1E8XA 4XZUB 4CN4A 3WXWL 3CHOA 1JGUL 3DOSB 4L4VB 4YNYB 5EFIA 3AACA 4A2MA 4OCMC 3TGXA 4MXVE 4M61B 3IETA 2AQ2A 1J10A 2ITDA 4PJDB 3DTXB 1E40A 3C2AH 2Y5TB 1X5IA 2IQ9H 5CZVL 3DSFL 1A64A 1OAQL 3FB8A 2W07A 4IMKC 4KTDH 3U30C 5HP5A 5JZ7D 3GMRA 4IBZA 1RZPA 4HJUA 3DO7B 5LGJA 3P3YA 1IC7L 4HF5H 1WDAA 3QEHA 3VE0A 3GMMB 1BPVA 3INUL 4OM0H 3JXAA 1BHGA 2EYTB 4FJZA 2O5NA 5K9QI 4XGZA 3JVFC 1JYXA 1QYGL 1WFIA 1WK0A 3CPLA 5EH1A 1LD9B 4MLIA 1ETA1 2C34A 4GT7A 3SJVB 3MV7E 3QR2A 4PH8A 1XB8A 5I17B 2CPUA 3KJ6H 3THML 4NQDD 2WLJA 3QG7L 3TBCA 1U8IA 4HK3N 2XXMB 1XTMA 4G1MA 4MZRA 1XL4A 2PYEE 3CVHA 1IGYB 5F3HB 5G4OA 2BNRE 4UT7H 1RUPL 3B2MA 3P30H 4L4JA 5FUCE 4KI1A 5LGHH 1XCTA 4AW7A 4XCNA 4CA4A 5JW5B 1SVBA 3G7TA 3PWPD 5JOFB 5EOTA 5I30H 2FT6A 4X0NA 2CHDA 5FKAB 4Z0XB 1FGVH 3SGEI 3OZKA 2KS0A 1LK3H 4YDLB 2BCKA 1S9XA 5KSBB 4ZMOA 3HBPA 5E1AA 1OB0A 3LKRA 1DVFB 3ZQWA 2MKWA 2X6MA 1M42A 2AXHA 1W72L 3H9HB 4N2FA 4XP1H 1T1YA 1I85C 2RBLA 3WKMH 2QFPA 3S2CA 3AGWA 5B4MD 5AKVA 4TOYH 5C6WH 1E7UA 4ODHH 2PWHA 5DI8B 1LE5A 1V7ML 1WCBB 3G6JB 3UC2A 3PXLA 2F6AA 2IEPA 3K4DA 4NZUL 2DLEA 5TDNA 1KN2H 1QUNB 2AVGA 4Y4FD 4ABUA 3SN6N 3CC5B 2WJ7A 4TTDD 4U1GB 3BJLA 1A1MB 2ADGA 5IB1A 4JRYD 1C08A 2R0LL 4ZTEA 2PF6A 3I6GB 4JL2A 1A7OH 3EW3B 2X7LB 2VXSL 1SN5A 2HH0H 4NQEA 3TWCL 1H3PH 4LT7A 1WT5C 4FF9A 1S5IL 3BGMA 5AW0B 1IC5L 2I5YH 2WZAA 3P2BA 4MSWA 5HHOD 5DLMH 4B9CA 4Q2ZA 3VWKC 3IJYA 2EKSB 2CO7B 4K71C 2BY2A 3ZKMC 4JGUA 1G0YR 3CCHB 3X3GH 2VDNH 3X3FL 4Q56A 4J4PD 1ZT1A 5HJDA 2O5ZH 1A4BA 1WFOA 4RETB 1BBDH 4NHCL 1M7DB 1EGJA 2AQPA 3NGBC 1CICD 2CBMA 1FFOB 4QJ3B 5FF6B 2NXZD 5K39A 3AG1B 4KKCD 2AJUL 1XGTA 1OAYL 5JPMC 3KLAB 3AW5A 2X0VA 5IQ9B 1E0OB 1YY8B 5I6XB 4PY8J 2VR7A 2BFVH 2E7DA 3FH5A 3X12A 1RPQA 3QI9C 4QGYA 2BRQA 3VFRA 3X1EA 1LEGA 4P2QB 1PGRB 4PBXA 1T5XB 4ANWA 