3WSQH

Structure of her2 with an fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
218
Chain Sequence
EVQLVQSGGGLKVPGGSVKVSCKASSYTFTSYGISWVRQAPGQGLEWMGDVNTYAGNTNYAQKLQGRVTMTTDTGTSTAYMELRSLRSDDAAVYYCARDRGYYAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Insights into HER2 signaling from step-by-step optimization of anti-HER2 antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 36
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wsqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wsqH01
6CGTA 3GHBL 3E8UL 5GGUA 3ALPA 1K8IB 3HC0B 2NXZD 2EDEA 1VESA 2W9EH 3C5ZB 4HZLB 4HXBL 3EYVB 2N1KA 5C0FB 2PF6A 2EECA 4WW2C 4P4RB 4YGVA 1F4WL 3W0WA 4O2EB 4LARH 5C0AE 2H9GA 4DVRH 3CVHB 3JWOC 1IAIH 2O26U 1DQML 3S4SA 4C83B 1UB5B 3AS1A 1ORQB 1UXSB 2WLZA 1NFIB 3MUGB 3K1KC 4Z78B 2XTJE 4U6TA 5CINH 5BV7L 3T1FB 2A1WH 4ZODA 3SOBL 5CBAB 3MRIA 3ZE0E 3OAZK 3ILQC 3HFML 2XKSA 3Q6FA 5D2LF 2FGWH 3G9VA 2GTZA 4YJZL 3VXQA 3LSOA 1G7HB 3BJLA 3VG9C 2EEAA 2AXFA 5T5NF 1KN2H 3VXNB 1T20A 2AERT 5E2VH 1XGTB 5K59E 3LD8C 4LCCA 1OQXA 1NFDB 3X3GH 4I0CC 1J7VR 5CJOL 1FH5L 3ZDXF 5SV3A 1A9BA 1WBXB 2X4SA 1SJHA 1KJMB 1VADA 3HNTH 5JUEH 5I1DA 5LXGH 5EIIB 3EYSH 1YEHH 1CVRA 2P8LB 1PYWB 4F58H 5GJSL 4PBVC 2VLRB 4RQQB 4UB0H 1GIGH 4G8FA 5HDOA 4KRPB 5D1QA 1T2JA 4NN7C 3S36H 2CDGB 1A3RL 5JPMB 1XGYL 3KYOA 5D5MF 1T4KB 1J1OL 5C6PB 2V2XB 1KEMH 3M8OL 4MXQD 5B8CB 4WFFD 3RWDB 4ZPTA 5D71L 2PR4L 3BQUD 2PXYA 2F19L 4YHNA 1BAFH 5I17B 4QRSB 1FE8L 3UPRB 5GGRY 3ZE2E 5L0QC 5D2NC 1YY8B 1WQVT 5JXEC 3L3KB 1QR4A 3GBMH 1DQJB 1A14H 2FBJL 1TJIL 2VUOA 2IBBA 3EO9H 2BNRB 4JFEE 1KNOA 5BVPH 3M45A 4X6BA 1XCTB 1KACB 5KN5A 2LVCA 2Z4QA 2OJEB 4LHUD 3IDYB 2CJUH 3D0VB 5DHVB 3HE7A 1RZFH 4R2GC 4YHKH 1PZ5B 1KJ3L 4DN4H 3DVFA 4PJEB 5FYLD 2EDWA 3RZCC 4XPFL 3GM0A 1AGDA 3PHOB 1VKXA 4CW1B 1NGPH 