4YFEA

Crystal structure of ptp delta fn1-fn2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
193
structure length
193
Chain Sequence
ALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKPKNSEEPYKEIDGIATTRYSVAGLSPYSDYEFRVVAVNNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Receptor-type tyrosine-protein phosphatase delta
publication title Mechanisms of splicing-dependent trans-synaptic adhesion by PTP delta-IL1RAPL1/IL-1RAcP for synaptic differentiation.
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yfeA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yfeA01
1OAQH 4KJQD 3PWPA 3HB3C 2A6KA 4WHYH 1G7QB 1IQDB 3RWIA 3WBDA 4JDVB 3BIBX 4ZNEA 5BW7C 1MLCA 1TQBB 3I2CL 4Y88A 4CW1A 4M93C 3T0BA 4X8JA 3SE3A 4HG4J 5GZOC 3K3QA 2X7LB 1JMXA 1RK1B 4ZAKD 5FOJA 1BGXL 3TC9A 4PJHB 5GISL 1ZEAL 2EYTB 3STBA 4WW2F 1AHWA 4ZPVB 2QR0A 1QFWH 4ODTL 5E8PB 4APQC 3PG2A 4YHPB 3T4YB 4JRYE 4LOUC 3O41B 2AJ3A 1OGTB 3BZEA 4GKNB 3MRGB 1IZKA 1J1OH 2VIRB 2HMIC 1J0IA 4G6JH 5HYSG 4KJYB 3SPVB 3UTTD 4PY7A 1CXFA 3GM8A 3RWEB 3QHFL 1MCOL 2CUHA 1KTKE 5IBTH 1YPZF 5A2LH 2PR4H 5IROC 2P49B 3B5TA 1HYRC 3E3QE 4XC3H 3X11A 4TTGA 2QQNL 3GUTB 1CL7H 2DWEB 3QUYA 4TNVK 1AXTL 5EU6E 5I16A 4XPTH 1ZSDB 1DVFC 5FAAA 4OAWA 3TIEB 4TOYH 2H6PB 1B0GB 3VFMB 1DBML 2F15A 3JV0A 4WIQA 5F88B 2EE9A 3DBXB 1A7OH 1A2YA 2HFFB 4DTGL 1QZ1A 3JUYA 2YN3A 2H9GA 3TBTA 4DGYH 4LFHD 1UA6H 1RZ7L 1SEQH 2QQKL 3TO4A 3MRJA 1HN1A 3OHXB 4B0MM 2XPGA 1KN4H 3BKCH 4AYFA 1KLFA 3MUHL 3CSBA 3MLUH 3BP5A 1OTSD 4JAMA 4F7EA 4OCSH 3UROR 3CFBB 4U1NB 3IDYB 2J7LA 3PWJA 4MNQA 1BOGA 3SJVE 1DLHA 3QZWG 2MKLC 4KAQH 3MTRA 3S5LA 3O81A 4UT6H 1DJSA 4E42B 4HJ0C 4RBPH 1YMHB 4PJIA 2YPLA 5T1DL 3SGKA 2E7BA 3FHQA 4NFBA 2OR9H 1TNNA 4XMKH 5C2BH 1OL0A 4P2RA 5FK9A 5FYJU 1P7KB 1XF3B 3FT4B 4MJ5B 4W6YB 3HA0A 4HC1A 4LLQB 3KR3H 4H88H 4OTXH 3AMKA 3TV3L 3TLRA 2UV3A 2VN7A 3EUUA 2FRGP 3BPCA 3MRKB 4KK9C 1NMBL 4DJMA 4JM2C 4JG0L 1N2RA 5ISZD 3OKYA 5HHOA 3VDCA 5DD5L 2MHAA 2GK0A 3QAZC 4N1HB 2Q7NA 3UCRA 4K9EC 5GGRY 2PCPB 4AH2B 1BWMA 2LU4A 1FYTB 3BGFB 5KVMC 3O4LA 1I9RL 3QQ4A 5F96H 3X12B 3ILPA 3BKJL 4LPVA 1T1WB 1A6AB 3RWJB 1R3KA 2P46B 4ZNCD 2FH8A 4DQOL 4QNPE 4RFOH 2VMFA 3P4NA 5GS2H 1PQZB 3T0EA 2YEZB 5IUSA 4ZPTA 4R90H 3BP6A 2EZ0C 4G6KL 4U1IB 2Y5TA 5TE7H 5C92A 4GAGL 3MRMA 1BEYL 2DLGA 3QUZA 4YBHA 4WV1C 3NCJH 5C3LD 5FF6A 1HNGA 4YPGA 5LGJB 3NFNA 3IVKA 2H8PA 4XPHH 3B2VL 1U8OB 4AIXA 1EBPA 4RAUA 3ZL4H 5C0EB 1FSKC 4GSDH 2D7OA 3FQRB 4N1CA 1AGEA 1XZ0B 5EN2B 4OZGB 5KW9L 1FLRL 5DMIL 1KIRA 3MV7D 3MLSH 3MJ8A 2X41A 4AY0A 1X5LA 3FOMB 2WBJB 2BVPA 4JHAH 1TZHA 5C0DB 1NCUA 2ZSWA 5DQDH 5JZ7C 5GRYA 2Y72A 5GS0C 43CAB 5E94B 4JR9L 4FFZL 3WDHA 5F7NC 3BX7C 1JPST 1K3ZA 5D71L 1CBVH 1MCCA 1BFOA 2J1KA 5DQJA 5KS9A 5CJOL 2F8XC 3MRFA 4MJ4A 3D1MC 3HI1B 4KTYA 4ONHB 1TVHB 1MHCB 5DHVB 4UDTB 5F6IC 1V7NH 1IM3B 1T5XB 3QEUA 4K7FA 1DCLA 4ONOA 1C16A 1BBJA 3KPRE 1OAXL 3DX9B 5I9QB 5CIPB 3VXUE 2VQUA 4R9HA 2WBKA 3OKDA 3SE3C 4MZ3A 1C7SA 1UGNA 1MFCH 4IOIB 4PJ7A 4OB5L 3MBXL 3QG6B 4HAFA 1AHWC 3A6BH 3CK0H 3I9GH 4OIIL 1PKQA 2NY6C 2VN4A 2ZUQB 3EAKA 3JWNC 2DL9A 1TJIL 3NGBC 1ZOXA 3VGAC 1PG7H 5HI5C 3MJ7B 4KI5E 4FN0A 4HH9B 1CR9H 3HC3L 2MCPL 2N56A 4POZC 5EUKB 2PYEB 5ACZA 3VFNB 3H9ZA 1NC2A 4I2XE 4XMLH 5E2UH 5IBTL 1DANT 2PR4L 5EZJA 2EYSA 2DJ4A 4UINH 3O8XA 2W0FB 5TF0A 1CL7L 4U6HA 1U8KB 3WFBL 5FOBB 2DLTA 1WUNT 3HS0A 1T7WA 4U0QB 5IHLB 3BQUA 2DMCA 2A1WL 2AJUL 4TOYL 1C5CH 3SCMA 1R3IH 5CAYB 3REWB 4M1CD 1K4CB 1CGSH 3TYGL 1A7OL 1JNHA 3G5XA 1KB5A 3MLVH 1XIWB 2EDFA 1T2QH 2P1YA 3DUSB 2BNRB 1UA6L 3PF2A 2X6MA 4G8FA 1SEQL 3C5JA 5FFLA 3CXHJ 1BQHB 5GGRA 4FFWC 4J3TA 4K71C 2R2CA 3MSPA 3VRLF 3VI4F 3E1F1 4F9PA 3BZFB 5E95B 3BKCL 1I8IA 1N6UA 3MLUL 1SEBA 3QFDA 4OCSL 1QEWB 3V0AC 3BHBB 2HTLD 3B9AA 5IK3B 1CLCA 1DL7L 4XCNB 3X3FL 3NZHL 4Y4HB 1G9NH 4KAQL 4FABL 1KPUA 4HS3A 3WFHA 2NPLX 3FQWB 1AKJA 2VO5A 4JQIH 4UIMA 3MROB 3QQNA 4UT6L 5DJAA 1XH3A 4H1LB 2R0WH 1OD9A 4AM0B 4K8RL 1XF1A 4QRRE 5JDJA 3KNBB 3GEWB 4PD4J 4XMKL 2VAAB 1CVRA 2DTMH 3UJJL 3MA7B 4K23H 4UB0H 4W68A 4XWOC 5I19L 1FYTD 1L7IH 3HI5H 1I9EA 4H88L 4OTXL 2LTQC 4LAQL 3CPLA 4U6XA 4LHJB 3ZTJG 1YDPA 3BWUC 5DD0H 1DQTA 3SJVA 3FN9A 1A6ZB 3FAXA 1QA9B 1KJVB 2WNGA 4FQQB 2XZZA 1YY9D 5CEYA 1N26A 3GIZH 1X5GA 3LKQB 4ZFZB 4LPWA 5FYLE 4E0RA 4C58B 2GFBB 5CCKH 2ZG1A 2HLFC 3MLXH 4GXUN 3C5ZA 5I76B 1PEZA 4MNGB 3D25B 3OF6D 5F96L 1M7IA 4LBEA 3LPFA 2ZUTA 1KIPA 3T0EC 1ZT1B 1VSCA 3BE1H 4RFOL 1ZANH 3GMNA 3O3BB 3JV6B 4APQB 5EOCJ 5IGXL 4R90L 4ZD3L 2YPVH 2Z92B 3LKOB 3TJEH 2XZCH 2WZPD 4M43H 1RSFA 4XNZC 4J2XA 3BZ4A 5TE7L 3ZE2E 4UNTA 3QEQB 3T0WA 5DS8A 3NCJL 3QISA 5JORA 1DR9A 1X3DA 4XPHL 2WBJD 4RWYH 2X4PA 4LCWE 3JWOC 2C1OA 3ZL4L 4WFHE 2CLRB 1T0PB 1XF4A 2P8MB 1FG2A 3DI2B 3U9UB 3BH8A 3BRFA 1DVFB 1UKTA 4NQUA 1VKXB 4JY5L 3P0YH 3Q1SL 2BZDA 2LU7A 5F9JA 1S9YA 3B8YA 3LQZA 5DC0A 3IFOB 5AG9A 3FQNA 1FL3A 4LSRH 3QJFA 1JGLH 4I5BA 2A6JB 4JO2L 5HTSA 3BESR 2Y7QA 4BH8B 1XGYL 3KWWA 1QPXA 4NQVB 3FO2B 1V3LA 1GGTA 4NBXB 1CBVL 2B0SL 1Z6JT 2EXYD 1HK6A 3C87A 3ULVE 3BRGC 3DTXA 1KTDA 4G6MH 2WAHA 3H9HB 1V7NL 5JHLL 3QUMH 5D1ZA 5J13C 4D0CB 1A7QL 3VFVA 2F5BL 5I66B 