4YFEA

Crystal structure of ptp delta fn1-fn2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
193
structure length
193
Chain Sequence
ALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKPKNSEEPYKEIDGIATTRYSVAGLSPYSDYEFRVVAVNNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor-type tyrosine-protein phosphatase delta
publication title Mechanisms of splicing-dependent trans-synaptic adhesion by PTP delta-IL1RAPL1/IL-1RAcP for synaptic differentiation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 32
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yfeA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yfeA01
3T4YA 3IU3A 3SDYH 4EJ1C 2EEDA 2Q1EA 4QYOB 5KVDH 2EE2A 1KCUH 4YGVB 5E8NB 1PJ9A 4WI9A 4PJDA 2ED7A 5D4QA 1OP3K 1X5FA 4ZPVA 1TQBB 4G7VL 5T5NG 4NZDA 5DQJB 3RDTA 2D9CA 4M62H 4NNYA 4PRIA 5FAAA 1X5GA 1MJJB 1Z0MA 3PF2A 3WSQH 5DQ9B 1JGLL 3VFTB 2AJXL 2EDLA 1K5NA 3THMH 5I1LB 3F65A 4L29A 3QIWC 1UENA 2D4DA 4DVBB 1G6RH 5HDBF 5A2LH 1HWGB 3K8MA 5IVZA 3STZB 4XVUC 4GAJH 5EU3B 2VC2H 1LDPL 3HE6C 4WI8A 3HI6L 1C8PA 1AXIB 3H3PH 3OZ9L 3V6FB 2FHCA 3HUJE 3LB6C 1Q9OA 1QQDA 4PJFA 4HKJB 3OJDA 2UZIL 1F4HA 3VFGL 4F57H 5FV1L 4DKAA 4NRYA 2B5IB 1W72L 2AKRA 1XGUB 3H7LA 3HC0A 1BD2E 1AD0B 3REWA 2BVPA 2HT2D 1AIFA 5JOFA 5IJKC 5DMGC 3L3KA 4MA3B 4LCIL 4DZBB 4OB5L 3X3GL 4AQOA 1AJ7L 1QLFB 5EU6E 2YPLE 1RULH 4KI5F 3VXOA 2QSCH 4OUUA 5KN5A 3RWFA 5KG9B 1CZ8H 4JHWL 4LU5L 5TGBB 4XBGA 3VXRA 5BV7L 3HE7A 4PIRF 2DQDH 5IFHH 5K9JH 3WMSA 4OGXL 3W9DA 4XMPH 3V4UH 1FVEB 3QFDB 5E8EA 1I9IH 3BP7A 3C09B 5GRUL 5FDYA 1MJUH 1REIA 4KKNA 1RZKC 2ZPKL 3RWDA 3BYYA 4K9EC 1NCAL 2B4CC 2VLJD 3OR7A 4XNMB 3I3DA 4G8EB 4B53A 4NHUB 1KBGH 4XT1C 1FYTD 5C08A 4QRRE 3WFBH 4KKCD 4Z77B 1FAIH 3IGAA 5F44A 5KVGL 2X9WA 4FXGA 4CMMB 3R8BB 2F8VA 3UTSB 3V6OE 4HWBL 4B50A 4U6XB 4KQ4L 3NH7H 4G6ML 3EO0A 4MJ4A 4HBQA 3FAWA 2XRAH 5TE6H 1N5AB 4QXGL 2DI9A 3TZVD 1MQ8A 2BVYA 3BN9C 4PRNA 1FIGH 1HH6A 3VRLF 1MIEH 3QQ9D 3BFOA 5BZDA 4YHZH 3MRCB 3C6LB 1NUFA 4P9HH 4JFEA 2CKBL 5HI5C 3OAYH 3U4EA 2JLLA 3MJGX 4X9BA 3MMEA 1TZIB 3HMXH 2PUQT 2X4RA 4JN1L 3U4BH 4X0KB 4HHAB 1DANU 1HHGA 1F8TH 4N8CH 4XBEH 5T1DL 9CGTA 1Q0XH 1CLOL 2VQ1A 3C8KA 3EJJX 4PRPB 3ULUE 2D9QB 2M2DA 3SBWC 2QKIB 2GKIA 1FV1B 2VKWA 4HGKC 4PJFF 4P2OB 4G9FA 1RD6A 3MLVH 4NRXB 2HFFA 5CZXC 4BUGA 2X9YA 4CU8A 4P2QE 3E2HC 3T04D 1P6FA 4OZIB 1QRKA 4ZOCA 3FOLB 1JPGA 3QUXC 3HAEH 5CSZB 5IROA 1MFBH 5C2BH 1FBIH 5TDPA 1DBML 1G6RA 2YD8A 1BFSA 2W0FA 4YHIA 3RBSA 5KSAA 1A9EA 4G8FB 5FA3B 4I48A 2GCYB 1UM4H 3MRLB 2NR6C 1KJMA 2EYTA 5D7SH 3UTQA 3QIBD 4HC1A 3HUJF 4FQXD 3FFCA 2HVJB 2CGRH 4V1DB 3TF7C 3IU4H 2FLRT 4LPVA 5D1QD 4K71C 2EKSA 1I9RH 4OF0A 3C6SB 1KN4L 2QADB 4CNIB 3R0MA 3X14B 1MREL 2KZ1B 1ETZA 1P9MA 4X5LA 3QI9B 5BS0E 3MLZH 5EBWB 3BP6B 4LLAA 4L8BB 3D3VD 3O2VL 3U7YH 3CFEB 4BM7A 3F5WB 2MKWA 3HMWH 3PQYB 1S7WB 2O26U 4ODXA 2BC4A 2ZWLT 3RPIA 4ODTH 4NJAH 4RGNC 5CD5C 3BH9B 1NEUA 5BW7C 4A6YH 4ZO7A 4X4ZA 4DGIL 3HG1A 4X6FA 3I6LD 3EFFA 3QZWA 4ISVA 1D9KB 2XACC 2VZ3A 3ZT5A 1JL8A 1KJ2L 4WWKC 2W65B 5DQDL 4F9PC 3GSNH 3QRGH 4X6CF 3MUZ1 3MROA 3OKEA 2ITDB 5DXWA 2EDOA 4KY1H 4R26L 4JPVH 1KT2A 2CDEA 4FQJH 2BVTA 4UDUB 3U46B 3SGKA 4K23H 5HHOE 3QNXB 1EVTC 2OI9B 3QQ3B 5DFTA 4NO5B 4HJJH 3KPNB 4NUGL 5FGRA 3KNBB 4HUXA 5E4EC 4N8VG 2IALA 2OR7A 1OM3H 4JZJB 1KCRL 5JUEL 3TJEL 3JSSA 5CKGA 4JVUA 1RK0B 3BT2L 3IF1A 3C5ZC 3JUYA 4PPTA 4PY7B 2AJSL 2O5YH 1DQQA 2D7MA 3ARFB 4NKDB 3HMXA 3QJFB 2AK4E 1JYWA 1HWHB 4JVPA 4UQ2B 5E2JA 2BRQA 4OF8A 4JRXE 1WC7A 3LD8B 1A0QL 3O9WC 3RZWA 4F7PB 3HNVL 3VE0B 2CSPA 4C54A 1J5OL 2VLME 5I8OL 3UPAA 3AREB 3RWIA 4YDIH 1DFBL 4PS4H 4ZSOB 4OLZL 1H3TA 1BJ1H 2Q8BL 5MENB 4LKCA 3S35H 4M48L 3TYGH 1HKLH 1R0AL 1N5YL 3HAEA 5JW4Q 3KG5A 3CVIL 4UV4H 3H9HA 4JR9H 1OGTB 2MHAA 3QIWD 1AXTL 3MZGB 4P4KA 5CGTA 5C0IB 3SE3C 2FR4A 4JO1L 4XX1E 4MWFB 1AQDB 3V79C 3IDXL 4GUPA 4MQTB 1K4DB 1K3IA 4LSVH 4JFFD 5FUOL 3E0GA 4PBVC 2F54B 2AXFA 3IDJB 1C5BL 1VADB 4KMTH 1EZVY 3SPVB 3SDYL 3DUSA 1E4XH 2Q6WB 3NABH 4MAUH 5EUOA 3OAYK 1D5XA 4PJGE 4EUPG 2BK8A 1ONQA 5F7UA 1HXMB 3LHPH 3WNOA 4XBPB 4Z7QE 4P3DB 1S8DB 3MXVH 4M62L 3WFDH 4KK8D 1LO3L 1WWBX 5BVJB 2BHYA 5CJBA 4CU7A 3WSQL 1A6WH 4LFHG 3RKDD 3PWNA 4XXDB 5IEKA 4UU9A 5E5MB 5C71A 3FL7A 2VR9A 3LQZB 5E2VH 3I6GA 2ICEA 4A6YA 1DQLH 1OQXA 2HT3C 3F7VA 1QLEL 2ITCA 1I85A 4JRYB 3B9VA 3H3PL 3O81A 1EFQA 4UNTA 3T3PF 3OR6B 5FM4A 1CGTA 3G6JF 4P5TB 43CAA 4F57L 3NCCB 4BKLB 1LHZA 3WUWG 3AXLA 3GSNA 3ZDYF 2K1MA 3BXNA 4R3SA 5FFLA 3SGEI 1HCVA 3TT3H 5J3HD 2VQUA 4L3EE 1HHIB 2E8YA 5IFJA 1R3KA 4N8VB 5E9DE 5I8CB 4QHKJ 1NGQL 5M7QA 1JRHI 1TTFA 1FNSH 4PGDB 5D93B 3G5ZB 3P4OA 5JPNB 2QSCL 1NBVL 5L7XH 3W0WE 3SQOL 1CZ8L 3JV4A 1JI1A 3KPRE 3MACH 1P4IH 3HZYB 4XCYB 5IFHL 1YEEL 4PJBE 4XMPL 1LEGA 5IBTH 3V4UL 4QTHB 1MIML 1SEQH 1NANI 3ARGB 4JFPB 2OXHA 5DJDA 4D9LL 2HTKC 1IGML 4OZ4B 1N6QL 3GSOA 5DWUH 3ZKMD 5TFSH 4GG8B 3DROA 3IDIB 2EE3A 4MD4B 2NLJB 1WTLA 4M03A 1VPOH 2DLEA 2VMFA 2NY3D 4HDIB 4UUJB 4L4TB 5SWSA 3HCVA 4HKBA 1VHPA 2QHLA 5E5UB 3B5GA 2CO6B 1FO0B 2AQ3A 4OD1L 2XN9A 2RGSA 3ZKND 4H0HB 3VFUB 3GBLA 2DYPD 4H0GA 4HT1L 1KPRA 4WW2B 4J2XA 3QEGH 5CEZH 1YA5A 