3GIVB 3MCKB 4IMLB 4TPRH 4ZOAA 1HSAB 1ZHNA 5TF0A 5KAQF 3G6JB 1P4BH 3KDMB 5AAMA 1DVFC 4RGOH 3T0VA 1OAUL 2Z92A 4Y2DB 4QHLA 2D31A 3PNWA 4OB5H 2O61A 1FNGA 3WHXA 3WN5C 5D1ZB 1FVEA 3SDXA 2JJTA 1B0GB 3MRFB 3EZJB 1UH4A 4QRRD 1U0QA 4KQ4H 5CZKA 4W6XB 2V7HB 5LGKA 2YC1A 3D85B 4LLMB 4JQIH 3NCJL 2R0KH 4DKEL 3NN8B 5DXWA 4NZTH 1RZJC 4X8XA 4OIIH 4PTTA 2XA8L 4CVUA 1IAII 3O2WH 5J1AB 2AS5M 3SPVB 5DYOA 1DUYB 3VH8A 4FQCH 5ANMB 2Y36H 3OR6B 3RP1A 3AREC 2VLJB 4AK1A 4GLRI 1F4XL 1XIWA 4N0YH 1UADC 4KMLB 1CDCA 3JWDC 4NQDE 4JN1L 1ZANL 1ZLUH 3NIFF 3AC0A 3RNQA 3VFPB 1UZ8A 5GZND 3TIEA 4QWWD 1DBKH 3GJEB 3AFLA 1BVKA 4JO1H 4XNYL 4DUVA 4HMCA 4I5BB 4F80A 3SKOB 3MLRH 4YIQA 2WK2A 4BM7A 3ME0A 3SDCD 1GJIA 3IFLL 1J11A 3KPLB 4L9LB 1RURL 1YEGH 2P5ED 5E9DA 4JO2L 3LRGA 3Q0HA 1T2XA 4WV1A 3SEPA 1A9EB 2ID5A 3QG7H 5C2BL 2EH8H 5K9JL 1U3ZA 1H5BB 1PLGL 2GJZA 5KAQG 1OGAA 4LLDA 3D9AL 4PV9B 3T4YB 3DBXB 1AFVL 1MCRA 2YPLB 5FYKE 3VRLF 2VXTL 4WI9A 2KZ1B 1LP9B 5IB4B 2PTTA 4JFPA 3QUMB 2AAVA 1JHTB 3X13A 4Q6IC 4JLRB 3U7WH 1S5IL 1FV1B 3MGOB 4M8VA 3BWAB 3QDJB 1HKLH 5TPWL 2WBJB 3VXME 5KSBB 1A47A 2ENYA 3D69B 3K7UA 3EYQC 4HJ0C 4XVSL 1O5DT 3GSUB 1KIUA 4I2XA 4LSPL 5BRZB 2DM3A 3LN4B 3N1GC 4A6YA 5I1CL 3O4LB 4JANA 3H42H 3OHXA 4MXVF 1KCUH 1KTLA 4X7TA 5IJVA 2VR5A 4J1UA 3D25A 5J6HA 5HYIA 3N50A 1KPRB 5IQ7L 3GBNL 4PBWD 5DK0A 4IRJD 4LPWA 3WUWA 1CICD 3DX6A 5DD3H 1OVZA 1KOAA 1KULA 3UC0L 1PQZA 4WFEE 5KW9H 3F5WA 3KPNB 5E00A 4Z8FH 1CT8B 3VGBA 2RQ8A 2NY2D 1KJ2B 2IGFL 5ISZB 3WL9A 2EE9A 3ARFB 2W92A 3EKCA 3ZKQD 1ZVYA 4J4PA 2K7PA 4Z7VA 5BO1L 4XMKL 3OXRB 1T2QL 5DJ2B 1FFPB 5DEZA 1YMME 3QQ9D 3TVMA 5HTSA 4UIKL 3HN3A 1MCDA 2EICA 4LNVA 3MNWA 4JE4B 4TUKL 4NKMB 3S34L 2BZDA 1UWGH 4Z7UE 4EDWL 3OWEA 3PHQA 3G5VB 3F7PC 4PFEA 2V5MA 4PUBH 5DD6B 4UBDC 2I25N 2P8MA 5F89B 4Q74A 1MCOL 2WUBL 4YWGL 5DEFA 1QFWL 5HSFA 