3ULSA 3O11A 4ORGB 4YZFE 5HVHC 3RKPA 4HX1B 3GNML 3MRPA 4JZJA 1INDL 2YC1B 2G5BA 5FYKH 2D31A 3HZMA 2YPKB 4PYHA 3OXSA 1MFCL 1FNSH 1E4JA 3T08A 2HVKA 2ZJSL 2AABL 4QXWA 3X13A 3KYNA 4AEIH 1EAPA 2NY3B 2PYED 1FN4A 4HKXA 3WS6A 2F8OA 3FFCE 3FQTA 3KLSA 5LQBH 3LS5H 3C5SA 4FG6D 1WJ3A 1A1NA 3PHQB 2J8UF 3BWAA 1HH9B 3DUUB 3KPRA 4JM2B 4CDGC 3LRSA 1HH6A 2ZG2A 3VXUA 2IFGA 3VGGA 3L7FB 3T2OA 4B41A 3WNPA 3BXNA 3QAZB 3O8XC 5E2TH 4ZSOE 3VG0H 1CT8A 5E2UL 3WFDH 5KJRH 3PIQA 5LWYH 1AY1L 3IRZA 2RFXB 4UINL 3HUJA 1XIWD 3HN3A 1I9JH 2ICWB 3QCTH 3BQUC 4X6CF 2RHEA 4MNHA 5ENWB 2BNRD 1EHAA 3SCMC 1F42A 5D70H 4MYWB 5J12C 5CSGA 2PF6A 1HEZA 3ULVH 5ADPH 1AGFA 1IGYA 1EH9A 4XPGH 2FSEB 3C2AL 4K8RC 4RFEB 5B21A 2V17H 4S1SH 3MLVL 1PZUB 3VFTB 2KUTA 4XPFH 1D5XA 2HN7B 1MJJA 4HQQL 4W4OC 4HUKB 5BZDA 3BDBA 2ESVB 4F9PC 3E3QC 4WV1B 4I2XA 4NYLB 1BWWA 4N90E 3V8CA 4KK5C 3CFKB 1Q9WB 1HSAA 4HLZH 3A0OA 1WV7T 3D2UB 3KPLB 1FSKB 5C70A 2V2TB 1QQDA 1NCWH 1C8PA 3Q5OA 1NANI 4AMKH 1MJ7H 1RVFH 2FX9H 3QFJE 1ZLVH 4HUUB 3LIZL 2V9RA 3CH1B 4P2YA 1B0RB 3FFDB 3CMGA 4XP4L 1OT2A 4X5XB 2GAZB 5IV2B 2DQTL 3ISWA 2GCYB 3MGOA 3F5WB 4OM0H 3RDTC 3HB3D 5L2KB 4I48B 1NAMH 5DRXA 5HHNA 3VJ6B 2Y23A 9CGTA 5HBBA 3HZYB 4K23L 5EO1B 4PGJA 1I4FA 1L7IL 3DURA 4MQ7B 4WJ5A 1IKNA 1AD9A 3PWPB 5GZOD 2A6KB 2PTTA 5F6IB 2C7UA 3RWIB 2OXHA 2DQJL 1MLCB 1YJDL 4PJBA 4ZOBA 4CW1B 4APQD 3C5ZC 5I0ZA 5FM4A 4X8JB 2BFVL 4NKDA 4YAQA 2K7PA 2OP4H 4LOUD 1CWVA 2YD6A 2ZP0T 2KZWA 3BJLA 2HMID 3N85H 3NCFB 1AHWB 3MLZH 2QR0B 3QEQD 1DTUA 4YHKL 5LGHL 2NY6B 2CO7B 3WHE0 5JNYB 2UVEA 4FQIH 1BQSA 2AJ3B 3T3ME 3BZEB 3NGBB 2YPVL 2XZCL 3STLA 4L8DB 4YXKH 3VGAB 4Q9RH 1VFMA 1S9VA 5EC2A 4GO6B 1DVFD 3KG5A 5DJ2A 2A6IA 1TJGL 3K80A 1ULVA 1PD6A 4AQOA 2ZCKH 4E5XA 3X11B 3QUYB 5I16B 5E00A 3P9MA 4PG2A 4OAWB 3EYFA 5L8LB 5MI0C 1ZHNA 5EULV 2EDJA 1CDJA 5D5ME 1S7TA 3CFJA 3RI5K 4KKAC 5F89B 3GBML 1KCVL 5IEKA 3P0YL 2H9GB 3TBTB 4WTZG 1ZGLP 4Z7VF 4LSRL 5IESL 1I75A 1MWAA 1XEDA 1JGLL 4ZUSA 5DR5L 4S2SB 3VGHA 4Y8AA 1J87A 3RL2A 4KK8C 3MRJB 4MVBC 1AH1A 5FYLL 2EDWA 2PXYA 2QSCL 3TP4A 4LCWA 4K71B 5D1ZC 4O9HH 3BP5B 1JCKA 4JAMB 5DRWA 4F7EB 4M6AA 3PWJB 3S36X 4HJ0D 1BOGB 3QUML 1DLHB 2C4FU 2NZ9C 2NY3D 3L1OH 2PTVA 5C0FA 1FDLL 1FGNL 3R06A 1JNJA 1I3GL 4L4JA 2DI9A 2ADJA 4JFDA 4CVZA 4PJIB 1B9ZA 3QDME 2YPLB 4KK9D 2NW3A 5FIEA 3VMPA 4JM2D 1MWAL 1ORQB 4K3DH 5C0CA 2X1WL 4ZXBA 1X5FA 2XA3A 4P2RB 5FK9B 1PBYA 2YD9A 4LSTH 4EKXA 5T1LB 3RI5F 1FCCA 3E2HC 4QXTA 1N2RB 3LS5L 5HHOB 2D9QB 3IETA 2LTQB 1CFSA 1LO4H 2MHAB 2QSVA 4GRWB 3MV01 4LGSB 4M48H 1UWXH 3TO2A 2BVYA 2GK0B 3EZ8A 1Q9LA 3QJHA 4I13B 5FV2A 4ZQKB 1MFBH 3BN9D 4QHKI 3H0TB 3O4LB 3QQ4B 2D03L 1W8OA 1P6FA 2HAZA 2EZ0D 5D7JA 1I1AC 3KYMB 5BQ7A 4F7PA 3CFEA 3N1MC 4P3WA 1R3KB 4EQ3A 1EO7A 2ESVD 5D70L 3FFCA 3P4NB 5DD6A 3T0EB 5HGBA 4ZPTB 1RV6X 4KI5C 3BP6B 4GFTB 5ADPL 3ULVL 1UWGH 2E9WA 5TDPB 4DAGH 4F58H 2FBJH 1KGCE 3D2UD 3RVTC 1Z3GL 2V17L 4S1SL 5DLML 3QUZB 3U79A 4UUJA 4XNZB 3WJJC 5I1GH 2ICES 5FF6B 4YPGB 3NFNB 3IVKB 4RMQA 5FDWA 4ZSOA 2CDFA 4RX4A 1JPGA 4RAUB 3GJFH 5K9QI 4G7YH 5I15L 5TFSH 1X4YA 4V2BA 2DM7A 1QSFE 4RGMB 5JZ7D 5D7IE 5FCSH 3SGEH 5L2KD 1AGEB 1AC0A 5GS0D 1CLOH 4P9HL 5A2FA 1RVFL 4GG6E 3Q2CA 2FX9L 5KANG 1KIRB 3MJ8B 5HYSA 2BVPB 1N4XL 1V5JA 1B4JH 2ZSWB 3R8BB 1N5AB 3PWPD 4L4TE 1D6VL 5E6YA 3EO9H 2Z4QA 1AJ7L 2Q1EA 4OM0L 3J7HA 1BJ1J 5HSFA 1BFOB 5KS9B 4ELMF 2OS7A 3MRFB 4LIQH 3DYOA 3U82B 3QRGL 4K7FB 1MRCH 5IMKA 5CEXA 1C16B 2YOCA 4Y1AE 2YBRA 5J13B 3B9DA 1IAKA 3QFJA 2NY6D 2ZUWA 3OKDB 3RVUC 2E7HA 2IPKB 5HVHB 4FQXC 4HUNB 1TIUA 2FHFA 4OD2A 4QHMA 2GUOA 4PJ7B 1FL6A 1I1CA 3F7QA 3IDMB 4FQPA 5HI5D 2FEEL 3SDAA 1PX3A 1QSZA 4Z7WE 1TTUA 1MAMH 1IFHH 5DC9B 3EYUH 3MYJA 3NH7H 3L5JA 4POZD 3MJGX 1GYAA 5F9WC 4HUMB 4OZHE 3IDXH 4LDEB 1B88A 1CGYA 2CMRL 3QUYD 3HR6A 2AQ2A 4YXKL 3L3GA 2YUZA 1Q0YH 5ACZB 1QSVA 1JNNH 2Z9TA 4JRXE 2VQ1A 4R7NA 2VLKE 5EZJB 2EYSB 1OCWH 4LNRA 3O8XB 1KJ3L 4PG2C 4LHQB 4X6DA 1TCMA 5HDBF 3T1WA 1NPUA 3PP3K 5ICYB 3BQUB 4NQDE 2F58H 2F54A 2M1KA 2OMNA 3SCMB 1DQQA 1J10A 5IMMB 3BFOA 1AFVL 4KJPC 4FFWD 5DF0A 2I07A 1RY7B 4GRLA 4OLVH 5J12B 1JNHB 3G5XB 5C09E 2EDRA 1KB5B 4MWFA 1F4HA 2AXHA 3G9AB 3WE6A 1NC4A 4QHUA 4OIAA 4G8FB 3C5JB 2PXYC 5GGRB 4GKZA 4PY8I 3W9EA 3MV9E 2Q8AH 2R23A 1CGXA 4JM4H 4O9HL 3QFDB 3VRIA 1A6UH 4HBCH 1NCCH 2YPLD 1KNOA 3BPLC 3JTTA 1B6DA 1K85A 2N7BA 3GSRA 4YWGH 1FNLA 2R8SH 2DQEH 2EE2A 2P47B 4P2RD 3L1OL 3HC4H 3QQ3A 4HS3B 5D5MA 1B90A 2Z35A 3Q6GL 1YZZA 3PGFL 3WFHB 1K6QH 3SGDI 1AKJB 2A9MH 4KVNL 3SE9H 5T1LD 1U8QA 3MFGB 1TZIA 1YEFL 4XWOD 5IW6A 4LCIH 5DJAB 3RHWK 5HHOD 4ZXBC 3VD7A 4ACPA 4DGIL 3CDCA 1G0DA 4Q9CA 4UT9L 4PJHF 3O45A 3GO1L 3VXQA 2CR3A 2PETA 3N1PC 2OK0H 2GJ6B 4K3GA 3RDTB 3VMNA 3O4LD 1JMZA 4UILL 4FQJL 3CPLB 4LSTL 2AK4A 2ID5A 4U6XB 4WFFE 1NKOA 1YDPB 1P4LA 2HLFD 3L5HA 3SJVB 4GW5A 3KJ6H 3T0ED 3RVWC 1OSPH 5CEZD 4E0RB 1AP2B 2VXTH 1ZMYA 3C5ZB 3QDMA 3GJFA 1CGWA 1M7IB 4LBEB 1JRHL 4JPIA 1KIPB 1KPRA 1T80A 1OGAE 4O2FA 1T0NA 3QXDB 5JOFA 3GMNB 1V8HA 4WY7L 1JZ4A 5E1AB 4F58L 1DN2A 1UB5A 2X9YA 4MA3A 1YPZE 4ZUTB 5D2LA 1XF2A 3RHWF 3BZ4B 5DSCB 4GLRI 1JPTL 2GQHA 4NDMA 2BHUA 3PJSB 2VRAA 1VDGA 2DAVA 5ITFA 1YYLH 5JORB 