4HPYH

Crystal structure of rv144-elicited antibody ch59 in complex with v2 peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
VQLVESGGGLVQPGRSLRLSCAASGFTFDDGAMHWVRQAPGKGLEWVSGISWNSNIIAYADSVKGRFTISRDNAKNSLYLEMNSLRVEDTALYYCAKDSPRGELPLNYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords CH59 Fab heavy chain
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpyH01
15C8H 2VZ1A 2D2OA 4LCWE 4RGNB 4Z95L 3IU3A 1J1OL 4S1QL 2I07B 3AY4A 1A7BA 4UDUB 4XVJH 3L3GB 3QUXA 2VR5A 5C0AB 4XMLH 2EH8H 3ZO0A 4QXWA 1Q0YL 3LN4A 4NN5C 3MRIA 1BEYH 4D9RD 5HDQL 2AI0H 2XNAB 3NACL 1KB5H 3KXFE 3QHZL 3R8QA 2O93L 4NWTH 3HPJA 2IFGA 4N90D 5JORB 3TN0D 1I9EA 5BV7L 1CCZA 1U58A 3RL2B 3G6DH 1U8IA 5JPMB 4FMFA 1RZJC 5C0CB 5ICYB 3BP6B 1DTUA 2OR9L 3KNBA 1R6VA 1MUJB 3AREA 3ZE2E 5KSAB 4KU1A 3QDGB 1VEMA 3MNVA 4N0UE 4QOKD 1YEIL 1QLRB 3MOAL 2OTUA 4I3SH 3C08H 3WNOA 2VLJD 3MA9H 4EDXA 4M4RA 1BD2D 4E0RA 1QA9B 3O0RL 3NFPB 2F8XC 1R3HB 4NUJA 1WZMA 1A8JH 3MR9A 5C2BH 4JFXA 1F90L 4UINH 4HGKC 3MBEC 2CIIB 1WIOA 3RWFB 3DHMA 3SQOH 2J6EL 3U48A 3UZEA 5BVJB 1W0VB 3VDBA 4HHAA 5E4IA 3F7VA 2JE8A 4L4VD 1WWBX 5CD3B 3RAJL 1MHCB 2HRPH 3B2VL 5JHLL 4DGYH 2E7BA 2SEBA 3L9RB 1F2XK 1ADQH 4UV7L 3F12B 3EYVB 3PL6A 3RGVB 1VERA 2VDMH 3GK8H 1MCQA 1U3ZA 2GK0B 3S8WA 1I8MB 5EORH 5LWYH 5K33A 5ABDE 4O2CB 3DECA 3DV4B 5E2TL 1EXUA 3VGAB 5FO9B 3EBAA 4H88L 1RJZB 5KAQG 4ORGA 4N8CH 4NHUB 5CKAA 3VXQA 5EIVA 4P2RD 1RZJH 1VHPA 5FV2A 4RX4D 3R06A 4Y19A 4BUGA 2DJSA 3VXUB 2QSTA 2AAVA 4J4PC 3W9DB 5BW7A 1QACA 4N1HB 3TNNA 2HVJB 5EC2B 4A6YL 4F8QA 1NMCC 1A0QL 3MV9D 5F70A 4JJ5B 4XHJC 5GISH 1ZEAH 4LVOB 2HTKC 3L7FB 4Y5VA 4FFWC 1OGTB 2GJ6E 2QQNL 3GRWL 2J5LC 3P30H 4U7SA 4QXTB 1I8KA 4HK0A 5KJRL 4DN4L 2Q7YA 4O4YL 5JTWA 1DSFL 1S7RB 1QOKA 2H32H 1G9MH 4ERSL 4ISVA 5L2KB 3JTSB 4RAVB 5SX5K 1RUPH 3G9VA 1BBDH 1YNLH 2PO6A 4AEEA 2PW2A 1CG9B 3U7YH 3OKKB 5GZOC 3EJYC 1CLOH 5EZJA 4XBGB 4KZDL 3CFEB 3P77A 4MXVE 3WIHL 4YHNA 1E4XI 4S1DD 3CDFA 4KZEL 5GSRA 5ITBH 4M1CD 1MCPH 2EDXA 4C4KT 5I17B 5E9DD 3QUZD 1CU4L 2P44B 4GKSA 4ALAL 2CLRA 4POYA 1OSZB 4PD4J 3ZE0F 4YZFF 1NDMB 3HZYB 2MQ3A 3U7WL 4TTDC 4EUPA 3S4SB 2ADJB 1YN6A 1DEEB 3TZVA 5T33H 1NMBL 2G5BB 1R5IB 4KK5C 4MJ5A 4P4KA 2H41A 3CXDL 1CZ8H 2FEEI 5IMLB 2FYYB 4Q6YA 5JIKA 3D6GA 3BYYA 2DMBA 3V4VL 1ZGLM 5FDWB 3B5TA 5IV2B 4N5ED 4YUEH 3F6LA 4S2SB 4J6RL 4ELKB 2NZ9D 3MODL 5JOFA 1YY9C 4KKAC 4XP5H 4Z7WB 1FN4B 4M6OH 1MF2H 4R96A 4XAKD 2IQAB 4NP4L 1IBGH 1BLNB 4OFYD 3JWOL 3O3DB 1MIMH 5DD6B 2FLRT 4L9DA 1CD8A 4JO2H 4M5ZH 1YNKL 4P46D 3MLVL 2FIKB 5CIPH 3HR5A 3C5ZB 5TQ2H 5F7YC 1A6TA 3CVHA 2HWZH 3MOQA 4KY1L 3VRIB 3MUGB 1OP3H 1XAUA 1NUNB 4Y7MA 4DZ8B 4YHPB 3EO0B 4H0HB 1MHHA 3EHBC 1PG7H 3MRDB 1JPST 2VLKB 5DURB 1NFDA 2YKLL 2Y72A 2BNRE 2JB5H 3FHQA 4BELD 4TOYH 1CICC 4TNVK 1INQB 3ARFC 1X4XA 3ES6A 2VAJA 3OJMB 3MRCB 2GFBB 3PDGA 1RUKL 3KYAA 3TYFB 4YHKL 3TBYB 5H2BB 3BQUC 3QDGE 1MFAL 2MKWA 3QNXB 2EKSB 2AK1H 1PLGL 4LF3A 5AG9A 4QGTA 4IRZL 1OTTD 4JM2B 2JK5B 2ARJQ 5JA8B 5TF1L 1DQJB 1GGBH 4LLAA 4Y89A 1WBZA 4LARL 2EH7H 5LKNA 1BOGA 2WBKA 2D0GA 4YFEA 3F62A 3O9WB 3HHRB 3O2DA 1P9MA 2G75B 4WUKH 3TYGH 1V3JA 4LSDA 4PREA 5IBUG 3F65A 2FX8L 5ANME 3KLAB 1CBVH 2VDOH 5IHBA 3GB7A 2VITB 2BSRA 4MA3B 4ORZC 4WWKB 4NGHL 3HC3L 4R4FL 2G9HB 3MRQA 2NW2B 3IXAB 4N9OB 4TRPL 4OFPA 4X7TB 4PJ8A 3UBXB 5I1IH 1CR9H 5ESQB 1CGYA 1P7QB 4MDJB 3U2SB 5FB8A 2ZUUA 5KVMC 1BVLA 2ZPKL 3QDJE 4Z76B 3LB6D 3BMVA 1LDSA 4X98B 5FYKE 1XZ0B 4KJPD 2Y23A 3RZCD 2YD1A 3TIDB 3VWKA 2VDNL 2PTTB 4P2QB 3RVXD 4WI2A 3H9HB 4MCYB 4WEUD 1DBAL 2ITCA 3PF2A 5C8JA 3V7AG 3VFWA 4UT6H 1WUNT 1SJEB 4LIQE 1Q72L 2B4CC 4KVCL 4WW1B 3BP5A 4HH8A 3A6BL 1AI1H 1OAZH 4JFED 1ED3A 3WFZA 1GVIA 2R69L 3SGEI 1J11A 3G5ZA 3U0PA 4PRPE 3WDHA 3A67L 3QIBA 1QBMH 2BRQA 3O45B 3PWJB 5I71B 4K2UL 4X6CF 2FECL 4HIIB 3CMOL 4P23D 2JJSA 4JFOA 3TA3D 1W72B 1I4FA 3B2UC 4WFEE 3CFJA 1MJ8H 5CEZE 5DK2A 3KNBB 1KLUB 1AO7A 1H0DA 5B8CC 3LSOA 3LPWA 5GS3A 1QUNA 1G7LA 1FO0A 4ODWB 1QFOA 4F33B 2V7NA 4OQ1A 3CDCA 4G8IB 3IGAA 1ACZA 1ZT1B 4LLDA 1XIWA 3TLRA 5TE4H 2EIBA 5ETUB 3BGMA 2E8YA 2MHAB 1IGYB 1N6QL 2XT1B 4GRMA 2R29H 4AIOA 3CVIL 1S8DA 5IHZA 3NAAH 4I18B 1B0RB 2RBLA 2EDQA 2DM2A 4HS8H 2EXYD 4HZAA 4LSQH 5B3JF 3K8MA 3C5SB 4Y1AE 3HG1E 4HHAB 4QRTB 3TBSA 5MHSD 5FIEA 1HIML 2UZYB 1QR1B 3OTTA 2VXTH 2GHWB 5AZEH 3SDCB 2DQCH 5F3BB 1BM3L 2DQFA 1XGQB 1MJ7L 3BKML 5LAXB 2GCYB 5CGYC 5C6PB 4XTRC 3SKNA 1ZS8B 2F8VA 3DMMA 2C3HA 4CVUA 2B4CH 3O6FB 2DD8L 1MWAB 5FM4A 5DMGC 3TV3L 4CMMA 1VGEH 2EE3A 1HHJB 5IVZA 4XXCC 1QZ1A 3TVMC 4L29B 2AVGA 1X5IA 1ZHNB 4XBPA 3BSZL 3MGOB 1YPZF 2WWMD 4JG0H 4XVTH 3FO2A 4UBDC 4ZOEA 2VLRD 5J13C 1VFOA 4PYGA 4MSWA 3GSQB 3FT4B 3G6JA 1JGEA 1TCMA 3N0PB 1N64H 4M3JA 4LOUD 1M05A 3CPLA 1CDUA 4DFIA 4Y5VB 1QFWI 3GSVB 1HXYA 3LKRB 1MJUL 4G9FD 5K93A 4YHMH 4NBYB 5H94A 5I6XC 2PW1B 4X8JA 2WUBH 1KTKE 4JVPA 4G8GA 2WW8A 5EN2B 3QJFB 4NQXB 4JR9H 3C60A 4PRBA 1MCWM 1IAIL 1C8PA 2PW2B 4X6DB 3QG6A 3GMRA 3SJVD 1EEUA 3BT2L 4PUBH 4LKXA 1J86A 1SEQL 4ZD3H 1HILA 2JIXD 2PKDA 1RVFL 2J8UB 1YJDL 3CSPA 4YPGB 3VRJB 5IFAL 4NRZA 1P4LB 4JY4A 3WO4B 3EGSB 1H5BC 1FQ9C 4H26A 1KC5L 