1XIWD 4BZ2H 2X09A 1A1NA 2XRAL 5TE6L 4GQPH 3GMQB 3R0NA 1FZMA 5H35A 3H9SE 5CZVL 3P9LA 1L0YA 3B2UC 4U33A 2I9TA 1T0MA 4H1LA 5D72L 1F3DH 1F45A 1CI5A 2IH3A 1QLRB 3D85A 3HRPA 1GC1H 1FIGL 4NN7B 3SKNB 5FCSH 4EUPB 4W4OA 3WL9A 1MIEL 3HN3A 1OAKH 4YHZL 5ICYA 1BQSA 1RV6X 4JHAH 2H32B 3HMXL 2DJUA 2PW1A 4W68A 1C16A 1MF2H 1F8TL 4N8CL 3QDME 1Q0XL 2AI0H 5GGTH 1KIUA 4O4YL 4KV5E 2VLLA 4GRWE 1D6EA 1PX3A 4OFYD 5C07E 3OG6B 1RJZB 5F7HA 3ARBB 3GMNA 3DI3B 1QFUH 1WAAA 3TFKC 5H2BA 1QA9A 3VXSE 3WUWB 5B4MD 2AJ3B 1MFBL 5C2BL 1H9VA 1FBIL 3HC3L 4PD4K 4QTIH 1EHLL 5D2NE 4UINH 3QUZA 4YDKL 5GS0D 3TJHD 1OL0A 5C1MB 1N8ZB 3WXWL 1YEHH 5CD5D 1DLHB 3BKJL 3QG6B 3A6OA 1UM4L 3I6KA 2JCCA 2VUYA 5D7SL 1CXHA 2ENYA 2VDPH 4UT6L 5TPWL 1HIMH 2GT9B 2YD4A 5F3BB 1U3YA 1X5XA 1LP9F 4MMXC 2DOCA 4KZDL 2R0WH 5E70A 1G7LB 4M8QB 3NPZB 4Q9QL 1TZHB 3MLZL 3MRJA 2CRZA 5C2UB 1MVUA 3FTGB 5FUZL 1NPUA 3NFPB 3U7YL 5FF6A 4TN9A 3PDDA 4XVTH 2NY2C 1T0NA 3WFEL 4LHQB 1CD1A 4QNPF 5IW6A 3B43A 3HRZB 4KUZL 4M43H 4ODTL 5L9DH 1W0YT 4NJAL 1X5KA 3HA0A 3RPKA 5JDJA 3M1BB 4A6YL 3OGCA 2W0LA 4LHUD 4R0LB 4NWTH 4BQ9A 5DJXA 5E5RB 3WCYA 4WFFD 2X4UB 3P73B 2Y5TB 1HI6B 3QRGL 2FRGP 3V52H 4DCQA 4RFOH 1QFOA 4WFHD 3MLXH 2GJJA 2NYYC 1U8IA 4FQJL 4CW1B 4X6BB 5JHDA 3D2UD 4C59B 4PTTB 1DN0B 5ACMA 1UZ6F 4NPYB 4AEHH 4LLMA 1LNUB 4HFUH 5I16A 2Q3ZA 1RZ7L 1G9MH 4YDLB 1JMZA 1I1YB 1KB5B 3CPLA 4Y4KC 3PV6A 4EDXA 4HJJL 3TEUA 1XF5A 4IRSC 3TN0A 2CUMA 4J3XA 3QEHA 1OM3L 2F74A 5H8DA 3I3BA 4IHOB 4WI5A 2HMIC 5EPMB 1IM9D 1A1MA 4OF5A 1I9JH 3LAFA 4X4XA 4Z18A 1H15B 3ZYOA 5F7LB 4YO0B 1AY1L 1JNHB 3IETB 3ULSA 2XZCH 1NGPH 5EZLA 2OTWA 2DJ4A 5F9JA 1IARB 1FFNA 1J05A 4QXTA 3SKMB 3O8XD 4QHMB 4YDIL 2Z8RA 5C09D 5I74C 1OB1A 1XGTB 1I8KA 3VXPB 5GZOD 3CCHA 4JZOA 1HOCA 4YBQD 4P2RA 3CDGB 1AGEB 3S35L 1HKLL 4NRZB 1U8OA 2IF7A 1KTLA 1W72B 2XZQH 3HNSH 4MNGA 1YY8B 4UV4L 1RHFA 2DJSA 3GNML 3QEQB 4KVCL 2C5DC 3B9AA 3ULVE 3ROOA 2RAMA 5KZCD 2AERT 5EDXA 1NFDE 3G5VA 4NDMB 1KIQB 4LSQH 2HTLC 2HT3D 1BM3H 3LSOA 3O2WH 4LQFH 2R4SH 5ID0A 2XOTA 4M4PA 4MX7A 3U0WH 3LRGA 4XP5H 3JWOH 3IXTA 5C0EA 1NLBH 3BO8B 5T3ZE 1UYWH 4RWYH 4MAUL 4KHXH 2LU7A 3QIUC 3MRHA 3ZE2F 1HZHH 5E08L 3ARZA 2A0LC 3LHPL 1YNTB 3VGEA 3TA3A 1PKQB 1TQCC 3L3IB 3MXVL 1JI2A 5BRZA 3WDJA 1NMAL 5EIQA 5D1ZC 4KTDH 4XI5D 3MFGB 4QHUA 1CFBA 2NX5A 5EA0L 4RGMC 3QUMA 4AENB 5FYJU 1PY9A 2WUBH 3TBYB 1ZWIB 4Z8FH 1JHLL 5I66A 1DQLL 3UBXA 2BJML 5I71C 5J1TC 5DI8A 4G8GB 5EOTB 3ARTA 4QRQA 1A6TA 3FB6A 4N0UE 1G9NH 4L9LB 1OTUC 3KPSD 4Y2DB 1U91A 5EIIB 3UP1A 2I07A 3TT3L 4J3SA 5DZLA 4OLWH 3NFSH 3NMEA 4HPOH 1FNSL 3X12A 1DQML 4U1LA 4XC3H 3OHXA 5L7XL 2GY5A 5GQBA 3REVB 4PJ9B 4JFOB 4MJ6A 4M6NH 1P4IL 2CKBB 2D2OA 2XY1A 4FQHA 2H6PA 4Y4FC 3TBSB 3GZKA 4MA1C 5ITBH 1T83C 4PR5A 2CK0H 1UA6H 1D5MB 4JREB 3QWQB 1F6AB 5DWUL 3MV7A 5TFSL 3ZKSD 2Q86A 4JKWA 1B88A 4G3YH 5K9KB 1S7UB 3DARA 3U82B 4N90E 5HYEA 2NQCA 1U92B 4Y19A 5DYOA 1T22A 4LCUB 4W81A 2NZ9D 1TTUA 3AB0B 1RY7B 2G5BA 1HNFA 1AO7A 2GAZB 4HS6A 2PTVA 2XWBA 3EDDA 4G6AC 4HKZA 5C0AB 3UC0H 3AGVA 4S0SD 1GXEA 1KUMA 1MAJA 1Y0LB 2LTQB 4UQ3B 2XNAB 4BZ2L 3PL6A 1X9QA 1B0GA 3VXUE 2HA1A 5HYFA 5D8JH 3U0PB 5JR1L 2XT1B 4CDHA 4FFWC 4KDTC 2VL5A 1FJ1B 4GRLD 1ADQH 3IU3B 4W70A 4XAWH 5A16A 1Z9LA 1N3NB 3P0YL 4RAVB 5ETUA 1KPUB 1VFMA 3BWAA 4GSDL 4JHAL 1UJ3A 4QOKB 2CIIA 4Q6IC 5E6IB 1IMHC 1JUFA 4N0CD 3RWEB 3UTSD 4ZAKC 3VGFA 3W11D 1MLBA 4NCC1 4Y2OA 3TNNA 1L7TH 4KC3B 1NMBL 1K5NB 1I9EA 1JE6A 2AI0L 3U9PH 3VA2C 3QFJA 2IPUK 5GGTL 2GSGA 1U58A 3P4NA 3SDAC 1KEMH 1EUUA 1A9BB 1OAYH 2O5ZL 3OGOE 1BEYH 4K7FA 1IQWL 1N0XH 1CLCA 4TSCH 3EYQC 4MQ7B 3L3HA 4P9ML 1WT5C 2DB8A 2ZNXA 3L9RA 3BPLB 1Q9OB 1QFUL 1QQDB 4PJFB 2CDFA 3C6LD 1KJ2B 2G60L 4H8WL 4IMKC 5ALCH 4QTIL 4UINL 4S1SL 3HC0B 4V2CB 1NJ9A 3TC9A 3REWB 1N4XH 3QDGA 3SDDA 4U05A 5BJTB 4Y5XC 1CFNA 4Z7NF 5EORH 2AEPH 1HIML 3LQAC 4QT5A 3SDCC 3EYSH 1CLYH 2ICWI 3IVKA 1ED3A 4DEPB 3GKWH 2PXYA 4WY7L 1HQRB 2ZG2A 5DSCA 1XF2B 4L3AA 5CSGA 3MR9A 3QXUA 3RWFB 2C7UA 4P2OD 5C0BA 2VDKH 3MRBA 2PO6A 5F21B 4KXZH 4F9LC 3BZEA 3VXRB 5E00B 3HE7B 5AD0B 4IMLB 2Y06L 5E8DL 2V2TA 1BWWA 3ZHLA 1VCAA 3UPRA 2P5WA 3BP7B 3BD4A 2D0GA 5F9OL 3O4OC 3B2VL 3PWPE 1NEZG 4GW1B 4OV5B 3RWDB 3GSVB 3V5HB 4UIMB 4GBXA 4R9HA 1HSAA 3N85L 3NA4A 4M43L 5I18H 3D39D 4NZTL 5I1JL 1K2DA 1VFBA 5I17A 3IDMA 4NWTL 5GRJL 3CXHK 4XP9H 2QADD 1ORQA 1T2QH 3DWTA 1FC1A 1P7HL 2H8PB 2MPAL 1CGSH 2Y7QA 1N64H 2COQA 3QI9D 2QQKL 4Y1AA 2AXGA 3NIFF 3EO0B 4XCFL 4PJ7E 2G9HB 4Y8AA 3LQMA 3MLXL 1EAPB 4DN3L 5GSRB 5HYIA 2YUZA 3ARDC 4X6CB 3PQYD 1XGRA 1GH7A 2FHFA 4K3JL 4AEHL 4MNQA 4WTWA 4HFUL 5JQ6H 4N9OB 4R4FH 2GSIA 4XAKE 3A67H 1HEZB 3IT8D 4DQOH 4YEEA 3MBXH 1D9KD 1QKZH 2XV6B 3O0RH 4WV1B 3ET9F 3BQUC 4PLJC 4Y5YA 3UO1L 4UI2A 3FONB 3RUGA 1ADQA 1HHGB 2HP4A 1OTTC 4LDEB 5ESVB 1MJ7L 2BNQA 4NQDE 4N0FA 1SJEA 3DJ9A 1I9JL 4MB5A 1FGNH 4IM8A 3Q6GH 2C3GA 2NW3B 3BW9A 3DX7A 3VJ6B 3QJHA 3VGGA 5HHMB 4FXKA 1YY9D 1C1EL 4UNUA 4UT7L 2XZCL 1DQJA 4IRJA 4CMHC 1NGPL 3V6ZA 1F42A 4ODBD 1LD9A 1KIRA 2W59A 3W5NA 1NL0L 3SE8H 4ZFZB 5KW9H 3E6FA 3K74B 4POZC 1DUYB 1U9KA 2W0FB 3TLRA 2IADB 4JAMA 2X4TA 1YDPA 5GRVK 2YUVA 4LVOB 3S37H 4I48B 5CD3B 5DLMH 3UTQB 3PWUA 1GGBH 1G7PB 