2D7NA 4NGHH 3WFEH 4AL8H 2C1OB 4YR6B 3VFSA 1IEAA 5FUOL 1ZAGA 2J5LC 4G7YL 4KDVA 1XF4B 1FG2B 4S1DC 1R0AL 3BH8B 4ONGH 4YHIA 3HNVL 3TBVA 4JFZH 3LH2H 4H8WH 5MI0B 3PXJA 4QF1B 4HK0A 5F9JB 1S9YB 3LQZB 3FQNB 1FL3B 5SX4H 3TBSA 3KYOA 2JF1A 4I5BB 4ODBD 3KWWB 4N5EC 5FM5O 3O6LH 3MNWB 4FS0A 5JQ6L 1FAKT 2VUYA 2CUMA 5TQ0H 4X4XA 1Q38A 4F7TA 5TPWH 4WU7B 2P5EE 3L5WA 1KTDB 2DQIL 2HJKA 4WTXA 3MXWH 5D1ZB 3WEXA 1BD2E 1QSFA 4OGZA 1KF9B 3VFVB 1RUAH 2CO6B 3ULSB 5E8NA 3O11B 2BX5A 3OJ2C 3MRPB 4X4YA 3UYRH 2EKSA 2R0ZH 4L1DA 3HZMB 3OXSB 4R4FH 2X4OA 1HKLL 2EDBA 3VE0B 3NPZB 4L4TA 3ZKXC 2X2YA 2HVKB 1SBBA 4I3SH 2NY5H 3X13B 3KYNB 1EAPB 3GSUA 1W2KT 4HKXB 1JYWA 4FMKA 3FQTB 3VRJB 3ZYZA 1OW0A 1RZJC 1ES0A 3BSZH 5J0BA 3O8XD 3IDXL 3D5OF 5JXEA 1UC6A 3C5SB 2GITA 3ARBC 4XPAH 3S8WA 2YRPA 1Q9OA 5JUEH 2ARJA 3PDGA 3BWAB 5CILL 3E2HB 3KPRB 5F70A 3BQUD 1BAFH 1HH6B 4KUCD 5BJTA 4HJGA 3VXUB 4YX2H 4PV8A 5E5RB 3SCMD 3BXNB 4R0LA 1WC7A 3WKML 1CT8B 1YEJH 1IE5A 1QSEE 3HUJB 4FQCL 5B8CA 5GIRA 4GJTB 4FQHA 4K8RD 5DJ0A 4MNHB 1RUKL 2EDQA 1CN4A 1I1AB 1HINH 3ZLQC 4BSVA 3WUWG 1IL1A 4GRLC 2LVEA 1HEZB 3GIVA 1AGFB 4OZGF 5E2JA 4OZHA 1YEGL 2VXUL 3LN4A 1U2CA 3QNYA 4ZO7A 3BJ91 1IC1A 2IH3A 3GFUA 1D5XB 1MJJB 4CJ1A 2HLAA 1S7SA 1KN2H 5BZDB 3BYTA 4CKVX 3P3YA 1AKJD 4I2XB 1H3GA 2KZ1B 4JRXA 4PREA 2HH0L 1QLRB 3WNLA 4HWBH 5DMGC 1NEZA 1HSAB 5F9AC 2AJSH 1I3RA 1T21A 4LMQE 3ZT6A 1NCCL 4ODVH 3ELAT 4NOBA 4NQDA 4WDIA 4U6TA 4YWGL 1WWBX 2GJ6D 3WXVH 2DQEL 3QIBA 2YD2A 2R8SL 3RDTD 1U41A 2A9ML 1VFAA 1OM3H 1NCAH 4ZUVA 1IGMH 5DJDA 3I75B 2B7DT 3SJVD 3H42H 1YNKL 1NBYA 4CADA 5DRXB 5EORH 4U1GB 5HHNB 4WI9A 4JFXA 1HZHL 1RUMH 4FMFA 3L7EA 1I4FB 3DURB 2VLLA 3VFOA 4PJXB 4WJ5B 3OGCB 3C5ZD 4NJ9H 5IT2L 1TETH 3ULUH 1W72H 2PTTB 2C7UB 2FB4L 3O2DA 5F7KC 3UJIH 2WWMC 3KPQA 4PJBB 2ENYA 4NM4H 1OSPL 5CJ8A 2W38A 4PGDA 4NKDB 3KPSE 2DQCH 1IARB 2VXTL 4ZS7H 3DXAD 3LQMA 3INUH 1BFSA 4P2QA 5JOPE 4QO1A 1PSKH 4RIRB 5K9JL 5F9WB 3STLB 2ZOLA 3AROA 3O0RH 3O2DL 2O61A 2JK5A 2VKXA 1S9VB 5EC2B 2GIYA 4P3DA 5DFTA 1UACL 5DJ2B 2A6IB 3OKLB 1JYNA 5I1IH 3NA9H 4P99A 4WW2A 4NGHL 4E5XB 3L3JB 4KKBC 3P9MB 3LN5B 4HIIA 4LFHG 3SBWA 3EYFB 1WBZA 1ZHNB 3QQ9C 4NT6A 3LMJH 4C59B 1S7TB 3CFJB 4KK8D 2XY2A 3LH2L 4MVBD 2WP3O 2XFXB 5IEKB 1WBYB 3NFPA 4PLJC 3BAEL 4K94C 3VRLE 5D1ZD 5ALBH 1ODAA 1J5OH 1YPZA 4QRTA 3VI4E 5E1HB 5C0RH 1FFQA 1MWAB 4ZUSB 2V7HA 5IFJA 2AGJL 3RU8H 2H45A 3RL2B 1MI5B 3EYOA 3ZKNC 2NZ9D 5C2UB 3P4MA 2PXYB 4XVSL 3O6LL 4NUJB 4LCWB 3FCTB 1KCUL 2BERA 4I18A 5DRWB 5TQ0L 2WWKO 1S9XA 5I1LA 4D0BB 5TPWL 1FRGH 4YFLI 3U6RA 1MPAH 5FGCE 2UZYB 1RZFH 2DKMA 1E4XH 4NWUH 5DEGA 3ZKQD 4CL7A 3U9PL 2VL5A 5C0FB 3UYRL 1GVIA 3R06B 5CP3H 2CRIA 5CBAA 4YIQA 1BFTA 2ADJB 3TPUA 4JFDB 5GRZA 3S35X 2NLJA 4CVZB 5DEZA 1ZHKB 1CL7I 3C8DA 4NO2A 1NGYA 3RNQA 2NW3B 3KPRD 3B5GA 5C0CB 1I9IL 4I3SL 4ZXBB 3VXUD 1WT5A 5AG8A 5BO1H 4X5LA 1OW0C 1G7LA 2VDLL 4LLMB 2DDQL 4BZ2H 4OCWH 5JXEC 5DMJB 5C9KA 2B4CH 2DM2A 2P5EA 3BSZL 5JTWA 4L4VE 4QXTB 4D0DA 3PABA 3IETB 4YDKH 1CFSB 4Z0XA 3WN5A 5JUEL 1I1AD 3TO2B 1A7RH 4D9LL 1INQA 1Q9LB 3QJHB 4G6FB 4ODXA 5A1AA 3H3KA 2VQTA 3RKDC 4F33A 4F37K 4KI5D 4ZFFA 1VFUA 2R56H 1T04A 3HNTH 1ZS8A 1PX4A 3CFEB 5EG6C 4XP9L 1IC5H 2VZ1A 4NQEE 3RVTD 2EDOA 2A9NH 5F9OH 3FFCB 4BUHA 4PRBA 3V52H 5DD6B 3EDJA 1C1EH 4PRDA 5EH1A 4FFYH 3IAGC 4TTDC 3IGAA 3U0TB 3GSWA 4HGWA 1SVCP 4YHLH 1F00I 1T3FA 3MLWH 3SE8H 4UUJB 5FUZH 1ERNA 4K7PH 1JWUA 2VDMH 1P1ZA 1KT2A 1JPGB 1QSEA 4LKXA 4HWBL 1K8IA 4YHOH 2XV6B 4MCYB 1MY7A 2AJSL 3QIBC 1DEEA 1QO3A 4ODVL 2J5LB 5DI8A 1T1YB 5E24E 3H9SE 3WXVL 3HTLX 2H2SC 3RJDA 1Z0MA 5HYSB 4K7PY 4RFNC 4PV9B 1UKQA 1J0YA 3KPTA 1OM3L 2Y5EA 5GGQH 4JVUA 1P4IL 3OJVC 1NCAL 2DJUA 1JHLH 4YE4L 3RX8A 2VJXA 1NAKH 2Z4QB 3HFMH 1OAKH 2VB5A 2WLYA 5DZNA 5EORL 4MD4A 4EI5C 1UFUA 1FCGA 2CLVA 1HIML 4MD0A 3RVUD 2NY4C 2OI9C 2YA1A 4WI5A 1G6RH 4AZ8A 4NJ9L 4ERSH 3R8QA 5CEXB 5IMKB 5L8KB 4WUUA 3OJDB 1MCWW 3ROLA 1TETL 2E6JA 4OLXH 4OUUA 4JM2F 4WTZA 3QFJB 4Y16A 3TA3A 2FLRT 5AAWA 4OD1H 1FC2D 4OD2B 3KPOB 5T5FL 4QHMB 4PLNC 1AGBA 2GUOB 2J6EH 2ZPKH 3ALPA 1V05A 1FL6B 3AB0C 1UZ6F 2DQCL 4OFYA 4D3CH 1RU9L 4ZS7L 4UOW1 4UT7H 3VFGL 2DQGL 3EJJX 3LPWA 3MUZ1 1Q1JH 4TSBL 3INUL 3M8OH 3MYJB 4I3RH 1FFPA 2J8UE 1CE6A 1LDPH 1E27A 2N1KA 1FE8H 4PGZA 1NGQH 5IHBA 5AZEH 3V4PL 4JREC 3WNMA 3L3GB 3O0RL 5SWSA 3ARBB 4LLWA 3T3PF 2H32H 4PP1C 1RQ5A 4N8CH 4X6CE 4WW2C 2ZUUA 2VQ1B 3CZFA 2ICCA 3BN3B 1EJ6A 4R7NB 2R4SH 2EIZA 2WSKA 3KPSA 4LNRB 4KJPD 5B38G 4X6DB 4XAWH 3BT2L 3FQXA 1G1YA 1NFKA 2AEIT 3RPKA 1MI5D 2FJGA 2F54B 4IOSD 5IBUG 1DQQB 2PXYD 5KSBA 3LMJL 3TF7C 5IB4A 1FNEB 2HP4A 4MX7B 3R4DA 4LCWD 2I07B 4GRLB 1VFBA 3N9GL 4HXAL 4WFHD 4X7SL 3WE6B 2CUIA 4PJ5E 2FJFB 1NC4B 1NMAL 3DVGB 3EGSB 4QHUB 5DJXA 1D7FA 2BXZA 4OFDA 3I6KA 4FZEH 2WIIA 4PLOB 3DSNA 4GKZB 3NCEB 1MLBA 2HT2C 3W9EB 1ACYH 2BSRB 2Q76A 4JFDD 3QG7L 2R23B 1JZ2A 1KNOB 1QNZH 2Y6SC 5C0CD 3GSRB 1MIMH 4ZXBD 3H7BA 1MCJA 1RZFL 43C9A 2C9AA 3QQ3B 3E6FB 5D5MB 2Z35B 4L3AA 1HNFA 4JDZA 5IVOA 2O5ZH 4NNXB 1U8QB 1GXEA 2J8HA 5IW6B 4PJGF 3QHZL 4F7CA 1KB9J 1WT5C 5I1JH 5AUMA 5IB1A 4R4NC 5CUSL 1R5IA 3O45B 2FX8H 1Y6KR 4G6FD 4HK3J 3QYCA 3WFCH 2C3XA 5BO1L 2MQ3A 1ZHBA 