4PJXF 3X17A 5F7WC 3QFJD 3OF6A 5F7FA 1QEWA 4PTTA 1WIPA 4MS8C 1C1EL 2HKHL 5E8DL 3SGDI 4PY8J 3D3VE 3GM0A 3STZA 2CK0H 1I85A 1YQ2A 3RU8L 5FYLH 2A9NL 5FA3A 2VB5A 4LK4A 4UIMA 4PPTA 4U6XA 1KEGH 2P5ED 4OFVA 3RPKA 1U9KA 4JPWH 5GS2H 4Z7QF 4NN7B 1KTLB 4LSUL 4J1UB 1KBGL 1IM9A 2Z93A 1QSFD 5JOFB 4OF6A 1J10A 3QUKB 3H0TB 5D7IA 3DETC 4E41A 4L8DB 5LJYH 3MRFA 1KN4L 5IFJB 1YMHB 4MB3A 4C4KO 3EDEA 1UKSA 3PGCA 1KT2A 1RUQH 2R0KH 1I3GL 3S96A 4JRXE 5L8JB 4UQ2B 1NCUA 2Q8BL 4YZFE 4IOFD 1CI5A 2B2XH 1EAPB 2VERN 3I50L 4JQVA 1QSEB 3GJFB 4MHHG 4Q0XL 3REVA 3TNMB 4F9LA 3PIQB 3GSNH 2Z4QA 3LS4L 1L6ZA 2OR7A 5DFWH 5F6IC 2HMID 1NCWL 4I9WE 3LZFL 1SM3L 5E8PA 3GZKA 2VDKL 3MA7B 1CFVL 1NC2D 5D2LB 2V17L 3UTTA 4QHLB 3OBAA 3IF1B 5F9DC 4F58L 3S36L 4JY6B 2ZG1A 2Y5TB 5IK3A 5F1NA 3PUCA 3VI4E 1EEYB 4MA1C 1BVKA 5HHNB 1R5VB 3T0AA 3BH8B 3OGCA 2FD6L 5HHMD 1FFNB 5GRJL 1I7ZB 5FYKL 3FB5B 4PJEF 1TLKA 4LGPB 4QT5A 3TBVB 1G0DA 4WUUA 1NC4B 4Z7NF 4L8SC 3QZWG 3FN9A 1HQ4B 1KPUA 3B5HA 1RZ7H 3WJJA 5J7CC 1R0AH 4X7SH 2Z31D 2NY5H 1CD1A 4MX7A 4K3EL 3VCLA 3QUMA 2CJUH 4JO1H 4LIQL 3CK0L 4M93C 1KJ2L 4RGND 1K8IA 4LLMB 4OD3L 4UAOC 5EUOE 4X99B 3FOMA 4YXKH 5I30H 1RJLA 5I73B 3MLYH 3FRUA 3Q5OA 3DGGB 4JZJC 1BOYA 4GMTL 1ZTXL 4Z78A 3D25B 2GW5A 3IRPX 2R0WL 3ZT6A 3KDMB 5CEZL 3RTQC 4PJDE 3HI1B 4ZTPL 3QH3A 2ZUQB 4XAWH 5JIPA 1R24A 3O6LL 1ZHBA 3V8CA 3D39B 4OCYH 5C0CD 4Y4HC 3H7BB 2ORBL 1N4XL 4JREB 3OPZL 4P99A 5FB8B 4O2EB 3B83A 4PJ9B 1JYWA 3EO1A 4KI1A 4ETYA 12E8L 3NA4A 3DX6B 4R0LB 4HWEH 5IG7A 3E1F1 3PV6B 1NL0L 1UEMA 4RFOH 4ZOBA 4XPGL 3ARZA 2FX7H 1JF1A 4B7IA 3V8OA 4BK4A 4Z0BL 5L2JA 2P8LB 3V5KA 3W11C 1TJHL 3QQ4B 3STLB 1U8QA 4I8DA 4KPHL 1ED3B 3HPLB 5D5MF 4QCIA 3SDXA 5HYJD 4Z7UF 3HI5L 5IQ9B 4S1RL 4GUPA 3RGVD 3MJ7B 3F5WB 3MLWH 4G7VH 4PJIA 3PE9A 1HWHB 3QEHA 1IGMH 1KJ3H 1BREA 2EEDA 5D93C 2GJZA 2XOTA 1EVTC 2OS7A 1FBIL 2J8UE 3VD9A 2V7NB 3RI5F 4PV9A 5DT1L 3U46A 5GRVL 4BZYA 1CQKA 2F5AH 4YX2L 2E7LA 1T66D 2DF3A 1CLYH 3EOTH 4P3WA 3WFHA 4NO5A 1LO0L 1NLDH 4K8RC 4KAQL 3V95A 5BJTA 3L7EB 1RJYB 4NZUL 3RWDB 4PJBF 3RY6C 5DUBB 5F7MC 2UVEA 1YEEL 3ARBD 2A9ML 5DJCB 1ACYL 4YXLH 1XF4B 3ILPB 1R3LB 7FABH 3P4MA 4N90E 3UAJD 1AKJA 3VXSD 1B0GA 4L3ED 4GAYB 2QJDA 1S7VA 3MLRL 3O41B 3P0YH 1F3JA 4G9DA 3WUWG 4HXBL 5GS0D 4QOKE 4PGDB 1NCCL 3K2UH 4MJIA 4U1SA 5A43C 1M7IA 2GAZA 4QEGA 5A2JH 4CADB 5DHVA 3MBXH 1OAKL 3BN3B 3NIDF 1BD2E 2EC8A 3HUJF 4LPXA 5C07D 5E8NA 2IBBA 5C0RL 4XMPH 1OB1B 2V5RA 3PGFL 4HIEB 3LKNA 4U1GB 3KPNB 4JY5L 5DTFB 3LRGA 5DLMH 5MEQA 5I19H 1KB5A 3QNZA 1KN2H 3BP7A 1X5ZA 4PGZA 4P4RB 4L4VE 1IMHC 5AWNH 4K3DL 4YHIB 1I7RA 5B3JE 4NQDA 4K8RH 32C2A 3ZZ1A 4JN2A 1GYAA 5IIEA 3VH8A 5KSBB 3RVVC 4IMLA 4XBEH 5D2LE 2VQTA 5EA0L 5JR1L 2G2RA 2FJHA 3LH2L 1LP9B 3T3MF 3WEXA 5LGJB 3VXTB 4Y5XA 3CGTA 4HBCL 5GGVY 1MJJB 4YE4H 5FECA 2DQIH 1EEZB 1NAML 1W8OA 4JG1H 5HI5C 3QG6B 4DUVA 4FQXD 4YC2B 4YEEA 1MCBA 4KVNH 3TJEH 4FXGA 3Q6FB 2NW3A 1UH3A 1HILB 1X5YA 4G42A 5C3LD 2IG2H 1Q9WB 5A3ID 1RZKC 4LLUA 3MV9E 3VW3H 5DXWA 1KIUA 3LEXA 1BIHA 2QADC 4KK8C 4N68A 4ZNCD 3AB0B 2KQNA 1EK3A 3V0WL 5FGCB 1I3RB 1SYSB 3T0EC 2DB8A 3SE3C 3T0WA 25C8L 2C1PA 3QPQD 4WO4C 5D1ZD 2BJMH 3R4DA 4DVRL 4OI8A 3HFML 2M2DA 2Q86B 2YPLB 5I1AB 1BJMA 2PUQT 4ZXBA 2JCCF 1FRGL 2CIKA 3UTQA 2RHEA 4XNXH 4L4TA 4NUGH 4HJJH 3WS6C 2DM4A 1ZE3C 1KV3A 3HCVA 2IPTL 3W81A 5FM5M 1L7TH 4PRAA 1E4KC 1Z0MA 4NRXB 1YEFL 5DYOA 3BWAB 43C9A 2YPKB 2AK4A 1KIPA 3ARPA 2VXUH 4DVBB 4JRYA 4GSDL 1FFOB 2FO4A 1F3DJ 4TNWF 3U36B 2LAAA 2YD9A 2R4SH 1Q38A 4I0PB 5FO7A 1UWXH 3UO1L 1D6VH 3EJJX 3HTLX 5E9DE 5D6DC 4LCYB 1N6UA 5D7IB 5E08L 4RFNC 2VO5A 2VXVL 3QDMD 3ARGC 4PG2A 1HH9A 5J6HB 3DRQA 2JJTA 4FQCL 5DEGA 4DAGH 3MLZH 4PJXE 4RFEB 5DD1L 1PJ9A 5L6YL 3UTSD 4ZPTA 2QEJA 1MRDL 4OQTL 3KYOA 4PJHF 2H32A 4C56E 5E6ID 5ICXA 1CFSB 4KK6D 1H3UA 1PZ5A 1RUML 4WU7A 1C12A 3DX7A 2F54A 4GRLC 2EDKA 4YAQB 1GHFH 5EBMA 3IKCB 4KXZH 4S1SL 1JZ3A 1XH3A 4EOWH 2B0SH 1YMMD 3L3JA 2JELH 3H7LA 4PP2B 3UYRL 1SVZA 3ZSTA 5DQDH 4EKXA 2YXMA 1MWAL 3V4UH 4Q9RL 5CD5D 4XAKE 5C0ND 4XPHH 3QEQA 1KCKA 2BVQB 4APQC 4GXUM 4WY7L 4XVSH 4Z5RB 2GTZB 3IETB 2UWEA 3WXVL 4BZ1H 3CFBB 3QQ9D 1NCBL 2A83A 3IFNH 3SDDB 3O2WL 2CRYA 4G8FB 5HGHB 3I6LD 3WNLA 1IC5H 4WRLA 1HSAB 5IB1B 4KQ3L 4YQXH 5HHQA 4HGWB 1B4JL 2IGFL 5D7SL 3QA3B 1WTLA 3VFVB 2DQDH 2ICWI 3N9GH 3IJSA 3QHFH 5SWZD 4FQ2L 1CGUA 4HS3A 5AUMA 4LRIC 4NBZB 1MCLA 4P2QD 4IOIB 3VU2A 5IW6A 5HGBB 4N0YL 1KPRA 1A9BA 3M8OL 4JM4L 5L8KB 3WE6B 3QUXD 5KANI 3OAZH 1YYLH 1EHLL 1C08B 2FSEB 3BPLC 3RWEB 4PLJD 1N0XL 1A5FH 2B8OT 3PP4L 3GIVA 2DM3A 5KZCD 2CQVA 4KH2A 1PKQA 1LO3H 5IVOA 1FE8H 4M7KL 1DBBL 3G5VA 5CIPA 5GRZA 4JZNB 3JV4A 3CX5K 3ZTJG 2EEBA 4M7ZB 2R9HD 2FGWL 1T0NA 5I1JH 4OZIA 5KVDL 4I4WB 4U3CA 1IGCH 4PJ7B 5D7JC 3CDYA 3V9FA 3EZ8A 4JDZB 3ARED 2XA3A 4RA3A 3TWCH 3WLBA 4B0MM 3V4PH 2XICA 3FB8B 4XHQA 1JWUB 2NY6D 4YWGH 3DV6B 1Z9SA 3WD5L 2VL4A 2X9YA 2XIDA 4OB5H 4ZAKB 1FL6A 5BQ7A 2AGJH 2X05A 4J3WA 3LRSA 4KI5E 4Y2DB 5AAWA 1JGDB 4DOHE 2RGSA 1OTSC 2HRLA 3AFLA 3V5KB 5GS1B 1CF8H 3A6CH 4QCIB 5IMOA 1T2QL 4X4YA 4JE4B 3HI6L 3VD3A 4MJ4A 1OARL 4D0DB 5IVNA 2Y6SD 1AHWC 1X7QA 2AP2A 4YR6B 1RSFA 