1KTDA 4QLWA 2EIZB 1EHKB 3NIGE 3NACL 4G8EB 2AXFA 3ASOB 4UCFA 3GD1C 2F7IA 4MD4A 5EUOF 4UOZA 3IDNB 1L9PA 2EZ0D 5SWQA 4R9HA 5FGBC 5F97E 1DE4B 1QVOB 1FWXA 2FGWL 4POUB 1THCA 4MCYA 3QQ4B 2JIXA 5C8JA 2LLGA 4DZ8A 5I1DA 3CPUA 3MLZH 2NY4C 3LQAC 5F93C 2J8OA 1DBKH 3KW7A 1RIHL 2Y4SA 1J0YA 5DA4A 4M1DH 4P2RB 4G6KL 5I9QC 2ZWLT 4D8OA 4XMPH 2BSEA 5L0QB 5IQLA 4XCYA 2J1KA 1AD9B 3A67L 2IH3B 4JG1H 1IGTA 3JWNE 2EE3A 1BX2A 1AE6H 4RDQF 5TFSL 2A4ZA 1OIOA 2DQUH 2Z93A 4JO4L 4U33A 1VCAA 2JLLA 1FH5L 3LEYL 1GSMA 1CGVA 7PCYA 2VSKB 4HETA 1ZKAA 8CGTA 2FWSA 5KW9L 2D2CC 4U6HA 2V9TA 1K4CA 4RMBA 3ULVL 3TVMD 1UJ3A 4PCKA 2ZKMX 4MB1A 4UNTA 4FQHA 4X83A 2FEEL 2X9WA 4YE4H 4DEUA 2BH0A 2FJUB 2UZYA 3ZUCA 2HMID 1S7UA 4IHBA 1GJIA 4MJ5B 2PPEA 1NFDA 2QV2A 3Q9QA 2AJVH 4FLQA 3KWXA 2Q10A 4LCWE 5FCSH 3HE6D 3WIIL 2GCYB 3FTWA 4XWGL 3QDJA 5F7NC 4HKXB 3P2TA 3QJFB 2IWFA 5EDSA 1UUSA 3QUYD 3OAWA 3I6LE 4ZUVA 1X5ZA 4F8TA 1JZ3A 3QJOA 3ARDB 2JKXA 4GXFA 4RA0C 4XODA 5DDHB 3NCJL 1XF2A 3RDJA 1KB5H 3NA4A 2C9PA 1MFCL 4GRWB 4N9GA 3QXAB 2DQMA 3HC3L 3KLKA 3L7EA 4X4YB 4J3XA 2EAEA 5GGRY 3ZL1A 9CGTA 4JDTH 3S37L 3G5YA 5ITFA 4UQ3A 4FFTA 2H9GA 5C0EB 3MBED 3ILQD 2K0RA 4R0LB 1W91A 1JIBA 4CGUB 4GP5B 3SDCC 4S0HA 2ZSVB 5AUMB 3RHWF 1MJUH 4PGDB 4F15C 4HHAA 2M1KA 3RKDC 2XPGA 1R1CA 1I8UA 4HG4J 2PXYA 3ARGA 4MRBA 5C9KA 4U1KA 4DWHA 1O9WA 3ZVVA 1O7DE 3KGTA 3L9YA 3SO5A 2XZAL 4I18A 3CTTA 1OXYA 4EDXA 4NQXA 3RNKA 5KVGL 4LCCC 1T2JA 1KBWA 2X4UB 4L3EA 4X9GA 1SJXA 4Z95L 4RIRB 4U3HA 3D52A 3VSTA 4OBRA 4WI9A 3GGWB 3QE5A 5DD1H 1GOGA 2J12B 2BOBA 2OMVB 1ACCA 4HBQA 5L9DL 1E4KC 4N6QA 1MFNA 3L9RB 4KQ0A 1GOHA 1AGFA 4RNRB 4H8WH 2YRPA 4WFED 4QEGA 1LEIB 3T6VA 3HJ0A 3D39E 3JWOH 4ODXB 4PG9A 5EFIB 4YHLL 5BRZB 2YAMA 1HKFA 3O6ML 2WQWA 3FUKA 4X6CF 3PQYE 1TKWA 4W6WB 1BQHG 1ZSDA 4CNIA 2XX1A 2QVFB 