1GPOH 5CJ8A 3FFCB 4X9IA 3MRKA 3BKYL 1KG0B 3QPQC 5JXEA 5CEXA 1R5VB 1ZANH 1BIIA 2HLFC 3TWCH 2PTUA 3RAJH 3ARFD 4P2QB 1CBVH 5D2LA 1DBKH 3MLUL 1BM3L 3O2WL 4LQFL 5KOMC 1DVFC 2XTJE 3U0WL 3VWJC 1JZ8A 1JJUA 1NEZB 3CFJA 1HYSC 3W9EA 4AEFA 5C8JA 4PTUA 1NLBL 3FZUD 1ZHNB 1YQVL 5F7WC 3CDYA 3BVNA 3H7BB 4KHXL 1MHCB 3KPLA 2YD9A 1HZHL 1Z5LA 4MNHB 3PJSB 4TVPD 3FJTA 5MEND 2P48B 2C4FT 3HG1B 4E41E 4JFZH 4MCYA 4G7YH 4KTDL 3VXMB 1I7RB 4C56E 2WUBL 4KKLC 4U1IB 4ZXBB 5F1IA 5CMAB 3VMOA 5HVWA 3HZKA 1TZGH 1NC2B 3MFFA 2F54D 5A3IC 2K7QA 4LNRB 3S7GA 2A83B 1Z9OA 4PJDE 3BGMA 2J8UA 3HZVA 2VISA 2CLVA 2EIDA 5IGXH 1RZIA 2YRPA 1TJGH 1GGCH 4HIIA 4PRIE 4HWZB 3SDXF 4PP1D 1YPZE 1OCWH 4M7LT 3P9MA 3FAXA 1EK3A 2X40A 3G6JB 1ZA3A 2BOCB 4HUXB 3NFSL 3VDBA 5L8KB 1YEFH 1UB6B 4PJEA 4IJ3B 3CFDA 4HPOL 1U8KB 4PBWD 4NZRL 4FG6D 1SMAA 4ZUVA 3IF1B 1R5IA 2EXWD 3D9AH 3UJTH 4QWWD 5T1MB 4JRYD 3KR3L 2FATH 3F12A 1S9VA 3TBTB 1RJYB 5ITBL 1E6JH 4L8SC 1IE5A 2CK0L 5CIPB 4P5TD 1UA6L 3HPJA 1PKOA 4ZNEA 4NO0B 1UVQA 4O58H 3UCRA 1KSRA 4BZ1H 3SKOA 1CXEA 5JZ7C 1NH6A 4NC1C 2H2SD 4OLUH 3U36A 3RGVC 1S7VB 1AR1D 2F53A 5GRVL 5D2LF 3Q5YA 1ITCA 3GO1H 4ZPTA 4U1KB 4P5KA 2ZUSA 3Q5OA 4LF3A 5JPMA 2DIBA 43C9A 3H9HB 1JTTA 5GSVA 3RWJB 5JOEA 1YYML 1ZXQA 2FR4B 3ARGD 4GUPB 3FQNB 4PGCA 4Q9RH 1H5BC 4EI5A 5D8JL 4LVNB 5C08E 4IEFB 3CUPA 4OKVB 5KVEH 1U42A 3OKYA 3CDCA 5CP7A 4HUWA 4L4TD 4XAWL 4GW4B 4WCYH 7FABL 1KYOJ 1EFXD 3OMZA 1K8DA 1A7NL 4KK9C 4ETYA 3VRIA 1ZA6A 4DFIA 4X7TA 1ONQB 4I5BA 1MHEA 3MUGB 1F58H 4HS3A 4XNYL 4DW2H 2DQGL 3EBAA 4XH2B 3IDGB 4BFGA 4HJGB 1L7TL 4OM0L 2AXJA 3PWNB 3TVMA 3O45A 5IEKB 4IOFC 4OF6A 4UU9B 1SHMA 1JMXA 4XPHL 3VD3A 2A77H 3BDBA 4HBCL 3T77A 1KEML 3FT2A 3MOAH 1RZJC 1J0JA 3I6GB 3VXNA 4A6YB 3G5XA 4LCCA 5ILTH 3DTXA 1Z3GH 2ZSVB 4ZFOL 2ITCB 4TSCL 3MYJA 1CS6A 4F33A 1CL7I 43CAB 2VABA 1JNLH 4YC2B 4NT6A 4AL8H 3SCMC 3KXFA 2AJZA 4XP1L 3P11H 2IH1B 1WCQA 3TPUB 3BXNB 4PJEF 4R3SB 4UBDC 1XF4A 5FKPA 5DR5L 3GSXB 1IL1A 5HI4C 1F11B 4UT9L 4LFHD 4EQ2A 1TETH 4LRNL 1BLNA 5EORL 1NGXB 2AEPL 4G9FE 1J86A 12E8H 2VLRB 3EYSL 3F62A 5FV2A 3GKWL 4APQC 4GAGL 3NIGE 1NCDL 2FJFB 3JV4B 3U2SA 5C0ND 5EFIB 3K1DA 1RUQH 4UMGA 1MFDH 3QHFH 3MLRH 3ARBD 5DVLA 1WF5A 1LEGB 1LP9B 1TVBA 4FZ8H 3ZDZE 1I1RA 1DZBA 5ACZB 1F5WA 2BP3A 5HYJB 5IJVA 3ARDD 1KLGB 1TJIH 3LCYA 3GSOB 3OSKA 1YECH 4PP2B 2ZNWA 5I15H 4ZFFA 4P23C 4OZHA 5K33A 4F3FB 1BZQK 5KSBA 5JW3L 3HCVB 4NQSB 4HKBB 3MBEC 3T08A 1DLFH 4U2ZA 1C08B 3BQUD 4PREA 2IAMD 4JFXB 2Q87A 1U8MA 4YH6A 2CMRL 4MDIA 1OTTD 2A2QT 1T2QL 4YHPA 3MNWA 2DIAA 3HNTL 3G6DH 3I02A 2QHRH 1BREA 3LKNB 4RA3A 2VZUA 5J12B 5FK9A 5FECB 1FZMB 3V6BR 2BNUA 2BVUA 4X99A 3PWLB 2YEZB 2V17H 2B39A 4G80B 5C9KA 2Q7YB 5JQ6L 4FFYL 3QCTL 2FEDC 3A67L 3Q3GA 1GGYA 2HWZH 4DQOL 2K3TA 3MBXL 4ONGL 3RWCB 3O0RL 5ANMA 4OD3H 1CK0L 1C16B 5EO0A 3VFPA 5KAQF 1CIUA 5HGDA 2HLFD 1U8PB 3RNKA 1TITA 2VLJA 4KZEL 4IIQC 1FGNL 1T66C 3FQTB 1FYTA 2Q8AH 3IDYC 1U3HC 2VLLB 4ZMAT 5JW5A 4FQQA 4Z7UA 5FYLE 4XMLL 3R1GH 3VI3E 1J1XL 1CVRA 1JCKA 3OKDB 4YWGL 5KSVA 1M7IB 4MXQC 2Z35A 2L7UA 1HYSD 4RNRA 1PAMA 4HUUA 4Y4HB 5H2BB 3SE8L 5GISL 1JZ2A 4X9GA 5E8PA 4OZGF 1GOFA 4POYA 2DMCA 4ZUSA 3PDGA 2GJZB 3H9ZA 2HN7A 1X5ZA 4NWUH 5MHSD 3AAZB 5DLML 1GGBL 1T04A 2ZUQC 3TZVA 5L8LB 1GPOL 5B39G 2HT4D 4FN0A 3EYOB 2ATPA 1ZANL 3OKLB 3RAJL 1CBVL 1DBKL 1JPTH 2NXZB 3GUTB 3QULB 4LEXH 3GK8H 3FRPA 3GM8A 4OCXH 4WEUD 4UZGA 1AD9B 4A2MA 1HINL 5E2WH 5FF6B 5EB9A 4XGZB 1T0NB 1YMMB 1S5IL 5L0QB 1HYRC 3VA6A 1KLUA 3V6OC 1CFQA 2RB8A 4EI6A 2XTLA 4JY5H 5IW6B 1I7UA 3NZHH 4DJMA 3WO4B 2FJHA 1OLZA 1XCTA 2DRUA 1JPSL 4X6DA 4W4NA 3R4DA 1X5AA 3GSWA 4F37K 2NY1B 1MHHB 4HX1A 3TNMA 1MEXL 2VLKB 1N59A 2QR0B 4G7YL 1AHWA 3GMMB 3QEQD 4HUVA 2WSKA 1FCCA 4ONHA 4X83A 3MQIA 3C8HA 1GCFA 4J23A 4XCNA 3BEWA 2A73B 1TZGL 5EUOE 3V4VL 4E0RB 3QIBA 1H8SA 4FQXA 1Y6NR 3UBXG 4PJ8B 1DN2A 1QFHA 5D1QA 3T0EC 3T8XA 1DQDH 1B9ZA 1MFCL 1ZGLA 1H0DA 3PHQB 3U9UB 3CPLB 3ULUC 3FCTB 2BHUA 3PV6B 3UYPA 1XCQA 1F4YH 3D3VA 3TN0B 5J6GB 3P0VL 3QEHB 2YZ8A 4JPWL 1YEFL 2XWJB 1CDJA 4FMFA 1ZVSA 5C0CD 5DK3A 4L5FL 1P4LB 3CSPA 3ZT7A 1A1MB 5CKAA 2ZOLB 5L8JB 3D9AL 5SX4I 1WUNT 5ALBH 4F37F 4JKLA 2GYSA 1E6JL 3WS6C 2QEJA 5IQ7H 4PJHA 3RU8L 4NHCL 4YUEH 1RZKH 4S1QH 3ULSB 1IGTA 4ALAH 4Z7OE 4PJAA 5EZLB 3SGJA 4GT7A 5MP6H 2OTWB 5F7DB 4GKNB 4RFEB 4BZ1L 2B4CH 2DM4A 1J05B 3GMRB 3U7WH 4DOHB 3HB3C 3TBVA 4OLUL 4M7ZC 2IPUG 3KJ4B 3P2TA 5EBLA 4JQVC 1OB1B 4MLSA 1FL5A 1I8KB 5B39B 3EJZC 1HOCB 3GO1L 1PEZA 4ELME 4PJ9D 2A38A 4CADB 3DYOA 5DTFA 1U8OB 1KTLB 1D6VH 3O3DB 4IOFD 1IGFH 4KI5D 4OFDA 3RQ3A 4F7MB 5CBAA 1RHHA 3IJHA 1NGYB 3G5VB 4CVXB 4PRBA 5GIRA 2G5RA 1K8IB 3W2DH 4Q9RL 5SWSE 2KZWA 3KJ6H 1IGIH 3VFNA 4AT6A 3IFNH 3LMJH 2XN9E 4DUXA 3SCMD 3PXJA 4WCYL 3LH2H 2DQCH 5CEYA 2N56A 3S6CA 3SO3C 2AXHA 2W1NA 2V9TA 4XP6L 5D7JC 4DVRH 4DW2L 3TA3B 4LAJH 1JHKL 5C0AD 2A9ML 2ZKHH 5DD0H 1CGUA 3ILQD 4QHUB 3RX8A 2NX5B 4AM0A 1GJIA 3T4AB 4WNQA 5GPRA 2A77L 5SX5H 3MOAL 3OXRB 1A6AB 4WFGD 2VAAA 5ILTL 1Z0NA 1ZLVH 1MCPH 2EEBA 3UBXB 2AABH 1YNKL 4X7FC 4ZO6A 3NPSC 3BP5A 5D6CB 4QRQB 3FO2A 3QIWA 2EEAA 5F6HI 1BBJB 4QOKD 1KENH 5E6ID 1KJVA 3CH8A 4YPJA 2WZPD 4JFFA 3OF6D 5IKCA 5J06A 3FN9A 