4HPYH

Crystal structure of rv144-elicited antibody ch59 in complex with v2 peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
VQLVESGGGLVQPGRSLRLSCAASGFTFDDGAMHWVRQAPGKGLEWVSGISWNSNIIAYADSVKGRFTISRDNAKNSLYLEMNSLRVEDTALYYCAKDSPRGELPLNYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
molecule keywords CH59 Fab heavy chain
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpyH01
32C2B 4YBQC 5LQBL 1UFUA 4WU5B 1ZT7B 4PRIE 1Z9MA 5JNYB 3ULUD 4WHDA 3VXPA 4PGJA 5ICYA 3BN3B 4N0UE 3GJEB 4OFYA 1U41A 3QA3A 3TIDB 3HUJE 4AIZA 1CICA 3DGGA 4QRTB 5KS9F 4MJIA 1U3HB 3H0TA 1CDUA 4YBLC 4J6RH 3MRJB 4PRAA 4DN3H 2QADD 4OQTA 1S5IL 4L9LB 3BD4A 3UZQA 1MSPA 4HUXB 4IIQC 3ZT6A 4X4YB 4L4TA 5JMOC 3B6SA 5DMYA 4OF8A 5HDBE 3TH4T 1N64L 4JRXD 2XICA 4RAVB 5J6GA 3NIFF 1G9NL 1K5NB 2H6PA 4W6WB 4MNQA 5T1MA 3SY0B 5E8DL 5I76B 5LJYH 3CFCH 1FE8L 2D31A 1U8NA 4OCSH 2RCSL 1U58B 5C0DB 3DURA 3W5MA 1U8KA 5EFIB 3LEYL 2NXYC 1CGWA 3W0WD 3MRPA 2HFGL 5FYLD 5KOVC 4WFED 5DC0A 4KI5C 3BW9A 4JG0L 3VD5A 3CXDH 2Y07H 4KJPC 3TP4A 3SQOH 4KMTH 1Z2KA 1VFBB 4PRBB 4K3GA 4KVNL 3HNSL 4XB7A 4DAGL 1U93B 5EN2B 1E4WH 2OXHA 3GMQB 1WK0A 5HGDB 4PRPE 4GW5A 5J3HD 3JV5A 1RY7B 5JOPE 4APQD 3KYOA 4KPHL 2DJSA 4OLEA 3M07A 4K3EL 1DBMH 4K94H 4WW1B 1YEGH 3QYCA 4NP4H 5DR5H 3TN0A 1NDGA 3BDXA 4ZUWA 2L0DA 1QFUH 1CU4L 4P2RA 3LRSB 3DVNA 4OF7A 3BDYL 3DGCR 3OAZH 4NOBA 4NZDA 3WFHA 5KVGH 1EFXB 1F58H 3GJFH 1BGXH 4N0CD 3V6FB 4CVZB 2K7QA 1F3JA 4NFBA 5KZCD 2XA8H 2R2HB 3IDNA 5CHNA 1B0RB 5IESH 4C55A 4JZNB 4J6RL 3VFPA 3HI1A 4LP5A 5E8NA 1OB1A 3W11C 1QA9B 4LVOB 5T1KA 4PJXE 3DI3B 4B53A 3H9HB 4JFHE 5ANME 2ZSVB 4LOUD 1KNOA 4OZGA 2HG5B 5HHOB 4P57B 3LN5A 2UVFA 4CJ1A 3MRMB 1T2JA 4S1SH 1EEYB 4TVPD 1CGUA 1GZPA 3NZ8B 3HI1B 3DRQB 3T0EE 3O3UN 3BEWB 2VE6A 4AEIL 2VR4A 4D0BB 3B9AA 5CHNB 3C8KB 1J0IA 2XTJE 1NGXA 1I9JH 4PJIA 3RJQB 4LSTL 2EDDA 3V6FA 4KWUA 5JPNB 5IW3A 4XNQA 4F9LA 3O4OB 5HHVH 5I1CH 5E4IA 4GRLD 5HHXH 1EAPA 1BOGB 2ERJC 4E41D 4YHIB 3VFTB 3D1MC 4LCIL 4MQSB 4PTTB 1K4CA 1A6UL 1K6QH 2QTEA 1VEMA 3O6FB 4D0DA 4WW1A 1JFQL 1PY4A 4MA1C 2F9BT 3IFOB 3C60B 4ORZC 3LQZA 1XF3A 3DETD 3TCXA 4YWGL 4GRLA 4DUXA 4LLYB 2YRLA 3Q0HA 4ZOCA 4KHXH 3C8DA 4IRSC 2VH5H 4S0TD 3BP4A 3SDCD 3VGGA 1BQLH 3IFPB 5KSUB 3ULSA 1P84J 3TO4D 3CVIH 4HWZB 4CVXA 5INDB 2ESVD 2X5PA 1UJTA 4J3SA 3AM8C 4OAWA 5GGVH 4GQ9H 3ARUA 4KZEL 3QDMD 4QGYA 2WBJD 1T1ZA 4YZFF 4FG6D 5CBEA 2VLMD 1U8KB 3M8OL 3MV8D 5D7SL 4PJFF 5H8DA 3B2UD 3D0VB 5ETUA 1OAQL 3MXVH 3PHQA 4PJDE 3RWJA 4DUWA 4ZUUA 3RWGA 3MA9H 3BGAA 4E9LA 5L0QB 4IRSD 4RAVA 3WD5H 1A2YB 1HXYA 5F96L 1A9BB 4IIQA 4S0SD 5TF1H 5D93C 5DTFA 2XZCL 1N59B 4JO4L 3BN9C 2WBJA 3KJ6H 1SMOA 4XBEL 4GRWB 1IM9B 1U8HB 3QDGA 2W91A 4OLWL 3HG1E 3ZYOA 1RJYA 5IJKA 1NJ9A 3T65B 2GTZB 3H0TB 3ZE1F 1T0NB 5DVMA 3GDBA 3DARA 1EHNA 3DSFH 1I4FB 5HJ3A 3T3MF 2R69L 5F6HJ 3BXNA 1GGYA 4TVPH 1BFOB 1EGJA 3PWNA 3CDFA 2GJZB 2Q8BH 4FQQB 1V05A 2BMKB 1QSFD 1UXSB 2QADB 1TJIH 4I9WE 4JY4B 3GSXB 4WTZA 4RWHA 2AI0L 2MPAL 2WK2A 1KBGL 3C2AH 1JZ6A 4ODXA 3LN4B 1ZT1B 4WI5A 2VLKB 2D9CA 4Y2OA 4YHPB 1EEUA 2KKQA 1JYVA 5C0EA 3MROB 1AGFA 1KN2L 4QRUA 5CZVL 5HBBA 1FNSH 5MERB 5F8RC 1VEPA 4WWKC 4UU9B 4YPGB 2V7NB 1VB9A 2EDTA 2F15A 4LRIC 2V2WA 3AREC 2I9LB 1JPSL 4P2YA 4PG2C 4OCWL 1XF2A 1WVZA 3GNML 1IE5A 3HUJA 5KSBB 4F57L 4LU5H 3U2SB 2J1KA 1S5HA 1CDBA 4ODUA 3C09B 4WCYL 4C54A 4KXZH 5DJZA 1N7MH 5EULV 5T1LB 1P9MC 1AY1L 3O6FD 2OR8A 3PE9A 5EO0A 3UTTD 1PEZA 4X5WB 5CJOL 4DGYL 5ILTL 4JFEB 4F7CB 4KKLC 3IJHA 5FCSH 4PJ7B 4K9EL 2AJUL 3WL9A 1S7WB 1AHWA 1MY7A 3HI5L 1ZTXL 5IP4A 4PJ9B 2GJ6E 4JFQB 1ND0B 1KTLB 3TESA 3GMNA 1ZGLP 4PS4H 2ED9A 4MA7L 2XKNB 5D8JL 3Q3GA 5C0BB 5J3HC 1IQWL 4Z7OF 4QRSB 4R26L 1HQ4B 3IAPA 5EUOA 1TITA 1SYVB 5DT1L 4PLKD 1QRNE 5F1NA 5C0CD 2GIYA 3MLVH 1J12A 2XNAB 5GS0H 5ERWA 3BZFA 5C3TA 3BZ4B 2HFGH 1TIUA 1S9XB 4KKLD 3C9NB 4MQXC 5FXCH 3SKOB 3QUMH 4K8RC 3O6FC 3QFJD 2ZKHL 3FOMB 3REVB 3SQBA 1H15A 3C2AL 5DJYB 5DRXA 5E5MA 4U1HA 4XMKH 2VDPL 2C3GA 3SKMB 3N1FC 4ZFGH 5I19H 4OB5L 5I1DB 1OAXL 1BQLL 3I6LE 1A1NA 4KK5C 5L8LB 1S7VB 3LDBB 1F97A 4X9GA 3MODH 5IOPB 2J4WH 1XIWB 2YSSA 3FRUA 3L3GA 2DLIA 2Y07L 4F7MA 4OUOA 3PWLA 4I0PA 1G7IA 1OGAA 2CKNA 2FJFA 4HD9A 4JY6B 3QPXL 5D7KD 5HDQH 4IRZL 5GRUH 4QT5A 3SKNA 2F53D 4XPHH 2E3VA 3WD5L 3OZ9L 4PLJC 3CK0H 2J8UB 2Y23A 5D1XB 1PDKA 1E28A 3OKOA 3NGBC 3NVQA 1MNUH 4OZGE 3UJIL 3LKRB 2DQFB 4QYOA 4OQTL 2BOCA 4RNRB 3DV4A 5F9AC 4WFGE 4POZD 5I0ZA 3CZFA 2HJKB 4OFYD 4HH9A 3SDCB 1DE4A 1YDPB 2HTKC 1QFHA 4F58L 3S36X 4PV9A 1GL4B 5DHYB 1NMAL 2X1PA 4DK3A 1PJ9A 4J3OC 1KIPA 4XPGH 4LSRH 3HCVB 4KROD 2DQDL 4JPIA 3TT3L 3CSPA 2CMRL 4WFFD 1LE5A 2EKSB 3EO1B 4WENB 4WW2F 3P30H 1FL5A 5T3ZL 1DEDA 5E8EA 3TH2T 1UENA 3IDJB 2HRPL 4KZDH 4OLYL 4HFWB 3X17A 3P73B 1BD2D 4M1DH 3WDIA 4HUUA 3WKML 4YDJB 3Q5YA 4NZUL 5LGHL 1WCBB 2OJEB 4ODTL 4DQOL 1C1EH 3JWOC 3DO3A 3BJ91 1N5YL 5I1GL 4J3VA 1NFIA 3MNVB 3NCJL 3TH3T 1WCQA 1BD2A 1H3PL 2WBKA 4JN1L 4CVUA 1AXSA 4EDXB 1J87A 5HHVL 3VFNB 5GISH 3LEVH 5IFAL 1UVQB 2NNAB 2P5WE 3HZVA 1VEOA 2DWEB 2MQCA 3ZDXF 1G7LA 3BKMH 5B8CB 3SDDD 2WZPD 4RMTA 4F33B 2XA8L 1I8IB 5IHZA 5TQ2L 2H26A 