1JZ4A 5AB1A 2QDWA 4E9XA 2FO1A 1UC6A 5LGJB 4PIRF 4PJ8C 5L4MA 4M43L 1LWRA 1UOKA 3W82A 1J86A 1JPTH 1L3NA 4XGZB 2GITA 4WI7A 2VXTH 2C3XA 3CPLB 1NM4A 4WFFE 4WNJA 3SE3A 2P28B 4XP9H 1CGUA 3ULUE 2YBRB 2V17L 4GKOA 2YN3A 4JPIA 3RWEA 4TQIA 2FATH 4NQEE 5I1LA 4OLUL 4MFHA 3G04B 3O2VL 1GYVA 1U8IB 4JQIA 5E5RB 3KNBA 4JY5L 3NVQA 3SE9H 1F41A 3RDTC 4OD2A 3D50A 3CVHB 5JQIB 3CFKA 4N5EC 3CD4A 3BAKA 3PGDB 5ISZA 1D5ZB 1XCTB 2HAZA 5HHXH 2Y9RT 2GSIB 4P46D 2ORBL 3RPIA 1JVKA 4IS6A 3VNZA 3HN3A 4G82A 4GBXB 2BCKB 3BKCL 4GO6B 4WJKB 4OAWA 3I9IA 1I9RH 3HUJA 5AYQA 3ZTJH 2L0DA 5IFHL 1U6AH 1U3HD 2BJML 3K74B 1FHNA 1RUAL 2Y1YA 5EO9B 1NFIB 1RU9H 3UYRL 3BOVA 2VN4A 1MCFA 3QUMB 4PIBA 2PWEA 2FWLB 1S9WA 3BZ4A 3Q6GH 2FO4B 3VQLA 4HAKA 4HULB 1CI5A 3C6LD 3PP4H 3WG7B 4CVXA 4J3TA 1U58A 3MO1B 4LSUL 2P5PA 4G70B 4IU2A 4MVBC 3TBYA 5M7QA 2NZ9D 1T0MA 4HUXA 3FPXA 2KT6A 4P07A 1NCHA 1T5WA 2ADGB 2BNQE 1C08B 3OMNB 2OL3H 4JGNA 2K4AA 2O5XL 2CU9A 3VGAB 1NBZA 1BCIA 4S10A 1P4LA 2VLKE 5AW9B 4W1TA 1ZEAH 5IBLD 1FL3A 1KGIA 3QDMD 5FR3A 4Z7QE 1CCZA 2YUXA 2V5SA 2D7TL 4MSWB 1K3ZA 5HXMA 3RWDA 5AW7B 1A66A 2EJ1A 3ZDZB 5JQ6L 2BSCA 2HP4A 4OGZA 1DCLA 2YEQA 1ZT1B 3ZE1E 4GMSH 4LARL 3KCWA 1KPRB 4PJ7F 1AKJA 3WLWC 2ZOKA 1A6UH 1QFWL 1SXZA 5L88H 3SBQA 2W9LA 3BE1H 5K39B 3LV3A 3KM2A 1AZBA 3A24A 3LKOB 4I0PC 3RHWK 1YN6A 5I1JH 3SOBL 3HIZA 2V2WA 2CR3A 4KY1H 2FECI 3V9EA 4MAZA 4YE0A 1SMDA 2BRRH 3ISRA 3IBEA 4FA6A 3ECBB 3CQPA 3B2DC 3VFRB 3ILEA 4U7SA 1LEGB 2FBOJ 5AALA 4EF3A 2IAMA 1N7MH 3IEAA 4MXWL 2C7UA 5AKRA 5CEYB 4ODUA 3IJHB 5E4EC 2AK4A 2FQEA 3IAGC 1KTDB 5EWIH 2PCPA 3WL9A 1ZLVK 2X6UA 2LQRA 3SE8L 2AXFB 4P2OC 5IHBA 5F71A 2CBQA 5HHVH 4ADIA 3A6OA 4UT9L 1X5AA 4F7KA 3NRQA 4Z23A 5EMYA 5C08E 5SWQB 3ZE2E 4RX4D 1BEYL 1WF5A 2XZCL 3FTZA 3V6ZA 5AB0A 3BP5A 4IIQA 5ACMA 1IKOP 4XPHL 5HGDB 