4TTGA 2D7OA 4GXVH 1LO2L 3RZWA 3SKJH 3QIWC 4XC1H 5I1EH 2XZAL 3I84A 5GGSB 5CUSH 3FTGA 1CLCA 2WINB 1WQVT 3WL9A 4ZUSB 3SPVA 3FZUD 5TE6L 2Z0BA 3DUSB 4B50A 1HOCA 4Y19D 4FZ8L 3BRFA 5BVPH 5CMAA 2JF1A 5HPOA 2EIDA 4R26L 4X80L 4OZ4B 1DUYA 1R3IH 5MI0C 2Y06L 3AUVA 4G6MH 1G6RB 1UZ8B 5FYKU 5L0QC 3T3PE 2VZUA 3MGAA 2XZZA 5SWQB 3ZKSD 4OT1H 4LP5A 2IFFH 1C5CH 5KS9F 5D5ME 4MXQD 5DJ8B 5DS8B 1A9EB 1S7VB 1K4CA 1UQSB 3H9SA 2ICEA 3DX9B 3PP3H 5GJTH 5FUZH 3W0WB 5IVXB 1FNHA 3BQUA 4HAFA 1FVCA 1GC1H 4X4ME 3SY0B 3VE0B 3F7YB 5F21B 5DQ9B 3RWCA 1XT5A 4I2XA 4HH9B 4EI5B 3HZMA 1IC4H 4RISH 5KSUA 3WFBL 4Z0XA 1N3NB 4QRSA 5JNYA 1MI5A 3I9GL 4JFFA 1FNEB 3KJ6H 5CJOH 3B9DA 4OZHB 1UB5A 2W0FA 1A6VH 1FL5B 4ZYKA 1IEHA 3L3IA 3RX5A 3PJSA 1ZGLP 5MHSE 4PJBE 8CGTA 2RAMA 2VSDA 4JQXC 4NKDB 1BGXL 2OM5A 5I18L 2NY3B 4MCZA 5T3XH 3TZVD 3MV8B 1D7FA 2NTSP 2OMNA 3O6ML 4YHZL 4P4KD 3BIAX 3THMH 2AXFA 3WFEL 3HLAB 1IRAY 5BMFH 3QCVH 1RFDH 3HA0A 3BEVA 3HC0B 4TUJA 4RIRB 3V5HB 3ULVD 1JPTH 1JIBA 5I76A 5J89A 1C5BH 4W6WB 4H25A 3DBXA 3CLFL 1FIGL 3QWOB 4POUB 2EIZB 1UACH 2VLRE 4QTIL 1CLZL 5GIRA 3SCMB 1G7JB 1DUZA 1E6OL 2G5RA 2QL1A 3VRLF 3DO7A 1NGPL 5ICZB 4RAUA 4OFIA 3MRJA 3W5MA 1S9XB 3ZKXB 2X4RA 2R1WB 1S3KH 1VESA 1VPOH 2XG5A 2J8OA 3GKWH 2P4AB 2A6JA 1HHGB 1T2XA 2XZCH 1L9NA 2DDQL 1TFHA 3WMSA 1F45A 5IEHA 3BZ4B 5J0BA 1QSED 2W9EL 3HRZB 3T2OA 1RZIB 4KKLD 1MFCH 4LCIL 5EUKA 1QVOA 4LHUA 4S1DC 4MVBC 4ZXBB 5DJ6B 5HY9A 1ZLUH 1S7XA 3GMPA 4MAUL 3SJVE 3UC0H 4LGRB 4WI4A 1T5WB 5F71A 4GW1B 5SWSB 43C9B 4UT7H 5I75C 1JJUA 1T3FB 5B8CA 1Q94A 2FR4A 1ZT7A 2H8PB 2K9UA 3GMMB 5AYUL 3MGTA 5HHPA 4UV4L 5CINH 4ZQKA 2H1PH 1ES0B 1BZ9B 2WQRA 1HH9B 3BE1L 4EI6B 1GZPB 4NCC1 4W70A 1DQML 5B3NA 1AR2A 3FCTB 1XF2B 5AEAA 1Y18A 3O3BB 4P49A 1N5AB 4RMVA 4L8BA 1S9WB 2VDLL 2AERT 1RV6X 2HG5B 3ZYJA 5J1SC 1JI1A 1A7NL 3DSFL 1UH2A 2NZ9C 4QY8B 1RZFH 3KPRB 2P24B 4K23H 5F9OH 2X4TA 2NXZB 1QD0A 1P4BL 2P5EE 1RULL 1KTRL 2JCCE 1Q0YH 1KPVB 4Y16B 3QFDB 2Q6WA 2ADIB 3CC5B 1OL0A 4P46C 5FOBB 4HLZG 4GG6A 3PG2A 1JZ2A 4WJ5A 1J8HA 3MLXL 3K3QA 4K7FB 3VFUB 3RWJB 1FJ1A 5BV7H 1WEJL 4IM8A 2FNBA 5CSZB 3V0VA 2WAHA 4K3GA 4LQFL 4UT9L 4FQPA 2WP3O 1S7SB 5IMMB 4O02L 5L9DL 4PJ8D 1E4XL 3FJTA 4MNQB 2E7HA 5IB3A 3BHBB 3E2HC 1MLBA 1NEZB 2W0LA 5JW4Q 3SDAA 4AMKH 4AEHH 2NXYB 1JCKA 2DOCA 1OGAB 2LABA 4NO0A 3CU7A 4PJHE 3KYMA 2E27L 3ZLQC 2D7TL 2PCPA 4FQHA 1FZKA 2AXGA 4HIHA 1ODAA 4M4PA 3O6KL 4JRWA 4XXDA 4FABL 2HVKA 3PDOA 2ATKA 2F58H 4NIKB 2FEEL 4RDQG 4LBEB 1U3HB 3KYKH 2OSLA 1OTTC 3GSOA 3UX9B 1JHLH 3T8XB 4LPYA 5FK9B 4ZNEE 2J4WH 3NIGF 5DJXB 3UBXG 2EYRA 2WWKT 2N1KA 1TVBA 5KVEH 2EYSA 3BPCB 3QIBD 1BBJB 1AH1A 4BQCA 4U49A 5EULV 1YC8A 4WI3A 4MMXC 5MEPA 3GSNA 3MO1B 5D71L 3GMOB 2EYTA 1H5BA 1FLRL 1AO7D 1HHIB 4H88H 4R4ND 4Y4KC 5CZXD 1DQQB 5D72H 4YDJB 3MZGB 1WVZA 2X40A 3KGRA 3L3HB 3FQRA 1XIWD 2BNQA 5JW4M 1JNLL 5IKCA 2JJUA 1VKXB 1Y6NR 4A6YH 1DE4A 1D5IH 1DN0A 4HZLA 5IBTL 4QRPA 4RAHA 3SE4A 4ZFFA 5C0EA 1JWSA 2APFA 3NCBB 2AV1A 3CZJA 4D3CL 2BMKB 3GBNH 5KJRH 5IFHH 2R2EA 3UTOA 3LB6C 1KLGB 3C2SA 5DJZA 1DSFH 4YPJA 3E3QE 4KJPC 1A7OH 3S88L 5D2NC 2K1MA 2HN7B 3SO3C 1CT8A 5I16B 4U0RC 5I66A 2DQGH 4P9HC 4I3RL 4MLSA 5LGKA 3RVXC 1QPXA 1X5HA 4JCMA 2FIRT 3DMMD 2IBGA 3TIEA 4JAMA 1NGYA 1WFNA 2HFEA 3MUHL 4DGVL 1F13A 4OF8A 3T2QA 1BFSA 1MAJA 3WIHH 5FGRA 2VH5H 5BRZA 3VA6A 3K74B 1WC7B 1QYGL 4ALAH 4LCUB 3W5NA 1I1YB 2O5XH 5CCKH 5J57B 1RQ5A 2DWEA 4U1JB 4P23C 3EYOB 3TA3C 5DVLA 2GITB 2V5TA 2DKSA 2P7TA 5BZWA 3HMXH 1HDMA 4RMWA 4BSWB 3RNQA 4S10A 3CXDH 4M1DL 2L7UA 1A7PH 5FXCH 4JPKL 1CXHA 2NQCA 3CDGA 5CWSA 3O8XC 3V4VH 1NGQL 1IAOB 3BGFB 1MREL 2Z8RA 1XGYH 4G8GD 3TFKD 3B9EA 4XZUA 2YOCA 3KPSB 4EQ2A 3VFSB 3C60D 4ELMA 1F02I 2I27N 1T89C 3R0NA 2GSGA 3HNSL 4GW5A 4N0RA 3RX8A 4Y5YA 4P9HH 4P3CL 4YGVB 5E24E 2OP4L 3P9MA 4YDLB 3SOBH 3GHBH 4U1MA 4PB9H 4OD2A 2I60H 4CW1A 2A2QT 2D0HA 4HUNB 1A7RL 1LD9A 3OF6D 3VXSE 2CRZA 2MSPA 5T1LB 2X7LB 1FVEA 3KPRE 5C0GB 2H2SD 4I0CC 5DJYA 1B2WL 4RMRA 1SJHA 2BDNL 4Z77A 3DLQR 1NEUA 2WWMC 3NH7L 3ULVF 5TGBA 3T0VA 4KV5E 2R1YA 4RBPK 4FZEL 4DUWA 4NQEB 1JHTB 5TJWK 1TZGH 3KLDA 4JPIB 4Y4HA 4LOUC 1J0HA 2VLME 3I02B 4X6EB 1JK8A 3KJ4C 2VXSL 4J7RA 3CFKB 1TVHA 3MACL 3B5GA 2DI9A 4IRJA 2H3NB 1JGUL 4E41D 3T1FB 4ZS7H 4L1HA 1MFEH 4XH2B 2Y9RT 1J5OL 3D9AL 3OG6B 5D1QB 4OZFB 3FT2A 2B1AL 3UDWA 3LDBC 4U1KA 3RUGB 1CXLA 3BUYB 3QUYC 3Q1SH 1JZ4A 3RL1B 4CVWA 1T20B 3NFNA 4LHUB 4KTDL 1CDHA 4E42B 2ZSWA 1NFDF 1T0PB 5DD3H 5FCUL 3IJYA 4XP4H 2R8SL 1CL7I 4PGCA 1TJIH 3TCXA 3UTTD 1MH5A 2X4NA 5BO1L 3AXLA 3HC3H 4H8WL 4OLUL 1KCRH 3SEPA 5KVFH 4TRPH 1H15A 3DVNA 1PYWB 2LVEA 4XMKH 5TFSL 4LPWA 2PTVA 3VRLE 4WHTA 4BZ2L 4M8QA 4F80A 3U30B 4WUUD 1MNUL 4QNPF 1WICA 4KMQA 3NN8B 5DMIH 4OI9A 3RY6A 4PGEB 3SKOB 1G6RL 1PY4A 4OCNC 4F7MB 4XPTL 1VACB 1QFWL 3H3PH 2ICWB 1EFXA 2VQUA 4NPYB 4P9ML 3LQAL 3HS0B 3P4NB 4EJ1C 5HGAA 1JUFA 2X4UB 3FMGL 3T65B 1E4JA 3X13A 3LMJL 1UVQA 1XEDA 2C3GA 1Z5LB 4IOFC 5DFVD 1P84K 5BZDA 1HSBB 4OKVB 3QDME 3K80A 1NCNA 4FG6D 1EMTL 2Y5EA 3P0VL 1HKLH 1A3LH 5F7EH 1L0QA 4NNXB 1FZJA 1T1YA 5IM7A 2E7CA 1MQKH 1EX0A 1MCDA 4XWOD 1TZHA 3UTSE 1FC2D 3HZKA 3GO1L 1EA9C 