1T5WB 5IR1A 2X7LA 3DROB 5D2LB 1Z5LA 1UWEL 3V6OE 1PZUB 2OK0H 3PWJA 3OKDA 3SGEH 3W5NA 2AS5M 3QDGE 1ZVSA 3A6CH 5FK9B 4XX1G 4OLVL 2HVKA 5IMOB 5ECJE 4TVSa 1FVCA 3O6MH 2HKFL 3GHBH 1F02I 3H7BB 3TZVB 4RSVA 3FFCA 5JZ7D 3JWOH 5DD5H 4Q9QH 3H8NA 2VLJB 3VFMA 4Y4KC 3VCLB 4JO2H 3HPLA 1WBXA 3VE0B 1HH6A 1XCTB 1FAIL 3EDFA 3FKUS 4XPAL 3QFJE 4O5LH 1FVEA 2PO6C 4W4OA 5J1TC 5EOQH 4Y5XB 1BIIA 1TPXB 3HE6A 5DJ2A 1YECL 3HN3A 4LKXB 4Z5RB 2GUOB 1CD0A 5C9JA 4S1QH 4LIQL 3KJ6L 1CQKA 3U0PB 3WLWC 3V6ZB 1IC4H 1YQVH 1L6ZA 3BSZL 3QULA 3BH8B 4QRPD 5D7LD 1INEH 4U1NA 3BP7A 5EU5A 3EOTH 3OJ2C 4RMRA 2AV7A 3LDBC 3CDYA 3CC5B 1IGJA 2WSKA 1YYLH 3PJSB 5KVMC 4NRZA 2H9GA 3F58L 1E6JH 2XFXA 2P4AB 4CW1B 4ELKB 3PP3K 5D72L 1OTUD 1JUFB 3L5IA 3W81A 1Q9KB 4GFTB 1GJIA 5C0FB 3ULUH 2DQJH 4ZUVA 2AK1L 4FNLL 4XNMA 1SBSH 4O2CA 3QXAB 2Z31C 4D9LH 3VGEA 2IC2A 2NYYC 4LHUA 4JZJA 3GIVB 5IW6A 2HTKD 1V7ML 3ARXA 3IDIB 2V5TA 5IW6B 4C58B 3T77A 1HSBB 5CLWA 1XGYL 4MJID 1HI6B 3T0XA 2IEPA 2QKIB 2NXYD 4L8CA 1RU9H 2YPLA 2Y06H 2CK2A 3FOLA 4LCWB 1G7JA 4O2CB 1BZQK 4PJCE 2KQNA 1MAKA 4UTBH 5FYJL 5I2IA 2MCPH 3V9FA 3RVVD 2JCCB 3I6KB 4L4TD 6CGTA 2D0FA 3GHBL 3MJ9A 4HV8A 4Q74A 2HT4C 4AIXA 3VWKC 2P8MB 3MV9B 3IGAB 1IAIH 5JDSB 3IDXH 1HE7A 2WNGA 3FZUD 4QOKD 2APVA 1K2DA 3ZKXC 1E27A 2EE2A 3HFMH 3GI8L 1P4BH 1L0XA 4OM0H 1AQKL 5JHDB 2BHYA 3FZUC 4WTWA 3VXMD 1IJ9A 1IEAB 1P7KB 5CJBA 4I5BA 4YHYB 2MJWA 1FNSL 3P9MB 4PPTA 2XXCB 2PW2B 4WUKL 2DIBA 3OB8A 3DV6A 4XHQA 1UB5A 1RUAL 1KXQE 5EU6D 2EDEA 5ADPH 4DKEL 2VWEE 5DI8B 2GUOA 4LKXA 1XFPA 5I6XB 1QR1A 1JIBA 1BIIB 2VITB 1EH9A 4K8RD 3MV8A 4G6KH 1WFNA 2GK0A 1MJ8H 4KUZL 4BFIB 3VCLA 4O51A 3U4EB 2V7HB 3C5SA 3FFCB 2NY0B 1CXIA 2Z8WC 4AL8L 4XT1C 3UXFA 1F6FB 3LD8B 5DS8A 5D1QB 4GW4A 2A38A 5CEZE 2OK0L 4G8EB 3V2AR 2ZUXA 2EDKA 3D9AL 4KFZC 3CH8A 2AJUH 1HNGA 2W07A 5JUEL 3D0LB 1DJSA 4MXVE 4MXQC 4XVUC 4Y2DC 2ZG3A 4O2EB 5DGRA 3WS3B 5I75C 3ZE0E 2NX5D 3V0WH 2XOTA 1MNUL 1MI5A 2V2TA 3PGFH 3E3QC 4F7TA 5D2LA 1A1MA 4F8TA 3N9GL 2VDLH 1I7ZA 3DTXB 4PJAB 1T5WA 4NT6B 1BEYH 4LLUA 4W81A 3N1PC 4TTDD 5T3XH 4TQEH 5CGYC 4HUKB 4PV8B 1YY8B 5B8CA 1NCBL 3EGSB 5GS1B 1WFOA 3ARYA 5GGSB 1ZEAL 2DWEA 3QIBD 5JMRA 2CKBA 3MO1A 3RPIA 3WLWD 4NC0B 1LO2L 3BWAB 3CVHB 4ZAKB 1E4XI 3GBNH 4OZFG 5GSRA 5GJTH 4KRPC 3AREA 1NLDH 5AYQA 1X7QB 4NSKA 4V2CB 1UM5L 5FM5M 4NUJA 4XMKL 4KKBC 5IT2L 3ZYZA 1R5VA 3GSNL 1T3FA 5I1LB 4IJ3B 4XBPA 4RAUB 1HILA 1HK6A 4NUJB 2B7DT 5BZWA 4ZFOA 3BQUA 4XPGL 4OF3A 4NSKB 2HLAA 2G75B 1BBDH 3F7VB 1MEXH 3FMGL 4WUKH 5MEQB 3BAEH 1WCBA 4TNWK 2FSEB 1ACYL 4GSDL 2DBLL 2FJGA 5TE7H 1D5ZB 4HJ0C 3IDJA 2CKBB 1QYGH 5FYLH 2WUCL 3KPSE 3EGSA 4YDVB 1FZOA 1YY8A 1DANU 2AJYH 1K4DB 1QG3A 1C1EL 4LHJB 1RJZB 4RBPK 1M7IB 1YDPA 1KEMH 2R1YA 3SDCA 3NCYS 5ESQA 2JJSC 5E08L 3QUXA 2VDOL 4F7TB 1B90A 2R4RL 1EFXD 1GGCH 2NY0D 1RU9L 5BV7H 3WS3A 1TVHA 3WIFA 1NSNL 4QYOB 1I7RB 4F3FB 4PRID 5KVDL 3KLSA 2G5RA 2PYFB 1DLFH 1IGTA 5JHDE 2ZUTA 4LARH 4Y4HA 2EXYC 5EOTB 4EKXA 2CR3A 1YUHA 2FGZA 1BIHA 1OGAB 2VLRE 2Y36L 2P45B 4BFIA 3WIIH 1T03H 3ALXA 4YC2B 1QPPA 1KFAL 2XPGA 3B8YA 1UEYA 2NMSA 4G7VH 1JGUL 4N5UA 1QSEB 4G8FB 5DI8A 4WEBL 4MB4A 3A6CL 4DGVL 1J5OH 1NLDL 3ZL4L 2A0LD 2YPKB 4FFZH 1T6WA 2Z93A 3WHE0 4UB0H 3KLDA 5K9QI 4R3SB 4R96A 5IFJA 4GXVH 2OLDA 1NANH 4DFHA 4I3RL 1E27B 2EZ0D 4NQEA 2D03H 3U46B 2XNAA 5DJ0A 5DJ6B 1UGNA 3MRQA 4XAKD 4G3YL 2AQ2A 1B9ZA 4XXCC 3O8XC 4L3ED 2UWEE 3EDJA 3GBML 2VQUA 4OGAC 4M7LT 4PJ5A 8FABA 2XKNA 1FIGH 5C0AB 5F9DC 3SE3A 3OKMB 3GMNB 1HI6A 4K94L 2G2RB 2QHRH 3NTCH 2EIDA 4RAHA 1RVFH 4GS7B 5F9JA 2B4CL 4GKOA 4JFQA 4N8CL 4NQCD 1A5FH 3MRKA 3BFOA 5J13B 4L3EA 2EDHA 1NC4A 1FZKB 2QQLH 1ORSB 4XWGH 3T0VA 3U0WL 4LHUB 3FT4A 5DLMH 3SDAB 1CT8A 3QUKB 1CR9H 5DVKA 4XNMB 2PN5A 2EO9A 4WHTB 5DJZB 3UPRA 3KPLA 4NQCA 4NO0A 1QUNA 5I6XC 1TQBB 4G6MH 3N1QC 3VRJB 4G6AC 4UTBL 1A3LH 2VZOA 5FYJH 1YNKL 3TO2A 5KSBA 5E2UL 5MHSD 3F7QA 2JB6A 3D5OF 3BRFA 3HB3C 2X44D 5DUMH 1WWAX 4I1NB 4K55A 4XNYL 4H0IA 2AGJL 1CFBA 1FLRL 4JRWA 5F44A 1ES0A 3CC5A 3K2UL 4IOFC 4JZOB 4RFOH 1JP5A 3FHQA 4PJCB 4ZD3H 4U6TA 3W9EB 2C4FT 3OF6D 4XP9H 2PF6A 2YKLL 3OKLA 3KNBB 2FX8L 4X7CC 2Z9TA 5FGSA 3JBG7 3TA3B 3V5KB 3U0PA 4ODXB 2IPUG 4WI4A 2XZAL 2WIMA 4URTB 2XTJD 4XNXL 5ESVB 1CXEA 2OZ4H 4LDLB 5FYKD 1CL7I 4Z5RA 1RZ7H 2V5RA 2VSCA 4GG6E 4HPOH 2H32H 4Y5XA 1ADQH 3AS0A 4BSVA 1BFOA 1WBXB 1Q72H 3HLAA 4RMSA 1IL1A 1MRFH 5CP7A 1LHZA 3B9DA 5TDNA 3K0WA 5HPMB 2NY7H 4HS3B 1QP1A 3MSPA 3WKMH 4KI5D 43CAB 3CZJA 3IT8D 2AK4E 1FVCB 2OQJA 3G5VB 3VXNB 3HC4L 5C8JB 4K3DL 5ITFB 2AEWA 4MYWB 1N59A 4GKSB 1MCOH 1YEJH 5L0QC 4EEEA 2HWZH 4YHML 2J6EL 3MUGA 3PWJB 5C08A 1EMTL 3LOWA 1XH3A 1Z5LB 2AJVH 1WBYB 1OQOA 1ZXQA 5FKAA 5EU6B 2YD9A 1RMFL 3IDUA 2X41A 4XP4H 3SKJL 2GSGB 4HUWA 2VQTA 1XGUB 1YEIL 3HR5B 1YNTA 2F54E 1FGVH 3DIFA 5IIEB 4Y5VA 5IQ7H 4HWZA 3CDGA 1UVQA 5KSUA 4CRPA 1MCQA 5J1AA 1EFQA 1H3GA 5IROA 3OKKB 4FFZL 4NM8H 1DBKH 4ZFOL 1AXSB 5JXAL 1NUDA 1VCAA 2BDNH 4LF3B 3X13A 5ACLA 2P5ED 5E2JA 1G7HB 3FO9B 4MLIA 1R3KA 3U48A 4ODVL 2J4WL 4D3CH 1AO7B 4YUEL 5HHPB 5B38G 3RY6C 2X1XR 2LQRA 4HHAB 1T4KB 3ARWA 4NN5C 5E2WL 5BS0E 3G5ZA 5E70A 2OJEA 2NY6C 3C6LC 3ARBA 