3U6XA 1VPOH 2A4EA 3HI5H 3P0VL 4MCYB 5DC2A 5C8JB 3AU0A 3R19A 1U3ZA 3WKYA 4DZ8B 4GMTH 1T1WA 4AQAA 4XCFH 2EE0A 3UGUA 1O9ZA 5LQBH 3NIDF 4HFWB 4X9IA 3KWTA 2VXVL 2R27A 7CGTA 1F45A 1S5HB 5F7LB 1NCBH 1R6VA 2IOOA 2DWXA 1ACXA 3GJFA 1CFQA 3SKNA 4WJ5B 5BXFB 4E9WA 1IGTB 1PCSA 4U7MA 5KYXA 4X0KB 3IE9A 1BX2B 5FUZH 1WFJA 4HW6A 5CS7A 4AGQA 3MBWB 3O6FC 5D4QA 2Z93B 2CE6A 2CUHA 3P1VA 4MNHA 2IXQA 5J12C 1K72A 3LZLA 4U6HB 1X5JA 4KXDA 2IADA 5ABZA 3VAEA 3GIZL 1TUPA 3RWIA 1MNNA 2AJSH 2G3NA 3KPLA 1I7UB 2ERJC 2YWYA 5GZNA 4YZWA 2G2NA 1H3VA 5J57B 2UZYB 2ED9A 1GR7A 1S7UB 5JIHA 4DFHA 1NM9A 5E1IA 4RH4A 4AYMC 5HYQA 5T33L 4ZJ9A 3VFWA 4NRYA 4PR5B 5CJ5A 2O5YH 5DK3A 3QDJB 4K7PY 3E3QE 1FGNH 1PY4A 1U8JA 2Z8WC 1UZ8A 4LEXH 4L0PB 3VXSE 4ZUVB 3VCLA 3DLQR 1D5MA 2G4EA 4RQQA 4A37A 5HHXL 2CBOA 2ADIA 1EDQA 1PLGH 2YC1A 4GKLA 4OLYL 4QD2E 4WO4C 4A2GA 1ZV9A 1NCNA 2QQNL 4XC3H 3FFCE 3BDBA 3ZTEA 5DU7A 4NBYB 3N44F 3QORB 3V95A 1GZQA 3ATEA 4JMXA 3L7EB 3RRQA 4GAAA 4FERA 3IMRA 1IGIL 4JFDD 5KBMA 3UAFA 3G5YB 3VXMB 3O8XB 3I50H 5H37H 5ITFB 2AITA 2EXWD 2H9GB 1NGXB 4O2CA 4DGVH 3IDJB 3O2DA 5F21B 2C9UA 4WLCA 1TSHA 1QBBA 4N6RB 4EI6A 1A65A 1RU9L 3LB6D 5E99H 2M8XA 5I73C 4F7PB 1A7RL 2XPGB 4NFCA 4IRSD 2OMTB 4ZUWA 1M56B 3ARGB 2A1WL 3O3UN 4U1KB 4J8RA 5HYJE 2EDBA 2EIBA 1AGDB 2X53A 3DX9A 1BGXH 4HZLA 3LVEA 4KK8C 4I18B 2YFNA 4EDXB 1OCWL 4JY6B 4HVBA 4XNDA 5ISZE 4TQPA 4UT6L 4XMKH 3RNKB 4IKJA 2HFEA 4O02B 3GTTA 4L3EB 2FH8A 1VB9A 5FOBB 1CFSA 1PZ5A 2H3NA 2UZIH 4X4XA 3Q44A 4Z78A 4MMZA 4KKNA 2ZAIA 5C0CE 3BT2H 3ECWA 1BZ8A 1PU0A 3WS6A 1HCYA 1UWEL 4LAQL 4N0UA 1OOAA 4HMDA 3HMWH 1UZ6E 5SX5K 4JZNB 4RCAA 1AGFB 2KQNA 2AQQA 3H7BB 1BG1A 1G94A 3FB6A 3IFLL 5J1AB 3OX8B 2ZQKA 4FS0A 2WNGA 4PG9B 3EJZD 2WV3A 2CH8A 4E9RA 5J13C 4QHPA 5KJRH 5JA9A 4KDVA 2CO3A 1LVEA 1P2CB 2XY2A 3QCVL 