3C60B 2W92A 1TETL 1SYVB 2V7NA 5I1HH 1A4KA 2R2CA 1NCCH 3SOBH 3GJFH 1MHPH 2IBBA 12E8L 3O3BA 4O51B 2YC1B 5IB5B 2NY6B 4U1LB 1YZZA 3PWJB 1DR9A 3D0LB 1WAAE 4MJ6B 1NCUA 2ED9A 5ICXB 1FNGA 5M94B 4PJAF 3QHFL 4N0UB 4FZ8L 4B5EA 1WCBA 5HYSG 1VSCA 4ONFL 2IFFH 2JCCE 1FFPA 1VACA 3JBG7 3FT4B 1YECL 5I15L 1A14H 1QEWA 3D0VB 5IVXF 2I26N 2WWMC 5GS0H 5DUML 2W0KA 4KU1A 4YHOH 1DLFL 1AO7B 4HS6B 4GOSA 2O93L 3K4ZA 3BOVA 4EXPX 5DURB 1M6OB 4YNYB 4R97B 2ESVE 4R7DA 4MXVE 4NQCB 1N2RA 4FRWA 4WIQA 1BD2D 1WICA 2QHRL 3PL6B 1BPVA 4XMKL 3K46A 1TENA 2ID5A 5C7XL 1M71A 2NW2B 5DJ2A 3FFDA 2V17L 4O2FA 1OW0A 3I50H 1NGZA 3ZSTA 4EVNB 1CFSA 5C0JA 2QSQA 3BWAB 5HSFA 1IBGL 1F13A 2X4QA 1UC6A 4GLRH 3O6FB 4RBPH 5C0DA 2VXQH 2RCSH 2EZ0C 1CF8H 3QB7C 1ZK9A 4K7PL 5JHDE 1JWMA 4RIRA 4FQ1H 4KJQD 4BH7B 4DKFL 1FCGA 2XKNA 2V7HB 4R4NC 4LLDA 4S11A 3L5IA 5HGAB 2FX7H 4AK1A 4GG6E 3O4LB 5AEAA 1OD7A 2DYPA 1M05A 3L9RB 1F90L 4LLWB 4GXUN 3JUZA 5IF0A 1XIWA 1VGKA 5F9WC 4KJPC 1LGVA 5T3XE 2UWEA 2E9BA 3DVGA 2Y36H 1NJ9B 1QR4A 2LV4A 4NWUL 3FMGH 5HHPA 3SDDB 3U79A 1CFNB 4WU7A 1CIDA 3NACH 3BUYA 5CGYC 4ZFGL 3ESVF 3MGAA 4PGBB 1FZKA 2OQJB 2YPVL 1UM6L 2PXYB 3LDBC 5ENWA 3WN5B 1LO0L 5C0BB 3MRBB 1JPTL 3U48A 2PO6B 4UB0H 5HHMD 3BZEB 1QSFB 3DI2B 3B5HA 1L6XA 2V2TB 1BZ7B 3GK8L 5HYSB 3GJFA 3BPNC 4LAQH 5D7IF 2P5WB 3MGOB 1BFVH 5FGBA 4XNZB 5E2WL 1ZHLA 3MSPA 4P2RE 1G7JB 1MI5E 4RAUB 5DMYA 4JY5L 3BP4A 3L95B 3QQ4A 4M1GH 5CJ5A 4OFYA 4MNGE 5LAXA 4EN3B 4C55A 5FYJH 3KPQA 5L88H 3FQRB 1K2DB 1VFBB 2O61A 3UJJH 4JHBA 2UZYB 5AYQA 4P2QD 5GGVL 5SX5K 3R06A 1I8IA 1W0WB 4QHNB 3QUYB 5DVMA 1ZLVK 5KS9A 4OAWB 1GOGA 3CVHL 4PRAB 4XNXL 5FYKU 1F97A 5FGCE 1LEIA 3BDXA 1DBBH 3ZTNH 3WLBB 4ELKA 3MRRB 1II4E 3QT2A 1X5HA 2DL9A 1H3WM 1S5HA 3DURB 1NFKA 1DQDL 5EU5B 1A02N 1HE7A 1FN4A 4MNQB 5JOPE 2P46B 3FQXB 3KYOA 2JJVA 4HKXA 4I3SL 1F4YL 4H25B 5IBLD 3TCLA 3SDXB 3VXMD 4UTBH 4YEFA 4MMZC 3DECA 4Y5YB 5J1SC 4NQUA 3PE9A 2W60A 3RUGB 1I7ZB 1INQA 2R9HD 4ZXBD 1U8JA 4LSSH 1GAFL 1NC2D 4I18A 4N0FB 5HI3D 4JZJC 1OHQA 3DXAB 5D2NC 1R3IH 2WUCH 3BW9B 3DX7B 4HWEH 4LHUA 3QJHB 3QAZB 2CLRA 3ARPA 2WWKT 4MXWH 4KPHL 4YUEL 4KKBD 5BXFA 3WNKA 2WLZA 1RZKL 2RHEA 1DQJB 4IRJB 4JEGB 2DTML 2OSLA 1KIRB 1N6VA 5DA0B 1FP5A 5DGRA 4K9EL 4HCRA 2B4CL 5FEBA 5JW4R 1H3PH 1NC4B 1S7XB 4RRPG 3U7WL 4C57C 5DZNA 5B8CC 1AC6A 1IM3A 3ECBA 32C2B 4JAMB 4ZFOB 2Z31B 1A6UH 2HFEA 2FL5B 4TUKL 3PWUB 5FO7A 3D2UA 4O2EB 4AG4H 3CFKA 3AREC 1EAJA 5CEXB 1D6VL 1BIIB 1PDKA 3AM8C 4QRUA 3MV7E 5LBSL 2DQTH 4PD4J 5D2LB 5D9SA 1V3JA 2EDRA 2EDXA 3JV5A 5TF1L 4OFPA 5B3JE 4HJ0C 4NO0D 3AS0A 5GZND 3W2DL 1MQKL 1G0DA 4Y19E 1IGIL 1NUDA 5E2UL 2IPKB 1X6NA 5ADOL 3CD4A 1UKTA 3LMJL 4D0CA 4WDIB 2WANA 3CFJB 1IM9A 1HN1A 4CVUA 4PTUB 4IRZH 5HHXH 1YJDC 4J8RA 5DJ0A 3KPLB 2DQCL 5EBGA 1LO5B 1Z5LB 1UWGH 5F6IC 5EN2A 5FO9A 5I1CH 1QPPA 3L5XH 5IMOA 2AV7B 1HDMB 4Y16C 4JRXD 5CZKA 2BX5A 3WDIA 3H3KA 3PHOA 4CDGC 2VN7A 4M00A 1J87A 3O8XA 5C3LD 4WI2A 2JJSA 5C09A 5KAQG 2VLMD 3MFFB 3VD4A 4Y5VC 1KELL 1MCPL 3RNQB 1NKOA 2AABL 3BGMB 3L6FB 2VISB 4DUWA 1FVCA 3IJSA 1RZIB 5MI0B 3BAEH 4JJHA 2HVKA 2WBWB 4NZJA 3GSRA 4LGPB 2JF1A 3LV3B 3QO0B 1KENL 2WWMD 1R3HB 2EIEA 4HPYH 1IKNA 1JYXA 4FTVB 2PCPB 1IRAY 2YA0A 3NFNA 3QFJE 5EC2A 3E6HB 1ZA3B 4HS8H 5E03A 4IDLA 3SOBL 2V2XA 1MHPL 4OCNC 1F6LL 4PJEB 3CFDB 3G04A 5C0FB 4BQBA 1S7QB 1XMWA 1GZPB 1R5IB 2E9JA 4XRCA 4Y8DC 5CLWA 5D93C 4S0TD 3F12B 1S9VB 1FL6B 3RVTC 1CFTA 3ILPA 3HPJB 1MRCL 3QDGE 1JP5A 5T33L 1PQZA 1TCMA 1A7PH 4HZAA 3X3FL 1NAKH 3JV0A 3IB4A 5I1EL 3R8QA 1Q8MA 3V5DA 1J10A 3ULVC 1JF1B 1E0OB 2VLRD 4JM2C 3U36B 4YHOL 2F53B 4QYOA 5HGHA 5E8NA 4P5KB 4XVJH 5CUSH 3S96A 2YBRB 3KPSA 1MUJB 5JPMB 1X7QB 43C9B 5DQJA 2OXGA 5GSVB 5JDSB 1A3RH 5D6DC 2H45A 1MJJA 3DRTB 1T6WA 4M7JH 5HYJD 3NCFB 4M9PA 4L3ED 4YZFE 4PGCB 4Z0XB 2C3XA 3NTCH 1I1AC 4OJFH 1E4XI 3CUPB 3V4PH 3L5HA 1ORSB 5CP7B 4HW6A 3I50L 5CJXC 4JFDB 5EU3A 1I3GH 4L4VB 4KHTH 2WINB 4J6RH 1WTGT 3IRZA 4X7TB 4I5BB 4HKJA 4Y1AE 1MWAL 2EDDA 4UTAL 2X41A 4UOW0 1AD0A 4QXWA 4U1SB 4FQ1L 1M7DA 4R96A 2ZUYA 4MA3A 3PUCA 3TVMB 4DWHA 2BSSB 4DZBA 4MAYC 5C9JA 3QG7L 5A40E 4M6MH 3BI9X 1E28A 3OKMA 3UDWA 3AROA 4CAGA 3P3YA 5E4IA 2DBLH 5TGBA 4PLNC 5DC0A 4WFEE 1JF6A 2F58H 4GMTH 1FVEA 1P4BL 1A5FH 2AJYH 4K07A 4HGWB 2BNQE 1XF4B 2LVCA 1A6VH 3GSUA 3FMGL 2BHZA 3DGCR 3V0WL 3MLSH 2CLZB 2VJXA 1A21A 1BLNB 4OZGB 4XNMA 1DL7L 5FHBL 4GRLA 4G8EA 2FX8H 3H9SD 4NHUA 5IT2H 1OTSC 1J1PH 2D4FA 1E4KC 1I3VA 2B1HH 4FZEL 4Z77A 3U2SB 4KROC 4CMMA 2NY4C 5D1XC 4JFHD 4JO4H 3UTSA 4MS8C 4LAQL 5EZOL 4MQXD 1DE4B 1UH4A 1EEQA 3C08H 3FRPG 4Y4HD 1EBPA 4KGLA 5IG7B 3PGCA 1VENA 3LPWA 4FP8H 1Y6MR 2HLAA 1N5AA 2J6EA 5F7KC 2DI7A 1NCBL 5FYJL 5F96L 1K3ZA 3VD5A 2JK5B 2DQIL 4TTGA 1RIHH 2X10A 4PREB 2NMSA 3MRCA 3C6LA 2OJZH 2F5BH 2VNCA 1FLRH 3MO1B 3MRPA 4X7SH 5IM7B 2NXZD 2L4OA 4YFDB 5HXMA 1ULVA 3B9KC 2RFXB 4J3VA 4OT1H 3BGFC 1DBBL 4RFNC 4ZYKA 2VDRH 1YMMD 2BNUB 4JQIH 4YHYB 3AY4C 1FV1A 2E6JA 1X5YA 3KS0J 4P2OA 4PBXA 4S1DC 1IEBB 2KL6A 4TPRL 4NRXA 4EEEA 2BNRE 1GSMA 5DMIL 3Q1SL 3Q3GB 2NY1D 4TVPH 3KAAA 5I19H 2VLKD 3FOLA 1CE6B 2NY0B 4YDLC 4LLVB 5CSZA 5DK2B 4UTBL 5EO0B 1V7ML 2ZUUA 2J8UE 3PP4H 4G8FA 2GCYA 4QGYA 3CU7A 4Z7VA 