4ZS6C 3ZYOA 1A64A 4BZ2L 1PKOA 1Q72L 5F6HI 4ENEC 5GRWA 3HG1E 3RVWD 4PB0L 4F57H 2AK4B 1M71B 3CXDH 3ZYJA 1DDHA 2DQHL 3C8KA 5DUBA 5I18H 4Q7DA 5FYJE 1DQML 1P4LB 1K5NA 3MFFA 1JHTA 4GW5B 3OKEA 3G9VA 5F7EH 4D9RD 5SX5H 4H25A 3FFCD 4HEPG 4ZUUA 5T3ZH 1DEDA 3LEVH 1P7HL 3NIDF 3RWHA 3QDMB 3HNTL 3OAZH 1N3NA 2Q6WA 5D7SH 1KTRL 4HGKC 4JPIB 1KPRB 1WTLA 3QA3A 4O2FB 3HLAA 1IRAY 5D8JH 2ARJQ 2A9NL 4X9FA 1T0NB 5F9OL 4U05A 1IEHA 5JOFB 5BMFL 3EIFA 3V52L 4RX4D 2ED7A 1IAIH 5C1MB 1C1EL 4Q74A 5JQHC 4L4VA 1UB5B 3IFLH 3CC5A 4MA3B 1NDGA 3MA9H 5D2LB 3LHPL 1AGCA 4EVNA 4NDMB 3WS3A 15C8H 3O6FA 4N1EA 4S1DD 5FUZL 5ITFB 4K7PL 3G5VA 1FVCA 2VDML 4Q6IA 4PIRF 3EYSH 4EI6A 3VFSB 2DJSA 2HT4C 4PJEF 3RL1A 3STZA 4YHOL 4TUJB 4GOSA 4NO3B 4JJHA 3K2UH 3IRPX 4P0DA 4Z7VE 4YHIB 4QRUA 3TBVB 1GOHA 4KHXL 4N5ED 5HGAA 4N90D 4BM7A 4HK0B 2BY0A 5JIKA 4PJAB 3MOBL 5FYJH 4YO0A 1KPVA 2A77H 3ZTNL 3TBSB 5TQ2H 1WAAF 5I8CA 3KYOB 4AEFA 4FP8L 2AJYH 5ACMA 1IC7L 3GSVB 3OQ3B 3HFML 3QFJD 4XVTH 2BVQA 5GSVA 1CDYA 2W65A 4RA0C 1HHGB 3B43A 4K3HA 4X4XB 4F7TB 4FXLA 4QOKE 3L5WB 3ZO0A 3OPZH 1AO7E 2HJKB 3O3EA 3WEXB 1QSFB 4M9OA 4NOFA 1WEJL 4ERSL 1CDCA 4YDJB 3EDKA 1A6TA 5GGSB 4Y16C 3TA3C 2KH2B 4M1GH 2H32A 3H9SA 2EKSB 1SQ2N 1XGPB 3TT1H 2PW2A 3T77B 4OZFH 2X4OB 1RIUH 4KGJA 2VKWA 2ZPKL 1ETZA 4L4TB 1C5DA 4XCFH 4D3CL 5I1EL 2GSIA 3ARBD 2DMBA 3LS4H 1E28A 1TMCB 1Q1JL 3FOLA 3GSUB 4GAYA 4LASH 3DVIA 4BQ9A 3M8OL 2VXSH 5IOPA 3T04D 5EBLB 4CU8A 1FVEA 2WQ8A 4ZO8A 4XTRD 1ES0B 4LEOA 2IAMA 1U8HB 2GITB 1IAMA 1Q9OB 2ARJB 4KRNA 5AZEL 4A2MA 5BJTB 4HJGB 3FO1A 4RSVA 4ODUA 2F54D 2HKFH 4PV8B 1BQHG 4R0LB 3U7YH 1UB6A 1WC7B 4GRLD 1SMOA 5F1KC 1SJVA 2R4SL 3V4UH 3UTTE 1NC4D 5CD3B 3IXTA 4FQHB 5DJ0B 3SOBH 4XAWL 5HHXL 4NWTL 4BSVB 4UNVA 1UJ3A 1IL1B 3MGTA 1CDIA 1HOCB 4O58H 2J8UA 3GIVB 3JTSA 3QHTC 4HIXL 1G7MA 3C60A 1VERA 3NPSC 3QWQB 1DUYA 5HPMA 5D4QA 4OI8A 5DMGD 5FCUH 1OF2A 2IH3B 1T7ZA 2HLAB 3D6GA 2RB8A 1UYWH 4X6CA 4FZEL 4H5SA 2XA8H 4JRXB 4PREB 5GHWL 3MXVH 5DD3H 2P8PA 5CZVL 5E08H 1NEZB 2V5YA 5F93C 2VZTA 2XN9A 1I3RB 4P3CL 1I3UA 3UZEA 2DIJA 3FB8A 3ARRA 4EOWH 4HAGA 3OTTA 3HCVB 5CFHA 4NC1E 2NW2A 2DI7A 3OAUH 3QIBB 3R0MA 4NCDA 3E6HA 4QHKJ 1VFAB 2AK4D 3FL7A 3MZGB 4ZUVB 5DJDB 3ZT7A 4ELME 4PJ5A 3WSQH 4RFNB 4PJ7F 2J3SA 2OBGA 3WXWL 5I1JL 1EUUA 1NGZA 1NBYB 4M4PA 4CADB 3VWKA 3P0VH 5IWLA 1OD7A 4L29A 3WFCL 4JFXB 4MSWA 3RGHA 4HGMA 2WWMD 4QXGL 4GQPH 3R1GH 3PL6A 1PEWA 3DROA 3VFOB 2VDKH 1SJEA 2XQYK 1CU4H 1UH4A 1ZLWH 2RBLA 3CXDL 4XH2A 3QDMD 2OR7A 1N0XH 2NY4B 2OI9B 1FZJA 5I18L 3JV4A 5CLTA 1ZT7B 3KPQB 3DRQA 4KDWA 4EDWH 2EICA 1AR2A 4PGDB 1D9KC 2JELH 3L3IB 1PGRB 3MRBA 3AB0B 2X4SA 4GH7B 4KRPC 5C08E 5D8JL 1QP1A 4Z0BL 4P2QB 5DJCA 2OSLA 2A2QT 4ZOCA 3MJ9H 5DUPL 5IB2A 2FH6A 4JO3H 1ZHLA 2ZOLB 4PRHD 3JWDH 3IFLL 2O61B 1JWSA 1L7TH 4KKBD 4J4PA 1NMCC 5F72S 4P3DB 4OSUH 1WCBA 4YBLB 4Q6IC 5E8OA 4JREB 4JY6A 2Q8BH 1KXVC 2EDKA 1G9NC 5HDBE 1GIGH 1HILA 4X6EB 3QQ9D 3D3VB 4WW2B 2XWTB 4O00A 3EYSL 4KTEL 1KGCD 4H0HB 3L3KB 4NJAH 3Q5TA 5ADOH 1NBVH 1GGYA 2DQDL 3ARVA 5EOQH 1SY6H 4PLJD 2VZOA 3NCYS 3ZHDA 4O2CA 1WBZB 1N64L 2F19H 4NT6B 4M02A 2R15A 2VC2H 1U9KA 3HI6L 3ZKND 4NPYB 4TRPH 3QI9A 3NFPB 5KG9A 3S88H 4X6BA 5FYJL 2A77L 1LQSR 1YPZB 2FEEI 4QRTB 4XBPA 3V6FB 5BV7L 4RCAA 1H3PH 2V7HB 3MV7E 5IFJB 4PJDB 4WW1A 3EYOB 2X44D 5F1IA 4XVTL 3P4MB 4NHCH 3UEZA 4N9GA 1EEQA 2JCCF 4UTBL 4YGAB 1BHGA 4I18B 2X5PA 1S9XB 5I1LB 1FL5A 1H5BC 3U6RB 3OB0K 3OPZL 4L4TD 4OCYL 1U58A 1TXKA 3TVMA 5DEGB 3D85A 4BZ1L 4BFEA 2VL5B 3AS0A 4CVWA 1U8LB 3F65A 4PJHE 4YIQB 3TT1L 5E4IA 4WWKC 3TPUB 1XGUA 5JXED 2NLJB 4FNLL 4XI5C 4NO2B 1NGYB 1BQLL 1F90L 3RNQB 3FKUS 3F7RA 4HDIA 1JK8A 1Z5LA 4N9OB 2BHYA 5F7MC 4LASL 2R69L 2X9WA 2O5YH 4GUPB 4JLRA 2VXSL 5ESQA 2L7UA 1MHPH 5BZWA 4QOKA 2P5EB 3HE7A 3RKDD 4D0DB 1AO7A 3PABB 3WN5B 1RJYA 5DYOA 5HXMA 3K81A 1INQB 4PRNA 1XFPA 2HKFL 4KKLD 4ODXB 4JPKL 4YDVA 3NTCL 4PY8J 3U7YL 1UQSA 4F33B 5INDA 1OP3H 4ZFFB 2W9EH 1ZS8B 4G80A 3RWDB 1UJ3C 2K9UA 1H15A 3BMWA 4TTDD 1S7QA 3SOBL 1H3UA 4X4ME 2M26A 2HJFA 4M03A 4PRBB 4JRXD 2Z91A 4O58L 3CZJA 5I30H 1E6OH 4R26L 2Y07H 3IGAB 3S97C 3V6ZA 5IW1A 2E7LC 1O7VA 3GSWB 4HGWB 2Z93A 4X7TA 4PG9A 2LAGB 3QIBD 5D6DA 3QDGA 1UYWL 5AYUH 2DBJA 1P1ZB 2NTFA 1KT2B 2XA8L 4RDQF 3MXVL 4LKXB 2H2SD 1K8IB 5E08L 1Z9SA 2AV7A 3UTTA 4NRZA 1DEEB 1B6UA 1QO3B 2YZ1A 3ESVF 5DI8B 4EOWL 1UZ8A 3N0PB 1J18A 2UYLA 4URTB 4M5ZH 1S8DA 3MUJA 3IKCA 3RPIA 1QFPA 1P2CA 3UJTH 2NY4D 1A3QA 2V7NA 4OD3L 2R1WA 3LN9A 5IWLC 1JRHI 3W2DL 3K46A 1AC6A 1XCQA 3PL6C 4UNUA 5I71C 4MD4B 3P0VL 2VR5A 2KKQA 1H9VA 2XZQL 1CF8H 4MD0B 1IQWH 3R1GL 2YSSA 4YHMH 4DKEL 3TCXA 1CLZL 5DC4B 4WUUB 5E2VH 3ROLB 1HYSC 1QVOB 4OV5B 1YQVH 2VZVA 1G7PA 2ZCLL 4P2QD 1T03H 4X83A 4UQ2B 5IFAL 4Y16B 3TA3B 1AGBB 4WFFD 4MB4A 4LLUA 5HHQA 1G1CA 4OZ4A 3HUJF 1JGUL 3CAFA 3KDMB 4M1DH 4U6VL 4RMUA 1J11A 1FFPB 4S10A 3K74B 4PP1D 1CE6B 3D3VD 5HYJA 4GW1A 1E27B 5H2BB 1NANH 2BVOA 1H0DA 4J4PC 5BV7C 4Z7UF 1L7TL 5SWSB 3VI3F 4OSUL 4EZMA 4U49A 4R7DA 2Q7YA 5FKPB 3CZFB 1GIGL 5JO5A 1GZQB 2EIZB 1SYSA 3QULA 3KPSB 2HKHL 2OXGA 3HPJA 4NJAL 3C8HA 3BP7A 1TZGL 1WFOA 4OGXL 1K4DA 1NBVL 3QWRD 4OZGE 1HHJA 3B3IB 3FQXB 4R6UA 3A6OA 2FJGB 