1ZSDB 1ACYL 1MJ8L 3SD5A 1MZYA 1GGIH 1NGZA 4M7KL 3BZEA 4UINH 4YHNA 2FEJA 1AANA 2BY3A 4HIIA 1FYTA 4Z1PA 2E3VA 4HU8A 1JCVA 1V7NL 2GITB 3B3IA 2AEIT 1YEEL 5H35B 1DDHA 1KENH 4UU9A 1P7KB 4FJYA 4WGVB 3TT1H 1KF9B 3KPRD 4DH2A 1G9ML 1ADQL 2J71A 1E5AA 1I8LA 2BS71 3RVWC 3VRJB 1GZPB 1MN4A 5EWIL 1MFBL 1MVUA 1TOXA 3KNBB 3FU9A 4PJXA 3RGVD 1HEHC 2HT2C 4ORGB 2P5WB 2W0FB 3IRZA 3X1FA 4CBPA 3CFKB 4G7VH 3V55A 4MAYB 4PP1D 3EOYG 2PWDA 1NMBL 3QIUA 5AW8B 4E9TA 1SFHA 1NMAH 3GWJA 3SDXE 3U0WH 2V3DA 4TSCL 1FF5A 2WXHA 4KUZL 1T4WA 1CLCA 5FX3A 3FF8A 3ZYIA 4KDWA 5FXCH 4OAWB 4D9QE 2J1YA 5GGTH 1JHTB 5IJKC 2VLJB 3MGOA 3PV6B 1SM3H 5KBDA 3MRJA 1KIPA 1ZHBA 4I1RA 2N1KA 4BQ8A 2Z31B 3MV8B 2XTJE 3CDGA 3VWJC 4GBXD 1A0QH 2PTTA 4GRWH 4ZS6D 4WZ9A 1S9WB 3BZ4B 2AK4E 2I24N 2TSAA 3L1OL 4W9EC 5FYKU 1M1SA 1INDL 3CMOH 3QZWG 4RFEA 3S5LG 2CHZA 3K0WA 1U58B 3HPLA 2B3RA 4G8GB 1ETZB 4NO2B 5FW6A 5I15L 4IU2B 3RY6C 3WEAA 4AEHH 1I8AA 1J05B 1KELL 1ID2A 3HCVA 3OAYH 3QNYA 3QDGB 5I8KL 3ABKB 1TJIH 4OZGE 4TNVF 4K0OA 4HBCH 5I1GL 1MJ7L 2G9HB 3OD3A 1P4LB 4M48H 2VITA 2NR6C 3SPCA 2D7PA 1BYNA 1UT2A 2AS5M 3NIFE 1RZJL 1UM4L 2GABA 4Q74A 1F3JA 3RWDB 2Q8BL 4MNGE 1Z3GH 1T83A 3B7TA 3OLDA 2YAPA 4EPSA 4KFZC 4PJBA 1AMYA 1FGNL 1Y6KR 5HJ3A 1S9YA 1PD6A 3ILDA 4G7YH 3ETBJ 3ML9A 3QH3A 4ONHA 4TULH 2B08A 4WEBL 4R7NA 4H13C 2Y6TE 4ZW3A 4OZIA 2ZOKB 3H3PL 2BOCA 2V7NB 3QIBA 3GJEA 3LPWA 3RUGE 4WKZA 4XOAA 4ENEC 1CK0L 4XHJD 5I66A 2CJSA 4I89A 4F33A 4ODSL 5TJWK 5BUGA 1RFDH 3OXRA 3QYMA 3L54A 2ZOOA 3KBEA 2LU4A 4LSQL 1OTUD 2XNAA 2ZUXA 5DWUL 1A6TA 4YHYC 1PAMA 3QYNA 5AG8A 5K1JA 1DL7H 2C7UB 4JY4A 4ODUB 1NIDA 5BV7B 4UB0L 4URKA 2PCPB 4H0LC 4MB5A 1ZLUH 3V2AR 3RU8H 3WL9B 3V4UH 4NKIL 2GHWB 5IOKA 2CGZA 3GC3A 4IRJA 4YWGL 5JUEH 2EXSA 2KZ1B 4W9CC 3O3DB 1OL0A 1HT6A 2WGNB 3CLFL 4NC1E 5DYFA 4G80A 4QXUH 