2GHWB 2EE3A 1MCQA 1H15B 2APTA 2JJSC 4GW1A 3L5WB 3K2UL 2IPTH 3FB6B 3RU8L 3WNMA 4HKXA 2X10A 4DGVH 4F7MA 3QSKB 3MRPA 4HWNA 4M7KL 3E2HB 1VPOH 5IFJA 3BD5A 3WO4C 3OKLA 5BVJB 3PGCA 4AEHH 2P48B 5ENWA 3VI3F 1G0YR 4LSVH 1HIMH 2C1OB 3QI9D 4JFZH 3QWOB 4NJ9H 5C6TH 1AP2A 1U8KB 4TUJA 2JJVA 3QUXC 5IG7A 4E0RA 2AV1B 5IR1A 4JFHE 4YXHH 1MCHA 4EUPA 3BMWA 2ZUXA 4UT6L 2D7PA 2FJGB 4R4BA 1UZ6F 1K4DB 3O6FD 4KMQA 3C2AH 4Q0XH 4HLZG 2B8OT 4XPAH 4A6YL 5HPMB 5J12B 4HIIA 4L8BA 1JV5A 4YEEA 4MDJB 4MA1C 4X8JB 4S0SD 2XZQL 4NQCA 1JGUH 5DMIL 3ILPA 3O3AA 4HH9A 4HX1B 4R8WL 4JO4H 1MVFA 2FWOA 2R69H 3BFOA 3UXFA 3IXAA 4F7PB 4PJ9B 1MCWM 1FFRA 4I0PC 1NAMH 3K1DA 2XV6B 3QCTL 3BD4A 2AQ1A 2EDRA 3I2CL 5D7LD 3TO4B 4PLNC 5I0DA 4XH2B 3MV7B 2X9WA 1M71A 3O6LH 3U79A 3OJDB 4FTVD 5I1JH 3RY6A 2OP4H 4LNRB 3GJFA 4Y5XA 1AE6L 3AS3A 3P30L 3HAEH 1C1EH 2BRRL 3B2VL 3VXSB 5SX5H 3QWQB 5F7EH 2XWTA 15C8H 3PWPD 4RWYL 1A1NB 1G7PB 1C5CH 4APQD 3WS3A 5FYLH 1WBZA 4PRPE 1JPFA 3O3BB 4JPWH 4MSWB 4NRXA 3RGVA 3X3FL 1CDJA 2D9CA 1I85A 5JW3L 1SY6A 3T0ED 3KPOA 3P0YH 3GSRA 3IJHB 3J7HA 4WU7A 1Y6MR 1XGPA 5KS9F 1OP5H 2OLDA 1QRNE 3B9KC 2GCYB 1DQLH 1JPSH 1NLBH 2J5LC 3TIDB 3MO1B 5ADOL 3U0PA 3Q48A 2YA2A 3RAJH 1LK2B 1T04A 2BNQA 4MLSA 1OAZL 1OP3H 3ARBD 1NMCB 2QSQA 2QBWA 4YHIA 1NEZB 4QGYA 4PRID 1U6AH 2GW5A 3CFCH 1M6OB 3SE9H 3UYRH 1K5NA 4ZYKA 3HB3D 3FONB 5I1IL 1FAIL 1E4XL 4PJFF 2VC2L 2GJ6E 3ARRA 4RMTA 4XP1L 3HPLA 3Q6GH 2FL5A 3VXTA 2FJFA 2FHCA 2EIDA 1YN6B 2JIXD 5KTEH 2Y5TA 4NYLB 3BP6A 2Q7YA 3IFPB 3RVUD 4UQ2A 3L5XL 4FQJL 3V4PL 3S7GA 4Y5YB 1G7IB 4PP2B 3ELAT 4JRYE 2BOCB 3NFSH 1ZE3C 4GRWH 1FN4A 5IM7B 3VMNA 3EYUL 2WINB 5HY9B 2O5XL 4HUKB 5DUPL 2P7TB 1QTYT 3EJZC 5IHLB 3THMH 4DZBB 3FMGH 1CGVA 3L5HA 4O2FA 5F1IA 1D5XB 4X6FA 3VGAC 1ZLVH 1F90L 4OV6F 5GS0L 1INEL 4Z7QE 1INDH 1CTNA 3QEQE 1HCFX 4P5KB 4KHTH 4ISVB 5H35A 