5C08A 5HD8C 4HF5H 1CFQA 5KSBB 1S3KH 3RX7A 1EFXA 2XG5A 2NR6C 3NMEA 1KCRH 2HT2D 4X9GA 1EAJA 4OT1H 3NPSB 1ZLUK 1UKSA 5FKAB 5DJXB 5A2KH 1TVDA 3P2TA 1H3PL 2CH8A 3I6KB 2Y6SD 2WIIB 3GMMA 4PP2A 4RWHA 1MLBB 2QTEA 3H3PH 3H6JA 1I1FA 2Q76B 3KPNA 3T65A 3N1FC 2UZIH 2AEQH 3T4AA 5H8DA 1ZGLM 4PJXF 3H7BB 4LPYA 43C9B 3GK8H 4R4ND 1PVHA 1G7IA 4MAUH 4JDZB 3W9DA 4ZS6D 4PJBF 2P5ED 4HPOH 5EBGA 4F7CB 2W07A 4ENED 3A6CH 3OB8A 5KVGH 5E5UB 1JBJA 2Z31A 5AUMB 2NYYC 5IB1B 4R8WH 2BOCA 4JZNB 2IFFH 1R5IB 4O02L 2LABA 4XC1H 1C12A 4CJ0A 5ILTL 3HE7C 4M7KH 4JKWA 2BHZA 2PNDA 3NZ8A 1DDHB 3C8KB 4JDVA 3GSNA 5DUBB 2UVFA 4X5WA 3NABL 1U93A 1K5NB 3MFFB 1JHTB 1IC4H 3OKEB 5T3XD 4H25B 4Q6YA 5DT1H 4ZUUB 3MV11 4JGUA 4JPWL 4W6XB 1R5VA 3WIHH 1A7NL 2EYTA 1FIGH 4J7RA 3RWHB 1N3NB 1D9KB 2Q6WB 2W0LA 1GL4B 4MA7H 3PWVB 3QA3B 4TVPE 5DHVH 1RFDH 3QR2A 4KRPB 2IC2A 1EHLH 2H1PH 5CIPH 1ITCA 1I8KA 1PDKA 1TJHH 4KJYA 2BNRE 3T2NH 3GSNL 1E6OL 4L4VB 4LK4A 5I30L 3CC5B 2EXWD 3S37H 3UTZA 1NDGB 1KCLA 2HT4D 1S5HB 3V5HA 1AGCB 4EVNB 1WIUA 5HVFB 1MF2H 1OAUH 2JJUA 2XQBL 5E8EA 3WS3B 1NMCB 2CRYA 3G5VB 3OXRA 3G04A 1FVCB 4Q6IB 3AM8A 2ZNWA 4IJ3C 3ZDZF 1GGIH 4EI6B 2MCG1 3STZB 2G60H 2H6PA 1CCZA 2C3WA 4JHBA 2IBBA 4JFPA 4X4MA 2HFFA 4OF7A 1XAUA 3KLAA 4QRUB 4EDXA 3CVIL 1YQ2A 4YO0B 1KPVB 4R97C 3EHBC 3HE6C 4QXUL 5I8CB 4WUUD 3OHXA 5B38A 5I1KH 3UBXG 1KFAL 2BVQB 5GSVB 3U36A 2W65B 3ZE0F 3CFBA 1RZGA 1DQLL 4Y16D 5TH2A 3TA3D 1EHXA 1R3HA 3RA7H 1PJ9A 2I26N 4Y19E 1IQWL 1A6VL 4OFYD 2C5DC 3O3EB 4JG1H 3GMQA 5AEAA 1H5BB 1A6TB 1MAJA 5AYQA 1YQVL 3H9SB 5C9JA 4L8SA 5I1CL 1T03L 1U0QA 2PW2B 4MNGE 4ESKA 2OJZH 3ARDC 3SY0A 4IM8A 2WLZA 4WWKB 4RGNE 4PRPE 5DHYB 4CGTA 1XF3A 5GGTH 5SWSD 1G6VK 5SWQB 1WICA 4ORZC 3SKJH 2F74B 4GAYB 1XGTA 4XNYH 5IOPB 4KZDH 1FVEB 5DZLA 2X4UA 4FTVE 4LEOB 3KPSD 4MZ2A 5GGVH 1DBJH 5TE6H 1MRFL 1YEIH 3QEQE 3THMH 5IHZA 4JFYA 2GSGA 3KLHC 1BREA 4H1LH 5DTFA 4C83A 12E8H 5JOPD 3QEGH 1J0ZA 4CNIB 3P11H 1PFCA 1JV5A 3GRWH 3RWJA 1A6AA 3WIIH 5DD1H 5CSBA 2XQYG 1LEIA 4PJ8A 2OR8A 1C5BH 4WFGD 2YEZA 2YUXA 1UJ3B 3MGTB 4Y2DA 3P0GB 5F7YC 3RUGF 4HF5L 4DWHA 2J8UB 3QRFM 3C60B 3RWCB 1FZKA 1DUYB 1F13A 4XAKE 1B2WH 5HPMB 1LE5A 1MCWM 1OF2B 4OT1L 3FAWA 5J9PA 3ECBA 1P7QA 5DO2C 2GTWB 3HMWH 4X6CB 1F4AA 1ORSA 4H5SB 4YHNA 4JB9L 4TSCH 3MRHA 4JQXC 3VG9C 2P8PB 2AEQL 2XN9B 5D7LE 2BSTA 4OZGA 3FB8B 5D72H 5L7XH 4DKFH 2EC9T 1BMGA 2EH7L 1G84A 2WBJA 1QFHA 5DVNA 4MAYA 3E6HB 1JZ7A 4MAUL 1CZ8L 4JY4A 2AV1B 1FPTH 2Z31C 5E94A 4XWGH 3G6JF 3HZVA 5J8OA 4HPOL 3ZKMC 4QTHA 4N0CC 2XXMB 3A6CL 5DK3A 5KVGL 2R2EA 1IILE 5DRZA 1OAYL 1NGZB 1TTFA 4JPVH 5E2WL 4C56B 4L29B 4M6ML 1TVHA 2GT9A 1ZT4A 4MSWB 3PP4H 3PL6B 5I71B 4M9PA 3DROB 3DUHA 3TESA 1SJEB 4XH2B 5CIPA 1E6JL 2FR4B 1D9KD 1FZJB 3JV4B 2X05A 3X3GH 1TCRA 1MELA 1IC4L 1ZK9A 1UM4L 1RUQH 1UZ6E 1MJUL 4XCCL 3DRQB 4NNPL 2E7CA 3S96B 1LP9F 2V5TA 2CGRL 4KRPD 4DN3H 2B2XH 2XACC 5LVEA 1CXEA 4L4VD 2JB6A 3F6IA 2FATL 1FIGL 4GMSL 3K7UA 4Q9BA 3MRBB 2RGSA 4J8RA 4L8CB 5I1DA 3QO1B 2X4SB 4X6DF 4MA7L 3CLFH 2AKRA 5KVDH 3EFDH 3P4LA 1U6AL 5DJCB 3MJ7A 2OSLB 4GAFB 1ZVSA 3T3PE 1EHLL 4LEXL 3N1GC 5IB2B 3B9KC 1Z9OA 1TJHL 4XXCA 1D3CA 1ZHLB 3S37L 5JIHA 1A14H 4KK6C 5BV7B 1OAUL 3AM8C 4DK6A 1YYMH 4RDQG 3BMVA 1T0MA 3IJSA 3VW3H 3EJYC 3DETC 1SBSH 3DOSA 1M6OA 3L95A 5SV4A 3BKMH 2DKSA 5D2NA 1VESA 4B5EA 4KH2A 4O2CB 1JFQH 1DQDH 3BD5A 4FFVC 4HKBA 5CHNB 1QBMH 1XIWA 3GJEA 2BVUA 4F80A 4X6BB 1EVUA 2H26A 5L8JB 4XBPB 1BQHA 4YDLC 4K9EH 2DBLH 4WW1B 2Z8WC 3LZFL 5F1IB 3H9SD 4HV8B 5J6HA 1QEWA 4AT6B 3GB7A 2VDPH 3BHBA 4MMXC 3T0AA 3DV4A 1FL5B 5IK3A 4LMQI 4D94A 3QP3A 4WWKD 4ZNEE 4JG1L 1PG7W 2M2DA 5KVFL 4TVPL 4IRJC 4PJGE 5ITBL 4TQEL 3D85B 5EU4A 2DOCA 3LD8C 3CNKA 1F4WH 4KY1L 4GLRH 1XGUB 4ZDHA 1BBDL 5GGTL 3EOAA 4H20L 4HDIB 1Z5LB 1CI5A 3SKJL 1NKRA 5KZCB 4JLRB 5GZNC 5ESQB 1KCSL 2CK0H 4XNYL 4KZDL 1FV1A 5BZWB 4QOKB 4Y19A 3HE7B 1A6ZA 1M05A 1GOGA 5GGVL 4FQQA 2DYPA 1DBJL 1YEIL 1RJYB 4WGVB 5FM5M 3O2VH 3NIDE 3THML 5HVWA 5D2LF 5A2JH 1BGXH 4YDVB 4H8WC 5MP6H 1CQYA 3C60D 3D25A 5GISH 1ZEAH 4PJ8C 3P11L 3QIUA 5INDB 4F8TA 4ODTH 4G80B 5DD1L 2I9LA 4PRPA 4Y2DC 1S7QB 3SEPA 2HJFB 2C4XA 3LKOA 5GRXG 1BVZA 4AENA 4FTVA 3E8UH 3IAPA 4PJAF 2XN9D 1B2WL 3V6ZB 5IW1B 4X7TB 3VXSB 2Z93B 3QHFH 1MCOH 4PG9B 2IQ9L 3CIQA 1FNAA 2JJSC 3Q5YA 4PJEE 2QQNH 3QDHA 3QDGB 3HMWL 2NTFB 2YXFA 4LCCA 5F6HJ 2CLRA 5HI4C 1LDSA 5F44A 4IJ3B 2AV7B 4RMTA 1DBMH 4NRZB 4ODWA 3LVEA 5I74C 5KOVC 4MAYC 1UZ8B 3TH3T 4C56D 2ADFH 4DKFL 2UYLB 1WAAE 4PJIE 1S8DB 3PL6D 3RIAK 3RPIB 4FRWA 2ZNXA 2QQKH 1BJ8A 3DYMA 3SQOH 3K8LA 3TWCL 1FC1A 1P2CB 2XTLA 4BH8A 2V7NB 1OQOA 1F4YL 4P2RE 2R1WB 2WANA 4XRCA 3QH3A 3VXNA 2A6DB 3HE6B 1HYSD 25C8H 4FQLH 32C2A 2BP3A 4BFIA 5IF0A 5HHOE 1IZJA 1F45A 5D93B 2PKDA 5KANI 1A6PA 1L0XA 1SJXA 4ORGA 5D7LA 4HPYL 1X9QA 2YC1A 1S9KC 4IRZL 2VXQL 5FM8A 4E9LA 1G0YR 5DFWH 1SHMA 1G7PB 4DN4L 4NQXB 5ESVB 5T1DH 1FZMA 1HHIA 4DN3L 1A1MA 2YD5A 3JVGA 4IRSC 5IVNA 2MSPA 4ONFH 2QKIB 4LLUB 2HFGH 1YEEL 5HHQB 1CFNA 2WQRA 3ARDB 4OZ4B 2Y06H 4N8VB 3WL9A 4QRSA 4J4PD 5CEZE 2VDOL 5KVDL 4Y5VA 4X80H 3LAFA 3VH8G 5HYJB 4GW1B 5DD5H 4XXCC 5DJ6B 2EECA 4JM2A 5CGMA 2WINA 5LAXA 1QLFA 1F4XL 1H0DB 4DCQB 4LVNC 