1FYTB 2HVJA 4EOWH 5JW5B 3D39A 4PJ8D 4FQQB 4Z7UB 4HWEL 4TSBH 1CXFA 4MXWL 4U2YA 3C6SA 4TSAH 1N6UA 4CNIA 3X14A 4KKAC 4RMTA 1PZUB 3QI9A 5EBWA 3RTQB 1CICB 3BP6A 2VKXA 3DV4B 4L8BA 1VKXA 4XTRD 4ZUSB 3ZDXE 4PJXE 5I0ZA 1W0VB 1J0HA 2APBA 3CFEA 3OPZH 5C0RH 4NGHL 3PQYA 1S7WA 3SE9L 5IHLB 2ZCLL 4Q74A 4R7NB 3PP3K 2EDJA 3BH9A 5E94B 4LKXA 1Z2KA 5AG8A 2ATKA 4YDVA 3HC4L 3AMKA 1D9KA 5L6YH 4M9OA 4AJ0A 3CSBA 1JZ4A 5DVOA 5I9QC 2W65A 4QRPB 5DO2C 3SKJH 4YXLL 4YGAB 2ITDA 2BY3A 4IRZL 5HHXL 4LDLB 3MREB 4CN1A 3GHBL 1UWGL 1XCTB 4G6JH 3UBXI 1ZLSL 4JB9H 5E2TH 1FIEA 3U46A 3GSWB 3H0TB 3WKNA 3RVXD 4JO2H 4HX1B 2W9DL 4ZUTA 1AHWB 2IQAA 4NO5A 4MYWB 4NYLB 4F15C 4B0MM 7CGTA 3EYUL 3KNBA 5IB1A 4ZD3H 3FN0H 3QIBB 2AK1H 1RK0A 4NKIL 5GS1C 3IFLH 3GSQB 3CFCH 2B0SL 4PY7A 1S7SB 4Z7WF 4KRPC 1KTKE 3T8XB 3ARFA 4ENEC 4NKDA 3QJFA 2JB5H 1XGPA 4UQ2A 1OGAB 3V5KB 5DFWH 4HPYL 1FO0H 5J89A 3GBMH 5KTEH 1XCQB 3AFLA 4JM2D 4I77L 3VH8G 4F7PA 3D3VB 3DETD 3VE0A 4Z7VF 3VD7A 3EJYD 3QNYA 4EIGB 4LARH 3AC0A 5T3ZD 4KJWC 5MENA 4M1DH 1ZHBB 3KXFE 2VUOA 5J13B 5H94A 2QLVB 2F5AH 3W5MA 4NN5B 5GGUA 2BY2A 1AQDA 2CRMA 4PJAB 3RL1B 5BMFH 3WHXA 1NAKL 1K4DA 4JREC 5IB2B 1NCWH 4XWOC 4BELD 3C60D 3LKPB 3ARWA 2F54A 3TBVB 3O2DL 4KK5D 4I2XE 3U4AA 3N9GL 5EBMB 3SPVA 5FXCH 1H3VA 1QRNB 3TO4C 1FL5B 2NY6D 2Q6WA 5IVXB 5CUSL 4K3GA 2AEIT 2YD7A 4Z76A 2OBGA 1WQVT 4XBPA 4XHJD 3VWKB 4P3DA 1S8DA 3M8OL 3FO9A 1A3RL 5BVJA 3MA9H 3KLSA 4OZHE 2GTWA 4GS7B 4XXDA 2VB5A 5KSBE 4ORGB 4OJFL 5E5MA 4WO4C 3VFNB 3V4PL 4AT6B 4U7SA 3LQZA 1IEAB 1T4KA 4YXKH 1U93A 2D0HA 1I3GL 1FZJB 5LCVH 2JIXB 4JRYA 4KHTL 5BQ7B 2PYEB 4FA8A 4TTDD 2VXSH 4P5TA 4PY8I 3EO1B 3WS3B 2N4IA 4UOJA 4NQCD 1HH9A 1HHIA 4OQTH 3RDTC 1J11A 4KK6C 4N8VA 5I8CA 4AM0B 5IHUH 1KEGH 2FLBT 3S36X 5EO1B 1TIUA 4N90D 1U3JA 4PGDA 1A47A 3G5ZA 1MFEL 2MNUA 1CDHA 5ANME 2QQLH 1JBJA 3FO2B 3QIWB 2QQNH 4GMTL 4QTHA 5AWNH 2OK0H 1JHTA 4XPAH 3CVHB 3BPLC 2Y4SA 3ARGA 4JFPA 2VLJE 4HULB 3O6FD 3VH8B 3HE6B 5DJCB 3MLSL 3IDIA 4MD4A 2NLJA 2V7NB 1A4KB 5DD5L 4E5XA 3VXUD 4HDIA 4UUJA 3DGGB 4L4TA 4IMKA 5IT2L 1VEPA 4YBLB 5HD8C 1EFXA 1FO0A 1SYSA 2B1HL 1MCOL 1TVHA 1A7BA 3O4LD 5ELIA 3VFUA 5JMOC 4JO4L 4WW2A 4Q2ZA 1AQKH 1IGYB 3HE7C 2DI8A 3BN3B 2E7BA 5TQ0H 2R2EB 5DMJB 1KB5H 4HQQL 4FP8L 2PN5A 5EOQL 2FBJH 4FQ2H 1JTPA 5D7IB 5CAYB 1AKJD 5F1SA 3U6RB 2R0ZH 1BIHA 4DGYL 1QLRA 1RIHL 3CU1A 3K2UL 2F5BL 4X7SL 5MEQB 4MVBC 4WUUB 1Q1JH 35C8H 1QSFD 2FEEL 4O9HH 2E7LA 2DM7A 4WTZG 2V5MA 4G6KL 4OT1L 4BUHA 2AJXH 5JTWA 4YXHL 1EVUA 2VDRL 4X6DE 3J7HA 4Z78B 2XFXB 3FFDB 2E3VA 4EN3D 3MV9B 1RJZA 4L8CA 1JF5A 1LDPH 2Z93B 3LKQB 3ARBA 1JFQH 2J4WH 3OZ9H 4X5WB 4OZFG 2Z8VC 2UZIH 3WUWA 3VFGH 3NZ8B 4OUOA 4TVSa 5E99H 4YFLI 5I19L 2AJ3A 2X4QB 4P48A 3ARDA 1W72H 4E9LA 5DUBB 3QUYD 3PP4L 2QL1A 4RX4D 5J11C 2VQTA 1DLHA 3QG6A 3QH3A 4RIRB 2HJKA 5I1IH 3IAQA 4LCIH 4OB5H 2GT9A 1A2YB 5DS8A 4EOWL 3UAJC 4TSBL 1ITBB 3BQUA 2IAMA 5DJZA 4JHWH 4TSAL 4OQTA 1MNUH 2QSVA 5BV7H 1G7LA 4M8QA 4ORZC 4OGXH 2BDNH 2ADGB 1JGVH 1ND0A 1XIWB 2BVEA 3RVWC 1IEHA 3QXAB 1EEUA 3ARVA 4TQEL 1F6FB 5E6ZA 5JXAH 1U6AL 3DVGB 2VZOA 3FTGA 3NFPA 5GGQL 5IROC 4EQ3A 3OPZL 3ALXA 4XWGH 1Q9LA 4D94A 3E2HB 3BRFA 3L7FB 4DK3A 1NCAH 1U3ZA 5KSAC 2R56H 4PJHE 1EZVX 3HRZA 5D7LB 2EC9T 4XPFL 5C6TL 4KXZI 1HHKB 3DXAD 2EIZA 3M1BA 5CGMA 2NXYC 3KPTA 3M07A 2CRIA 3L3GB 4OGAC 1FFQA 1J1OL 5CJQL 4PJIF 1C12B 3NCYS 5L6YL 3IXAB 1W8NA 2BCKB 4XZUB 3DNKA 4F7CA 2X4UA 3SKJL 2Y5TA 4KQ4H 1HI6A 4K71B 4G6MH 5F6HJ 5F97E 1ACYL 1NC4D 1ZHLB 4CVWA 3X11A 3RA7H 2Z31D 3O3AB 4NQDD 3BP4B 3QQ4B 2AEWA 3K8LA 4O5LH 3DBXB 5LAXB 1HQ4B 4PTTA 1Z9SA 4QY8B 5E2TL 2YD3A 2Z91B 1LNUA 1T0PB 2O61B 1BX2A 3FKUS 1KB5A 1I1YA 3UTZA 5HYQB 5INDB 1P7KB 5EC1A 2AV1B 3R06B 5F88B 2X9XA 1OP3H 4RGNB 4JN1H 4ZD3L 4V2BA 3FN0L 3MJ9L 4IHOA 3UTOA 3D87B 4XPGH 8FABB 5T1DH 1CLOH 2E7CA 3IFLL 2YUWA 3LPGA 1H15A 1X4ZA 2RR3A 4U0RC 2JB5L 1JNHA 2OR9L 2WWKO 2NY5C 5E95B 1C5DB 5K59E 4OZFB 3SGKC 3GBML 1SBSH 5KTEL 1O7SA 3MJ7B 3BJLA 5HJ3B 2IPTH 1VA9A 1D5BB 4QF1B 2A9NL 3KPOB 3TCLB 2H2PC 1GL4B 2XTJD 1T21B 3LQAL 3WFHA 2W60B 3QWRD 4FNLL 4QHMA 4DGVH 1WBXB 4H5SA 5FCUH 1MOEA 1U8JB 1XGTA 4N0RA 3WNNA 3VXPA 5DFVD 1G7HA 1AGEA 1MWAB 2D0FA 5E4EB 4M5YH 2Y5EA 1W72A 4M6AA 4WHTA 4CGTA 4P9HC 2CLRB 1KYOK 2F5AL 4JFFE 1F2XK 4NC1E 2J5LC 3QEQA 2H41A 1KN4H 4PRHE 3F8UB 2OSLB 5BMFL 4U6VH 1KIQA 4JN2B 2MCPL 4C56D 4FTVD 3DMMD 4RMWA 2FZ3B 3QCUL 3ECBB 3O2VH 1OQOA 3DSFL 4NSKB 2X6MA 5A2KH 2DDQL 3O9WB 4M1CD 4WENB 1ZSDB 1DUZB 3G6AB 4I9WD 3RIAK 4QRUB 1PKQA 5I8KH 1NANH 2PF6A 2X1PA 4DGIH 3VG9B 2JTDA 2HH0L 1V3KA 3TESA 3NAAH 1PG7W 4P4KC 4LSPL 4AENA 4HXBH 5C0CA 4UILH 4HAGA 1KJ2H 4ODVH 1ZWIA 2KDGA 5DQDH 4I13B 1DJSA 1MJ8L 4R26H 4J8RB 1CDYA 1LILA 5EOTA 3VCLB 1UACL 3VD9A 4NFCA 4J1UB 2LFGA 4L9LA 2ORBL 4NQEB 5EIIA 3SHSA 3GKZA 4BFEA 5I6XB 3P4LA 4NUGH 4P57B 1UB5A 4M3JA 4MZ2A 4JG0L 5F7YC 1UEYA 3NIDF 2XPGB 3TJEH 3RIAF 4WU5A 2MWCA 4QRSB 3REVA 4PJ9A 4JFOA 4EIZC 1FVCB 4J4PD 3IJSB 2CKBA 4JFDD 1QACA 4L4VD 2AJSH 3TBSA 3AUVA 5JW4M 1I85C 5AWNL 3GI8L 3ZL4H 2DD8L 4XPAL 5JO5B 1D5MA 5D5ME 1A7OL 1F6AA 3NGBB 5EC2B 3WV0A 1A0QH 4MJIB 5J0BA 3TBWB 2CKNA 2UUDH 1J5OH 5BOPA 5I8OH 3TH4T 3SCMA 4LCUA 3VFOA 2DQEH 