3M1BA 4O5LL 1R3JA 4KKCD 4S0SD 1IM3A 3EOAB 1HEZB 3X14A 4IEFB 3B9KC 4BH7A 4ZSOB 4IIQA 5K9QG 3WDJA 2OQJB 1EDQA 1FCCA 4R7DA 4N0CD 3BDBA 4GRWH 4TQEH 2OJEA 2CKBH 4O00A 1N6VA 3QG7L 4TVPH 2ZUSA 5I8KH 3FOLB 1A4JA 3LQAC 3S97C 3AAZB 4EVNB 3MRPA 4P5MA 5F1SA 4K3JH 4MAYB 3DVGA 3QJHB 1HIMH 2HT2D 4OV5B 4NNYB 1AD0A 1K85A 2AKRB 3IJHA 4IRSC 1QLEL 4DKDC 4OSUH 4DKEL 3PGDA 2BC4B 2Z31C 3BKMH 1OHQA 1CGSH 3FFCE 1AR1D 1U8NB 2G60L 3MMEB 1KXTB 2VZVA 4DEPC 3I6LE 4LVHB 1MPAH 2W65A 4RGNC 1LO4L 2WIIA 3EDJA 5EBLA 2XWBA 1D5ZA 3WFCH 3JWDH 4ZO7A 3R1GH 2X4QB 4HUXB 4X6BA 5T3ZD 3T0EA 1MQ8A 3SE3A 5D4QA 5HHOA 2LFGA 2QR0A 4WO4A 1DE4B 1LEKA 1F4AA 5AZ2H 4MXWH 1DN0B 5E1AB 5FKAB 3VG9B 1RIUL 4LLWB 3OSKA 4KTEH 3L6FA 3WS6A 3TCLA 3VFTB 5KSAC 3VXRB 1FORL 5F97E 2WQ8A 3I6GB 1F58H 1OSPH 5DJZB 1AKJD 3IDMB 5EO9A 3VXMA 3ARSA 2NY2B 1F2QA 1RHFA 4X5WA 2X4SA 3ZTJH 2IAMB 2QQKH 2XTJD 3OX8A 4FFYL 5ALBH 4MJID 2MCPL 3OKOB 2ATPA 1G9NC 2FGZA 4JAMB 5GGTH 1NGXB 1P7HL 2I5YH 1M7XA 2GK2A 3EDFA 1N59A 3U1SH 2VDPL 1ZGLA 2FJGA 1IT9H 3G6JF 4FTVB 1M1SA 3MLUL 2X4OA 4W68A 3BAEL 4HC1L 3U4EA 3OB0K 5EZLA 4LHJB 5E2UL 3Q6GH 3RGVC 2N56A 3BO8B 1TCRA 4HUKB 2WBJB 5DJ2B 3EOYG 3DNKA 5DVKA 5IHLB 1AE6H 4KQ4H 3O3AA 4NQDD 3BZDA 2D03H 2XYCA 1FNGA 5E2JA 1IEBB 1C16B 3VGAC 2H26A 1XCTB 1MVUB 2AEPL 2ADFH 4JKPH 4NBXB 4X9GA 1V3KA 4APQA 1SYVB 1VFBA 1R5WA 1P1ZB 5EO1A 2CMRL 1L7IH 1FG9C 4Q2ZA 3DIFA 3D85A 1KBGH 1WSST 5L88H 4JO3L 4YFLF 4PJ5A 1D9KA 1T83C 2E9BA 4BSJA 1SEBA 4K94C 1CFQA 2EDRA 1ORSB 2VDQL 4LVOC 4Y19E 1BFOB 3UAJC 3EW3B 5DJDB 5CEXA 4MA8H 1D3CA 2KQMA 2W60A 4UDTB 2FHBA 3BWUC 4OGYL 3MNWB 1G9NH 1A6AA 4RWYL 2Q8BH 5D7KD 3RP1A 3I50H 4K7PX 4LRIA 3FHAA 2F19L 5GS0C 4Q0XH 2HLFD 1Q9OA 5TE7L 2XPGB 3LS4H 1A7QL 3AM8A 5IGXH 1KULA 2UUDK 1NCWH 3ZT5A 4TUKH 5DJYB 2DICA 2A6DB 3C87A 1AY1H 2YWZA 2EEAA 4M5YL 3EYFA 3W9EB 4Y8AA 1K2DA 3WIFB 4UU9B 4ZXBD 5D1XB 5JMRA 1CVRA 1ZSDB 3S36H 1KG0B 5EBWB 4L4TD 2CDEA 2VLLB 1YEJH 5GZND 2Y07H 5SWSD 2AK4D 5B38B 5JDSB 2DLGA 4JKKA 5D7IF 4JRYD 2ZOLA 1V7ML 5GRJH 1UXSA 1ZA3B 4LLVB 3QQ3B 4Q6IA 1U2HA 1K3ZA 1BQHB 2VAAA 4K7PY 2X4PB 4JHAL 5DF0A 5D6CA 1JYXA 3PABB 1S9YA 3UPRB 1KTDA 5DSCA 4LIQH 1G7HB 3O4OB 4UIKH 1UCBL 2F53A 4FQXC 3E8UH 4OD3H 1Q1JH 3S37L 3MXVH 1ETZA 1W8NA 2QQLL 5I8CA 4F37F 1HHHB 2F54D 4F7PA 4DZBA 1I1AA 5A3IC 1C7SA 3ULVE 4NO3A 1XF3A 3QULA 4GMTH 1ZTXH 5A16A 3PDDA 2XV6B 1DBJL 1GOFA 4WU5A 3RDTA 5CEZH 3O4LA 1NFIA 4ZTPH 3C5ZC 1AIFA 3KG5A 4XCYA 3QIWA 1F3DH 1UCTA 3BESR 3IDJB 3NCJL 1H15B 1KENL 3QEQD 2VSCA 3BW9B 3NABH 4LPVA 5CLWA 5DRZA 5TPWL 5DK0A 3FN0H 4XWGL 3EYSL 5JHDA 4WVRA 5ISZA 3W39A 3RWHA 3DX8B 1ONQB 4GOSA 3FT3B 2BCKA 1HQRB 12E8H 2EXWD 2Z35B 3AU1B 1T1WB 4PJFE 5EU6B 1VGKB 4D0CB 3K0WA 2P48B 3MFFA 2KH2B 5LXGH 1UZ6E 3V6OC 4KGJA 4EXKA 3GUTB 1NL0H 2FEDD 1NAKH 4JFPA 3MRLB 1WZ1L 1OW0C 5IB5A 1NFDE 1T7YA 5T1DL 3CFDA 4PRIA 3WXWH 4PRHA 1MCHA 4KRPB 3IVKB 2OJZH 1GAFL 3A0OA 3V5DA 5E6IC 4J3SA 3G5XA 5GZOD 4NQVA 1B0WA 3E6FA 2I9TA 3QDAA 1TITA 4CUCA 4PRNA 1HZHH 3VG0L 3LS5L 4PJGB 3ULUE 3WS3A 5TDPA 1J0ZA 1FBIH 2X42A 4IDLA 3O9WC 1FG2B 1FH5L 4QNPE 3QCTH 3CFCL 1ZLVK 2FLBT 2LU4A 1CE6A 1UA6H 4XGZB 2LTQC 4KUZL 2PNDA 2APXA 1RIVH 4JQXA 4MYWB 4YDVB 1SBSH 4TTDD 3V52L 4NZUH 4AT6B 3OZ9L 1RK0A 4LSRL 2X41A 1NCTA 1I1FB 1C5DA 4P2RA 4QYOB 3TO4A 3QQ9C 5SV3A 4GKZB 4AQ1B 4CN6A 4ZO9A 3FKUS 3SDXF 4XCNB 4U33A 1NGWB 1D5XA 3KPPB 4XNMB 5I8OL 4HLZH 2CDFA 3MCLH 2O61A 3MLTB 2XXCB 1WBYB 3CSYB 2XKUA 5HJ3B 1GOGA 1OAKH 3QAZB 3P3YA 3LOWA 4AEIH 5CEYB 5C0RH 4ZFZB 2Q1EA 4Z7VA 5KN5B 4ESKA 3BDYL 3W2DH 4H5SA 4HG4J 1LDPL 4NYLA 4X6FA 3BEWA 1YY8B 4QRRB 3BP4B 1IKFH 5ACZB 4MNHB 3LKPB 3EUUA 5KSVA 1YEHH 1HXMA 3LQMA 3ZT7A 4RA0C 1P7KB 1CS6A 4U1LB 3UTPD 4G6JL 3IDXL 4HWZA 1XR8A 3BXNA 4K3DH 2BVOB 3LEYH 2BY3A 1X5JA 2CGRL 4NJ9L 4I5BB 3KS0J 4PGBA 1JZ7A 3T04D 5TH2A 1CXKA 4RNRA 2GIYA 2ZCLL 1I1RA 2XQBL 3AREC 2W59A 3EYUL 4QTHA 4TSCH 1JMZA 2ZOKB 2NY6C 3WSQL 4UUJA 1U6AH 4J3UA 4WI8A 2K7PA 2AEQH 2PETA 4R90L 4XNQA 5HHXL 3CSBA 3H9SD 5EWIL 4QXUL 5DVMA 1BZ7B 1DLFL 3V6ZB 3BPNC 1UWGL 5D9SA 4UOW1 4M43H 4XPAL 4I18C 3EOBA 5TDNA 2XKNA 3L3DA 1KCVL 1W0WB 5EU3A 4LU5L 4PTUA 1AD9A 1JF6A 3QXVA 4ZFGL 1TTFA 1R3KB 3O11B 2IBZX 1A64A 1MI5D 1GCFA 4JFFD 1A3RH 5F88B 3LV3A 3LKOB 2FECI 1CDJA 3C8DA 5EZLB 2XWJA 4DCQA 2Y6SC 3TO2B 2RFXB 5GGRY 3SE9L 5ITFA 3IDYC 4OLXL 3CCHB 5JO5A 3RRQA 4UTAL 6FABL 1JTTA 2XFXB 1Y6KR 4OBSA 5DDHA 3VFPB 5E2VH 1HHKA 3P4OA 3FZUC 5GGQL 4F2MB 1M7DA 2XN9B 2O5YH 2DBLH 2PR4L 1W72H 4KROD 3JV6B 2KZWA 1JNNL 3QZWA 3UPCA 3IXTB 3ESVF 4KMLB 3D85B 5ENWA 5C09B 4NZTL 3S3PA 4HLJA 4QXGL 4A6YA 4BKLA 2W0PA 1AQDB 1FGNL 2NPLX 3MRMA 4CVXB 5F1IB 5C08A 4LLYB 2FDBP 1NKOA 3C8HA 4Y5VC 4UB0L 4X0KA 2IBZY 5J6GA 4J8RB 4ONGL 3VWJB 4FQCH 4JFDA 4O51B 4MXQC 3G6JE 3EFDL 3N1FC 3BD3A 5J9PA 3DTXA 1E0OB 1P2CA 5IF0B 4XPBL 4XNUL 4HUMB 3VH8G 1CIDA 2UYLA 3ULVL 2V7HB 4LKCA 3LKQB 4I48B 4PJAB 5DI8B 1MCNA 5FM8A 3NA9H 2VISB 2FBJH 4LHUD 1G0XA 3WIHA 5EC1A 4BA8A 3DI3B 1RURH 3LEVL 1MWAH 3G08B 4R7NA 2IANB 3B2UD 1JRHH 3QO0A 3P73B 3OR7A 4Y4KA 1G7PB 4P5KA 1UXSB 1WF5A 5DD0L 1INDL 3HNVL 3JZ7A 4MNGA 3CVHL 3TZVC 1J1XH 3RNKB 3HMXA 2XQYG 