2AKRA 2PCFB 4IIQB 4X6DF 5F6HI 4AIEA 5KEZA 2EVHA 5HHOA 2NY5L 3QT2A 4M5ZL 2GY7B 4I85A 4A2HA 4P59L 1NCDL 3EADA 4AQAB 3Q2VA 3UOAB 4UNIA 5D70H 3IB4A 1T7ZA 1A1NA 2I25N 1YMME 3S96A 4L29B 4J4PA 3TF4A 3CVHH 1JF1B 1ZVYA 5KN5A 2NW2A 1Q72L 1IZJA 3SKNB 1CFQB 4IYKA 4RMSA 5C0FB 4U2ZA 3VSQA 5F6IC 2CLVA 1TTBA 2X42A 5KYXB 3ULVE 1NIEA 4Y19D 1QLEL 5ANMA 5D1QD 1AZRA 2FBRA 3JQOB 3BZFA 2W60A 5F96H 4KV5E 5AEAA 2IADB 4QGTA 2D3LA 1ZHNA 2DBLL 3SKOA 5DVPA 3PUUA 3ZZSA 2H3XC 1KENL 4KDTA 4UDTA 3I2CH 3CK0L 1HYSC 4WSKA 4FNPA 1JCKA 3UG5A 4ANUA 35C8H 1MRFH 3QEUA 4N0UE 3SEPA 3D25A 1G7LA 1TPXC 5D2LF 1U8JB 4OJEH 1SLXA 1T1ZA 1UZ8B 2HFGH 2H41A 4MZIA 3TFBA 1FG9C 4G7VL 1BA9A 2EYSA 4RQQB 1R5IB 3TLRA 3K6NA 5IHUH 3C6SA 1HQRB 4PJEA 3BD4A 3NCWA 1J12A 2GJRA 1AZZC 1F6LL 1IM9D 5F0LB 4GG6A 4Y8AA 1GZQB 6CGTA 1TVDA 1BMGA 1W6LA 5FO7A 4PJ5E 4AEIH 4DK5A 5B38G 4JLRA 3IMWA 4E9YA 3CHXA 4F1SA 2BSDA 5DQJA 2AERT 1EGJH 4Y2DC 4UI2A 3G5ZA 3GXTA 1HC1A 5AL8A 1YA5A 3ECUA 3OMIB 2O93L 5KSAB 4ZOEA 4H1LG 4KGLA 1WAEA 1MEXH 4ZW6A 2IH9A 4V1DA 1SXCA 3AY4C 4TNVK 4N22A 5KVGE 5DFVD 1TENA 5DVLA 3TVMA 2FEDD 2O6PA 1UXMA 4XNAA 4J8RB 4UV4H 2LOEA 1HH6B 3SPHA 3LD8B 5DHVB 3U2SB 4HZLB 3BVWA 5AENA 2WCSA 4Q0XH 3BUIA 1OF2B 2L7QA 2HFEB 3TASA 2BVQA 5D7SL 1BLNA 1PZ5B 3TH4T 3DYPA 5DT1L 4MMZB 1NLDL 1BXUA 3SBPA 4E2OA 2CRIA 1IBHA 3WFEL 2WXMA 3D87B 2WQSA 1VLXA 2CJUH 5CINH 4N2HA 2CMRL 3KXFB 3S0PA 2IDUA 4X4MA 3DYMA 1Z5HA 5KVDL 1CD1B 3KJ4B 3AG2B 1A4AA 3D2UB 2ZP9A 4N8VG 5G4NA 1WTGT 3WXVL 5KWYC 1TZIA 2NY7H 3BAYA 4ZO8A 1JZFA 4MWFB 2E7LC 4NI6A 3GB7B 4EIGB 2EDFA 5DSCA 2BVEA 4FADA 1DQML 1NGZB 2AMUA 2BX5A 3QS2A 5HHMD 3WIAA 1U36A 3P4MA 4YHNB 4LSTL 4K7FB 1HN1A 1UXLA 1N8ZB 4M7LH 1LEKA 4HIIB 3CH1B 4BSWA 1FYTB 3CZNA 3TURA 2FZ3A 2SODB 1G43A 2P5EA 3JTSA 4NB7A 3RWFB 4FQXD 5A2IH 5AG9A 3L5WB 