2H41A 4YH6A 2BY1A 3RRQA 2X89D 1I9RH 4R7DB 2Q7YB 1OVZA 2RFXA 1MCRA 1YECH 5HD8D 5JO5B 1JGVL 2FO1A 4WRLA 5ENWA 1SYSB 3QULB 5D2NC 2LU3A 4DQOH 4JVPA 3HMXH 3BP7B 1SBSL 4HC1H 1K4DB 1M7DA 3BKML 1ROWA 5EZOL 4MDJA 4LLVA 2HRLA 5C08B 3VWJA 4YHYC 4G6KH 3IDIA 1CFQB 1DQDL 1EFXB 1PG7X 1CIUA 4GRWH 4LHUA 1I7UA 4ODSH 1GHFL 4BQ6A 1BEYH 5EZLA 2ZUSA 4RISL 4WENB 5MERA 5FUCC 3P73A 3B9EA 3ZZ1A 5IQ7L 4WV1A 1MCQA 3D85D 2DBLL 4CMHC 1IEBA 4EXKA 2DL2A 2X4TA 3GMMB 4OJFL 3BIAX 1ZLSL 4I0PA 3D2UA 3KPNB 5DA4A 3T65B 1CLYL 3S35H 3QIWA 1GGBL 5HGDB 3T4AB 3VG9B 4LSQL 3OR6B 5KW9H 5CEZH 2XTJC 3FHAA 3CH1A 3BW9B 1T5WA 1MOEA 4PJ7E 1WITA 1UEMA 5KZCD 2Z8VC 1G7IB 5IV2A 1FIEA 3WV0A 4JR9H 4QOKD 5KOMC 3F5WA 3HE7D 2FCBA 2Z31B 5CJOH 2BOCB 1KV3A 3K4ZA 2IH1A 1C12B 3JWOH 4P5TA 5IFHH 2CK0L 1OAXH 2PUQT 3NZ8B 4MXVF 3GSNB 1X6LA 4X5WB 5SV3A 2WMPA 1U93B 1KYOK 3O2VL 4PJGA 1G9EA 4P49A 1KEGL 3D9AH 4OB5H 3QIUC 3SHSA 3BDYH 3MBXH 1R5VB 3ESUF 3CJJA 5MP6L 4N0FA 4OIIH 4M00A 3QPXL 4RGNC 4NBZB 5GS0L 3L9RB 3VXSD 3VGFA 1TJIH 5CZKA 4JCLA 5L2JA 5JNYA 2HWZH 3QDGD 2G75A 2ED8A 4W4NA 3HRPA 4BQCA 4L8DA 3HC3H 2MCPH 4WHDA 1JTPA 1I8KB 2PW1A 1GAFH 3E8UL 3UTZB 5FYKU 5D96C 3V5HB 3B9KB 8FABA 2AEPH 5E8EB 1EV2E 4NCC2 2APXA 4LCCC 3GI8L 1DN0A 2GJJA 3OXRB 4D9QD 4PJDF 3G04B 3WFBH 4ETYA 4HHAB 3U30C 1J1PH 4P46A 1CICA 5E9DB 3VXRE 4Y5YA 1EXUA 2A1WH 2AJUH 2OTPA 4PJFF 4JFPB 3EHBD 3HE6D 3TYGH 5F89A 3TN0C 3KLAB 2ADFL 4NRXB 4EDXB 3TPKA 3T0XA 5DURB 1XMWA 1OTUD 2DWDA 1AR1C 2EDHA 1GH7A 3SQOL 2X42A 5J57B 4S2SA 4NO0B 3D39A 3S98A 2GJ6E 2JCCE 2EEDA 5F71A 2A83A 3O3DA 2X9XA 4XP6L 4O2EA 5JLZA 5B38B 4PJEA 4YDLB 3KS0J 3U36B 4NNYA 25C8L 4FQLL 4PS4L 1RZGB 5TH2B 2EH8H 2L0DA 4H26A 1R3HB 1DL7H 1IAII 1RPQA 3X3FH 3NZHH 5DMYA 5IBUB 4FABH 5I75B 3ARDD 1WF5A 3GMQB 3MLYH 4LGRB 3S4SB 3CSGA 3Q6FA 1KB5H 2MQCA 5C9JB 1WAAA 3JVGC 4IRJB 4L8SB 5HYJD 1CTOA 4K8RH 4TNVF 3SY0B 1ORQA 3LD8B 4K3EH 4PR5A 4ONFL 3FRUB 2HFGL 3UJJH 1JVKA 1CTNA 4HKZB 3HMXA 3P77A 2Y06L 5I19H 4E41E 4Y5VC 5E7BA 4LAQH 1PW3A 1XGTB 5T1LA 4XHJC 5EFIA 1BOYA 4RMSA 3KLHD 4X80L 2X4UB 3DXAE 3O6KL 4MQSB 4JGMA 1A5FH 5JA8B 2Q3ZA 4CVXA 3EYVA 3QPQD 4ZQKA 5IHZB 2V2XA 4JFYB 1MCNA 3A67H 4M6NL 5C08D 2GSGB 3H0TA 2IADA 5DTFB 4C83B 2VABA 1EFXD 3I6LD 4M3KB 3KYMA 3C9NB 1RIVL 1JV5B 1YECL 5K33A 3AREA 1MCEA 1LEIB 4PJ8B 3HMXL 4J3VA 3VWJC 4HC1L 2QL1A 5ICXB 5CINL 4QYOA 5HYFA 1RK0A 5T1MA 5IGXH 1MNUL 4ZD3H 1E4KC 4Y2DB 4CBPA 5DO2D 5TDPA 4HWEH 4R96A 1QR1A 2DQUH 4ODHH 4MA1C 2X10A 2XKSA 4YHZH 1FZKB 3EOTL 4ODSL 4LSSH 5C6TH 1QPPA 1KOAA 4I77L 1LE5B 3V79C 6FABH 2ERJC 2ED9A 2CLZA 4LARH 5J9PB 3ECBB 1P7QB 3LRHA 1T1XB 4I0PC 3WLWC 1YUHA 1ORSB 4YHNB 1MCHA 3W11C 3VCLA 3MRHB 3QIWC 3GHBH 1GC1L 2YD8A 4L3EA 3S35L 3SE4A 2BSTB 2Z31D 3UC0H 2SEBB 1CK0H 4JY5H 1BZQK 1UCBH 4XZUB 1MCIA 3ZKMD 5CEZL 4N0CD 3Q1SH 2ITCA 4MAYB 1AXIB 1N5AA 4G7VH 4JY4B 4JO2H 4LGPB 3NAAH 2MPAL 1XGYH 3HZVB 3J8F7 3WHXA 5ELIA 4QTHB 4GG8A 2R2EB 5LJYH 2B0SH 5CP7A 5DRZB 1JZ6A 4P5TC 1P9MA 4FHBD 2GT9B 1ZT4B 1U95A 4J3XA 3L3DA 1GRWA 5JHLH 3JWOL 4W81A 5IFHL 1A7QH 2F5BH 3QDJE 1JYXA 1EFQA 1EBAA 4JGJA 3GNMH 1FAIL 2ADIB 4LLDA 1INDH 1TCRB 2IPKA 4PJ9A 1EIBA 3B2UC 2VDRL 5DGQA 5GS1A 5J6GA 2P7TA 2UZXB 3KVQA 3D9AL 3HUJE 4NFDA 3BDYL 1KELL 3IDMA 2ZJSH 2AABH 5E70A 4DGVH 2JB6B 3UBXA 3PHOA 4IRSB 5IJKA 2GY5A 1QUNA 3B9KD 4J8RB 4DVBA 1DBBL 3GBNL 5I1DB 4U1HB 3O4OC 4U2YA 3SO5A 2AKRB 2HWZL 4KK6D 4YPJA 2YA0A 3OGOE 1G9ML 1ZKAA 4X0KA 4Z7UE 1N8ZA 1ZVSB 5EO0A 5E9DD 5KSBF 1ZGLA 2EE6A 1GAFL 2OZ4A 3EJYD 3DETD 1FH5L 1A47A 1EGJA 4LVNB 4NQCB 2AEPL 1AY1H 4P46C 1CICC 5DURD 2X1OA 1OP5H 4Y5YC 4BELD 1T0MB 2OL3B 4FFVD 4Z7QF 3IJSB 4BKLB 1J1PL 5ICYA 4HMDA 3ZSTA 3V7MA 1M6OB 4NO0D 3L95B 2AP2A 5D2NB 4IHOA 1NUGA 5IVZA 4HFWB 5IMMA 4DUXA 5GJSL 3C2AH 4HKBB 1T83A 2QQQA 4YHYB 1HHKA 1RJZA 4HQQH 2VLJD 3GJEB 4CMMA 5HHME 1VA9A 2OZ4L 2H26B 3RTQC 1VEMA 1EGJL 4W4OA 5DEFB 1KJ2A 3C08H 4M5YL 3NN8A 4IRJD 4PJXE 5J6HB 4CMHB 3BDXA 2EH8L 3GB7B 5LBSH 3VXRA 3DV4B 5JIIA 5KTEH 3LIZH 3CX5J 4R4BA 4XP4H 3MLYL 4PJBE 4NRYA 1HSBA 3WD5L 1JZ5A 2XTJB 4OI9A 1KB5L 1MFAL 5EU4B 1FNGA 4KC3B 2DQTH 1YN6A 5GZND 4ZDHB 4K3EL 5I8OH 2GJ6A 2JCCA 4MMZC 3RDTA 1TLKA 3QB7C 3EOAB 3SKUD 2CKNA 2E9JA 4L8BA 2CKBA 1FV1B 3OKOA 2O26U 3RJQB 2EKJA 2DKUA 4K2UL 4LU5H 4Y19B 1M05B 1DUZA 2DYPB 4PJ8D 1A5FL 2BNQD 2DQJH 3I3BA 1MCPH 3KLDA 1YJDH 3V5KA 2FNBA 1BLNA 3A67L 4Y2DD 2BFVH 4RAVA 1CDBA 1AP2A 4M93B 3AREC 3K2MC 4WI7A 3P40A 1GC1C 3BO8A 2Q86B 1RULH 4I9WD 3QIUB 5EIIA 2ATPA 1E0OB 1NEZG 4YHKH 2I9LB 3DO3A 5LGHH 1Z2KA 4RGNB 4PRPB 3TT3L 1RZKL 1P7QD 1WCQA 3QXDA 1VPOH 4E41A 5C8JA 1KUMA 5IP4A 3P30L 5E1AA 4HWEL 3QEHA 2CKBL 4AENB 2DQUL 3S7GA 1QFWM 3QNXA 4FTVB 4ZUTA 3DXAA 4ODHL 3WNOA 2FX7H 5DSCA 4YHZL 3GMRA 4LSSL 5C6TL 3WMSA 3PJSA 5HI4D 5IR1B 1MI5E 4MB3A 2OTUB 5MEQA 3IJHA 1A02N 6FABL 2ZKHL 1TJGH 3ZDZE 4LARL 5H37G 4F8QA 4JO1H 5E7FA 5D96B 1FLTX 1FFNA 2Q3AA 4MAYD 4YR6A 1BJMA 4LCCB 4A6YA 3SE4C 3GHBL 3G6DH 1ADQA 1KTLA 1R3LA 2ZZUT 3U30B 3CFCH 1MJ8H 1WWWX 2HFTA 4ODWB 3UC0L 1CK0L 1BM3H 1UCBL 4O4YL 1K8DB 4QF1A 3BVNA 3GBMH 1KCVH 4JFDE 3RGVA 4DOHB 2QADC 2W0PA 4IMLA 5IESH 2AQ1A 3VGBA 4G7VL 2W59A 5DR5H 1YN7A 5C0CE 1CGUA 3ZE0E 