5GGTH 5GGVY 2VQ1B 1IGML 3MBXH 4P49A 4ZFZA 5IVNA 4HUUB 2YMXL 5ALBH 1T5XA 1YNLH 5IF0A 1ZK9A 3I3DA 3UTPD 4ETQA 2HFFA 4Q2ZB 1SJHA 1FVDA 1FL5B 2H8PA 3O8XB 1E4JA 1FIGL 3EO1A 4Z7UF 3V4UH 3X14A 3ORJA 3HCVA 3D3VD 1WC7A 3C8KA 1U0QA 1J10A 3MJ9L 4U2YA 3DYOA 4F8QA 3CJJA 4TNWF 3BEWA 1H3TA 4QXTB 2J5LB 3MMEB 3T0EC 4KJYB 1GZPB 3NZHL 1EEYA 4P59H 5E99H 3DUHA 5T1DL 5FUOH 1YYML 2CJUH 1IAOA 3H9SA 2ZP0T 3DV4B 1S9WA 4E42B 1FP5A 1Z3GL 4OZ4A 5I8OL 1N4XH 4DZBB 5DMGC 3L5XL 4D9QD 4OI9A 3SDAC 4MVBC 3VA6A 2J8UA 1CVSC 4FQXA 3FB5B 2I27N 1JWSB 5J12B 3WKNA 3SO3B 1GAFH 4L1DA 4JKPH 3CMGA 5GZOD 3DVGA 1PZ5A 3WNOA 5FHBL 1HDMA 4WFGD 4EUPH 3MC0A 4R8WL 4WO4A 3OQ3B 1U8JA 5IOPA 1G6RB 3EO0A 4GBXD 5DMIH 4C56D 5BVPH 3I50L 4M7LH 3VXRE 5DRXB 4WFFE 4RFNB 2OJZL 3MRBA 4G7YL 2DQUL 3REVA 5IFAH 2VXTL 4BZ2L 4ZOBA 1F90H 3MRDB 1CFNA 1J8HE 5EN2A 3SKOA 3NOIA 4YO0A 4AM0B 4PRBA 1VFBA 1RULL 3BZFB 1FQ9C 2PYEE 3ULVL 1NL0H 4UT7L 4ELMF 5F1NB 4HC1A 1A6AA 3MRPB 5BO1L 2V5MA 4M3JA 3VI3E 5E1AB 4YHNA 1DSFH 3B5HA 4PGDB 3DURB 25C8L 5C0BA 3Q3GB 3QBTB 4OIAA 1TDQA 3UZEA 4AENA 2UUDH 2VDPH 4ZFGL 5I76A 3SY0A 3TN0D 3ARQA 4P5KA 4NO3A 5ICXB 1H3XA 3EW3B 1WIPA 3OAZK 4LRNH 4S1SL 3P4OA 1FG9C 2J2ZA 4M93B 1RI8A 4PJ7A 3WL9B 1G6RL 4HS8L 3MJ6A 5CINH 1LP9E 2XWBB 4X5WA 2EDJA 5FGBA 4Q9RL 3MRJA 4IS6A 1VACA 4AJ0A 3E0GA 4QRTA 4GAYB 5F7LB 1IM9D 4PJXF 3WIIL 4HX1B 4S1RL 3CSYA 2ZKHH 2YPLD 4KRNA 2BSTA 2JLLA 4E5XA 4GRMB 1MRCL 5K33A 3MLYL 2H1PL 1U8MB 4LDOB 4CADB 5E4EC 4LPTA 2Z0BA 4JQIL 5EORL 3ULVC 3R0MA 5GJSL 3S88L 1OCWH 2C3VA 4M6OH 1FAKT 4JY4A 4X6DE 4UUJB 1V7NH 4X6CF 3MRRB 4ZPVB 3J8F7 1QHOA 3C2SA 4HC1L 4HKZB 4FTVD 5I17B 5AAMA 1QFWI 2VN7A 3BXNB 4JPVH 5KTEL 3VFWA 1LO2H 3OHXB 4YE4L 2Q8AL 4G80A 4GAYA 1VACB 4IRSA 5JLZA 5IB2A 3MCLL 1N0XH 3MRIB 1T66D 2DL9A 2VIRB 3EDKA 4NBYB 2MCG1 2ADIB 3T04D 3P4OB 5CBAA 4WUUA 3RKDD 2E8YA 1CXFA 4P5KB 4QCIB 2FEEL 5SWSA 1D9KC 3BEVA 1AD9A 3BT2H 4KJWC 4AZ8A 4CL7A 5ID0B 3RVUC 4WFHE 1TJHH 5ELIA 3DX8A 4PJDF 3GM0A 4OTXL 3VFOA 5CAYB 5FO8A 1BFVL 2HT3D 4I0PC 4OAWB 3MOBH 4K94C 3OG6B 1DQQB 1JYXA 3O3BB 2B4CC 3D25B 1GGTA 2N56A 3TJHD 2DQEH 1YY9C 1CFNB 4MJIE 5C7XL 1JK8A 1TETH 5ENWB 1X5IA 4XP9L 3EYFB 1S7UA 1LK3H 4NCC1 1GC1C 1D6EA 3FFDB 4UT6H 2E7BA 4X7SL 4KHXL 3NIGF 3T3ME 2CPCA 2BVUA 4GRLB 4Z8FH 1PG7X 1RK0B 2FO1A 1NGPH 4QY8B 2OMBA 3FQXA 3T8XB 1YPZA 3IFOA 3T0EB 5KVDH 5DVNA 1NMCC 1WAAE 3CFKB 4N8VB 4DWHA 3DVGB 1N8ZB 5DT1H 1BOGA 4R4BA 4YPJA 1K3ZA 3Q5OA 4DAGH 3ALWA 4XNQB 2WV3A 4S1QL 1J11A 5HVGB 1CLCA 1UJ3C 2A9ML 3SDYL 4M6ML 2HRLA 1ITBB 5K9JL 4UIMB 3D2UA 3QH3A 4JHWH 2VE6B 4GAFB 1A47A 3DRQA 4Z7VF 3OGOE 3NZ8A 3A0OA 4DZBA 5ESAA 4XWOC 4JFXB 5EIIB 1KNOB 4WI3A 5HHOA 2EYRA 2ZOKA 3RIFF 5FYLE 5FUZL 5ALBL 2VC2H 4CDGC 4CBPA 2HKFH 4JZNA 3KXFB 4PGBB 2VN4A 1IQWH 3IDNB 3VMNA 5F3BA 1U2CA 4PYHA 3ARGC 4H0HB 4Q97A 3X14B 3TBTB 1DUYA 4JM2A 3IDMB 5EBWA 1EFXA 4P2RE 3ZKMC 3ZTJH 3GBNL 4OGYL 1BREA 5HGGS 3BPNB 2OTUA 1RZJH 3VWKB 1T1YB 2DB8A 3RP1A 5CSBA 3QUML 3MCKA 3U36B 2Q3ZA 1OL0A 5JW3H 1OD9A 1YEKH 3TN0B 3CFJB 1T4KA 1ZKAA 4ZTPH 3VXRA 5AG9A 2Y9RT 4X5XA 1M71B 1JPST 4M61B 5GZOC 2E6JA 1YJDC 12E8H 4IEFB 2CDFA 1R3KB 1MJUL 2GKIA 5I18L 4HK3J 1CZ8L 3IDGB 4LF3A 5KS9E 4LLDB 4HCRL 2B20A 4C4KT 4HAFA 3VWJB 3BYYA 3SDDB 3HMWL 1WBZB 2PYEA 5JPMB 3UTQB 6FABL 5IIEA 5FOBA 5A2FA 5FHBH 4ZFFA 3BW9B 1I7TA 5DSCA 3KPPB 5FYJD 1YNTB 4EBQH 4N9GB 4KHTH 1UADC 1PBYA 1R0AL 3MJ9H 5ILTH 5D6DA 2F8XC 2GSGA 3WUWB 3PQYB 3KGRA 1CFSA 1GGCL 4YFLF 1VDGA 3CFBA 1U58A 1U8NB 4R2GC 1UJ3A 1ZSDB 4GAJH 3RQ3A 5HYJD 4GAGH 1NAMA 1OM3L 4MAUL 1IKFH 4HH8A 4TOYH 2FO4A 1I1CA 1NEZG 1RZ8A 4EN3D 1QLEH 2DQIL 2FR4A 1JI2A 3S37H 1MFBL 2P1YA 4CJ0A 4JRYD 3BD3A 3RTQB 2V2XA 4HK3N 4A6YA 3QCUH 1QZ1A 3HTLX 2CUMA 2FNBA 1J88A 1YMMA 5D9SB 2A9NH 1BZ7B 4ZUSB 5DFVD 1NPUA 1CICB 2BK8A 4LLVB 1WICA 4P5MA 4ZNCD 4LVHB 3IDXL 4WU5A 1WAAF 2BOBB 1FH5H 32C2A 2UZIH 4MJ6B 1YN7A 4I18A 3RRQA 4G9DB 5ESVA 2NX5E 3TLRA 3MUY1 5KSVA 1W72B 3NBNA 3TA3A 3V5KA 2ZUVA 4X99B 3SGKA 1DQML 1RQ5A 1JRHL 3W9EA 1F90L 1YQ2A 4Y16B 4LSQL 3L3KA 3RDTC 2ICWA 2CDGB 2X09A 4Y4FD 2PR4L 1NANI 4N5EC 2R29H 1RZFH 3TA3D 4M03A 1C16B 1IBGL 4J7RA 4NO0B 1BAFH 4JQXC 4RQQB 2J8OA 4YAQB 3UCRA 1MAML 1A4JA 1KEGL 1RVFL 1ZS8B 4Y4FA 3UDWA 2MKWA 5D1ZC 1KJ2L 1A0QL 4LSUH 4EIZC 4HG4K 2X4PB 4JQIH 1JN6B 3LS5H 4PB9H 4X80H 3H6JA 2B1HH 4YUEH 1T0MB 4QTHB 5EZIL 4AH2B 1YN7B 3RUGA 3MRKB 5L2JA 1DBML 2Y7QA 3BHBB 1UH3A 2XV6B 4PJDB 2D9QB 1Z9OA 2ZOLB 1PAMA 4YEEA 1TXKA 3K8MA 3QUMB 4X7TB 3S37L 1ZLSH 2EEAA 4P5MB 3BIBX 5C0AA 4LLVA 1BEYL 8FABB 1MCKA 4P2RD 1U95A 4E41B 3MYJA 5D9SA 5IB4B 4IOSD 4OLYH 3TNNB 3TCLA 2NXZC 2V2XB 1RPQA 1BMGA 5SV4A 5TDOB 3EJJX 3BPNC 3MRQB 3S4SG 3V5HA 3N85L 4EOWL 1RUQL 3ZKMD 1MREL 5GJTL 2XIDA 4NQEB 5C0IB 3V79C 3L6FA 4XCNA 2R1WA 5C0AD 4APQB 2R9HD 2FATH 4MDJA 2Q7NA 4ODSH 2RAMA 3MLYH 4NGHL 2SEBB 2X4TA 4W70A 5HHME 1UJ3B 3OBAA 2BVEA 1DQDL 5DA0B 2APWA 3PQYA 3HNVH 1A14H 3A6BL 4ZPTA 1JV5A 5E56A 3FMGH 1CDGA 4GBXB 1MRDH 4JFFE 4RIRA 3ZHDA 4BH7B 7FABH 4M6OL 1IGIL 4JDZA 4XTRC 3KPPA 4OCWH 5TH2B 4Z78B 3ARGA 4U1IA 2VUOA 3RVWC 5HGBB 1ACZA 1IC1A 4HULB 3K74B 5JPMA 3RAJH 2X9YA 2PTTB 3MZGB 