5F7NC 3IS1X 4HUKB 1XR8A 4OLZH 5AZEH 4CJ1A 4M48H 1R0AH 3LOWA 4PGEB 3N1MC 2UWEE 5C0AA 1AQKL 1CFTB 1Y0LA 3DHMA 4UQ3A 1PG7X 1HHJB 2XNAA 4JO1H 2UYLA 3BSZL 5GRYA 5TQ0L 2WK2A 3V5DB 4BYHA 2ARJB 2G2RB 2R0ZL 1J8HB 1C5BH 1FJ1A 4PLKC 5TH2A 1N3NA 3KWWB 3STLB 5HGHB 5L2KB 4K2UL 4RAVA 2MQ3A 3KPMB 4XCEB 1KPUA 4GKZB 3S96B 4LMQI 4PJCE 1OP9A 4RGOL 4YX2H 4XXCA 3KPSB 4QOKA 4DZ8B 2YD5A 1Q1JL 35C8L 4O9HL 4Q6YA 5E6IA 2EDEA 4R8WL 3RWEA 1RIVH 3S37X 3OF6A 1P2CB 2VZ1A 5I76A 1LO3H 5J56B 4X80H 4P3CL 3NCJH 4YK4C 4NO2A 4C83A 4ESKA 1BOGB 1G1YA 5C86A 1QSEE 1A9BA 5J12C 3DO7B 5BCAA 1QLEH 4FOMA 2VDLL 1JFQL 2FGWL 4MQ7A 2J4WL 1JK8A 5C92A 4GRMA 3KLAB 3K8KA 4WHYH 4W4OC 1QFWH 5E99L 1KJ2A 2CIKB 2VSCA 1WBZB 4HIEB 2YXFA 4JPIB 5DJAB 2XKUA 5BJTA 2GK0B 1M7DB 4R96B 2NXYD 2CDGB 5I1IL 1ES0B 1NGQH 5MERB 5C9JB 5I1GL 5K93A 2WIMA 1WGOA 5AAWA 2P24B 1CDCA 1KCVL 4W6WB 5BVPL 3UYOD 3ZYJA 1E28B 1NBVH 1HQRA 3OKMB 5IESL 1XF2A 3SQOH 2GQHA 3BZ4B 5JNYB 3HUJA 2P5EB 3EGSA 3J8F7 1MNUL 5AD0A 5E00A 4BFBD 1YEEH 2ZJSL 4G9DA 4IMLA 5FO8B 2BDNL 5GGRA 1JGVL 1MIMH 1BD2A 2NY0D 5JW4N 5JXAL 4D9LH 1QFWM 1IGMH 1N6QH 3G5YB 2I9LB 3GSUB 2K9UA 4QXUL 4I4WB 3GMLA 4N1HB 4GW1A 3LEXB 4XWGL 4OV5A 3QUZC 5DVNA 3GSVA 5KOVC 1UXSA 3V5HA 4UIMA 2R56L 4GRLB 1I1FB 1CE1H 3BMVA 3HLAA 4LHJB 1CQKA 3VXTB 2C3HA 4OD1H 1JZ5A 4I3RH 3NBNA 1WEJL 1CCZA 1LMKA 4LEOB 3ROLA 5IEHB 4HT1H 4U7KA 5DEFA 3KYAA 1JGUH 2H8PA 4Q7DA 4U49A 2VITB 1EERB 3RTQD 1CICD 3PGCB 1S78C 4NBXB 2G9HA 5FYKE 3IDNB 3RA7L 4BQ6A 3IKKA 1EAPA 3S88L 1EUTA 2HLAB 5GSRA 4GW5A 3ZT6A 4O5LL 3D6GA 1YEJH 1FG2B 5CZVH 2OR8A 4X6CA 3EDKA 5SV3A 3QXTA 5D72H 5FYLD 3S3PA 4F7TB 3WO4C 4AMKL 2H2PD 5I75C 1TNMA 2NY2B 2EECA 4TNWK 2YRLA 1HEZA 1YNLH 2XA8H 3MRPB 3T0BA 3GMOB 1YEDB 25C8H 3CFIC 4WV1A 1GZQB 4FFVD 4NFBA 5CIPH 3I9GL 3FONA 1XGYH 3T0EE 4XPGL 4QRPD 3MRFA 2HKFH 5ESVA 4L3CB 4ZYKB 3BH8B 1TMCB 4O4YH 4F8QA 2Z8WC 2NW3A 3VJ6A 2NTFA 5AAMA 3ME0A 2P43B 3QRFM 3LKRA 4LNVA 1JN6A 1SBSL 4Z7WB 2IPTL 2UUDK 4ZFZA 5C09E 5GGSA 3HC3H 1EHLH 1DUYA 5AG9A 4ODUA 4N5ED 2V5TA 4YDKH 3DV6B 2IADA 3WXWH 4DGVL 1LO2H 3TN0C 5FCUL 5I1KH 5CD3A 3BKJH 3MGTB 2H26B 4Y4KB 5A2IH 1G7PA 4UT6H 2BSRB 4Z7VB 2CO7B 1GC1C 3LZFH 5TPWH 1RZGB 4N5UA 2E9IA 3D39B 1KG0A 4TNWF 4IRSB 4M5YL 1R5VA 4LPUA 3W82A 4PRDB 1JYNA 2BNRB 3MLYH 4P2QA 4KZDH 1OGAD 4U6VL 5DD3H 1F00I 4LCWE 4Q9QH 1VKXB 1JRHL 4HIHB 5FUZH 1NEZA 2XQBH 2YN5A 1XAUA 3DYPA 3WFEH 1INDH 4HF5H 1ZHNA 3KVQA 3ELAT 3H7BA 1MHCA 3KJ4C 2LE9A 4KUZH 4MNHA 3PJSA 1EO5A 4OCYH 4S10A 1QOKA 2WW8A 5SWZB 2W07A 2A6DB 4PB9H 4QHLB 4LKXB 5I8KL 2V5YA 1E4WH 1IC7H 2ATKB 4YDVB 4X7DC 2GUOB 5I74B 4JPKL 4PG2C 3VXMA 3F7QA 3ESUF 1I7RA 1ZMYA 3NAAL 3CX5J 4HXBL 2YZ1A 3WIFA 1UT9A 4UILL 4ODVL 4U1IA 4ZXBA 3KLDA 5CMAA 4YHMH 2LQRA 4PG9B 1NC2A 4LNRA 2A83A 5DK0A 4OFIA 4JDZB 1DDHA 4I0PD 1QRND 4NNXA 4P5MB 4HWZA 3UPCA 3JTTA 3PG2A 4YQXL 1T20B 4BK4A 2DAVA 1AC0A 1RZ7H 2VDQH 3VWKD 5ESQB 4ZUTB 3TA3C 4PGZA 2IQAB 2Q76B 3G6JA 3QIUB 1AGDB 3OX8A 4LPTA 4WEMB 1RUAH 2BOCA 3QA3A 4X4YB 3WLWC 4I0KA 5IB1B 2MQ0A 1UB6A 5MEPB 1SVZA 1TQCB 1U8KA 3I2CH 3ZKQD 1AR2A 1AGBB 2X1WL 2UV3A 5IW1B 5D1ZB 3BD3A 1XGQB 3VGHA 5T1MA 4RGMB 1EMTH 2JIXD 2IMMA 4DKEL 3TBTA 2PYED 1RJYA 1AY1H 3ZL4L 5CIPA 5LJYH 1I3RB 1XGPB 4CRPA 5FB8B 1Y18B 5EO9A 5GS3A 3QCVL 4NO0A 5IMKA 5KVFH 5AYUL 1XZ0B 4PLKD 1L0XA 5I71B 3ULUF 5INCB 1QBML 4ODHH 3WJJA 3OL2A 3QNYB 3S3SA 1BQUA 2YUXA 3JV6B 3INUH 2DQEL 2R69H 1YEKL 1WISA 1S7VA 1RPQA 2JJUA 5AZEL 1YYLH 3U30C 2P45B 4U1KA 5E8OA 4I0CC 1G9MC 4KDVA 3VI4E 1XH3B 3GRWH 3OKKB 3ZE0E 4JRXA 2A74A 5H94B 2EYRB 3GNMH 3RWJA 5GGUB 4KVCH 3MUY1 2DQFB 4YJZL 4UOW1 1BOYA 3WHXB 3WHE0 1T89A 3FQNA 3RX5A 4XVUD 4U1MB 3HE6D 4Y4FB 3BKCH 4MA1B 4OKVA 3LB6D 1F4WH 1TNNA 5FHAL 2VE6A 4OKDA 5FYKL 5E24E 4GW4A 3UTSE 1HKFA 3EHBC 5F72S 4R2GC 5E08H 3ARQA 4YX2L 4Z76B 3G9AB 5DMGD 3MUGA 2I5YL 1ZHKA 4H26B 1RIVL 4XH2A 3IDGA 1OAXH 2A6JB 3FO9B 3RRQA 4JY6B 1NMAH 4HJGA 2IFGA 1EO8L 4X80L 2GTWB 4NP4L 5EA0H 3NCJL 3VFWB 3GHEH 5HVHC 4NNPH 3PL6C 4I2XB 1L9MA 2FNBA 2XI9A 1JHLH 1T4KB 2ZSVA 1U93B 4LPCA 4PJGA 2BJMH 1EO7A 5ID1B 3HTLX 3ULUL 2IANE 4KJYB 4JFQA 4GRWH 3C5SB 1S3KH 1NLDH 1QFWL 4D9RD 2OZ4L 3DYMA 4HEPG 4ZQKB 1T3FB 3S4SG 4WUUD 2IH1A 1FNHA 1G7IB 1NUGA 4JKPH 3TPUA 1UJ3C 3QHZL 2DKMA 4PRPE 1HH9B 3GSXA 3WNPA 1F11A 3JWOC 4S2SA 4JM4H 2PETA 1NGXA 1MCCA 2VLRA 4Q6IB 2Y72A 1BP3B 1DQMH 4ZAKB 3T0DA 4NN6C 1MCNA 4HK3N 1RZ8B 4OZIE 2FJFA 3N06B 1R3JB 3MV9D 5EFIA 3E3QE 4ODWB 3AU1B 1LP9A 2KBGA 5CCKH 1JHTB 2ESVD 5ACZA 1AGFA 5HYJA 4MB3A 3MV8B 3ZO0A 4L3EA 4WVRA 1KLGA 3BN9D 1OAUH 4V1DE 4PP2A 5I73C 5CILL 2F8XC 5BZWB 4E5XB 4FABH 3BESR 3SDDC 4F3FA 2X44D 1A3QA 4X8JB 1CE1L 5HI5D 3D25B 5I30H 4NQSA 3GIVA 3IKCA 1EFXB 1SYSB 1C08A 4LL9A 4I3RL 4JFXA 1TVHB 3MODL 1G9NC 1D7FA 4NC2B 3VFSB 3H3BC 1ZLUH 3QBTB 1D5ZA 1LWRA 3WE6B 1U0QA 4Q2ZB 3C9NB 4P4RB 2PO6C 3SDCB 1JGUL 2A6KB 2DLIA 2EXYC 3DLQR 4HLZG 1GOHA 4PJIB 3LKNA 3PQYE 2EDBA 2GJ6B 1YJDH 5CZXD 1CGVA 5FECA 3MOBH 3KLHC 5JR1H 3CNKA 1YEJL 3GRWA 5IB3A 3PWLA 2YEZA 4G80A 4U6HA 3QUXD 4GBXC 5D7LD 2Q7YA 3O4OB 3PNWB 2P42B 2X1OA 3P0YH 1IGJB 1YNLL 2XA8L 4GSDH 2FB4L 3ZE1E 2NR6D 3RWCA 1AGCB 25C8L 4JGUA 2QV2A 3K81A 1XGYL 3BZFB 5T3XD 