2A9NL 2VQ1A 1OP5H 5IFJA 2N1TE 3CFIC 3HHRB 3GXFA 4NQDE 1WICA 3TN0C 2AQSA 3LKNA 3BO8B 4BK5A 1TLKA 3IRPX 1MVUB 3HZVB 4ZTPL 3QJHB 5IUSA 2HVBA 4GSUA 4CUCA 2N0KA 1DQQA 2YZ8A 43C9A 4WGKA 5JPNC 1RULH 2IH1A 3IKCA 3PWPE 4AQ1A 2ED6A 4G1EA 4R26H 2D7QA 5J11C 3QIUB 1S7XB 4AL8H 4OZIE 4R2GB 3HOGA 3NZHH 5FLUA 4KRPC 1KXTA 3TO4A 3KCPA 3N04A 4APQC 2R1WA 5J6HA 4MAYD 3FFDA 3GI9H 3KHOA 1BZDA 4Z76A 3QR1A 3BXNB 5FAAA 3TV8A 1QKZL 4OIBA 4DO6A 2ZX7A 4GQZA 3MGOB 4UQEA 1J9TA 4NZRL 3MRJB 1KIPB 2H6PB 5TQ2H 4FXKC 2H6OA 3PAZA 3QVAA 2UY6B 3B2VL 3OJVC 2Q2LA 4PV8A 1NKOA 1ZCRA 4FEMA 5DR5H 1FSKC 1E6OL 3MV8D 4OI8A 4RFEB 3U7YH 2QPSA 3APNA 3BPNC 2YFOA 1QSZA 3LH9A 4JRYE 3VGGA 4NOFA 1BZ9A 3F7VB 4HPOL 3DUSB 3N5AA 1AR1B 1SYVA 3BWUC 1ZD6A 1BF2A 2OJZL 1HSAA 3QUML 4HX1A 3DBXA 3WMQA 2MMXA 1J11A 4OIIL 2VITB 2D9QB 4WUUB 1KYOJ 1YJDC 5HHOE 1H5BC 1P5UC 3O4OB 2X4NB 3AADB 3V8CA 3DVNB 4GRMA 3I9AA 4WWKB 1WGVA 4LVNC 3PE9A 2R9HD 2J43A 1GC1C 5I1CL 4JPQA 1QA9A 1MCRA 1D5IH 4TSBH 1PIGA 2XWZA 2EDTA 2KZBA 4P46A 2B1HL 2EC9T 2AEPH 1AKPA 5EZIL 1PX8A 3MYJB 4MYWB 2RD0A 1AR2A 3FO1B 3QH3B 4ONHB 4R7NB 3VQ2C 4TMPA 2BOCB 4QO1A 3GJEB 1ZHKB 2Q7YA 5FDWB 1DQLL 1TETH 2BM3A 5ANME 4ZTOL 5IUCA 3WELA 1V55B 1JUFB 5J9PB 4PSPA 4XN4A 5J89A 3Q2WA 4GQ9H 3L4VA 3OXRB 2WBWB 5BNXD 2E7BA 2WXJA 2XETA 1ZLSH 1C5BH 1KV7A 4JEGB 5FGCB 4CJ0A 4EN3B 3HHSA 2NTSP 3VFMA 3L5IA 4DUVA 3O9WA 1LXMA 4L2LA 2A38A 2Q20A 1BQLH 4HG4K 3HG1A 1I7TA 3FU7B 4QF1B 3B2XA 3BSHA 4HJJH 4BCZA 4XMTA 3ZHNA 3U82B 4IRJB 4YFLI 1MCDA 1R5WB 2UZPA 3KVQA 5C6TL 4EOWH 4JJOA 1ZV5A 4Y16C 3KL5A 3I3BA 4N2EA 2AKRB 1OQXA 3IWUA 5L2KD 3CLWA 4QTHA 3MACH 5D4JA 4JQIH 1KTKE 1URZA 3TO2A 4L8CA 4M7ZB 5CKGA 4Z7OE 3S96B 3OGOE 4BH8B 1KXVC 3EFFB 2ZWZA 1OGPA 5CF3A 5I1HH 4AWJC 5KN5B 1PLBA 2CLZA 3OAZH 3SDDA 4JM4L 4D0DA 4WW2C 2JKRM 4L1LA