5D72H 5I1AB 4H5SA 3GMMB 3B9KD 2XTJB 4MNGE 5BV7C 4LCIH 4GUPA 1W72H 4GMSH 4X7SH 1HN1A 5J89A 1AGDB 1BJ8A 3KPSB 5IMLA 4NWUL 5E08H 1G1CA 2APTA 1L7IL 3OKNA 5FEBA 4I4WB 4WTXA 2IPTL 1S78C 4H88L 3WIFB 4RX4D 3BP5A 4DZ8B 3U36A 3F5WB 1IFHH 1T1YA 5M94B 1ZLWH 2OZ4A 4CNIA 3GI9L 1GIGL 1FORH 2JIXB 1R5WB 3KLHC 1D5IH 1G7PB 4G8GB 1TNNA 5B22A 2GFBA 1MFAH 3LIZH 3AS1A 1HEZB 1ODAA 4M9OA 3V0VA 4OFKA 3CFIC 5GGSY 1C5DB 1FZOB 4IM8A 4LVHC 1AGBB 4G7VL 2BFVH 5CEZL 2YN5A 5D5MF 1OGAE 1TETL 5IGXL 1HSAB 4Z7WB 2HMIC 5ESAB 1LO4L 3WNPA 1JYWA 3QG6B 1A7NH 5F89A 4Y1AE 3LZFL 4ZS6D 2ADGA 4ODHH 2D2OA 3BQUB 2VLJD 3VMPA 3UDWC 3RIFK 4PJFE 5FV2A 1HILB 3MRGA 2D0GA 1R5VB 4NM4L 3FO1B 4PJ8C 2FEDC 4Q0XH 5B4MC 1PKQB 2BNQA 3FONA 3NIDE 5DF0A 3QIWB 3F58H 3TO4C 1CWVA 1VSCA 4HFUL 1IC7L 3HE6C 5KSAD 3M45A 4FOMA 4ZSOE 3S3SA 4XC3L 4C56A 1O7SA 4YX2L 1XR9A 4N8VA 2W60A 1RK1B 1CTOA 2A9MH 3SDYH 2R1XA 5CZXC 2AJSH 3QRGL 3LRGA 1KT2A 4P23A 1KCSH 5J56B 4WUUD 4WFEE 1RK0A 4NT6A 3QSKB 2I07A 5EH1A 1CGTA 5DVOA 5LWYH 5BS0D 1X5HA 3V4VL 3S6CA 2I26N 1FLTX 1ZLVH 2V2TB 1JWUB 3K4AA 2ZPKH 5F7FA 2VDKL 1AH1A 2OZ4L 2Y06L 4YQXH 5CCKL 3UTPE 4OKDA 1MEXL 1YEEH 4LASL 2W59A 4NJ9L 4M7JH 3ZDYE 5C0RL 3SBWC 3M17A 5ID1A 4Q7DA 5FO8B 2C5DC 2R39A 5EZLB 1V8HA 4XVJH 4AIOA 4GW4B 4HQQH 4TRPH 5BQ7A 2KUTA 3VMOA 3VRLF 5C07B 5JOFA 4TVPL 4LPWA 3PL6A 2P5WA 1NGYA 3Q6GL 4LMQE 4F7EA 1IKNC 1N0XL 1HYRC 3CFEB 5I8KH 4D9QE 2G60H 5FUCE 5JW5A 1V5JA 4N0FA 3T0BA 3FT3B 3FN0H 4Y5VC 3WO4B 4JVUA 5CWSA 4LQFH 1KB5H 1AGCB 5C92A 2IANA 4I5BB 5IHUH 5CEYA 1EX0A 1W8NA 1XCQB 1CS6A 2BVQB 1CFTB 1X5JA 5CGYD 2OL3B 3IU3B 5LXGL 1U3HC 3TBVA 1KLUA 1F4XH 5E03A 4TYUA 2HJLB 1AR1D 2VAAA 2Q1EA 4WEUD 4Z7OE 4L3CA 5J6HA 3CFDB 2Y72A 1OLLA 1KFAH 1UCBL 1NBQA 2XQYK 2Q6WB 1X4ZA 2AKRA 1G7JB 1U8MA 3BQUD 4KI5F 4PRHA 5CMAA 1DL7H 4K7FA 1G84A 3R06A 1HWHB 4RCAA 1HXMA 3SHSA 5E2VH 2F8VA 2H32B 3T08A 1OOAA 3CX5J 3CSYB 5J06A 4P4KB 3JWDC 2WWKT 4JN2B 5D5ME 4YHYC 2BSRA 5E9DE 3D85B 4NQUA 3QEQB 3O6LH 5KN5B 4GBXC 3VXQB 1UACH 4MSWA 1IGFH 1N5AB 1NAKH 3VH8A 5C0CA 1FN4B 4XPTH 2VMFA 3MV7B 1T7WA 3KPNB 1MFCL 3QFJB 5HYJA 4U1LB 2H9GB 4BQ8A 4CU8A 5HGAA 5T1DH 5K9KA 2VLJE 4HWBH 1K8DB 5JIKA 2R0LL 4X6EB 4X6BB 1DQTA 4NNYB 5EG6C 3QEHB 4HG4J 3B3IA 3K8LA 1MY5A 4N8CH 5DUBB 2W92A 4JRYA 3BP7B 4AENB 4HWEL 4MJ5B 3BP6B 3ZDXE 1N2RB 3T1FB 5F7DB 2E8ZA 3K1DA 1MHEB 1JZ4A 3RGVC 3VFRA 2YRPA 4WI9A 5C9JB 5FECB 1TZGL 4IHOA 4R0LA 3U7WL 4M3KB 3MRLA 3LH2H 1EUUA 3HE6B 4EI6B 3F65A 3LSOA 5I1CL 2CIIB 1XGRB 1IAMA 3BZEA 4BZ1L 2XWJA 4G3YH 3MBED 3QWQB 3KPOA 3GMLA 3ILQC 3X3GL 3MRDA 3VFMB 3R8QA 4KV5E 4AMKH 5DA4A 4PRDB 3TZVA 3ARDD 1OSZA 2AGJH 4JRXB 1UCBH 3MLTB 3CIQA 2H2SC 1QEWB 1YMHB 1ZAGA 1DBAH 1I8KA 1KIRB 3ZHLA 4BM7A 2X70B 4X83A 1JHKH 2OR9H 2W0PA 5FCUH 5GGRA 5ADOH 3HRZA 3BT2L 5EO9A 1U8JB 2GY7B 1F3DH 4XRCA 5D7IA 4UINL 1YEFL 1I3GL 1PZ5B 4D2NA 5IEKB 3EYVB 3LQAC 5DJXB 1OP9A 3MREA 4MB5A 2X89A 1CR9L 3EHBC 5E7BA 1KCUL 5FDWA 3VW3L 4OSUH 5BO1H 1R3JA 3STLA 1I3RA 1HIML 3OAUH 4F33A 4G6ML 3TO4B 4U7KA 4KHTL 5IM7A 5E0QA 4MA1B 5E6ZA 1Q0YL 3DX9B 3LAFA 3LKSA 1I1YA 2CDEA 3C60C 4XI5D 1GPOL 3P40A 1REIA 3G6JB 3WLBB 1QFWM 4JQVA 3RIAF 1CICD 3RHWF 5D6CA 3X12A 4FQ2H 1NEZB 5BS0B 4LPYA 2D0HA 4QRPB 5D7LB 2WWMC 3EO9H 3FCTA 3WFCH 4WEMB 5DHVB 4JO1L 4QXTA 4WFHD 4JFDD 3GEWB 3QWOB 1D6VL 4AEFA 5A2JH 2BHUA 2HJFB 4Z0XA 3DUUA 2PW1B 3VFSB 3CPLB 1MCFA 2PTUA 4IDJL 4M7ZB 2OSLB 2C9AA 5IWLA 4F15C 3KVQA 3QG7H 4WHYG 5DRWB 5I15L 2YD5A 3GSUA 2GTWA 1Q1JH 1CF8L 4HEPG 2VQ1A 3MV7D 2NY3B 1Z6JT 1FO0B 3VRIA 4HHAA 1LE5B 3QUXC 2D7TL 3VRLE 1MQKL 1O5DT 2YOCA 4FFYL 2HJFA 1L7IH 4PV9B 5DHYA 5C09E 5IVXF 4M8VA 5E00B 4MS8D 1QRKA 4JHAL 4S1DC 3PF2A 4HDIB 2XZQL 3BRDA 5D7LA 1FNAA 1NEZA 5JORB 5D6CB 1MCIA 4OT1H 3K3QA 4HLZG 4MZ2A 3G6JA 3GIZH 3DMMB 4HF5H 5HD8D 4Y5VB 5SWQB 1WT5A 4FTVE 5K9QG 1UM6L 3S5LA 5B39A 2NTFA 3R1GH 1AC6A 1P4IH 4OGYH 2FD6H 3UMTA 4DVBA 5DEGA 5F71A 1IGCL 1S7XA 5KSAB 2EDQA 4PJBB 2GK2A 4I0PB 4Y19D 2IGFL 5L88L 3ZSSA 5JA8B 5EOCJ 2DM4A 3VXMB 3QEGL 3MUGB 3RL2B 5D7IB 1H9VA 3BPOB 3KYKL 1OAZL 4EXPX 4XPBH 1PFCA 1S7VA 5D7KE 1XF5B 5ITFA 1A1NB 2GSIB 1PG7W 2PXYC 4BJLA 3VXNA 3SKMA 2OQJB 2IG2L 1LO0L 5E5MB 4PR5A 4DVRH 5HI4D 1JI1A 2YK1L 5DD0H 4HKBB 5C0NC 4RGND 5I1JH 1UZ6E 4HS3A 4GS7C 3C09C 2VDMH 6FABH 4YJZL 2O61B 2DBLH 2ED7A 4TRPL 5TDNB 1IGMH 3MBXL 5DC4B 2IFFH 3GMLB 3AUVA 1KC5H 2XWJB 1LEKB 2E6PA 4BSVB 1BFTA 3HRPA 2YXFA 4MXVF 4QHMA 3V52H 4UV7L 3MV01 4POZC 4IHOB 3IF1A 4R0LB 5FV1L 3QQ9D 4L29A 3S96B 1QACA 2XN9B 1PX3A 3OL2A 4TUKL 3MLRH 4OD2B 2HLFD 3BJLA 3OKLB 2HN7B 3QNYA 3L5WB 5DYOA 4LNRB 4X8JA 2P8LB 5HTSA 2BNQD 3B3IB 5JIPA 2JJTC 3PP4H 5CJ5A 2MPAH 4X6BA 5LGKA 5C0GB 2VISB 2OJZH 3AVEA 5ITBL 4WGVB 4RGMC 3QNZA 4RDQF 3VW3H 2ZCKH 2D03L 1ZE3C 3QZWB 3KPNA 3TO2B 3F7YB 2DQHL 1U3YA 3P4MA 4UDUA 1DVFC 2XG5A 2FBJH 4GH7B 4GG6B 2VLKE 3TJEH 4RISL 3QQ4A 3HZYA 4WHTA 3WSQH 2HA1A 5KN5A 4XHJD 3QISA 4KK5D 3O3AB 1S5HB 3RWEA 4ZUTB 3VXUA 4MAYD 4UDUB 1RUML 2FECI 5JXAH 3F7YA 1NC4B 3D9AH 5L6YH 3MJGX 3WV0A 2UZXB 4KV5F 5EOCL 3QEGH 3K2MC 1VGEH 5F9OL 5C0GA 5F9JB 3R06B 3DNKA 4U6HB 4PY8J 1WZMA 2G2RA 1OPGL 3SCMC 4MD4B 2DYPA 1KB5L 2VNCA 