1D5MA 2NTFA 5CSBA 1U8JA 4GAGL 3IDGA 5H37G 4KDVA 3NPZB 2W9LA 4EQ3A 3UJTL 2Q76A 4ZFOA 3Q5YA 2OBGA 5HYSB 3GI8L 1S7TB 5ESAB 4NN7C 5F96H 5J4MA 1DQLH 3CXHK 3H42H 5F8RC 3NPSB 3BIKB 4X5XA 1WBXB 4GAFB 5DJAA 3F58H 3OAUL 4N0YH 4HV8B 3SGKC 5EU4B 1NDGA 1MY7A 1A6WL 5DZNA 3S35L 3M45A 3TM6A 2E6QA 2C7UA 4MQ7B 5E2WH 5DRNA 2A6IA 3EFFB 2J88L 1U36A 1DDHA 1F8TH 3D0LB 4XCFH 5CGYD 4M7KH 2BSSA 4OM0H 4WEBL 1J8HD 3ULUL 3GSUA 3VDCA 1VADA 3MJ8A 1K5NA 2UWEF 2L4OA 3JTTB 4LRNL 4E41E 1MFBL 3CU1A 1DL7H 1UC6A 4KKLC 4JO4L 4JFEA 4N1EA 4BQ8A 3FONA 5KOMC 3VGDA 5AD0B 2NCMA 2C3WA 1S7QA 3JVGA 4OCSH 5EZIH 2BCKB 4CJ0A 5FO8A 3SDAD 1T1ZA 3O2DL 4OF3A 5MENB 4HDIB 3DRTA 5FYLD 3RVUC 3WD5H 3MFFB 4NO0D 2BRRH 2AJZA 5CILH 3D5OF 5EU5B 2FX9H 4HFWA 4NFCA 3MV7A 1AXTH 5GS2D 4C59B 3O8XA 3UTTE 4MAYD 4CRPA 1JNHA 1T22A 3CFDB 3MXWL 4PRIB 5IT2L 1F4WL 4WI7A 1RMFL 1NLBL 1QBLL 3DYMA 4LCCB 3N85L 4ZOCA 1F6AB 5FHAL 4EDWH 1HNGA 3PQYA 4CU7A 3INUH 2X6MA 2Z8VC 1NEZG 4WUUE 3MUZ1 1FZMB 1XGTA 1BP3B 1X5LA 2C3VB 3L95B 4FMKA 2BK8A 4GBXA 1GIGH 3O3EA 1P9MC 5I73C 3E6HA 1HINL 3GJFH 1OP5H 1T1XB 1FYTA 2NX5B 3OKLB 5E8OB 2ICWJ 4M62H 3MQIA 5I15L 1ZOXA 3LKSA 4AIZA 1AFVL 1MCIA 1X5GA 2BNQD 2COQA 2YD2A 3BN9D 3MZTA 2HFGL 1JWMA 4MQTB 4IS6B 1JPGB 2E3VA 1VFUA 2GJJA 4QRPD 4CMHC 4XX1E 2Y06H 5T1KB 3VFGL 3AS2A 4WGVB 1CK0H 3B4NA 1QLFB 4XT1C 3TO4B 1AGFB 3QO1A 4PJ8C 4YO0B 4JREC 2XWTB 4LSTH 3VXRD 4OD1L 1BIIA 1FO0L 2MPAL 4GH7B 5HYQB 5FYJE 3KLSA 1F11B 3OR6A 5IB4A 5IQ7H 4HPOL 5C09E 2PYEB 4R0LC 2EDYA 2YSSB 4X4XA 5E03A 4PG9B 1MCOH 3WFBH 2HTLD 5ADOL 1E4WL 3MBEB 3GHEL 4H5SB 1KOAA 1ULVA 4HKXB 3M17A 1NUFA 3PWPB 1TNMA 3WN5A 2A74A 1XGPA 3SBWC 5KSVB 5DA4A 4HWUA 1YYMH 1JPFA 2HFFB 2R2HA 3QUYA 4HS6A 5IP4A 1GGIL 1LEGB 1MHEB 3B3IB 3C2AH 4LLQA 1XR8B 2VNCA 3FN3A 4DKFH 4Z7OF 2A77L 1E6JH 2BOBB 3PNWA 3T77A 3TC9A 5T5FH 3ZL4H 1JNJA 5GSVA 4PJCA 1NBVH 1LGVA 4R4NC 3SDXE 3JXAA 2C4XA 1BMGA 2VWEE 3QRGH 5CZXC 3VFMB 2EDJA 1AGCB 3LN9A 4HKBB 1K6QL 2EDEA 4N0FB 3MX0A 2OK0H 2DBJA 4PJIE 3ECBB 1ZHKB 3MRBA 2VR4A 3U79A 2IANE 1I7UB 4OLWL 3FB6A 5CJXA 2GJ6A 2CKBA 2LU3A 1LEIA 4RGOH 1T21A 1FIGH 3DURB 1ZLWK 5ERWB 5T3ZE 1CLZH 1QQDA 5E94B 1NMCB 1T80A 5MP6H 5JUEH 1Q9KA 3CMGA 1ZHLA 3WKML 4YXHL 2BSTB 3IFPB 4YHLH 2ZUTA 1G7MB 2J5LB 1Y0LA 2FL5A 1IAKA 2DDQH 4IBLT 2P5WE 3KHOA 1DN2A 2WUCH 4FNLL 1U8PA 4KDTA 5CHNB 3TT3H 2W9EH 2V9TA 5F1KC 3DMMC 4MDIB 2EDBA 2JB6B 1EJ6A 5BS0B 4ODXB 3TF7C 4L4JA 3ILQC 2HJFA 4MD5B 3RWGA 2JJVA 1DANT 3ALPA 2XTJE 3CUPB 1JGLH 3GSXA 4U1GC 2RCSH 4MJIE 2R15A 1UWEL 3ZDXF 4L5FL 5IR1A 4HQQL 3LQZB 2IPKA 4HT1H 4DQOL 1AQKL 4D8PA 5LCVL 4Y4HD 1MEXL 3WJLC 3X12B 1JF5A 3PWUA 4BH8B 4HUVA 5INDB 4LSPL 4PGJA 3B9KA 4LNRA 2HKFH 2YEZA 4OGXH 4MLIA 3C9NA 5EOQH 4IRJD 4ZUVA 5I1DA 2DTML 4E5XA 3QI9A 4QHUB 4OF0A 4WFFE 3F7QA 3MLSL 1NJ9A 2Q3AA 2HJKB 4LEOA 3ZE1F 3TFKC 4NQDE 1A7NH 5I2IA 3OJVC 4NZRH 5GGRB 4AENB 5MEOB 3WKNA 3C6LB 5CP7B 3NCFB 3U4AA 1J8KA 1YEGL 2BNUB 2DQJH 4NM4L 1P4BH 4IRSA 4Y88A 1M6OA 4YC2C 4V1DB 5GGTA 3CX2A 2W9DH 3P40A 4AYFA 1UM6H 3BH9A 2APBA 5C0BB 1PAMA 4OV6F 5I9QC 2V2TB 3MLXH 1LE9B 2ZCKL 1G7QB 3Q3GB 3AB0C 2I07A 2D3VA 3UJIL 4KXZI 4PRDB 3L3GA 2BXZA 5C0AA 1KF9B 4BFEA 2H2SC 1OP3K 1NBYB 2JTDA 1UB6B 5D7KE 5C7XL 2XNAA 4LQ1A 4MQSB 5E00B 1WT5A 4OZFG 4WWID 2GSIB 5D7LB 1QFUH 5E1HB 4ZTOH 4K8RD 5JORA 3L5XL 3RL2A 1I9IL 5DWUL 1M71B 5JPMA 5DMYA 4HF5H 1ZANL 5ICYA 3BP6A 2MQCA 4LHUG 1LO5B 4CNIB 4OZGB 5KSAA 1MUJA 2AEWA 3HE7A 3QDGA 2VJXA 3H9YA 4MB5A 4OF7A 1CICB 3BKJH 1QLRA 4FABH 4L4TE 3UJJL 3ARFB 1Z6JT 3GIZL 1EFXD 2PTUA 4GG6F 1LQSR 1NDGB 1WGOA 5AG8A 1QA9A 3G9AB 1NANH 3NFPA 1R3HA 2J12B 4ETQB 3EO9L 4P0DA 5GRYA 2CIIA 3RWFA 5KVGL 1V7NH 2FCBA 2IPUK 1KJMB 1DJSA 5BVJA 2F9BT 2YS4A 4F9LC 1W0VA 1ZXQA 2ENSA 5GQBA 3QUML 1MHCA 1A2YB 1YUHB 5FKPB 3MYJB 1DLHB 1S7QB 1EH9A 3RWIB 3L9RA 3SGJA 1ZA6B 1TXKA 3F12A 3EYVA 3DJ9A 2CO7B 1RIHL 5DHXB 3NTCH 5I1LA 2F54E 3L5IA 2GK0A 4G6KL 4MWFB 1I8MA 1F4YH 4UTBH 5DO2C 1QRNB 1S5IL 1ORQB 5T5NG 1CDYA 1CDBA 1VEOA 4O2CA 3DV4A 3RIFF 3HMWL 1I3UA 4D3CH 5FO9A 3U9PL 5KANG 1RJZA 1RUAL 3BKCL 2EO9A 4B53A 4NHUA 3ZHDA 3VMOA 2HP4A 4D9LH 5FYJL 3SDDC 1OT2A 1IEAB 4QO1A 3VGFA 1FAKT 3VXUA 2BFVH 3W9DA 2EDTA 3QEQE 3DXAB 5EC2A 4RZCB 3WJJC 4LCWB 3VFNB 4ONHB 5HI5D 1JVKA 2ESVE 4I3RH 2UWEE 4JJ5A 4W4NA 3VGHA 3L7FA 4ODVL 1HWGB 4FQLL 1OGTA 4OCRH 4RGMB 5GRUH 1HYSD 5B21A 5KG9B 3IRZA 4QXTA 4DGVH 2AABH 1KNOB 1DBML 3G04B 5EOCJ 1A14L 5IW1B 1GZQB 3K46A 3KXFB 1S7RA 4Y4FB 1OM3L 2QSVA 4ZMAT 1QYGH 4GXUN 3FO9B 1T0MB 2O5ZL 4ODTL 5L2KA 3JTSA 1REIA 1NCAH 4PY7A 4DTGH 5DFVC 3MRKB 1X5FA 4RAVA 2IALB 1FFPB 3T0ED 1HK6A 4YDKL 3QEGH 4FG6C 1CG9A 3OKKA 1OPGL 5HHOD 3VGEA 4WO4D 1JWMB 4XBGA 5TDOB 4M7ZC 4N0UB 5F93C 3CFEA 1TZIB 4XWOC 1GSMA 5I17A 4WI5A 5ID0B 3CH1B 4KKCC 1CL7L 1OSZA 3IU4H 1NDMA 4OZIE 4N0CC 5I1KH 4XCEB 3VXMD 2AJSH 5T3ZL 1Q0XL 3S4SA 2ADJA 1DEEA 3TBWB 5L8LB 3H9ZA 2G5BA 1R5IA 2A0LC 2GT9B 4ZAKC 4OIAA 3V6FB 4Y1AA 1A22B 4M02A 1ZLSH 5IMLA 2FYYA 2APTA 4NQCB 3IFOB 4FQJH 2HT2C 4M6NH 4GMSL 1K3IA 5FDWA 1PSKL 5IV2A 3ETBF 4UNUA 4S2SA 5EO0B 4ELKA 3OAYK 2RIKA 1UM5L 2FJFB 2VWEC 4IDJH 4Z7WA 1NBZB 1FN4A 1PEWA 2IQAA 2QV2A 3T77B 