2M1KA 2WV3A 1NMBH 5B38A 2HKFL 1U8PA 3DSNA 5EU4A 5J1AA 4PJGF 1S9XB 3H9SA 1MCIA 3FQTA 5ADPL 4MCZB 2R2BB 3X13A 3TH2T 1WIPA 2O5ZH 4Z7QF 1EEZA 1IQWH 1ZS8B 2ZP0T 4L8CB 3S98A 3OKDA 3RIFK 4GLRI 1M7IA 3L3JB 4P9MH 3D1MC 2UVEA 2ADFH 4Y4HA 3QDJB 4LASH 2G60H 4H8WH 1U95B 3S4SB 3ARDB 1ZT7A 4U0QB 4B41A 4S1SH 4XB8A 3D18B 3CZFA 2GJZA 1LO2L 4RGND 5I1KL 4M02A 1ZOXA 3P40A 3QH3B 3TGXA 1HILB 2HJKB 3AAZA 4Y5YC 1MI5D 1X4XA 3LZFL 2ARJQ 5DS8B 5F1NB 3M17A 3EYOA 1P1ZB 3BQUB 2IAMB 4PJ5B 4WY7H 3OKLA 5DJZB 1I7TB 2R29L 3MLYL 1DBJH 2G75A 3CSGA 3QNZA 4WWKD 1XF3B 2CJUH 3GUTA 3QULA 5T1KB 1UCBH 3H8NA 5DD3L 2Y06H 5E8DH 4N1EA 1LK2B 1ND0B 4G43B 4IRJC 1AD9A 3KHQA 2FO4B 1YMHB 4BSWB 4PY8J 5F9OH 4ZDHB 2X05A 5ABDE 4ZSOE 2XQBL 3B2VH 4P3WA 4TVPE 4KQ3H 4XGZA 5MENE 1YMMA 1Q9LB 1INDL 4HF5L 3HKFA 3WXVH 4CMHB 1UWXK 2R23B 1F4XH 1BAFH 3RIFF 4PJBF 3N85H 4M4RA 4OCYL 2EIZB 2WBJC 4PB9L 4NZTH 3CXDH 1RK1B 2N1KA 5I1JH 5T3ZH 1E4WL 1MHHA 1IC7L 4MJ5B 3RVUC 5JXEC 2VLKA 5GRJH 2QR0A 3GMMA 3GJEB 4AQ1B 1N7MH 2F54E 4OCSL 5KSUA 1TFHA 2KPNA 1R5WB 5EUKB 1CN4A 3C5ZD 3KS0H 2MPAH 4F7CB 2QQKH 2FD6L 1C7SA 3AM8A 4YHML 2A73A 4E0RA 1K85A 4XCFH 5E56A 3X11B 4DN3H 4PJ8A 1U41A 2EYSA 4LSRH 1NBZB 4HWUA 1DVFB 3O9WD 2AW2A 4Y7MA 4K3JH 3VWJB 2Y6SC 3PHQA 4WJ5A 1B0RB 3U9UA 2VDQL 1BX2B 3FCTA 4IS6B 3UTZB 1BZ9B 1WZKA 5EC1B 1RUAL 5J6GA 1UWEL 4LBEA 2XWJA 5D71H 3UO1H 3I2CL 3RFZC 2LAAA 4JRYE 3K80A 3DUHA 4F7EB 1MJ7H 1P4LA 2ZOLA 4LVHC 5F1OB 2CXGA 1EMTL 2PTTB 2VIRA 3TO2B 3EOYG 4K8RC 2LABA 1C1EH 4UT7H 4KRLB 5KVFL 4NQED 4LVEA 2DWDA 1NL0H 3LS4H 5GGTA 5F7DA 4GKNA 4ODHL 4KV5F 4RFEA 1MCLA 4GRWF 3GMRA 3WFHB 4CJ0A 1CLZL 3INUL 5FYJD 3SJVB 4H5SB 1IC1A 2R69L 4MQSB 5E1HB 4DN4L 1ZLUK 1IAKB 5B39A 2X7LB 4D2NA 1YYLL 1G7HB 3EOBB 2PR4H 3BKYH 4CADA 3GRWL 4L1HA 4WHTB 1QD0A 4M5ZH 3O3DA 5HTSA 4K3DH 1KN2L 4F7MA 2F19H 2CD0A 3T0WA 1NGYA 4CVXA 3MLUH 4P2YA 3ZTJG 1YUHA 1K8IA 4L4TE 4MJID 3ARUA 3BKCL 3NOIA 4L8SB 3ETBF 2XYCA 1F4WL 3FHAA 1U2HA 2XIDA 4F58H 3JVGA 1YQVH 4HG4J 5BV7B 4NUJB 3JWNC 1IFHH 5GHWH 3T0XA 2YR3A 4NQXB 1K6QH 1OAXL 3V7AG 4JM2A 5IWLA 5EG6C 1IC5H 2D3VA 2XQYK 3EKCA 3T4AA 3GHEL 5C0CB 2W38A 4NNPL 1Q9KA 1KFAL 2UZXB 2R15A 3OXRA 1A6AA 1AXSA 4EI5C 1RURH 3F7RA 4F8TA 1J8HD 4G8IB 1UADC 3V8OA 5DZOA 4MLIA 3FRUB 1WWCA 1NAML 4OLYH 2HTKD 2BVOA 5D7KD 1H5BB 1S3KL 1NLDL 5D6CA 5L2KD 1EDQA 4PB0H 1BBJA 2HG5A 3UTTB 4JKPL 3VGAC 2APTA 4JM4L 3C60A 1SYVA 1UB5B 1T5WB 4AZ8A 3GBNL 1MCJA 4O51A 3TVMC 2YC1A 5IB5A 4GKOA 4NZRH 3PWJA 4WU5B 4XP4H 5DHYB 4NOBA 4HFWA 3D0LA 1UM5L 5ICXA 1Z9MA 4HH9A 4LCCC 5CFHA 5HGBA 4PGJA 5IBUG 3KR3H 4N0UA 4Z95H 5CCKL 2JJTA 1OP5K 4NIKB 3B2UD 2W9EH 2AEQH 1W2KT 2UVFA 3S8WA 3OKNB 1OAUL 3FT4A 4FABL 3D0VA 2WMPA 3L1OH 1J9CT 3EDEA 3P4MB 3SCMB 3VFOB 2NNAA 5I30L 1OAZH 5DDHB 4BQ8A 1XR8B 1YEIH 4TUJB 3PDOB 3S34L 4FS0A 2P5ED 2QTEA 1HXYB 1M6OA 1RJLB 5EU7C 4YNYA 1YN7A 3FQWB 4NQCA 2JE8A 4LP5A 4APQB 2ADIB 1YYMH 2X4OA 3O41A 2UYLB 1R6VA 1TDQA 3QEUA 1YJDL 3TIEB 3MOBL 3UJIH 2NW2A 4PV9A 3TFKD 1U8QB 4GMSL 5TH2B 3ULVF 5DRWB 3ZMRA 7FABH 3EAKA 1T1ZB 1NFDF 2VR5A 4EVNA 3HZMB 4JM2F 5J57B 1A7NH 3RWGB 2ZSWB 2C1PA 4P23B 2LVEA 4OIIL 4XNYH 2R2HA 1OLLA 2DQGH 2ICES 1WVZA 2X4SA 3O6FA 5HVGB 3MBEB 4XVSH 1FZOA 5I76B 2V6HA 2I27N 2DN7A 5ISZE 1EGJL 4OM0H 3VXUA 4U1HB 2HT2C 4P0DA 4BH7A 3CLFL 4PUBH 1Q38A 4LIQE 4XPHH 1TJHL 1DEDA 4NO2B 4C83B 3BISA 4HBCH 2V7HA 4MB4A 5HGAA 3E1F1 1MELA 2OTPA 3O4LA 4NC0B 1QNZH 5DUPL 4ZTPL 1JK8B 4LLWA 1IKFL 2ADFL 2NY2D 3I85A 4GRMB 4LASL 5MHSE 1X3DA 4HZLA 4XP1H 1HNGA 5DR5H 2WBJD 1AKJA 5IMMB 4UT9H 4LRNH 4H20L 2CK2A 1YC8A 2ZOKB 3F6LA 3UEZA 4PGBA 1SQ2N 2DF3A 2OQJA 2YN3A 4WHYG 3GM0A 4GAGH 1DBJL 1NCDH 2WP3T 3WN5A 2XZAL 3HUJB 2CJUL 3EGSB 2BVQB 4KKCC 5IBUB 1QSFA 1UCBL 2V5SA 1ZLWH 4G9DB 1BZ7A 1EHNA 3N1QC 3FN3A 4IIQB 4M3KB 5DD1L 5GGRB 5HYSA 2NYYD 1U3HB 5TDOB 3MGOA 1BD2B 1RJCA 3ES6B 2H3NA 2LU4A 5DJ6B 3ULVL 3CSYA 4KQ3L 2DTSA 2APXA 3GMLB 2VWEC 1FH5L 3ARSA 1G7JA 2Y6SD 3D69A 4RAUA 3WXVL 4LLYB 1UXSB 1F4XL 3L95A 4AEIL 5SX4H 3BRDA 5EU6B 1BAFL 2YPLB 2YPKA 2FIKB 4EN3A 1JGDB 4Y4KD 1WBYB 1MRFL 5JW3H 3QEQE 3TZVC 4YDJB 3FQRA 1OD9A 3CXDL 3HLAB 5DMKB 4IRSD 5T3ZL 3FO1B 5FDWB 2BNRD 3ROLB 5JHLL 1BFTA 3QQ9C 2CMRH 2ZUQB 1CR9H 4K7PY 5DEFB 1N7ML 1NUNB 3PWVB 2HMID 3NN8B 4WGVB 3WDHA 2Z92B 4AIZB 3MRIB 1W0WA 4QHNA 3HNTH 3QUYA 5E6YA 4RX4A 4OAWA 4PRAA 1MCFA 1CDUA 3WLBA 3FB8B 3MRRA 2P49B 5JIKA 4GW5B 1I8LA 4LSRL 4JCLA 1PKQE 1T5XA 3DURA 4QRRB 5EU5A 3C8DA 4FFYH 3MPCA 4NM4H 5SWZD 2BZDA 3QCTH 3BYTA 2DQUL 1P53A 3FQXA 1KTRL 4G6FB 4NOFA 4LOUC 4H25A 1LE9A 4D9QD 4ONGH 3SDXA 1DBAL 4URTB 3K7UA 1AHWC 3AS1A 1CK0H 5D71L 4PJ7A 5KANG 1I7ZA 3V0VA 3MRFB 2XXMB 4G8GE 4KZEH 5HDBE 1UEMA 3DXAA 4LLUB 1EJ6A 5ERWB 3QIBC 4FQXC 2BFVH 1TXKA 2HTLD 3DUUA 4XMLH 1MH5B 2NTFB 1I8MB 1J1XH 1L7IL 5D1QC 4YWGH 4NM8L 3LKRB 1CU4L 1JN6B 2Y9RT 3A6BL 5F1KC 5IIEB 1XF1A 3LS4L 4UAOC 5GISH 2JELL 5GGSB 3QIUD 1NC4A 1S7XA 3CH1B 4ODUB 1A8JH 3LRHA 2F8OA 32C2A 4ZFOA 4OCLC 2Z31A 2MMXA 4NQDA 2A0LD 1AE6L 2FL5A 2QJDA 1D5IH 1OSZA 2B2XL 2R8SH 1NSNH 4KI5E 3GI9L 4O2EA 4BK5A 5DT1L 2PR4L 4DKDC 1CL7L 4UV7L 5GGVY 3BUTA 5D1ZD 3CC5A 4M5ZL 2JB6B 4K3DL 2F19L 5J13C 1Q72L 5HDQL 3EYVA 5IR1A 2IPKA 