3NAAL 3K1DA 4XRCB 5FYLH 1P9MC 1A9BA 4CU6A 1H8OA 3QH3B 2QSCH 3MNWA 3VXNB 1G9MC 5JDSB 32C2B 4WU7A 2D2OA 4A6YL 5IF0B 4BFIB 1ADQL 2Y1VA 3RY6A 2FD6L 3LSOB 4P2CG 2DIAA 4IRSD 4PJ9C 1W8NA 1MQKL 5D7LB 3V8OA 5HGGS 1PZ5A 1FDLH 5FHBH 1FGNH 5GS1C 35C8H 2N4IA 1I3GH 3VMOA 4TNWK 4LNVA 4JKKA 3PQYE 4WNQB 3LB6C 4WVRA 1FZMB 1HHIB 5GS3A 3VE0A 2BSSA 1A1MB 1MWAH 3GZKA 5JXAH 5IJKC 3RAJH 4HG4K 2CJUH 5ALCL 1ZWIA 5IKCA 4DGVL 2NY7L 1CFNB 4D9RE 3VRJA 1D5MA 3WL9B 4QRSB 5C71A 4NQCD 1A3LH 1DP0A 3K4DA 1VEOA 4Y5VB 1UH2A 1KSRA 1H3XA 3W0WB 5F21B 3WDJA 3QDJA 2WINB 3RP1A 5LAXB 1QLFB 4N68A 3KXFA 3PV7A 3UTPE 1CFBA 1X5KA 4ZTOH 4TVPD 2OTWA 4ZYKA 2ITDB 4OF3A 4HMEA 2D03H 4CU7A 3U0WL 1C7TA 1GGUA 5DXWA 5CSZA 4J3UA 3RUGE 1I1AA 4KXZH 4P4RA 1EX0A 5M7QA 1M7DB 1NDMA 1NGPL 4JE4B 1BFVL 3D69A 4U3XA 4MDJB 1T83C 4LLVB 3N1QC 3VWJB 3IDIB 3T8XA 1EO8H 4NM8L 4Z7UA 1Z3GH 4LHUB 3EOBA 3Q3GB 1I7UB 5DLMH 3DV6A 5EZLB 5MERB 3NIGF 3P73B 4MA1B 1OLLA 3MOQA 1IT9H 3BGAA 1TVBA 3WJJA 2ERJB 1D6EA 1QLRA 2XTJD 3C08L 1IEBB 4HZAA 5I15H 1IGCL 1II4E 2X4TB 4X99B 4KUZH 5F1SA 4I0PB 5E99L 3IJYB 2NY1C 5LBSL 3QIWB 4P9HH 4OCXL 3KS0H 5KTEL 1N4XH 3G6JE 5DUMH 1T5WB 4BH7A 5I8KL 5IW3A 3AFLA 2B1AL 1D6VH 2FECL 3I75A 2GKIA 4Y19D 2EDNA 1AJ7H 1YEKH 2VLME 2DYPD 1RZKC 5C7XL 3QO0A 1INEH 1J0HA 1MHHA 5I8OL 1PYWA 1F97A 2XY1A 4OCRH 2IH1B 1RZ8A 4PBWD 4QTIL 3KGRA 3WNNA 3GMLA 3QRGH 4PJXA 2C4FT 3OGCA 4P5TB 3PNWA 5JHDA 4U7SA 4KFZC 3QIUD 1QYGL 5BVJA 4JANA 5EC1A 4DZBA 4LU5L 1M7XA 3ARSA 2FGZA 2ZUYA 1LP9E 5KVEH 4RGND 4PRPD 3V95A 4F9LA 4YXLL 1MCPL 5A16B 4PJGB 3VDAA 4XB8A 4FQXA 4P5KA 2VWEC 2WUCL 4X6DE 4FTVD 4UV7L 3M1BA 4N0FB 1RULL 2COQA 3S3JA 2F54E 5TGBB 3EBAA 5L2JB 2EIEA 2F53E 4ZOAA 1JF5A 1U91B 1VPOL 1U8IA 2CMRH 2G75B 5K59F 4RIRA 2XT1B 1LE9B 4QGTA 2EDEA 1EHNA 2BC4B 1NCBH 2DD8H 2PW1B 4M62L 2FX7L 3H3BC 4X4ZA 4JO4L 3I84A 3OKLA 8FABB 4Q2ZA 3WO4C 4JO1L 3MREA 1DN0B 1KJ3H 3L3JA 2YZ8A 4U6YA 3TN0D 1X5AA 5J89A 5GPRA 2ZUVA 1LGVA 3LN5A 2DRUA 4P46B 1CICB 4XAKD 3G6DL 3CU7A 1QBBA 4Y5YB 1EXUB 2VDNL 5I1HH 1AR1D 3SO3C 3VH8A 3CFCL 1MJ8L 1AFVH 1MCDA 1CG9B 4RQQA 3RGVC 2BSED 1BM3L 5ID0B 2VDQH 2XFXA 1WBYA 1RZJH 2HA1A 3ARQA 4MJ2A 1F11A 1LO5A 1N7MH 2DWDB 5D7LD 1MI5A 3D39B 4HBQA 1P4BH 2A83B 3O3DB 3RTQB 4O2EB 5JLZB 4NUJA 4J3WA 4PJEB 5EB9A 3FCTA 2AK4E 4LCUA 4NNYB 4D0BA 1YEHL 3RY6C 2APTA 1JZ8A 1U3JA 4H26B 5ESAA 4S1QH 1YMME 4N0YL 4QKXB 4OLUL 3FT2A 3Q6GH 1JGEA 4AEEA 3PGFH 1UXWA 1FNHA 1YEDA 5FHBL 4KVNH 3S34L 35C8L 3Q6FB 1T7YA 1YEFH 5T1KA 4ELKA 3PWUA 4LRNH 4X7FC 3W0WD 4EUPA 4DGIH 5JMOC 1ZHKA 1UENA 4XHJD 2V9TA 1BPVA 5ACLA 4UT9H 5JXAL 3SKNB 3RAJL 2CJUL 3GO1H 1A6WH 4JQVC 4PR5B 4XCEA 4XNMB 2DQFA 2Y25A 1NCNA 4LLMA 3P77B 2YUWA 1HXYB 4UILH 4FQJH 5K93A 1A3LL 5EFIB 3ILQC 1UWXK 1UM5H 5D2LE 4L9DA 3RVVC 5IQ9A 3FTGA 3MR9A 1O7SA 3V6OE 3EYVB 4CVXB 1J8HE 2V2XB 3VWJD 4GS7C 4ZTOL 1VADA 2IADB 3PQYA 2LAAA 2VABB 4LHUD 2OMBA 4PRHE 2CR6A 1JRHH 1CIDA 3AREB 2PYFA 5B22A 3JXAA 1DFBL 4EXPX 4QYOB 5BOZG 4WY7H 1RK0B 5T1MB 4EN3A 3OAYH 5HDQL 4PJAE 3PWNA 4R96B 3BI9X 2FWOA 1QR1B 1EO8L 4I0PD 5GGUB 3WLWD 3U0TA 4KPHL 4UIKL 3SN6N 1JPTH 2RIKA 4NP4H 3W11D 1VGKA 3QIWD 3MRDA 2CLZB 2NTSP 1FO0A 3NCBB 1GGCH 2R1XA 1FORL 1IT9L 3CXHK 3VD9A 2WK2A 1YUHB 4G9DB 5FUOH 1SM3L 3VCLB 1NUDA 2ARWA 4KUZL 4LPUA 1X5IA 4MCYA 3O9WC 1R0AH 4LQ1A 4L3EB 3RUGA 1T1YA 3ARXA 4WCYL 3HNVH 3MV8B 3RNKA 2GY7B 5H94A 2B1HL 2ITCB 4PV9A 5DUML 1U36A 2XIDA 4OM1H 4OFKA 4P5TD 4WHTA 3WJLC 1T20B 3ZMRA 4Z78A 2N7AA 5B39A 1MEXH 4TN9A 1RIHH 2QADB 3WHXB 4GXVL 1YEKL 4XCYA 4I8DA 4GG8B 4TYUA 4XBEH 5JQ6H 5CP7B 1INEL 1EEUA 5C0GB 5HYIA 4PD4K 2XRAL 5CS7A 4OCRL 1L6XA 2DQIH 4NO5A 1U95B 2CDGA 3WIFB 3B2UD 3L3DB 4NSKA 3OJDA 4F9LC 3QUKA 5KVEL 4LLDB 4PJ9B 1NLDH 3ALXA 2IBZX 5ECJE 3G6JA 3KPOA 5GS1B 1HKLH 2P7TB 5J6GB 2HRPL 3HAEA 4OBSA 5L9DL 1IJ9A 1QRNE 3ARFA 2HFEA 3UBXB 3PHOB 5FEBA 3GI9L 4G6AC 4P57B 4DVBB 3BGFC 4ZFOA 1ZA3A 4OUOA 4X0KB 4TSAL 1N8ZB 4HUWB 4P46D 4WI3A 5CILH 1CICD 2H2PC 5EO0B 1ZGLB 4P4KA 4XNQA 3ARBA 1NCBL 2DD8L 5T5NF 1LP9A 3B83A 1ND0A 4Z18A 3WKMH 4FXGB 4KQ3L 4HCRH 2X4RA 3HZKA 4HWZA 4FQCH 3MCLL 1F2QA 3VXME 1RUKH 5FGBA 3OR7A 3D39D 1LO3L 2G9HA 4IHOB 5GGSY 5I1HL 1ACZA 3RTQD 5HHVL 5IVZB 4ZFOL 2F53A 3F7YA 1FNEA 1YEGH 4MX7A 2VXUH 3MNZA 2VDQL 1RZJL 1HHKB 1RJZB 2FJFA 3DVGA 1RUPL 3EGSA 4CMMB 1N7ML 4JJ5A 4N0UE 2E8YA 4DFHA 5ERWA 5K9KA 1QLEL 2HH0H 1KJ2B 1P4BL 3HR5A 4NZDA 4GKSA 4AJ0A 3NN8B 2BSRA 5BRZB 4GRMB 1MREL 2AEWA 3CLEL 4OQTA 5BS0E 3S3SA 4X7EC 3ZTJH 3VXRB 4S1QL 4XHQA 2P45B 1KG0A 2NY1B 3E6FA 4R4BB 4DVRL 4NRYB 4X7CC 1HSBB 4NNXA 1FNGB 4LRNL 1REIA 2UWEF 4JVWA 3TIDA 1YN6B 1YNKH 1QBLH 1A6WL 2JCCB 1HZHH 4JRWA 4OGYL 4P2QE 2F9BT 5EU3A 4MXVE 5AD0A 3DRTA 3ROOA 5EO9A 4OQTL 1M71A 3IDUA 3IU3A 2QHRL 4L8BB 5IT2H 3K8KA 2CKBB 3OKOB 1NUNB 2FB4H 4PLKC 1UM5L 1KC5L 1YMMA 3ARED 4NQSA 4PFEA 1DUZB 5DJYB 4L5FH 3SDDA 3D0LA 3V5KB 1ZE3C 3B6SA 5FO7B 1B3JA 1BLNB 3D3VE 2WIMA 4NN5C 3X14B 1VGEL 4RAVB 3CVHA 1S7VA 2ICWI 3FJTA 3OBAA 3FONA 4WGWB 1JHKL 2L4OA 3BO8B 3SGJA 3ARTA 4HW6A 5EIIB 2ATPB 3QCVH 3C2SA 3FQUA 4KGLA 2BK8A 4EN3C 1N6QH 1BIHA 2AI0H 4E41B 1JWMA 5C8JB 3LQAL 2QV2A 2FHCA 3FT3A 5K9JH 1LO2H 3CCHB 4PRAB 3QEHB 1LK3H 