4YIQB 1B2WH 1BLNA 3O3DA 4TSBH 5DD6A 1UG9A 1XFPA 4K9EH 2FIKA 3FO0H 3NH7H 3C5ZA 5C0BE 2QHRL 2FRGP 1DVFB 3TVMB 2E7LC 4XVJL 4J3TA 4KJYB 1ZVSB 3VRIA 3MUGA 3OMZA 4XMLL 4ELMF 2EH8L 1U93B 1FZOB 3L5WB 3PWLB 3RBSA 3FB6B 1BEYL 1UM4H 5J13B 3D85D 4DZ8A 1KB5L 4PJ5D 3EO0A 4YHPA 1D9KD 5I1GH 4NWTL 3MRDA 5LGHL 1VFMA 1JGUH 5FUOH 2WNGA 3QB7C 2VLKA 4XP6H 2VZ3A 2NY7H 3HB3C 5D7LE 4D9QE 3CJJA 1U92B 4GJTB 1INQA 1EIBA 3I6KB 1J5OH 4JFHD 5J1AA 4POZD 4P3DB 4RMTA 1QG3A 1MAMH 2GFBA 3MRCA 3J7HA 3TYFA 3TBYA 4I3SL 3C08L 5H2BA 4Z7OE 5E5MB 3QNXA 4PV8B 2EKSA 1S7WB 1VFAB 4V2CB 4JM2A 4WHDA 4N9GB 2JK5A 3H9SE 5C2BL 3WHXB 4UINL 2X1QA 5M7QA 3IAQA 4GG8B 3QDHA 1DQJA 3SQOL 4JPVH 3OHXB 3F7RA 3FQTB 3IDIB 1JTPA 4AIXA 4YDIH 4M7JH 3O9WA 2HRPL 4R97B 4N5UA 1E27B 4B5EA 4DGYL 2G75A 4WFHE 5TFSH 2IH3B 1MI5E 3P9LB 4JFFE 1YN7B 1ADQL 1DQDH 3T4YB 2VDML 3GK8L 3KLAA 1EO8H 4GW4A 4KKBD 2VITA 3QI9B 2E9JA 2I9LB 4MA3A 5LWYL 3OJDB 4WWKA 5IB2B 5IHUH 4NDMB 4G6FB 5CJQH 1YC7A 2G9HA 2NW2A 3RA7H 3IXAA 1G6RH 2HH0H 2QSCH 4ZUUB 1QRNE 4X7TA 2VDRH 3UBXA 5CZVL 4N8CL 3HZVB 3VI3F 5ESQA 1RZJL 1P7QA 4MDJA 4JFYB 3U2SA 2F53D 4Z76A 3FMGH 4X98A 1XZ0A 1TQCB 1I7TB 3JUZA 5DR5H 1I1AD 5B38G 3ZDXE 3TIDA 5GISL 1ZEAL 1J1PL 3ZKXC 4C55A 5HDLA 2PTTA 4P2QA 2HLFC 1EMTH 3RDTD 3P30L 3GSRB 3O4LD 3H9HA 1JE6A 4MCYA 1O7VA 2FZ3B 1YDPB 4G3YH 1BQHG 3QIWD 3N06B 2DYPB 2NY4D 1SJEA 1G9ML 2P49B 4WW1A 1H3TA 4O5LH 1L9MA 5F6IB 4GKNB 1RUPL 2BNRB 1BBDL 2CXGA 4ZXBC 3VDAA 1YNLL 5T3XD 5JHDD 5ISZD 3U7YL 4KRLB 3ALWA 1CLOL 2YBRB 3O45A 3PWJA 3N1QC 4HIIA 5C9JB 5GZNC 1W72A 5MEND 1KLUA 1FDLH 1L0YA 5ITBL 3HE7B 3RHWK 4NCDA 1BJ1J 3QR2A 3SGDH 4ODWA 4F33A 3EKCA 4MA1B 3QBTB 4M9PA 2DWDB 4G8IA 2YD3A 1ZT1A 4PG2C 5KAQF 2AJXH 5ETUA 4MHHI 4PRID 2MHAA 3I2CH 4G43B 2D4FA 1IGYA 4HJ0D 4XNZC 2JJTC 3GBLA 4PRHD 5T33L 3QPXH 4XPFL 4L8SB 4I18A 1B0RA 2NY0B 1G9MC 2G60H 5FCSH 3G5YB 5EBGA 5GJSH 3C5SA 4QRTA 1QR1A 4NQCE 3ZDZF 5ANMB 2CRMA 2GUOB 4M93B 3SDCA 5F3BA 2FHFA 4L9LB 1JYVA 5H37H 1XGQA 4XP5L 5C0FB 5LAXA 2GCYA 4M6OL 3D87B 1MF2L 5I1LB 1ZS8A 1O5DT 4C57C 4QLRA 3O6FA 1MWAA 1IBGL 4YHOH 4JZJB 3WIIH 1MIML 1PD6A 1HHJA 1T4KB 5HYEA 5E6YA 3HNTH 4M5ZL 2B20A 1CDIA 4L29A 3RTQB 3QDJB 1ZHNA 4GG6E 3MGOA 1BAFH 2OZ4H 4CKVX 5GGVH 3TO4D 3WFDL 3BUTA 1J8HE 1PQZB 3GSQA 3FFDB 3FT4A 2EXWC 4BSVB 2Y36H 2NXYC 3X11B 4FP8H 4OM1H 4H1LB 2VABB 1PG7L 3O2VH 5B39B 2FEDC 2OCFD 3GSVA 1GRWA 2QKIB 3WO3B 4F9PA 3LKRA 3S98A 1KJ2B 2JB5L 4P2CG 3GMLB 5FYLE 4TOYL 4YNYB 2PW1A 1U3HC 4LSVH 5EN2A 3QJFA 4PRPB 5K9JH 2X70B 4NQXA 4PY7B 2ZNXA 3BAEH 4HC1H 3U4BL 4X6DA 3S34L 3PWNB 2AK1L 2VE6B 1KGCD 4HUUB 2J8UA 4YPGA 1YECH 4MVBD 3VRJA 5ID1B 1P4LA 2FB4H 3EGSA 1GGBL 4OUOA 2EH7L 1FYHB 5D93B 2AEPH 1RK1B 5K59F 1FV1B 2ED8A 3FQUB 1J05B 1JGVH 2P46B 5C0DB 2CMRH 4WUKL 4CGTA 3TYGL 3IT8D 3C8KB 4JO3H 2K3TA 3ESUF 5FGBA 4Y1AB 3HG1B 2Z8WC 1IQDB 1CBVL 2VDOL 2VDQH 1I9JH 2Z92B 1EJOH 2BNQE 2YHGA 4L3AA 5F1OB 4QRPE 5FA4B 1OAQH 1KTLA 4U6YB 5I1IL 1CR9L 4OJFH 4J1UA 5F7NC 5J56B 3GJEB 5TE7H 3QUKA 5HDBF 3H0TA 5I1CH 3SGKA 3MV11 2NZIA 3OXSB 4OFDA 4L8DA 3KS0H 5IFJA 1YMHA 5JW4N 2B5IC 2QLVB 3NOIA 4UQ2A 4OKDA 1EAPA 4ODUB 1QSEA 3GJFA 4PB0H 3TNMA 3PIQA 1OTUC 2ZSVB 2DN7A 4UT6L 5ELIA 5D8JH 1AI1L 3ARXA 5BRZE 1OAZL 3PHOB 3MA7A 1KCLA 5D2LA 5C08D 1ZAGA 2DLFH 2AJVH 4QHLA 1QBML 4WFGD 3IF1A 3OKEB 3HE6B 5GRXG 4D2NA 5FYJU 2DS4A 4JY6A 1AGDA 2DL9A 2Y5TA 4JFDD 1EEYA 4HWBH 5HHNA 5J1AB 1R5VA 3BH8A 4FQIL 1FFNA 1I7ZA 2R1XB 1UCBH 3DHJA 3FB5A 5EB9A 1WCBB 3C6LD 4ONOA 3TBVA 1G0YR 1J7VR 1NC4A 5TE4L 5E4EC 3ULSB 1LK3H 1S5HB 1BHGA 1BFTA 4X8XA 4KMTL 1HQ4A 2OTPA 3TT1H 2UZIH 3MRRB 4OCMC 2R29L 3ORJA 3TBTB 1N8ZB 4HS8L 1U8HB 3NZ8B 4LSQL 4PY8I 1II4E 5GRVK 1IFHH 1U8LB 3D3VB 4LLMA 4AL8H 2VXTL 1KENH 4X99A 1BF8A 4BQ6A 1CFNB 5AZEL 3KLHD 4LEXH 2DQCL 4Y4KD 4YBLC 3EYSH 5JPNB 4JN1H 3DGGA 1Z0NA 1SMAA 4OLVL 4GW4B 3UTZB 4AJ0A 2B4CL 3D25A 1W2KT 3KDMA 3CH8A 1VGEL 3HI1A 4KROC 3RKDD 1WJ3A 2D7PA 3GI9H 1UT9A 1CFBA 3D39A 3GNML 4WENB 1RU9H 3H7BA 5DGQA 1NAMB 4XC3H 1Q9LB 4XVTL 4O2EA 4PJ9A 4JRXB 4HW6A 1H8NA 5IOPB 1N64L 3DX6A 1UXWB 2MMXA 3LN5A 5C86A 3ARGB 4R0LA 4AH2B 4QHMB 4L3CB 4YFDB 3TH4T 3PV6A 2GKIA 4ZODA 5D1QC 4YHML 2IC2A 3VG0H 4F57H 2WUBL 3F8UB 5I74C 5EZOH 2P8LA 4JR9L 1X6LA 8FABB 3QQ4A 3SBWA 3STLA 3L1OL 3KPMB 4XVUC 3HPLA 4TPRH 4GRLB 4HKZB 5DRXB 3PHQB 5HYSG 5IWLC 4LDLB 1WISA 2FATH 4TVSa 5IQ9A 4NKIH 2YA1A 3B43A 3MJ7A 3F5WA 4ZD3L 2ZJSH 1KSRA 4ODBD 2DQUH 3VI3E 5EOTB 5C0IB 2W91A 2V6HA 1XGUB 4LVNB 3MV7D 1H8SA 3O8XD 3VXPB 4U1IA 2OR8A 3U30C 5I8OH 1EHAA 3ZMRA 1OQXA 3L7EA 1RJYA 1N7MH 2CK0L 3RWDA 4LCWD 1QP1A 5DUBA 5EUOB 5FYLL 1IL1B 4NHCH 5DJCA 4QHKI 3PQYD 1KEGL 1XF4A 3ILPA 1R3LA 2CXKA 2VKXA 4U4BA 4NNPH 2YK1H 4WHCA 4OAWB 4JPWL 2E6PA 2PXYB 3BDYH 4GAYA 5LQBH 3O41A 4CU6A 1T5XB 4GBXD 3OAZK 4M61B 4OZFH 4F7EB 3N1PC 4EN3B 4PJDB 4PGDA 3T0XA 2P8PB 2WANA 1FYTD 4CADA 3BPLB 4ZPVB 3IDXH 3TH3T 1BFVL 5D70H 2VC2H 2CGRH 2YD6A 1U91B 1I8IB 1OB1A 3DUUB 4Z8FH 1RUQL 2R0KL 4HIEA 4M48H 4KTYA 1F6FB 1IILE 2B2XL 3KPNA 4MJ6B 5DTFA 5D7JB 4FXKB 1HH6B 1MAKA 5T1MB 4M8VA 1MRFL 3SDAC 2C26A 4JVWA 1FGVH 1KFAH 4LFHG 4P4RA 3WJLA 3H2WA 3VGGA 2YUXA 