3FT2B 3GKWH 1IT9L 5DDHA 4LNRA 3OKMA 5GIRA 1KJ3H 4JFEE 4PJ5B 2VABB 2BVOB 3BUYB 5JW4R 3O2WH 3GHEL 1EUTA 1WEJL 4X0KB 1V3MA 2WMPA 2QLVB 5DD0L 1KV3A 5L9DH 4XCEA 5I1JL 3V4PL 1NFDF 4L3CB 3SGDI 3UTSE 5DJ6A 4JJ5B 3LEYH 1UXSA 4ZNEA 3MR9A 4GOSA 5J4MA 3NH7L 5D1XC 3LS4H 3P0YL 4JFZL 5IHLB 1UA6L 3PWNB 1R3IH 4OQ1A 5D71L 4XH2A 2GCYA 1WSST 1XCQA 3GBMH 5CEZH 2LTQB 1G7QA 3DVIA 4FQIH 4NQCE 4DN4L 4R96B 2GTZA 5DQ9B 4FTVB 5D70L 1JF5A 4PR5B 2C1OB 5CWSB 1OSPL 2YPKA 2GT9A 4U6YA 2GSIA 2OCFD 1U92A 3DX7A 3CVHL 5D7IE 5BRZA 4TSBH 3VXTA 3GSQA 3U7WH 2XPGB 2ZWLT 3DMMC 3VI3F 5DWUH 3LQMA 4ZUUB 3UP1A 1NGYB 2P5WB 4KK8D 1V7NL 5C07A 2YD2A 2B1AH 4KKNA 5JOFB 3CD4A 4PJBA 1OAYH 1GYAA 1Q0XL 4WTZG 4Y19E 1T1ZB 1KTDB 5EUKB 3G08A 4DVBB 5IWLC 2FHCA 5IW1A 1CICC 2NTFB 2EDNA 2EH7L 2YN3A 3M17B 4OZHA 1N7ML 4ZSOB 3CMOL 1JMZA 4GLRI 5EU7E 2WANA 5DK0A 3T4YB 3DMMA 4N0YH 2FZ3A 2ZUQC 1TVHB 2VLLA 4R4NC 3K1KC 4XNZC 1S8DB 3OKEA 5EDXA 1PKQE 3T2OA 3HE7A 3KYAA 4YFLI 5ESQB 1T2XA 2AK4A 5E00A 2R1YB 2IH3B 4PLNC 1FZJA 3NPSB 1XF3B 3VJ6B 5CD5C 1QBLH 3UBXB 5I71B 3BAEL 1JGLH 3P3YA 4NYLB 2W60B 3JSSA 5DD5L 5C08E 1TCMA 3UJTH 1FCGA 1WGOA 2F53B 5CILH 5L7XH 4C56B 1P6AB 1D5ZA 4X4ME 1XT5A 1W72L 5CSGA 1FH5L 1UH4A 2Y6SD 2V17H 1UA6H 4CDHA 1JRHI 3F7VA 3ULUE 4Z77A 4C57C 4ZFOB 1NUFA 1HHHB 2F54A 5C09A 3FO1A 4Z0XB 4OBRA 2NR6D 4RAUA 1F42A 1KN4L 1T3FB 3MRGB 1AQKH 3B2UC 4G43A 4K2UL 5BZDA 4JVPA 4YDIH 4GXUN 5F89B 5IMMA 2FX9L 4XCCL 4LPVA 5FHAL 3MLSH 3OR6A 4OLZH 5KW9H 3TZVC 3RPIB 3RFZC 2VXQH 4M1CD 3MFFA 4WHYH 1Y6NR 1B4JL 1I1YB 2CDEB 5LBSH 3VFPB 1DVFB 5GRJH 5D7JD 5IM7B 4P3DA 4JRXE 3WFDL 3TO4A 4YK4B 1RUMH 1SBBA 1RUPL 3V0AC 1NBYB 1QPXA 2BRRH 2ESVB 1DFBL 3STLB 1R3JB 4LLUB 1ZVYA 1NCAH 3LKQA 1I85A 1E6OH 1KIQA 4C83A 4QLRA 5ISZE 4OZFB 4OCNC 3WFHB 2FHBA 4YDKL 4DFIA 3H3KA 3LRSA 3PIQB 1F13A 3F5WA 2UWEF 4J3UA 4ZUWB 1NH6A 5L88H 3HRZB 5EO9B 1PW3A 5IV2B 4WW2C 3MLWL 3GHEH 4GG6F 4LAQL 1XF4B 5C6PB 1WZ1H 3AB0B 2AXGA 3MRNA 3ARSA 4L5FH 2YRZA 3KYOB 3QQ9C 2C26A 5F7HA 1O0VA 4G8EA 5C3LD 3MLTA 3R1GL 1FFQA 5D1QA 5D6DC 5DS8B 2MCPL 2XWTA 2V7HA 3C5SB 3MV11 4WGWB 5JQHC 4O51B 4PJHB 2FGWH 3F7PC 3GMMA 3KS0J 2AABL 3GSVA 3BZEB 4LLAA 1MOEA 2CIIA 1NDMB 2V6HA 5HGBA 4IRJA 4PJGF 1B6DA 1HWGB 1KC5L 3HFML 2ITDB 5HI4C 3O2VL 35C8L 2AP2A 5I1EL 3DV6B 5DO2C 3J7HA 3MV9D 3RA7H 2PW2A 3U7AA 4JY5L 4NKDB 2PTVA 3T1FA 1JGVL 3QI9B 3HNSH 5DJAA 5BOZG 5CCKH 1P7KA 1IEAA 4QRRD 4XC1H 3MOAH 2SEBA 1RJLA 1OAKH 3BH9A 3VXOB 4DKEH 4X6EA 4J3XA 1F8TL 3ROOB 5C0IA 3U9UB 1TZGH 3BIKA 4NZTH 3MV9A 4K3EH 3RAJL 4L9LA 3MV7A 1U3ZA 4NO2A 5E4EB 3QAZC 5TDOA 1MF2H 4PRAB 3THMH 4HV8B 4GJTB 1KIUA 3U83A 3C87A 4N8VG 3LKPB 2JCCA 7CGTA 5F1IB 1UKSA 3N50A 1EV2E 4PJHF 5I2IB 1F00I 2DQEL 3TYFA 2NY7L 1ZWIA 4L8CB 2R56L 1PY9A 4JN2A 1C5BL 1BZ9B 1ZHKA 2O5ZL 5ICYB 3VXPB 2J8UF 4Y4KD 1X5ZA 2EIEA 3CU1A 2ENYA 4G6FB 3IDIA 3NFNB 1HXMB 4QTHA 3GK8L 3MXWL 3HPJB 3L95A 2D3VA 1EEZA 1JJUA 5EWIH 5IJKC 1IKNA 5BV7L 1P7QB 2YWZA 3AC0A 4JLRB 5I9QB 4Y4FB 4OV6F 4U05A 2PYED 2V5SA 5C08D 2R23A 1OAUH 5L7XL 1X3DA 2OL3L 3ARPA 4JG1H 4GKZA 3CFDA 4K71B 2YZ8A 4JR9H 4XXDB 3QEQE 4ELKA 2NTSP 3O41B 3VG9C 1S7TB 1Q72L 3TBVB 2ICWB 1IGJB 1I1FB 2BJML 2C7UB 4XVSH 1P84K 5CJQL 2UVEA 1N6UA 5HHXL 1TLKA 1TNMA 4X99A 3RX8A 1AGCA 3HC4H 3V6ZA 4HXAL 3RA7L 1B0GA 3RI5K 2HVJA 4P2QE 3TFKC 4QNPE 3CGTA 4MVBD 4G9DA 4TUJA 4UIKH 5DJ2B 1JGDA 1JNHB 2BOBA 4M5YL 4NPYB 3WN5A 1FVEB 5T5NG 3LHPH 1XCTA 3TZVD 3CLFL 4PJBE 3JV4A 3QXWA 4QHLA 1RUAH 1JF1A 1HH9B 2F58L 1QVOA 1I9RL 2R4SH 4K7PY 5E6YA 4ZAKC 3KPQB 5GZND 3H7BA 1U8QA 4OZHE 4PJ7F 1CLZL 2XKSA 5E6IC 3TV3H 1MQ8A 1OTSD 4NM8L 3QNXA 3S98A 1H3WM 4I18C 1FRGH 2X6MA 4HK0A 1D5MB 2H2SD 5H37G 4IMLA 4EI5C 1LO5B 1OTSC 2X7LB 4FFWD 2O5XH 1IC4L 1YQVL 3BSZH 5C0RH 5IR1B 2FLBT 4JAMA 1CFSB 3V8OA 2QQNH 1WZLA 4OZIA 4Y1AB 1YEGL 5E2WH 1KT2B 4P23B 3MBEC 1FGNL 1OF2B 1LE9A 1QFWL 5F9WB 4F58H 3BI9X 1BFVH 1I7TB 5DSCB 1XR9B 5HY9A 2QSCL 4JKKA 1MVFA 5K9OA 5DQDL 3PGCB 4AMKL 5IVZA 4ZS7L 4N1HB 1WBZA 2PYEB 3SDDA 4LSPL 1YZZA 3QRGH 3KPMB 1MCDA 4LLDA 3NMEA 1BD2B 1X44A 2DYPD 1NC2B 1F58L 1UWGH 2UYLB 4ONHA 3UPAA 3DBXA 1EIBA 4P5TD 4R6UA 1M71A 3D39B 1C08B 3B9KB 4KUCF 5GSVB 1Q9OA 1HKLL 2ADGB 4B5EA 1U8OA 3VXSA 3CFJA 1WTLA 4PJHE 1R3LB 4LCYB 3VFVA 4YDJA 3BPCA 2EDOA 4HGKC 4BZ2H 3QCUL 1U8PA 2P49B 3HZKB 1VPOH 1T83C 5IG7A 2A2QT 2A9NL 2OTUB 4FQXD 1YC8A 3AB0C 4DCQB 1M4KA 4JB9H 4WV1A 1KGCE 2VXQL 5LCVH 1KIPB 3IDYB 5ISZA 3BKML 3SDXF 5C6WH 1S7QA 4WU7A 3KXFA 4HH9B 5MEPA 4PJGE 5DUPL 4K2UH 1CIDA 4LLMA 1JZ2A 2EYRB 2ZOKB 5EIIA 1ZMYA 2BOCB 3VFVB 5E2VL 3WUWG 3O4LA 1U8OB 1J1XL 4KY1H 5SWZE 3OKNB 1BQSA 1KELL 3KDMB 3O9WD 5HVHB 4ZO7A 3D2UB 3G04A 4U6XA 1N64H 1NUGA 3DBXB 4NQVB 2R0WH 5MENE 1ZGLB 3HUJF 1MJ7L 5C71A 3UJTL 2R29L 4K71C 2HT2C 1INDL 4QXGL 4U1GC 3QXTA 1A7BA 3L3GB 1RHHB 4H26B 4V2BA 3FRUB 3UTZB 2YSSB 4PJEB 1FAIH 4XPAH 2D4DA 1CLOL 1JL8A 2YUWA 1CGYA 1OF2A 1WTGT 1YN6A 3WMSA 1YPZB 1X5AA 1JV5B 3UAJD 5HHMB 4L8DA 1BLNA 1MPAL 1S7UB 4LHQB 3QRFM 2F53E 5F96H 2OTWA 3MXVL 4RRPG 5HYQA 2EDWA 3KPRB 3MA9L 1INEL 2YUVA 3RZCA 1S9XA 3EUUA 4EI5A 1TCRB 2P5EE 2AV1A 5F97E 2YD6A 3TWCL 4ELMB 1CE1L 1GGIH 4M02A 