3SE4C 4L3AA 5IVNA 3QJHA 3VXRE 5CLWA 3V0WH 3IETA 4M1DH 4R4FH 1T03H 1FCCA 1QBBA 3DMMA 4KDVA 4MVBD 4OZ4A 5HHOA 4HZAA 4YDKL 2VXVH 3U2SB 4MA3B 3ARQA 4RMWA 1WTGT 1BFSA 4ONGL 5BS0A 5B3JF 2ESVD 4TRPL 4OLYH 3UTSE 4TVSa 3VFOB 3NH7H 3L3GB 4JFFE 1FNEA 4M5YH 3RX7A 4P49A 3WXVH 1NUNB 1JI2A 5I1EL 1Q1JL 5ACZA 1S7SB 3OJ2C 3T4AB 1JI1A 4H8WL 2L0DA 2RHEA 4XMLL 4FQIL 2NZIA 1GCFA 3D39E 4PJ7B 1E4WL 4U6HB 1BIIA 1P7QB 3VJ6A 1RZ7L 1YYLH 3VWKA 1SY6L 2G5RA 2AJUL 5IVZB 4MS8D 3TA3C 2IQ9H 3BEVA 3UAJD 2FX8H 5HDQH 5I1AB 2GYSA 2ITCB 1YQ2A 1RMFL 1CXIA 2ICEB 4QRUB 3DX8B 4OD2A 5HYJA 3T3MF 5GRUL 1N6QL 2Q6WA 1CFBA 3C8KA 4X5XB 3OKYA 1FFQA 3A67H 3NIGF 4N0UE 3VRIA 4IRSC 2KQNA 5DLML 1S9VB 1CL7L 2OTWB 3MREB 4JGMA 2G2RA 5GRXG 1D9KB 5HHMD 4P59L 1NMBH 4FFVD 5DDHB 1I1FB 3R0NA 4JGUA 1A5FL 1T66C 4PJHB 1KLGA 3ARWA 5C08D 2NZ9C 4MAYA 1ACYH 4L8SC 4GAYA 5F8RC 4ODTH 1JUFB 4BQ9A 4Q2ZA 2ZUUA 3C60C 3MODH 3CDGB 2XPGA 4PJCB 5HHQB 5LQBL 1QYGL 3E8UH 4OQTA 4XMPH 3MJ8B 5GGQL 5C9KA 4U6YA 4QCIB 3RVWD 2CLRB 1I1AD 2E9JA 1Z0MA 3QIUC 3I3DA 1ZT1B 5MEQA 4ELKB 1ZGLB 5D1XA 2Z31B 2B0SL 3QIWD 2AJSH 4YDLB 5CJ8A 1VACB 4OGXL 3MRNB 1DQMH 5CSZA 1C5BL 1ND0A 3TZVB 4MJ2A 5HHPB 4P5TA 1RJZA 3B5GA 3NIDF 4DZ8B 5BV7H 5JHDA 1MRCH 4KVCL 5D7KE 4K2UL 4U49A 3BH9B 1ZSDA 3SOBH 1P4LB 1EZVY 3HFMH 5I30H 1MFDL 4WW2A 4QF1B 4XBPA 4ZPVA 1NFKA 5HI3C 1CDBA 4P2OC 4NRZB 1OGAD 2CLZB 4LCYB 4G9DB 3D1MC 4Z76A 5DQDL 5GRVK 4HKBA 3O9WB 4PJDF 2QQNH 4LDOB 2DN7A 2R2BA 3MLXL 5IVXE 3DHMA 4HHAA 3RA7H 3G5XA 3AROA 1OB1B 1PAMA 3P2TA 5E6IC 1Q72H 5CFHA 1HE7A 2ICWJ 1NCCH 4OFYA 5LWYL 4OD1H 3MV8B 1J0KA 3LN5B 5E2UL 2BC4B 5GJSH 5JIHA 5FYKU 3ALXA 2VISB 1I8LA 4K07A 3ZKMD 5DGQA 5IK3A 5DMYA 4MXVE 4D9QD 5F3HA 5CIPA 1A1MA 4WCYL 5F6HJ 4PRNA 1T3FA 1XGYH 3FT2A 4XNMB 1J1OH 3V5HB 4NZJA 2YPKA 5L2KD 4KK5D 5D71H 4U3XA 3P4OB 2F19H 4L8DB 4MCYA 3RBSA 