4QXUH 4YHIA 5DUML 4R8WL 3ZYIA 1AJ7H 4GAJH 4Z7VF 5FUCC 4F7TB 1CGWA 1AP2B 4R9HA 5KSBA 3ZDZE 4FQQB 3GDBA 1KCVH 3D2UB 2RQ8A 4MAYC 4LU5H 1LP9A 4ZFGH 2AJYH 5LGJA 3VXTA 3FQXB 3S7GA 1EERB 4RRPG 1MJJA 4MD0B 4BK5A 3LD8C 1EEZA 1I9RL 1JL8A 1DBKH 3QUYD 2YMXH 3Q6FA 4OCXH 5H8DA 6FABH 4LVHC 1A6ZB 1WAAA 1Q9WA 4X7SL 1AHWB 4OLZH 3K81A 2CJUL 2ARJB 3ZTNH 1RZ8B 4JO1L 1U8KB 2M1KA 4OFKA 2V2WB 5C6WH 1I3RA 4Z9KB 4YXKL 1SYSA 5I30L 4XP1H 1MRCH 2CLZB 3MLYL 3BN9C 4LSSH 2DI7A 3OKMB 4ZUWB 1HI6B 3VJ6B 2IH1B 3SE4C 2C3XA 2Q86A 4UOW0 2YPLA 2GJ6D 1XCQB 5I1AA 3TN0B 4NC2B 5CBAB 4TVPD 2YA2A 4U6HB 3QWQB 3T0EE 4R4BB 5HHOE 5HPMA 2BHUA 4NRXA 4XAWL 1X3DA 3BWAA 2YPKA 4X6CB 5HBBA 4QOKB 4DVBA 2K7QA 4PLKC 3X3GH 1FFOA 4OCYL 3U36A 3KPOB 4XP9H 3A6OA 2CD0A 4KDWA 4I0PA 2VLJB 4XNUH 1N0LA 1BD2B 4PBVC 4LCYA 3ROOB 2NY5C 1NBQA 4R2GD 2YRPA 4U3XA 2N4IA 2HTLC 5J6HA 3VXME 4RFEA 1CFTB 4HWEL 3ZE0E 2NR6C 5K59E 3ELAT 4JB9H 5I8EB 4ZDHB 1CFSA 2ZCHH 4JQIH 4L4VB 2FX7L 4R3SB 4FN0A 5D96C 3DVFA 3EZJB 3NCMA 4JLRB 3T09A 4YAQA 3CLEH 3V79C 2WBJC 3IKCA 1NGZB 4PP2A 3B9KD 1ZV5A 1AGDB 1Q8MA 3MLWL 4G7VL 1RI8A 4PFEA 4KJQD 1KJ3L 3QI9D 2BVQA 1G7IA 4Z5RA 3PWVB 1GOHA 5HDBE 2GTZA 3IETA 4IHOB 4TULH 4UQ3B 4MD4B 4QRUB 3VFRA 2F5AL 3DPBA 3CFBA 3SDDA 1JN6B 1CLYL 3EOTL 4G8FA 1YEDB 5HGHA 1YPZB 2LU7A 3NVQA 3V7MA 3ABZA 1NLDL 3MV9B 4IRSD 4AG4H 1KJVB 2KZ1B 1HSAA 5IB1A 5DMKB 4Y5YC 4HGWA 5F3HB 3QA3A 3VFVA 4PJ5E 4KUCD 3VMNA 1OD9A 2ZUYA 4UMGA 4YXLL 4WEBH 3ULUH 7FABL 4PD4K 1V3MA 4IOIA 2D7NA 5IESH 5HGBA 5A40E 3P4LA 2J2ZA 4F3FB 3WE6A 5DD5H 5C0AD 3IDNB 1C08A 2FSEA 3P0YL 3RWEA 2H9GB 4JFHE 5EU7E 2R0ZH 3HC4L 2BY1A 3K2UL 4KHTH 4LP4A 3HN3A 3QIUB 4OIIL 2OYPA 3GSWB 4JZNA 5HVFB 5FF6B 4DJMA 4MZ3A 2HYMA 4XMPL 1FSKC 3B8YA 1CGTA 4GO6B 4I4WA 5E9DB 3QUZB 4PJ7A 4BQBA 5H35B 4H20H 2Z91B 4JDZA 5HI4C 5KSAD 3HE7D 3QDGD 5DLML 5GGSY 2B1HH 5I75B 2BOCB 2IPUG 1KCSH 3FB8A 5EDXA 1MHPH 1JWUA 4PJXB 1KN2L 4IRJC 4U6VL 3DV6A 5AWNL 3LN5B 4C56B 2H2PD 4BUHA 3SE8L 3VXOB 4HIJB 2CK2A 4ZAKA 4LAQH 4K8RL 3I75B 1ZMYA 4MMZC 3EDDA 2GTWA 7CGTA 4XBEL 1BX2B 4FFZH 1PX4A 4HCRH 2NY0D 3UDWC 2KKQA 3U0WH 2DIAA 5FHBH 1TIUA 2A73B 5HHVH 3V7AE 4Y2DA 4Q9QH 1JGDA 5GS1A 1FAIH 1JFQH 2C5DC 1H3GA 4JFQB 4YE4L 3TPUB 1HINH 4JG1L 4MQXD 5A1AA 4HXAH 3U0TB 1T7WA 2N7BA 4KVNL 4D0DA 3TJEL 5DJ0B 5FM5O 4YR6A 5IEKB 2IG2L 4P46B 2WIMA 3BZFB 3VW3L 5GGSA 5M95B 3ARTA 2PYFB 2WINA 4DGIL 5J06A 4U1HA 1WV7T 1OQOA 4ZUSA 1FVDB 3QDJD 3DUSA 3BFOA 3JUYA 5HYFA 4U1IB 3QXDB 3LHPH 3O4LE 1TDQA 2DLHA 5JA9A 3VXUD 4EBQH 3T2PA 4KHXH 3E2HB 1MIEL 4D9RE 2P45B 3RVTD 4OZ4A 4NUGL 4HJJL 1G6RA 1UZ8A 5T3XE 1K8DB 5JHDE 5ISZE 1L7TL 5SWQA 2R2CA 4JVUA 2VXUL 3N50A 5DJ8A 5DS8A 1A9EA 1GPOH 4XNYH 1BWMA 1UQSA 2R4SL 1UKTA 3DX9A 1J0JA 3OXRB 4X6CE 3W0WA 1AGEB 1X5KA 5IVXA 1S9KC 4KRPC 1IZKA 2EDDA 3P11L 3SY0A 5C92A 5L2KD 3VE0A 3F7YA 2VLJE 1GGIH 3KR3H 5E8EB 4PJEB 4NSKB 4WFED 2DQEH 5DQ9A 4HFUH 4D0BB 5CEZD 4EI5A 4HH9A 3MLZL 1N3NA 4S11A 4PRHE 4W6YB 4FHBD 1QTYT 1FNEA 4G8EB 1RZKL 1UJ3B 1XF5B 2AJ3B 1VEPA 4CN4A 1H3PH 4OZHA 1FL5A 1WFOA 2WSKA 1EO7A 4IIQC 5KTEH 2HAZA 1GHFL 1LWRA 5JZ7C 4YLQT 3VXNB 4NKDA 1ZLVH 3MRHB 4EOWL 2CLVB 4QWWD 4Z6AT 3MV8A 4HX1B 5DQDL 5JOEA 4DOHB 2VQ1B 4O9HH 4Y1AD 1FC1A 4NM8H 4C83B 5EOCH 3HLAA 3UBXI 4OGZA 4XPHL 2F5BH 4YXHH 1A1NB 4XVSL 3HC0A 1LK2B 1SJXA 1T03H 4RIRA 3QEUB 3V5HA 4GFTB 1A6UH 4BZ1L 3MCG1 5HVGB 3IFNL 5JQ6H 4P2RE 4FNLH 1U95B 4CDHA 4UNVA 3QWOA 5D2NB 3RZCB 2EIZA 1HYSC 1IC5L 4PJCF 3SCMA 1G7JA 3C6SB 4YQXL 5ICZA 1HKFA 1YPZE 4TSAH 2E6JA 5F7HA 4UOJA 4OUUB 1P5VA 3QHFL 1S9XA 2R1WA 1P6FA 3FB7B 1HHGA 4G5ZH 4TUOB 2ZKHL 3C5ZD 3ALXA 4GRWF 2XRAH 3BZ4A 3NZHH 4DQOH 3AS0A 4M7LL 5LBSH 1A1OB 3HRZA 3SN6N 1YYLL 4WNQB 1RZIA 1P4IH 5DJ6A 1LO3L 4HPYH 4OCWH 1FE8L 1RHHB 4P23B 5D5MB 3TA3B 4HMEA 4NJAH 2Y7QB 3MRNB 5HPMB 1MLCB 5I1JL 2OZ4A 1T5WA 4GW1A 5SWSA 2VLKD 5DURD 3UEZA 1IGCL 4U31A 3MJ6A 1T3FA 1NSNH 3WUWB 2H8PA 2VZOA 3KPLB 4I77H 1A1MB 3QISA 4MXVF 2R56H 3GMMA 4HMDA 1ITCA 2AXJA 4FRWA 3QXTA 2WP3T 1UFUA 1QHPA 4DUXA 35C8H 4NM4H 4YWGL 1ES0A 1BZ9A 4EI6A 1GZPA 1DEDA 4O2FB 3FCTA 1XF2A 4OB5L 4JM2D 3O3BA 1N5AA 3QP3A 1S9WA 2HG5A 1HCFX 1LE5B 4PJBB 1ND0B 1GGCL 3BKYL 5DFTA 5ESVB 5GHWH 4QY8A 4HC1A 1BZQK 3L5HA 1FFQA 3KPRA 4YBHA 2P24A 5GGUB 3S3JA 1CF8L 3NFSH 3O9WD 2AS5M 2YUVA 4M9OA 1KPVA 1NMAH 4Y16A 3QFDA 1YZZA 3CNKA 4MJ2A 2ADIA 3CC5A 4K55A 3SKMB 1K4DB 5FOBA 1I3VA 4ODHH 1DFBH 2UY6A 1JRHI 1G84A 1MCFA 4Z7QE 4K7FA 3VFUA 3S37X 4GXVL 3RWJA 3OG4B 1EGJH 4HKJB 1F3RB 3ET9F 5HGGS 1I9IH 4DW2H 5CSZA 4W4OC 3SKJL 4XC1L 5I1EL 4WWKD 3BVNB 3TGXA 1G7IB 1FL3B 4G80B 2DQHH 1QNZL 2VLRB 1IAIM 1S7SA 5IMMA 3VFRB 3IS0X 4QRQB 1JV5B 1D9KC 3UJJH 1PFCA 4MNQA 1P7QD 3BHBA 4FQ1H 1NEZA 1AGBB 4KUCF 3RI5K 5K9OB 2V5YA 5EPMB 5BVPL 2D7MA 1OGAA 2NLJA 2MFNA 3VWJC 5C2UB 1QSVA 1R3IL 4KJWC 5IMKB 4G7YH 4POZC 3T4AB 4G9FB 5EU7C 5C08E 3S4SG 5FAAA 4OT1L 5INCB 5DC4B 2IFFL 3JBG7 1C5CL 2NMSA 4NKOB 5J12B 4LBEA 1U3HA 4JFDE 3AM8C 4K71B 5GJTL 5FUZL 5DHYB 5ILTH 3T8XA 1JTOA 4NWUH 5FK9A 3SJVB 3D18B 6CGTA 1RZGB 5DJXA 2GEEA 1FIEA 1ZVYA 2JIXB 1MFNA 1UYWH 2GY5A 3BPCA 1N2RB 1BBJA 4X83A 1IC4L 3FL7A 4RISL 4GQPH 1LNUB 