1CU4H 1P7HL 2DICA 1NAKL 2ITCA 3TCLB 5J8OA 4ENEC 3TVMD 5IB4A 3B8SA 1NKOA 4QRSA 4OZGF 1EPFA 1U95B 2AERT 5J7CC 4D9RE 1L6XA 1JWMB 1JZ5A 1JF1B 5D96C 4X7TA 3QUMA 2C4FU 1B2WH 1SJEB 4K3DH 4QCIA 5SWSB 1KTLA 3WN5B 1TJIL 2H2PD 3RGHA 4MHHI 1AHWB 3RUGB 5L2JB 4JM2F 1YEFH 1SY6A 2B0SH 4NUGH 3I02A 3MUZ1 1JN6A 1UT9A 3FN9A 3G9AB 4KMLB 4NC2B 5IB2B 1CFQB 2RR3A 2CLRA 3D39E 3QZWG 1F4WL 1H5BC 3ESVF 1EZVX 1A8JH 3OHXA 4M7ZC 1RFDL 3CDCA 1LNUA 4NKOA 4NRYA 5IB3B 3NFPA 2WP3O 1MCRA 3FQUA 5TE7L 3OGCB 5DLML 1TMCB 1S7TA 4LEOA 1GAFL 3AU1A 1KUMA 1AGEB 2BNRD 1XF2B 4M1CC 4N1EA 3AY4A 5EC1A 4DOHE 3WNKA 4EVNB 5CD3A 3ARFD 2NZ9D 4P2OB 4JO1H 5CSZB 2DRUA 3F12A 2W9DL 3PDDA 4JLRA 4FHBD 3FN0L 1EEZB 5CJQH 5BJTA 4E5XB 1CK0L 1VPOL 2WM0A 2VDKH 3GI9H 4I18B 1MWAH 5AYUH 1RIVL 1N5YH 1UG9A 3JVGA 3JV6A 1L9NA 2FX8H 2X10A 2XI9A 2ARWA 3JXAA 1I8LA 1ZWIB 5HJ3B 1I4FA 4I2XA 5FO7B 4Z7WF 1NKRA 5F1IA 3IDYC 3CLFH 3T65A 2DWDB 4IS6B 1NCCL 1RJYB 2BC4B 4N90D 3RTQA 4U1MA 4BFGA 4XPFL 4HIXL 1KF9B 2WBJB 2P43B 5MP6L 2FR4B 1JHTA 2YC1A 4IIQB 5M95B 4NN5B 5C07D 5ICXA 1BM3L 3VXOA 1RZIB 1Q38A 4ERSL 2ZJSH 1BP3B 1RJLB 1WEJH 1NAMB 5EU3A 2FB4L 4FFVC 4KQ4L 5AD0B 5HHOD 4N0UA 5DJAB 2F58H 1MCOL 3B9KC 1OAXH 5CBEB 5DEZA 3EDEA 4I0CC 4XGZB 5E1AA 5KANI 4KC3B 2X05A 3TNMA 1NMBL 2F5BL 3MNZA 4YZFE 4HSQA 1U8LA 3IRPX 4IRJB 2IGFH 4R9HA 3GSVB 4FQIL 3WE6A 3IFPA 2P44B 3BP4B 1CVRA 4LP4A 1JFQH 3TGXA 5BVJB 3T0WA 2WAHA 3MRBB 4L9LC 4LLYA 1CLYH 2CDFB 4DW2H 3LQZB 4M61A 2VZTA 1A14L 1DL7L 1HHJA 3FQWA 4JGJA 3O6FA 4D0DB 4WI6A 4UOJA 1G6RA 2CH8A 3EO0B 5DJDB 5IV2A 4HJGA 5CP3A 4ETYA 4LIQH 1GHFH 2EDRA 3X3FL 2OP4L 3IFLH 1PKOA 3MCKB 3OF6A 4Z7NF 4KQ3L 4OCMC 3MJ8A 4NN7C 2ERJB 4JFFA 1NL0L 2ZUSA 3LKNB 4UT7H 1WQVT 5I66A 1DUYB 4JM2B 4MQ7A 4PJIE 4BSWA 5L8JB 1NMAH 4PRPA 3QCTL 5GPRA 1QFOA 1ZOXA 2F19L 5A2LH 1DVFA 5TGBB 4V1DA 4UZGA 3WS6A 4KJPD 3QUZB 3QP3A 1R24B 3MRMA 3LMJH 1JGVH 1FRGL 2NLJB 5BCAA 3LN5B 1DDHB 2HFEB 4JFFD 1AHWC 1JPGB 4NZUH 4E42A 3I6GB 3UX9B 1P2CA 4EZMA 5HHNA 1OWRM 2Q20A 4J4PA 1M7XA 1IKFL 4P4RA 1KENH 3D39D 4TOYL 1BM3H 4KJYA 2D7NA 5BZDB 3RVUD 4ZYKB 4QOKE 4YXHL 1KB5B 3HI5H 4PJ9D 3NCJH 3GKZA 1YEDA 1MFDH 3QO0A 4UDTB 5I1KL 4Z77B 4PD4J 1AR2A 5FDYA 1KCRL 2JJTA 3O8XA 4Q2ZA 4R4BB 1OVZA 1T66C 3WBDA 3E6FA 5EU6E 3DVNB 1LEGB 4UV7H 1P4LA 2CLVA 4Q9BA 5GGQH 1C5BH 1NDGB 2OI9B 3JUYA 3ZE1E 1LO4H 3G5ZB 1T03L 3U7YL 2AW2A 4P2OC 2KZ1B 2V9RA 2RIKA 4UTAL 1OPGH 3PV7A 4QKXB 3T0EA 2FX9H 4QY8A 4M93C 1FZJB 1VERA 5HXMA 1G7HA 3FO9A 2XACC 5LGJB 4I3SH 3FL7A 3WN5C 1YEJL 5HGDA 5ENWA 3WNMA 2FWOB 1DQMH 3VFGL 3OKEB 3VFUA 2VLLB 4F9PC 2FZ3B 3CDGB 1GIGH 5DK0B 3TJEL 4OZHB 2E5EA 4K9EC 3CSBA 1NFKA 1H5BB 1RZFL 2A74B 5H35B 4HUWB 3UBXG 1KTDA 1IARB 2FIRT 2NY2C 3MCLH 2D31B 4CAGA 5ID0A 2ZUYA 1WBYA 4TULL 3WFEH 1A7RL 4JG0H 4YGAB 1K5NA 4KJQC 3SQOL 4XP5L 1UQSB 1A7NL 3H3BC 3GSQB 4WWID 4JCLA 4U4BA 2K3TA 4W68A 4PB9L 4X80L 4EDWH 1U92B 4X4YA 5GQBA 4NFDA 4JEGB 5C8JA 1HKFA 3MRIA 3G5VA 2WQRA 2VRAA 2X1QA 3LV3B 5I73B 3LH2L 4IRSB 2UV3A 4XX1E 3RNKA 2VZUA 4G80B 1RURL 4DTGH 3SGEI 5HPMA 3V8CA 4AQ1B 1IC7H 2R15A 3EFDH 5I17A 2RB8A 4PRNB 2X4RA 1YA5A 5H94A 4JJ5A 1CDCA 4GG8A 4Y5YA 4IMKC 5IBLD 3EYQC 2BVTA 3FAWA 4WY7L 2QSVA 1E0OB 3TBWB 3DLQR 1CBVL 1BJ1H 3ULVE 4D9LL 1KJ2H 3KNBA 1B0WA 4LSUL 5LGHH 4S1DD 1D9KB 4Z8FL 4CADA 2O5XL 2DYPB 4DUVA 3V95A 5AZ2H 4U6HA 4MJ2A 5TQ0H 2IAMB 4M1GL 2DMBA 1H3VA 3WXWL 4XMPL 5EU7C 1C12B 4LVEA 3SJVB 4UQ2B 5BXFA 4JN1H 2IANE 3VRJA 1MWAL 2MQ3A 4LL9A 3O3AA 3RWEB 4O2FB 4HPOL 2FD6L 4HBCH 2EC9U 3KPLB 4YK4C 2K1MA 2LAGB 1HCFX 1T1WA 1A6WL 2A6KB 3QUKA 3DO7B 1Q94A 3FT4B 4IRJC 1W0WB 1ORSA 3MGOA 1CE6B 4LCWE 4MA3A 1L4IA 4L3EB 3QNZB 4R8WH 5IBUB 2VLRD 3GMRB 5IHBA 1D5BA 2XY2A 1CL7H 4NO3B 3WJLA 5F7EH 5FUZH 5L2KB 5DYOB 3L5WA 2HN7A 4NNXB 4NRXA 2GI7A 4HCRA 5D5MB 3C5ZC 4HS8H 2CMRH 4PGDA 1KPVA 1KJ2A 1RFDH 4PJ8D 3SKUD 2WBWB 3ILPA 4L29B 1NCUA 3S96A 4RBPH 4Z7VB 2MSPA 1U9KA 3GZKA 4Z7NE 2Z8RA 4MA7H 4TN9A 3ZHKA 3RWFB 1MFCH 3DYMA 3FHAA 1MJ8L 2XA3A 1LEKA 1MQKH 4FFYH 1NLBH 4PJIF 3NGBB 1KYOK 4YNYB 4FQCH 3MRCA 3OG4B 2O61A 4KMTL 1N6VA 1YEHH 4KTDH 1QRND 5C0CE 1UZ6F 2EEDA 1CD1B 1IZJA 4HKBA 1U36A 2I60L 4Z0BH 1VGKA 4EI5D 2DOCA 5D7SH 1DUZB 5IMKB 1UM4L 3WHE1 1D3CA 4Q58C 1QSEA 5JUEH 1KCLA 1AO7D 1A02N 5I1IH 1P1ZA 1HDMB 4TSCH 1QRNA 1B4JH 3A6OA 3VXMA 5LAXA 4Z95H 5I8CA 5AWNL 3V0WL 2M1KA 4UILH 1S78D 5DHVH 4P3CL 1YUHB 5KSAA 2ORBH 4MNQD 4ZXBA 4I3RH 3ZZ1A 5EOTA 3ES6A 35C8H 4Y4HB 3K46A 5EA0L 4YX2H 1MIEL 1QSED 3CLEL 5B39B 2AJZB 4DW2L 4C4KO 3QQ3A 3TEUA 5SWQA 3RL1B 3C5ZD 3LPFA 4Y0GA 5A16B 4F3FA 4RMVA 1I7RA 1SHMA 1X5LA 1R3HB 4BQ6A 2MFNA 5KJRL 1A0QH 1S9WB 4FQPA 1RZKH 4FQLH 1F8TH 1IAOB 5IK3A 1FE8H 3QUXB 4NBXB 4UBDC 1CL7L 3PDOB 1V7MH 1T0PB 1HOCA 3JTTA 4G8IB 4KQ3H 4OUUB 5T33H 5F7EL 1ULVA 1WC7B 4QXUL 4RGOH 3S35H 2L7UA 5FUCC 3L5HA 5E1HB 5FOJA 3VRIB 2H8PB 4HXBL 3MTRA 3WHXA 3RVXD 2HFFB 3ZDYF 4ETQB 1EBPA 3KHOA 4GSDH 1IM3A 4Z9KB 3TF7C 4K8RL 1RIUL 1S3KH 1LDPH 3HS0A 3E1F1 4OIIL 4ALAL 4P23D 4M48L 4U2ZA 1FYTE 3G6DH 5JOPD 1RUQH 1RIHH 2F5AL 2ZSWA 3CPLA 5BZWB 2LABA 1JHLL 2CRZA 4KI1A 1JNJA 5GGQL 1ZA3A 2BNRB 5BRZD 5J11C 2CLZA 3DX6B 2NY2B 3QXDA 4HIEB 