3W39A 3MRRB 3O2DH 3QNXB 5JOEA 1OSZA 3DXAB 5E4EC 4L3ED 3IYLW 3GMRB 4NP4L 3MGAA 1UACH 4PJDE 3MV8D 1WZLA 5MEQB 3IJHB 3V6OA 1J8HA 3ZDYF 1GGCL 3CVHL 1FFNB 4PJFE 1UM6L 2XWBA 4PRHA 5IBLC 4A6YB 4JN1H 4TUJA 4ALAL 2QADD 4NO3A 1KTLB 1R3LB 5F7WC 1KEML 3WUZA 3IKKA 3RFZC 3SO3B 3BVNB 1F6AA 4PJAA 3BAEH 3ZHKA 3RGVB 4OM1L 4IMLB 1MEXL 1YN7B 5BXFA 2AGJH 1RIHL 1BIIA 3ORJA 4Y4HC 3CD4A 3GSVA 2VAJA 1A9BB 2HYMA 4B50A 4XVSH 4PJ9D 2P42B 4XBEL 1HHGA 5E8DH 2YK1H 2CRZA 2EIBA 3NFSL 1KCUH 1HKFA 4MJIE 5L0QC 3DLQR 3ARPA 5FGSA 4HT1H 3LB6D 4YDJA 3U9PH 5GGSA 3VD3A 1PZ5B 4YC2C 1XGPA 3IFNL 4JKLA 3T77A 1NLDL 4HJJL 1HCFX 4ZTPL 1EERB 2ADGA 3U46B 4HCRA 3ARFC 2KQNA 4IIQA 5AAMA 2BSSB 1FJ1A 7FABL 4ISVB 4JZOA 1I9IH 4K94L 1RZIB 2NX5B 3T1FA 1ZWIB 5IKCB 5T3XE 2LVCA 2VDLH 2DDQH 1D5MB 1I7RA 5EBLA 4YEFA 3F7VA 3B5HA 3SDXA 4DEPC 2MKWA 1BX2A 5J4MA 4P4KC 1U8HA 5F3HA 4ZO6A 2CRMA 3AXLA 2W60A 4D9LH 3QDJB 1CD8A 3UO1H 2VERN 4XVUC 3KXFB 1EA9C 1X4ZA 1CD9B 5DK2B 2OTWB 4ZYKB 4WHCA 4HCRL 1W0WA 3S6CA 4GS7B 1GZPA 2IPTL 4U0RC 5CD3A 5FGBC 2B39A 5T33L 4XP9H 2Y36H 5CSZB 1QRNA 3F8UB 4LSUH 3M07A 2IG2H 4P4RB 1WBXA 1NDMB 5I2IA 1IGFL 1HOCA 2VSCA 3D69B 5EOTA 5I8EA 2GW5A 1JIBA 3GGWA 5BRZD 3T8XB 1UCTA 4Z7UB 4KK5D 3EOBB 2IJ0C 3VXRD 3DV6B 2QQLH 3TCLB 2BXYA 2NY1D 3K1KC 1TVBB 5C0NC 1D6EB 3O3AA 1UVQA 2VLRB 3VXMA 1XF5B 4WUUE 5T3XH 1CGVA 3HCVA 3O9WB 3OG6B 2AJVH 3LEXA 3TYFA 3UP1A 4BH7B 5FV1L 3SKMA 1P4IH 5J11C 4YE4H 5IVXF 3LKRB 4U7MA 1NFIA 5HHMB 4N0UA 3QO0B 1QBLL 3LQAC 3DMMA 3NACL 1MHHB 4JFHD 1PYWB 1EPFA 1U8NA 1BZ9A 1HIMH 5A2IH 1IGJA 4NBYB 2VYRE 1JI1A 5CBEA 4EI5A 1RZ8B 3GMLB 4PRIA 3PNWB 5JHDB 5BS0A 3SDDC 4BUGA 5BVJB 4JANB 5EC1B 5SWSE 2NY3C 4DZBB 1ZT7A 4L5FL 4E41D 4WI6A 5DK0A 1IM9A 4DW2H 5T5FH 4OLWH 4G3YL 3F62A 4M6OH 2J2ZA 3SGJC 4FQXB 3L3IA 4Z8FH 4P5KB 1RU9H 3VFGH 4P23C 4XNXL 3M1BB 2DQGH 3WKNA 4TSBH 1FNFA 3UAJC 3QCVL 1EDQA 2DN7A 1N6QL 5CJ5A 1DSFH 1I1YA 2BCKA 5KSBE 4POYA 2AI0L 2KDGA 3DX7A 1U8IB 1KLUB 1NBZA 1LO2L 1LK3L 3V4PH 2QLVB 4NCC1 3V6OC 4WFGE 2FLBT 3WLBA 5KSAA 1NJ9A 4Z7QE 4OF8A 3BN9C 4X6EA 4Q2ZB 3D3VA 5TJWK 2O93L 3VGDA 3MREB 2XWTA 1XGRB 3L3KA 4Z95L 3RGVD 3MRQA 3RWGB 4U6YB 4KKAD 1BF2A 3GHEL 3KPMA 3BT2H 3ULUF 4JN1L 4RGOH 1N5YH 2JJTC 2X4NB 1IGIL 3VH8B 3SDCA 4RQQB 4FXKA 4NPYA 3MRLA 3N9GH 4HXAH 4X7SH 1NMAH 1F11B 1LO5B 5GQBA 2V6HA 3QWRA 3V6FA 4PJDA 2DLHA 2OX5A 4N8VG 2XZAH 3T2PA 3BEWA 5E8DL 2YK1L 3QG7H 1VACA 4LCUB 1EEYA 4PJFA 1BF8A 4G8GE 1AD0A 4Z7OF 5ESAB 1U8MB 4YNYA 2NX5D 4HT1L 3DGGA 3QXAB 3WHE1 3BPLB 3FT2B 1HI6A 1JGEB 1RI8A 3L5XL 1UXWB 1YEDB 5DDHB 1U8LA 1HQRB 1QKZL 1LHZA 4IIQC 5T1KB 4ELKB 3PWUB 3QHZH 5DGRA 4EUPB 3HPLA 4POUB 2PO6A 3MLRH 1HDMA 3ILQD 3QDJD 4U1MA 3UBXI 1OAQL 5CUSH 4XCEB 3KXFD 2YD4A 2DQFB 2YWZA 3RVVD 2MFNA 1H3VA 1Q72H 4GUPA 4PB0H 2KQMA 3QWOB 4PYGA 2DQHH 2I60H 4MJIA 1DQMH 1F3RB 5IMOA 1T66C 1NFDA 1IGTA 5IQ9B 3FTGB 5T5NG 3UO1L 3MR9B 4YGVA 4R3SA 1RURH 2R1YA 3IAQA 3MRIA 3S3PA 1QFWL 1VADB 4FQ2H 4OF0A 3PQYB 2D7PA 1XR9A 5IJVA 4X6FA 5CJQH 1CD0A 4NN5B 3RWDA 4HWUA 5I0DA 3GSXA 5DHXB 1J1OL 2Y36L 5EZIH 4LSUL 4YBQC 4AEHH 2IG2L 2PYFB 4G6JL 5BMFH 3NA4A 3LY6A 1IMHC 2B5IC 3WYRA 4EN3B 3PWNB 2VLRD 3DVFA 2FWOB 3QUYC 4XC3L 3LHPH 1VGKB 3TNMB 2E6QA 2K7QA 3O9WD 4XPTL 2QQLL 4ZODA 3MRDB 5E4EB 1FO0B 4GAJH 2R1XB 5K9OA 5C6PB 4JRYA 5E5MA 3D18A 4NHUA 1KACB 3SQBA 4U3HA 5HHMD 3LV3A 4DGYL 3TO4C 5T3XL 3RUGB 2V2WA 1YY8A 5C07B 3WCYA 5HYEA 2XG4A 3RNKB 4M8VA 4KHXH 2IBGA 2AJVL 5H94B 3P4OB 3MOBH 5IB5B 1KN4L 3ZTNH 4WHTB 5JHDD 2EC8A 4F37F 1AXSA 2XWJA 2ZOKB 4Z78B 5TDOA 5B39B 4FP8H 4YEEA 2WV3A 3U0PA 3DMMC 5EU6A 1IC7H 5J1SC 4HZLA 4HIJA 5KAQF 4XCYB 4JKMA 3NOIA 4F3FB 2WM0A 3I02A 3EYQC 3VFRA 4G8EB 2ZSVA 1KJMA 4NO5B 2CDGB 4FQXD 1UEYA 4NSKB 4O51A 1WEJH 1X5HA 3SGKC 4OZIF 5FXCH 2FJHA 3NCYP 5L0QB 1QVOA 3WO3B 4OV5A 2RR3A 5HGHB 3QUKB 1FQ9C 1TTGA 4KMTH 2OR9L 5C2BL 4UQ2A 4G6AD 3G6JB 3I6GA 4DW2L 4YC2B 4OLWL 4M6OL 4KRMB 3KR3L 3HAEB 4ZO9A 4GBXA 1XR8A 4Z8FL 5I1EH 2W91A 3ARFB 2HFEB 1KBGH 3ZKXB 2H2PD 3BEVA 2EEAA 3KDMA 1FZOB 5DWUH 4P48A 1G7JA 1DSFL 4ZFOB 1ZA3B 2IQAA 4BA8A 3EDFA 1CDHA 1SYVA 5H2BA 4V1DE 3T2QA 1U8JA 4DEPB 5KSAC 4HSQA 5HY9A 5F1NA 4P4KB 4PJCB 1DANU 4XNQB 3RY4A 1LP9B 1ND0B 2GJZA 3N50A 3D87B 5FKPA 3CMOH 4HIEB 3NVQA 2X4RB 3HZKB 1GZQA 4HWZB 5I6XC 4NKOA 4KKCC 3VFPA 3PV6A 4MQXC 2XN9E 3CSYB 5FYKE 3DVNB 1ZA6A 5EU7E 4RNRA 4NKQB 4NWTH 5HHXH 3QUZC 3B3IA 2CDEA 4RGOL 4U0RB 2HG5A 3SDCC 1N5YL 3OR7B 4P5MA 1R24A 2G9HB 4HIXH 4AK1A 2F53B 3F7YB 1QFUH 3S4SG 3NIGE 2DB8A 1NEUA 3MNZB 4NQTA 2RJMA 4RGMC 4YK4C 1LILA 5FKAA 2K1MA 4GSDL 4LLAA 4JJ5B 4QWWC 1UJTA 4C56E 5J1AA 1Y0LA 3DIFA 5ERWB 1ZVHA 5GHWH 5K9KB 3HR5B 2A0LC 4GKSB 5CZVH 2AS5M 2XZAL 5T1KD 3MLSL 1WIOA 4P3CH 3RIFK 4JHAL 4Z9KB 5DQDL 1L9MA 4WEUD 5ICZA 5DVKA 2IWGA 4J12A 1KG0B 4U7KA 4F2MA 5F7UA 2NXYC 2PO6C 4N5UA 3WXWH 3TIDB 4Z5RB 5J11B 3MLRL 5L6YH 2E27H 5EBWA 4JZNA 2DMKA 2LQRA 4PLKD 2NQCA 4QXGH 5EU3B 5IIEA 5EWIH 5AD0B 3PQYD 3FB6A 3DRTB 3ROOB 5EO9B 3TM6A 3IU3B 2I60L 3T09A 4G8GA 4R2GC 1H8NA 5SX5K 2F8VA 1YMMB 4NQSB 3L3HA 3A6BL 1OQXA 1CXHA 2R2HA 3CK0L 3SDDB 3I9GL 5M95B 2FO4B 3D0LB 3FO9A 3B6SB 4EN3D 1RURL 1CXKA 3CVHB 4FQ2L 3OAZK 1S7VB 3KPPB 1S7