3SGJC 5GJTL 1HINH 4J7RA 3VDAA 2FWOB 3GFUA 3O3EA 5K9OB 4WDIA 3VFMA 4D0DA 4L8DA 3HS0B 4F58L 1MCKA 1MCHA 1S5IH 5D96C 1OTUD 4M7KL 2YXMA 5C0AE 1LO5A 1IFHL 3ZHKA 3D5OF 5GHWL 1JPSH 5TQ2H 4WW1B 1SM3H 5ESAB 1K6QL 4R4BB 1K4CB 2AV7A 1HDMA 2IMNA 3QXDB 4XX1G 1MEXH 1G1CA 1IC5L 5BS0B 4WFGE 1E27B 3P77B 3QWRA 3WIFB 1Q9WB 1B3JA 2FYYA 3FB7B 4B7IA 4Y4FD 3V4VH 5JORB 5FA4A 1INEL 1RURL 4LGRB 5DK0B 2GI7A 5DF0A 3RNQA 1DDHB 3L6FA 2XXCB 4UIKL 4QOKE 4OLYL 2P8PA 3N1PC 4NNXB 1GGIL 1EX0A 3DVFA 1BGXH 1LK3H 2FH6A 3VRLE 1IVLA 3EYFB 1JGEA 5E7BA 1OAQL 3JTTB 3VFRA 1MFCH 4PB0L 3LV3A 3QO0A 2J2ZA 1UZ8A 1KGCD 1B6DA 2BSTB 4YBHA 3VG0H 1R3HA 1NBQA 4PJ7F 2HFGH 2D7TH 4C56A 4FTVA 1O5DT 2PCPA 3DMMA 3E6HA 1JV5B 3OX8B 1FC2D 1UKSA 3IS0X 1A7QL 2IGFL 3P0VH 3QA3B 3SO3B 3FO0L 4JPWH 5D7JB 2BOBB 5C0FA 2C26A 2VXUH 3ISWA 4H88H 4G6AD 3B9EA 4LSTH 4XP4L 4L5FH 1ZLWK 1S7QA 1GZPA 4PJFE 2E5EA 5J6HB 3QSKB 1NCTA 1SY6H 5GRXG 3GIZL 4Z95L 5HHOB 1WK0A 1YPZA 1FL6A 3LEVH 2YSSA 3RU8H 4NHCH 5IQ9B 4P46C 1KPVB 5EO9B 3CMOL 2W9EL 5IMKB 2AEQL 4FFWD 4K3HA 5AZ2L 1GGUA 3B4NA 3NPSB 4D0BB 4RRPA 3C5JA 1IQDB 3L1OL 4N0YH 5EOCJ 3GMPB 1OAZL 4LCYB 3WIHH 1JF1A 4HC1H 2HJFA 3VXRE 4NCDA 1RUPL 3C87A 1R3LA 4ZAKD 1YEIL 4YBLC 1B2WH 5E8OB 2AK4B 2YBRA 1OSPL 1MUJA 2EDYA 4GFTB 2X89D 4GQ9H 4OF7A 1P84J 1X7QA 2A74B 4JRXB 3RL2B 2HAZA 5JDSA 3SDAD 3DRTA 5ECJE 4KK8C 3MV8D 4JG1L 2P4AB 1VB9A 4ZOAA 4Z0XA 3RKDC 1FPTH 3EYQD 3UJIL 4LPYA 3LN5A 1SEBB 2XWTB 1ORSA 3IJYB 4U31A 1NBYB 2K7PA 2VE6B 2AAVA 4OGYH 4J4PA 2FBOJ 4JFDA 4LLQB 4L4VA 4WHDA 2WINA 3BHBA 4E42A 1RZFH 1KV3A 1GRWA 4XP6H 2R1YB 4XC1H 3WJLA 3T2OA 4FQIH 2VH5H 1ZHKB 1JHKH 1HHHA 1FL3A 4XVSL 2A9MH 1NGWB 3SDCD 1CG9B 1PY4A 2FECI 1OOAA 4U1SA 5J3HC 5B38G 2X70B 1MFAL 4X6CE 1FFRA 4PUBL 4MSWA 2BSSA 2IG2H 2GJ6D 1QFPA 2CUIA 2AS5M 2R0KL 1EXUB 4ZTOH 2R39A 4JFEE 4PJGB 3KYKH 2NY5H 1QNZL 1YNKH 1M4KA 5FM8A 1OW0C 2NZIA 1Y6KR 4JFQB 1OY3B 5FYLH 1OF2B 2B8OT 3KGRA 4HGWA 1T2XA 4WHCA 1MCEA 3BPOB 1S7TB 4PJDF 3B8SA 4S2SB 2CLZA 2D7NA 3CLEL 3ZKMC 5C3TA 1NDGB 3PGDA 4OZGA 5T1LA 1P5UA 3JWDC 2NY3C 5HHME 3L7EB 1YPZF 1L6ZA 2IANB 3VU2A 5TE7H 3B6SB 3ZKNC 2EH7H 2YWYA 5DEGB 1DE4A 2HKHL 3QDJD 4ACPA 1AGFB 2ILLA 4ONFH 1P7QB 4L3EB 4OFKA 5IG7A 3LEYH 1XIWC 1EJOH 4YAQA 5E9DB 3FFCE 5DGQA 2KUTA 3EIFA 1QO3A 1WLHA 1SY6A 1FSKC 4IBLT 4LOUD 5DUMH 3W0WB 5BO1H 5F9WB 3GIVB 2JK5A 3KPRB 3IKCB 1QBLH 4PJ5D 4PLJD 4PJBB 1BQHG 3MO1A 1CR9L 5IM7A 1D5ZB 4U1NB 3LKSB 1UGNA 5IP4A 5T1KD 2AVGA 2RFXA 4IDJH 3WIHA 3ZYZA 3LDBB 4RCAA 4WWID 2ZUTA 5FGBC 4XMKH 3ZKXC 3IYLW 5C7XH 4CBPA 1O0VA 4BJLA 4ZOEA 5IB3B 2EKJA 3BPNB 4X8XA 1T7YA 3HG1E 1IEBA 4U6HB 4NM4L 3VXME 3WYRA 4POZD 4LQ1A 4KDWA 1PGRB 2VDML 4LDOB 2ZCKH 1MSPA 2OJEB 5T5FH 2XICA 2E9WA 1IBGH 4U1GC 1CE6A 4JKKA 4LLVA 5DK2A 2ICWB 5B4MC 5CINH 3Q6FB 4FQCH 3T1FB 4U3CA 1UJTA 3QPQD 4D3CH 5GS0C 3TJHC 5B38B 4K7PH 4YE4H 5EU4B 3B3IA 5J1AB 4DKFH 3H9SB 5FIEA 2OS7A 2BFVL 3X13B 2APWA 1EEZB 3T3PE 4I3GA 1DVFD 4Q9BA 4JHZA 4TULL 3G6JE 3VWJD 2R1XB 4HXAH 1F90H 2I25N 3ZDYE 1K9TA 5M95B 5A2JH 4N1CA 4BSVA 1ZT7B 3RTQA 1IAIH 2GK2A 5K9QG 1CICA 2AJUL 2XQYG 3DV4A 3RY6A 3QDMB 3CZFB 1CTNA 1W0VA 4OCWL 4LK4A 1D5IL 1NAMB 2R8SL 1NSNL 4GRWB 3HPLB 4ZFGH 4R7NA 5C07B 2YPVH 3M17B 4I18C 4DTGH 1UM6H 5E94A 3DX9B 1DTUA 1VDGA 2G75B 5LXGH 3QNZB 4KKLD 1LO0H 1JWSB 3DO3A 5HHVL 3VXSB 3LN4B 3B8YA 4KAQL 3WEXB 5A3ID 5D2NB 3W39A 2GY7B 1AH1A 5BOZG 5ITFB 1RFDH 4U6TA 3JTSA 4QRPA 1QG3A 2Q7NA 2EH8H 1VFUA 4HMDA 3NIGF 1IAIM 4ZNCD 5C0GB 3VFVA 4OLEA 3SJVD 3MREA 3L5WB 4LRIA 3T3ME 4BQCA 3V8CA 3ZDZF 4J3UA 5TQ2L 1SM3L 3KDMB 1GIGH 3H0TA 2J88L 4M6OL 2E27L 5B8CB 1FGVH 5DRXB 3RZCC 3OG4B 4B7LA 1BQHB 3LS5H 1AP2A 4JQXA 3OAUH 3QUKB 2L7JA 3IRPX 1Q94A 4NYLA 5GGVH 4C4KO 5KSUB 2EDQA 3VG9C 3CAFA 3CVHH 4XNXH 1GGTA 1B0WA 4JANA 3RVVC 5GS2H 1NFIB 3O3UN 4H1LH 4OM1H 2EYSB 1NCNA 4P46D 4CN4A 3GSQA 3EUUA 1S7SA 1BGXL 1LK3L 3DX6B 2DWEB 3NCMA 4WJ5B 4Y89A 3VG0L 1OGAA 5JZ7D 1BVKA 3V5KA 1BQLL 2HFGL 2D7TL 4I3SH 4PRHD 4OLVL 1TPXC 2Z4QB 3WHE1 3RGVD 1KXQE 1MCRA 3TM6A 5F6IB 1ZT1B 4LBEB 5I6XC 5KVDL 1KCUL 1SBBA 2MKLC 5EZJA 2VXUL 4DAGH 3O8XC 2DL2A 4H88L 4LSTL 4Y16B 1MCWM 2VO5A 1GAFH 2JJSC 3H2WA 5F9DC 5GZOC 2EO9A 1KIPA 2VIRB 4YBQC 1SY6L 1ZHBA 3EZ8A 2IBZY 2W91A 5HDOA 3LEVL 3V95A 1J0IA 3THML 3M45A 2HJLB 4KPHH 4Y5VB 3RL1A 2DTMH 3UTTD 1A6ZB 5TE4H 4J12A 3HI5H 1S9YB 2DWDB 1G6RL 2VLRE 4K9EH 5IB2A 1IKNC 4GAJL 3NGBC 3LKPA 2VC2L 4N0YL 3IFPB 4KK9D 4K94C 1YN6B 3VI3F 5FM5O 3WIHL 4HC1L 4I0PA 5EBMA 2IQ9H 5A1AA 1QRNA 4TUKH 1UH3A 1IT9H 1I75A 5IVXA 1LP9E 1B2WL 1PZ5A 5HYJE 4OIBA 4GQ9L 3VWKA 3ZYIA 1BWMA 4M61B 1RI8A 1X6LA 5LBSH 3UZQA 5TF1H 2ERJC 5EULV 1RULL 1YUHB 4XI5C 1TCRB 1MLCA 3QR2A 1MQKH 1FPTL 4ORGA 5E2UH 1FG9C 3G9VA 5ADOH 2C1OB 5FUCE 4EDWH 1IEAA 5JLZB 4GAFB 4QNPE 1URLA 5K9JL 2DQDL 4OGYL 4ONOA 3LKOB 4ELMA 1FZJA 1I9IL 2JIXA 5BQ7A 1EEYB 2PYEA 4UBDD 3KPPB 1MJUL 4O2CB 1RZFL 5HI4D 3PIQB 4XC1L 3EO1A 4FQIL 2VH5L 3CFBB 4XHQA 4CL7A 1DEEB 1NFDB 3WS3A 2FCBA 4JM2B 2ARWA 1G9EA 1TQBC 4APQD 1KBGL 3MRMB 3T3MF 5J7CC 3WFBL 2IG2L 1Q9KB 1L0QA 5EO1A 5I1AB 1CXKA 1T1WB 1FAIL 3NA9H 1AXSB 2ZCHH 3EFDH 4ZTOL 1A1OB 4I8DA 1KELH 4QKXB 2XA3A 3KYKL 2NY5L 5IK3B 1UZ6E 1DSFH 4GXUM<