5CJXC 3WXWH 4UT6L 3V6OA 1JGEA 3SE8H 3IETA 2VDOH 5BVPL 3RPKA 1GHFL 4I13B 3X3FH 2NZIA 2IJ0C 4NZRL 4HZAA 1D7FA 3OKKA 1E4KA 3EYQD 4ZAKA 3FB8B 2BY2A 3WLBA 4JKLA 5HHMD 3LKSB 3ZE2F 1HZHL 3B2VH 2PNDA 3MACL 4PV8A 3GSNB 2XT1B 4WDIA 3KR3L 2FJHA 4KUZH 1T80A 3WYRA 3JTSB 3RWCB 3PWUB 2NW3B 2P5WD 3DTXA 1I7ZB 4ODWB 1ITCA 1GGUA 5FKAB 2DTML 5D2LF 1FPTH 1XH3B 1FCCA 4NWUH 1BF8A 3OB0K 1QO3A 3WDHA 3MXWH 3ESUF 5GGRB 4GKSA 5FHAH 2ADJB 5SV3A 4YHLH 1S5IH 2UY6A 4HKJB 2FX7H 4G8GE 4JVWA 4WEBH 4Z7QE 5EPMB 2V5YA 3R8BB 2P24B 1YMHA 1AP2A 1QEWA 5FM8A 3H42H 5JQ6H 4WWKD 3EOAA 4P9HH 4YHMH 4PRDA 3GJFA 3UTTA 3MBEB 3HR6A 4JHZA 5C2UB 5F9WC 3U4EA 3P77B 2BRRL 5TE4L 2GK0B 5JW4Q 1NCTA 5T3XL 4DTGL 2Z31B 4LSVH 5HPOA 4DN4H 5JXEC 1IC5L 2JK5A 3S35X 2F74A 2I25N 4KGJA 5I1HL 2GITB 2V9TA 4ZG1A 3H2WA 4X4ZA 1CYGA 5SWZD 1UB5B 1SJXA 1Y18B 3G6DL 1MHEA 3MNWA 4W6YB 3ECBB 4F2MB 3P9MA 3BP6A 4I3SL 4NQXA 2AJ3B 3OR7B 4JRYB 4RWYL 4NN6C 1W0VB 3QEHA 3L7FA 5E8PA 4WO4C 5F6IB 1KN2H 2X42A 4P2OD 4P3CH 5HGAB 4QRPE 3GO1L 2IADA 4U1LA 2DLFL 2ZG2A 3ZKND 3QFJA 3QIUB 5BW7A 3HMWH 1K9TA 4XVTL 1GC1L 4KJQD 2NY1B 2Q7YB 4KKAC 3I6KA 2W65A 3AXLA 3EYSH 3OJMB 4Y4KB 3BKCL 1XGQB 4G9FB 4N9OB 3FQRA 3VXQA 1OLZA 2J3SA 4U3CA 2Y5TA 2DQDH 4LCWA 4BH8A 3SDAA 1TPXC 3GGWA 4ZOEA 1FZKA 4KPHH 4FQHB 1UWXH 2YBRA 3SE9L 4RGNE 1PYWB 4OD3L 5E8OB 5CJ8A 1IFHL 4YFEA 2DL2A 1UZ8B 1VADB 3D18B 4QF1B 3BMVA 2NR6C 3HG1D 4JZJB 1AXIB 5CMAB 3ROLB 1DLHA 3EJZC 4H20L 4TUOB 3OKYA 2DQHH 2CXGA 3KLAA 1G9MH 1YYMH 5SWSD 4R97C 3LCYA 3ME0A 1Q9KA 2DDQH 2NY0C 3RKPA 3HNTL 2GY5A 5D1QC 1TJHL 5IB5A 3TVMB 2VAAB 4M48H 5DJ0B 4OTXH 2VJXA 5DZNA 2HJLA 2JTDA 3CSGA 3OV6A 1G7MB 3PJSA 1SQ2N 4P46B 2OL3A 4HJJL 1T7VA 4H1LB 3EJYC 3U9PH 2AV7B 2RHEA 2FYYA 3GSNH 2JE8A 3VXUE 5TFSL 3EOBB 2W1NA 3BH8A 1JNNH 5FA3A 3RI5F 2QQKH 3PWPD 3DXAB 4MWFA 2EH8H 3FT3A 1RHFA 4PFEA 1CXHA 2VLKD 4G8FA 5L2KD 4MZ3A 3VXME 1KACB 1NCNA 4KMQA 4JM4L 4XCFL 2X89D 3BX7C 4H1LH 3VE0A 3HPLB 4OF6A 1K8IA 2Y25A 4LSSH 1JF6A 4BH8B 5FYKL 2QSTA 1LD9B 3CFCL 3O11A 5AUMA 4HIXH 1XGQA 3EKCA 4G9FA 4L3AA 2W65B 3AXLB 4Y4KA 4LLWA 2Y6SC 1YEIH 4QHKI 1IGTB 3ABZA 5GRWA 3L1OL 5CIPB 2R8SL 2ORBL 2O5ZH 3QIUA 3E2HC 4NKIH 5FK9A 2R2BA 1ZVSB 4H25B 3REWB 3UJJL 3IXTB 2ICEA 1QBBA 3OKDB 2ZPKL 2FHFA 1EZVY 2CK0H 4G9FD 1A4KA 2EEBA 1YECH 3WIHH 4ODVH 2AJ3A 3OR7A 4NQXB 1DLFL 3B9VA 1HHGA 2G9HB 3TWCH 1I1AC 3T3PF 1F4YH 1AFVH 5DD6A 3MNWB 3FTGB 4F37K 4YBHA 1Y18A 3Q2CA 5D2NA 2W9LA 5F70A 4HQQL 2GITA 4W4OC 2QQQA 4XVUD 4Y2DD 2F74B 4U3XA 4OCYL 1YNLL 3HZVB 2NNAA 4M4RA 4NO5A 3O6KL 2FJGB 1FYTA 1L0QA 4LEXL 1AJ7H 3O2DL 1AXTL 2BNQB 3FONB 5HYSG 3RHWK 1ZEAH 1NFIB 3MNVA 4PJEE 4H0GA 4Y2DA 3U0TB 1AP2B 5I1LA 5EC2B 1SEBA 1KULA 4DQOH 3MODL 4QXUH 3KJ4B 5I75B 2ADJA 1ONQB 3N0PB 1G0XA 1X7QA 5BMFH 3D48R 2QQNL 2EH8L 5FAAA 1IQDA 3D69B 2DQGH 2P7TA 1D9KD 1G6VK 5HI3D 5I18H 3SE8L 2VYRE 2Y4SA 3SGKC 4M9PA 5CZKA 4K3JH 2VTFA 3ZMRA 4I0KA 3PWPB 2BNRE 5DJ8B 3QPXH 4YC2C 1C7TA 3V0VB 4Y19B 3IJSB 1HEZA 2ICWJ 3HC0B 4PP1D 5GS1C 3GSRB 4WDIB 2GFBB 2VLRA 3GNMH 1CLZH 3BGFC 4PJAA 3KYMA 1R5WA 3BESR 4PGCB 4TSAH 4FQJH 4ZQKA 1MI5B 2W0LA 4PJBF 1T7XA 2HT4D 3FJTA 4UAOB 1WFUA 4RNRA 3BP5B 1QBMH 2Q86A 4OFIA 5CLTA 4OZHF 4EN3A 5HHQB 5D1XA 3AAZA 1U91A 5LBSL 5ITBH 2X4NA 4UINH 3DX6A 4JR9L 5IMLB 2CLZB 1SM3L 3KPSA 2ZSWB 4GUPB 4LHUD 4LPUA 4WJ5B 2FJFB 2Z8VC 1YNKH 5GRYA 4M43L 2BERA 4NQEE 3TVMC 2A73B 1AD0A 4HIIA 4F7MB 4N90E 5I1AA 4OI7A 2OM5A 1P7QD 2A1WH 1P5VA 4XHJC 2XZZA 4Z78A 2AVGA 2M8XA 3FQNB 3MRFA 4JDZB 5I1GH 2W9DH 4LBEA 2Y36H 5I1DA 5FGCB 1W0YT 4Z18A 4U49A 1IMHC 1IT9H 1QSVA 5JQ6L 3PNWA 3AMLA 3VD4A 2G60L 3PP4L 3QEUB 5JHDA 5DEFA 3UAJC 4BK4A 4DGVH 3BD5A 2E7LC 2R1WB 4XCNB 2WIIB 1BFSA 1WWWX 5ERWB 2DMKA 3IGAA 5EZJB 3TC9A 1IC5H 5I15H 5I1HH 4R97B 1Q9LA 4JM2C 3TNNA 3GMPB 5K59F 3VGHA 3IVKB 4LQ1A 3ZYIA 1NFDE 3MYJB 2C3XA 1FL3B 3NABH 2BP3A 2QKIA 3NCYP 4JREB 2BFVL 3QR2A 2E27L 5LAXB 2ZOLA 4JPWH 1ND0A 1LO3H 1P1ZB 1A6PA 2Z4QA 1MPAH 3Q6FB 4AH2A 1KXVC 4YHLL 1PSKH 4M5ZL 4OCSL 5EO0B 5J13C 5JXEA 4NM4H 2VH5L 2HP4A 2G5BA 4BUHA 3EFFA 4YAQA 4DKDC 4ZUVB 1CE1H 2ZNWA 5L9DL 2UWEA 3O6KH 1FGVL 4HJ0D 3K8KA 4RQQA 3ARGD 4YNYA 4FXLA 3U2SA 4LSPH 3S88H 3Q48A 2Z35A 3MV9E 3V6BR 3KYNB 1LDSA 4LPCA 2VDRH 4ACPA 1VHPA 1J9CT 4PTUB 1VA9A 4G6JH 3SN6N 2I9LA 2KZWA 2DQCL 3OXRA 2BDNL 2CXKA 4GMTL 4ONFH 4Z7VA 3L3KB 1GOFA 4OD3H 3ILPB 1MJJA 2W0FA 4YPGA 1QNZH 4UU9A 4AEHL 3UYOD 3MROA 1FFPB 2RFXA 4J3WA 3NCCB 5C0EB 3G5YA 1GSMA 4XPBL 4YH6A 1W72A 1ZT1A 3KJ4C 2OMNA 4PB0L 5JW3L 3QIBA 5TFSH 3QUYB 3GSXA 4X5LA 2C3HA 3HZMB 3NA9L 4MJ6A 3PABB 2AEPH 4MS8C 4FQQA 5KSBE 3P30L 1CE6A 1JMXA 1HH6B 3CXHJ 4TTDC 1OAYL 3MFGB 4LRIA 5IBTL 1WIUA 1I1AD 4ZUSA 4P23C 4K8RH 3C6SA 2A77H 4R7NA 5C1MB 1A6ZA 4O2FA 2YA1A 1CG9A 5IMOA 1IM9A 3F7RA 4LK4A 1CTNA 1AE6H 3P9WB 4LIQE 4F7PB 3MLRL 4R4FL 4Q6IB 2DKUA 4MXQD 3L1OH 3WFZA 4WWKA 1RZ8B 4Z7UE 1A2YA 1HXYB 3ULUF 1AI1L 4MA8H 5KS9B 1LK3L 1X5KA 1MFEL 3RWGB 4AEIH 4PJEF 3RWJB 5C7XH 3PHQB 1FIEA 3H9YA 4HUVB 2WW8A 4M6NL 1JHKL 2JB5H 3BUTA 1DBBH 1SY6L 4LSSL 3V5DB 5ADOL 2DS4A 5LG1A 4L4TE 2ZZUT 3UYPA 1JGLL 2N7BA 4N9GA 4LCWD 3L3HB 4ONOA 4YR6A 3Q1SH 2EYSA 2Q76A 