1SBBA 3MO1A 1YEKL 2MOVA 3GMOA 4JDVB 4PJEE 5DEFB 3UMTA 4Z7NE 3QFJB 3F6IA 2LV4A 3KJ6L 1HHIA 5CJOL 1DQQA 1A6VL 5KW9H 1VB9A 4YDJA 3L3HA 4Q6IC 4KKBC 4C54A 4LMQI 1VKXA 3MJGX 3MCKB 5T3XL 3BPOB 5MERB 4HWBA 2GTWB 4MNGE 3I3BA 4Q58C 4HIXL 4FQLH 3GGWB 2P5EB 2BMKA 4QHNB 2JCCB 5BMFL 4LASH 1GC1C 1AC6A 3MJ9L 1KLGA 3QCVL 3L3KB 1RFDL 4JFZH 1QSFB 1XR9B 4NC0B 1JPTL 4ZOAA 2HLAA 2HN7A 1I1AC 1C5BL 3SDCD 5I16A 4WW2A 1ROWA 2IQ9H 5DRWA 1UACL 1RPQA 5F89B 1WWCA 3RDTC 2OL3B 3F7PC 3O6FD 1I8LA 4P2YA 5D2NE 1TPXB 1BJ1H 2NY4C 5F7KC 1S3KL 1VPOL 4DN3H 1F4HA 2XZCL 3GKWL 4U1HB 4DK6A 1VENA 1WC7A 3T2NH 4LCUA 1IGJB 1CL7H 3KYNB 1I1YA 4PJHB 5E7FA 1FNFA 5J8OA 2CUMA 4U1JA 1DR9A 2CDGB 1ZWIB 3CD4A 1IC7H 3EYOA 1NC2B 1MFCL 2GITA 1Q0XH 4CVZB 4JFEE 3OKNB 5CLTA 5E56A 3HR6A 4GLRH 4Y2OA 1PDKA 4BSWA 3UC0L 5JLZB 1PBYA 3SDYH 1IAOA 4Z7UE 4JHWH 5JXAL 2XA8H 4HJ0C 5DQJB 5BCAA 3KPSA 4TNWK 4LCCC 3VFSA 4P57B 4X7CC 5CINL 3ROLB 1OT1A 1VA9A 3CZFB 5EG6C 1TETH 5EFIB 4XB8A 4XCCH 2Z31B 2ZUWA 3QXWA 2OMBA 4OLYH 5K9QI 1AXSB 4YGVA 2BVPA 2R4RL 1B4RA 1IGTB 4Q9BA 4DEPB 4H1LG 1ERNA 4KRNA 3LIZH 2RJMA 2QHRH 5B39G 1RZFL 3PQYE 2BVEA 4K23L 1OCWH 5F9OL 1Z2KA 4OTXH 3HAEB 2DQTL 4RMSA 5T1LA 2X7LA 4NQSB 5DMJB 3Q2CA 5C0GA 4OGAC 1FNSH 3MOBH 4BFIB 3VFOB 3X3FL 4K7PH 4TNVF 1IARB 5LGHH 2EECA 1FYTE 3CAFA 4V2BA 3TO4C 5K9KA 4PBWD 2DLEA 1NUGA 4NQEA 1JHTA 3KVQA 1S9VB 4Z7WF 4JPIA 4UILH 3NIDE 4TN9A 3I02A 3HUJE 4X6EA 4EXPX 2YN5A 1OF2B 1INEH 3CFKA 2AW2A 2DMCA 4AMKL 4AEHL 3U9UB 2C1OB 2H3NA 2DLTA 1NPUA 1FHGA 1KIQB 3G6AB 3T1FA 2HT3C 2ED7A 5SX4H 1IGIH 4FFVD 5DC9B 4XH2A 4RQQB 3PV7A 1F4XH 4LL9A 5D1QA 5IJVB 4OZFA 4G9FE 1JHKH 2F58L 3U6RB 3KYKL 3RUGA 3BUYA 5HSFA 1JHLL 3RL1A 5HYJB 1T20A 5BV7C 3MROB 2J4WL 4E42A 5IWLA 2X1XR 3MC0A 3T3ME 1IKNA 2YRZA 3RPIB 5KVEL 2R2BB 1ZT4B 2QHLA 3ZHKA 3RVUD 3D69B 4N8PA 3MREB 4ODSH 4XRCB 2QQQA 1BQLH 2CUHA 3FQNB 4ACPA 1PYWA 5CZVH 4WGWB 4PJCE 3LRHA 4JM2F 5D72L 3QFJE 2C9AA 5JDJA 1WLHA 1NC4D 4WCYL 1D5IL 1T04B 2YPVL 4KWUA 3ARBB 3NN8A 1ZLWH 5L7XH 2IADB 4PGEA 4P5TA 1J1PH 4GRWE 5FDYA 3SKOA 3REWB 5EIIB 4Z95H 3GBNL 1J1OH 4S1QH 4TVPE 4F7MA 3VXSB 4L3EB 5IFHL 1VACA 2ICWA 3QXAB 2Z8SA 4NPYA 5FOJA 5F7DB 5LVEA 3HS0A 3P4NA 1A7OL 1FFRA 2X4UA 3T65A 1A6PA 1G6VK 5KS9B 5HDQH 4RDQF 3NACH 1QSFE 2DQGL 3QHZH 4YGAB 1Z5LA 1O0VA 5C07B 3DARA 2MTPA 1HSBA 4OKVA 3QIUD 2D31A 3OV6A 1CTNA 5F6HJ 3S35X 3PHSA 4NNXA 2OR9H 2VH5L 3D39D 1YEIH 2OTWB 2VZSA 3MOAH 4M6ML 1XGRB 2O5XL 3EOAA 43CAB 1HEZA 5CCKL 3QNYB 1DANU 4ZSOA 3O0RH 1IVLA 2OQJA 1SVCP 2NLJB 4NN6B 4PJ9D 3HMXL 1F90H 3RY5A 1KLFA 4XPFH 1WIUA 4C56D 3FOLA 2VL5B 1A7PL 1SMOA 2J6EH 3AAZA 4EVNA 3ARRA 2ZNWA 4MAYA 4PR5B 1GH7A 1NANI 3C6LC 3FRPG 2F74B 3QJHA 1Z9MA 4OV5A 3W82A 4ZFOL 4NNYA 3RAJH 1XGYL 3B2VH 2AKRA 2ITDB 5JHLH 3VI4F 5A2IH 5HHME 1S7UB 2HFTA 4YFLI 4FQXB 3B9VA 4UV7H 3UROR 2BC4A 3GMQB 1Y6MR 1KIRB 3UZVB 4P2OA 2ADGB 1U8NA 3MMEA 4NKMB 4JANB 4P9HL 4ZUTB 3TJHD 5E2TH 3KLHC 4DFHA 3SOBL 3GHBL 4WDIB 5JW5B 4PB9L 2X4QA 4HUXA 2I60L 5F44A 3WFDH 3DYPA 4N8VB 5D1ZB 1B9ZA 4RGNE 4PJFA 4NRYB 1NFKA 3RKDC 1JYNA 5FKAA 5E1AA 1A0QH 2A6KB 4AM0A 5EUOF 4LLWA 5C0AE 1WFTA 1D6EB 3B6SB 5HGDB 2ERJB 4NQTA 5EH1A 4BM7A 2QQNH 3GRWH 3VFTA 5E0QA 3VXRA 3D0VB 2X10A 4DN4H 5BXFB 4WI9A 4O4YH 1TZGL 3I6GA 4EZMA 4PJDF 2ZUXA 3IDMA 2HLAB 4ERSH 5C0CE 3QDMB 1MCKA 3KWWB 4WW2B 3U4BH 3JWOC 5DRWB 4WHYG 2IAMA 3KPQB 1U8MB 3S34H 3OKOA 5C71A 3FO1B 1NGXA 4KZDH 4ZS7L 4CAGA 1OVZA 3UTSB 3DROB 5CBEB 5C1MB 3ILQD 4KZEH 1MFEL 1WITA 5E6IB 1CU4H 2YZ1A 2LAGB 1D5BB 4FTVA 3S5LB 3PXJA 4WV1B 2OI9C 2AEIT 3JVGC 3Q1SL 4MZ2A 3U7WH 4HBQA 5F9JB 4YH6A 3BO8A 5LG1A 1YMMB 2WBJA 5DJ2A 4KFZC 1NMBH 5DD3L 5HVHB 2LTQB 4XP4L 5HYJE 1MCWW 1TJIL 4KI5D 3OKDB 2FWOB 1IEBA 1C16A 3MNZB 2GYSA 1XCTA 1MVUA 2D9QB 1KCRL 5KVFL 1SYVA 1P1ZA 4X6DF 3C5JB 4J6RH 4XMKL 2NNAB 2YC1B 5E7BA 3FFCB 2VIRB 5ALCL 3MODH 4WTZG 4NT6B 1U8OB 2JLLA 2J8UF 4QF1B 4F7CB 1QBBA 2EDOA 1ORSA 1OY3B 4NP4H 1BFOA 1YNTB 4RGMC 5DJDA 3JWOH 3VXUE 1JPSL 4HCRA 5SWZB 5DMIL 4W81A 2BVPB 1VSCA 4UDTA 1YNKH 3MLVH 3MNWA 4GBXC 3QRFM 3IU3B 4Y4FC 4X5LA 3H3PL 3QUXB 2XPGA 4KY1H 4B41A 4L3EE 3LN4B 3MRIB 1JZ5A 5KZCB 2A6DA 2C4FT 3HPJB 2Y1VA 3W9EA 2O26U 5KS9E 2YPLD 3WIFA 4UU9A 5L2KE 1OD7A 1U58B 5D1XA 3ZYOA 5K9KB 2WZPD 1U8IB 1SY6L 1Z3GL 1ZSDA 2YKLH 1KG0A 5EBWA 1HKLL 1A3LL 1X6NA 5C07E 5F7EL 2VLLA 3AREB 4RWHA 1MQKL 3MNVB 5B38A 5JDSA 4N1CA 5IJKC 1PZUB 4FQIH 1RUKH 4YHKH 2OTUB 4MB4A 4I0PD 1FNAA 2NY6B 1MFAH 4EDXB 3D1MC 1ZA3A 4LLVA 4E0RB 3LY6A 3QQ3A 1PLGH 4IRZH 4M1GL 1BQHA 4NUJB 4KMTH 3MR9B 4TQEL 2X4PA 2CKBL 4JFXB 3BPNB 4TVPL 5KBNC 4FOMA 5I8KL 5TF1H 3PABA 2GI7A 3UPRA 4K3JL 4LARH 5JMOC 3WN5C 2WK2A 3K8LA 1G7HA 3F7VB 5D2LF 3P0GB 3CIQA 1HHHA 3BYTA 3OAYH 2SEBB 2VUYA 4OSUL 3PL6B 2FX8H 1T2JA 3IDYB 4OLVH 1URLA 1CGSL 3RBGA 3ARWA 2OL3L 1MPAL 4NGHH 4Z7WE 4R4FH 3T1WA 5DO2D 2W07A 3IDJA 1DVFC 3WFCL 3JWDL 1EXUB 3BW9A 1IGFL 5J11B 1G9EA 4ORGB 3GNMH 1JP5A 3R1GL 4H0GA 3VXQB 3R06B 4Y19B 3ARDA 5CJXC 2EIEA 2ZPKH 3IAPA 2HT4D 3TNNB 4JGUA 3T0DA 1MCJA 3SDDD 3DX8A 1ONQA 1OAUL 3FT3A 5AZ2L 4MXWL 4R6UA 1HQRA 5JQHC 2Z35A 3AU1A 1T1WA 5EU6A 3UZQA 1VGKA 4D0CA 1PW3A 5F9AC