2Y1VA 3CAFA 1A7RH 3KG5A 4PGEA 5EBMA 3GRWH 2V17L 3VFNA 2XYCA 4ZMAT 3VGFA 3RKDC 3FRPA 3SGJA 1T2QH 4YWGH 2BSSA 2ED8A 4POUB 3TFKD 3S34H 1CXKA 1T22A 5FKPA 3C5JB 2UZIL 5K59E 2PCPB 3CX2A 1I1RA 5ANMB 1K3IA 4QHNB 4OFDA 5D1QD 4P48A 2FL5B 4OJFH 1CCZA 4YHIA 3VFTA 1TZHA 3F62A 4LHUG 4BYHA 4JFED 5GGVL 4M7KL 5JPNA 3TBTA 1EO7A 3O2DH 3RWIA 4PJAE 1BQHB 5F3BB 3ULVD 4JREC 4WVRA 1DE4B 1U8IA 1IEBA 1CLYL 4JANB 1OW0C 1XAUA 3DPBA 1NCDH 3CX5K 3MUHL 5JHLH 2D7TH 2HG5A 4OZGB 2J5LC 2NCMA 4EDWL 4YBLB 1YEKL 1QA9A 2DQFA 3LKRA 1R6VA 5T3XD 4XNUL 1YYLL 3HAEH 2OP4H 3IFLL 1E28B 4MNQE 3E6HB 1ZHNA 4UIMA 1B0RA 3C5ZB 2B5IC 2COQA 3TBYA 3SKNB 4QT5B 4UT9H 2DJUA 4FMFA 4U7MA 1F3JB 1QSZA 4A6YH 4R0LC 1G7IB 1ZA6A 5EBLB 5D4QA 2ADFL 2EICA 1UM6H 4IOFD 1EBAA 4P2RB 1P4IL 3I3BA 1A1OB 4E0RB 4XPHL 5ICZA 1ZA6B 1QKZL 1MRFL 5HDBF 4UDTA 3TBYB 1KB9K 1TQCB 2UUDK 3I9GL 1DBAL 1ZHNB 5DJYA 2J8UE 2MNUA 5D96B 1KB5A 2A6JA 2MWCA 1D6EB 3FFDA 3ZTNH 1G9ML 1M7DA 3I6GA 4PJ7E 1U93A 3C9NA 1MWAA 2NLJA 3VXRD 1EXUA 5F21B 5SWZA 3BZ4A 3A6BH 4X6FA 4AYFA 2YK1H 1OQXA 4V1DB 1FYTD 2FECL 4D8PB 3THML 5MENA 1WWBX 1DQJA 1ZHLA 3QJFB 4NQTA 5D71H 1DQLH 5IBLC 1HQ4A 3GJFK 2X1WL 4GW1B 1Z9SA 4OGAD 3MJ8B 1TTGA 4JM2D 4YDLC 1TZHB 5INCB 2P42B 4NIKB 2UY7A 1I85C 4PJ9A 1MCCA 4UOW1 4JHWL 4WUUB 4BQ9A 1DSFL 1DTUA 1S7WA 5ANMA 3UO1H 3T2NH 3ZT7A 3SDXA 2BNUB 4OLXH 2DKSA 3IJYA 1HHJB 4HUXA 2VIRA 3FQWB 4HS6A 4NCDA 5D8JH 4PBXA 1OGAD 3C5JA 1A7PH 4O02H 4TPRH 2CD0A 4HEME 4MMZC 1IEHA 2B1AL 5JLZB 3HC3H 2VC2L 4LPXA 4ZTOL 3DGGB 4AIZB 1UB6B 5HVFB 1I7UA 4NP4L 3HUJB 4YHZH 1F5WA 3WE6B 1CQYA 2VLME 4HKZA 5TQ2H 1I8LC 3GFUA 5SX4H 4Z7VE 3HG1A 1UCTA 2KBGA 4UUJA 2C1PA 1A6VH 3WSQL 2DIAA 2H45A 2V2WB 3S34L 4NC1C 1ZLWK 4GO6B 4HPYH 3BRGC 2JF1A 2VXVL 1BAFL 4XGZA 1BGXL 3RY6A 5MERA 4JO3H 5I19L 1FLRH 3V5DA 4N0UB 1CDYA 1LP9B 1SBSL 2EXYD 1C8PA 2GAZB 4PREA 3BZDA 1RUKH 1MCWM 4WUUE 5EU4A 5HYIA 4WWKB 4HXBH 4H8WH 2YC1B 1H8OA 2IALA 5E9DB 4QHUB 2BMKA 1QFWH 4Q6IA 4DEPB 4XNXH 2GJZA 4MJ4A 4RZCA 5HSFA 3DETC 4JGMA 1EHXA 5LKNA 1CG9B 3K4DA 3JWOL 4HX1A 2BC4A 1NC4D 4P9MH 1A6ZB 2X4OB 3FQTB 3H9SD 2MMXA 2E6QA 3CK0L 4JKWA 1NJ9B 4UBDD 2X4OA 4PP2A 3L3IB 4HW6A 4PP1C 1U8HA 3QDGB 2XWBA 3ARBD 1YJDH 2P8PA 4GRLC 1T7YA 2P46B 4YDIL 5F1KC 4F9PA 4X6DB 5FB8A 2IALB 1A9BA 4OGXL 2WLYA 3MRHA 1CXLA 4NNPL 1U3JA 2GAZA 4PJ9C 4PREB 3MQIA 4MGXA 3SPVB 4DJMA 1YPZE 4J23A 2RFXB 1WAAA 5CSZA 4YHNB 3C8HA 5JW4M 2EC8A 3QIUD 4DKAA 2O93L 2VDML 1LK2B 1A6AB 1L7TH 3H3PL 5CD3B 4AG4H 4WCYH 4J8RB 3OXRB 3W11D 2C1PB 2EE3A 3RVWD 3RWHA 1AGEA 3HG1B 2DTMH 4CVXB 5INDA 4GRWE 4YO0B 4AM0A 4ALAH 3OGCA 1PG7L 9CGTA 4I2XE 5CJOH 4DGYH 1ZLUK 1QNZL 2CSPA 5FM4A 4OM1H 1UB6A 2UWEB 4H8WC 4ZO6A 3KAAA 1A3RL 3QDJA 5FGBC 2FX7L 3GMOB 4M00A 3IS0X 1KSRA 3G5XB 3FFCD 2Z92B 2FCBA 4HS6B 4MNHA 3I02B 1S9KC 5GHWH 3Q6FA 2A6DB 4WO4B 5F6IC 1NMCB 4HGWA 3FRPG 4PTTA 4F37F 5INCA 3RWDA 1EAPB 1HHIA 2OX5A 2XRAL 1JWMA 5F7KC 4CVWA 15C8L 2OBGA 3FO0H 3S36H 3RBSA 4KI5E 5LXGH 3MUJA 1R3IL 4PJIB 1NCCH 3GMPA 1JWSA 3FB5A 4XPFH 5E9DD 2ARJQ 4FQXB 1G0DA 1YEHL 1ZHLB 3QJFA 5FA4A 4D0BA 1XF1A 4D8PA 5MENB 4ELMA 5T1KD 4OKVB 3BGMB 2AV1B 4OZFH 4X6FB 4EIGB 3LVEA 2NW2B 1EXUB 4OZ4B 4XTRD 1OSPH 2DQIH 2FBOJ 3ARDB 1MCWW 4CN1A 2ZSVA 3H9SB 5TE6L 3H9HA 2FB4H 2OTWB 5HYQB 4JE4B 1BOYA 5C9KA 1ZLUH 1OB1B 5E8NB 3QEUA 1CDHA 3MMEA 1TENA 4UIKL 3MGTB 3ZKQD 2C3WA 3SE3C 5HI5C 2DLTA 1MAJA 5F72S 2B4CH 1BX2A 1I8MA 5CKGA 1CN4A 4Q9QL 4U6VH 3C08H 1J7VR 3FQNA 5EUOE 1FVDB 4AG4L 5GRJL 3EJYD 5IF0B 4M8QB 1T5XB 4WHCA 1F6AB 4R2GB 1CFVL 2DI9A 2A73A 1T7ZA 5T3ZE 3ARBB 4C59B 4MCYB 5AG8A 1S7SB 1AC0A 4XCYB 2EECA 1M6OB 5CUSL 4I48B 4YHOH 2VDNL 1ZV5A 4P0DA 4D3CL 4UI2A 4H20H 1AO7A 3G04B 2CGRL 4LGSB 3E6HA 5MEOA 5HHQA 3RTQC 4L8SB 3GB7B 3DJ9A 1Q9WB 2HTLD 3MLZL 4GW5B 3VU2A 1LVEA 2Q86B 3EJZD 3S35L 4JDTH 3SCMD 3SO5A 4CUCA 2DQUH 4ZQKB 4GT7A 4JANA 4LFHD 1IEBB 3DIFB 3QDMA 4FRWA 5DFVC 3MLUL 4RMUA 1IGYB 4NJ9H 3KYMB 5I16A 5GRXG 3EYSL 4KZDL 2VDRL 2NZ9C 5ISZB 1BD2E 3D3VE 1XIWC 3ARZA 2NYYD 4XNYH 1XMWA 2A83B 5C0DA 2X9XA 3VXUD 4B7LA 5C0ND 4P59L 5EU6A 3BVNB 3VD7A 4EN3C 5D1ZA 2CJUL 4KKAD 4MNQB 1MVUB 5T1MB 4Y4FC 3PWPE 4HMDA 1BJ1J 1U8PB 5AEAA 4BKLA 5C08B 1AQDB 3IFNL 4NZJA 4KKCC 5J6GB 4M6AA 4EUPA 2P7TB 4EQ3A 1KENL 1BVKB 1FNHA 2XZAH 4LAJH 3B6SB 4NUGL 4M5YH 4L4TB 1Q9OB 1MCJA 1NAMH 4GRWF 1LQSR 4WO4D 4XZUB 1T22B 5FKPB 1XIWD 2EDXA 4LKCB 43CAA 3ZDZF 1NC2A 1BF2A 3AM8A 3KPMA 1JPTH 2QJDA 4LU5L 3KR3H 1IL1B 3C08L 4MX7A 5CP7B 1FYTB 2PKDA 3SDCC 1FJ1B 4WIQA 3PGCA 4X4XB 2HTLC 3M1BA 3ARFA 1FFOA 2DQTL 3L3HA 4YR6B 3PGDA 2N1KA 4YLQT 5MP6H 1LE9B 3QIWD 3FFCE 4OLXL 2QV2A 5HYSB 5IGXH 2AQ1A 1KCVH 2R4RH 2QHLA 1HHGB 5E8DH 1NCWL 5DHXB 5K9JH 4M6NH 4KGLA 1XZ0B 4L5FL 1MLBA 1D5MA 3S4SA 4NC1E 3IS1X 5DRNB 5CP3H 4HIHA 3RDTB 2IPUK 2OTPA 3RVTD 3L9RB 43C9A 5GGTA 5CIPA 4F9LC 5EB9A 4O4YL 4NQCB 3MOQA 1B4RA 3SOBL 4GQ9L 3QUYD 4R7NB 1U8QB 1T6VN 1AIFA 2NX5A 4OIBA 2AJXH 2CKBL 5D2NC 4K3HA 1SYSA 1LD9A 3O11B 4W6XB 1XGTB 2CUIA 3BGFB 2PO6B 5DFWH 1CT8B 1K8IB 4N1CA 3QDAA 4EXKA 3W2DH 3BDBA 5IKCB 1FZMA 3PWVA 4NPYA 3GSOA 4Z6AT 4ERSH 1SEQH 4YGVA 3QUYA 1V3LA 1I1AA 3DXAA 2H3NB 3GBLA 4MDIA 2R2E