1FE8H 1ZA3B 5CP3A 4PJGA 3FO2A 3MXVL 5EUOF 3RJDA 4L4VA 4LGPB 5I1LB 5JZ7C 4FQHA 4ZOCA 5EU7C 3RZWA 2NY1B 5EU5A 4XP9L 2OMNA 1RZGB 4OQTL 2FBJH 1TJIH 3JV6A 4J3WA 2EDYA 4P2CG 3IT8D 3T65B 2AEWA 1KCVL 4OZFB 4F3FA 1OTSC 4OFVA 1TQCB 2PYEA 2ZJSL 3ULVC 4CVWA 1CGSH 3TFKD 1LK3L 3S96B 3SDAC 1CXKA 5A16B 1LE5B 4LPCA 5D2NA 2ICWB 4OZGB 1KTRL 4U05A 1YY9D 3RPKA 5FUOL 3V7MA 1ZK9A 4JB9H 4JO3L 1FVDA 5GS2D 4OLXL 5I76B 3LKNB 1G9EA 4R96A 1OAUH 5EU6A 4DW2L 3LHPH 4K94H 3WJJC 3O3EA 4MJIA 4PLJC 1FYTE 4G8GE 5DI8B 4UV7L 1KYOJ 5KVFL 3LEXB 3REWB 2WANA 1QA9B 5IV2B 5ETUA 4YR6B 1U58B 5HHVL 3RDTB 4ZTOL 1ETZB 3NCJH 3QO1B 3BP5A 4CDGC 4EI5C 4C4KT 1D5IH 1UKSA 2F54A 2R23A 2EYTA 1DVFA 1J8KA 2OX5A 1AHWC 3TYFA 3RWEB 1CZ8L 1GRWA 4KZEH 3GKZA 3F7QA 5FUCC 2OR9L 4P4KC 1QACA 1KCKA 1LO5A 1F4XH 1YPZA 2EE2A 3FO0L 4LEOA 1A6PA 4JN1H 1ZANH 2EDKA 4YXLL 3OV6A 5KSUB 5BJTB 4KJYB 4J6RL 5DJYA 4JM2A 3AMKA 5C0AB 5DJ6A 3BEWA 3WFHA 5GS0D 3QCVL 4QXTA 3SGDI 3GI8L 1CR9H 2HT2D 1LDSA 4Q9RL 1GC1H 1N8ZB 5C0DB 4XNYH 3H9SA 2R2CA 2Y1VA 4M61B 3FO9B 4I3SL 5JMRA 2XTJB 4PJ8C 4X6DE 3ZYJA 3OGCB 3NCYP 4M6ML 4U1GC 1KN4L 2J1KA 3AREA 2V7NA 1M7IB 5TH2A 4IM8A 1X4XA 1WAAA 2RB8A 2WQ8A 4L4TE 5DRXB 1RURH 4I9WE 1JGDB 2BNRD 4JO2H 1V7NL 4HIHA 4RDQG 3CFDA 5C2BH 5K9JH 2YD2A 5TGBB 3LEYL 3VFMB 1T83A 5GJTH 1HSBB 2DIJA 3K8KA 5FGBC 4XXDB 4KJQD 1JWUA 1AFVH 3RL2B 3QUYA 2VXTH 4PJXF 3IDNB 4ZDHB 2PCPB 4R0LB 4DOHE 3T2NL 1VGEL 2BMKA 3QIBC 2XQBL 3MRRB 4CU8A 2Z8RA 5I66B 4KUZL 5KS9E 4WEMB 4ZAKA 4BZYA 3QWRA 2DYPA 5L8LB 1H0DB 3OX8A 1Q9OB 1S5IH 4Y2DD 3RIFK 4ZFFA 3LQAL 4NP4L 4GRLB 4OF3A 4F7TA 4F8QA 1BPVA 2FX7L 3EIFA 3JSSA 3LRSB 5CEZE 1JF6A 1R3KB 1JTOA 4XVSH 2BXYA 3NCYS 4LSPH 4FFWD 4HSQA 4U4BA 1N3NB 4PJFE 4PTUA 1EEZA 3D85D 5I1CH 3MMEB 2J88H 3HAEG 3X17A 4OZHA 4WUKH 5IQ7H 5KG9A 3GBNH 4PRHA 4LHUG 4Q6IA 2Q3AA 3B3IA 4KV5E 1ONQA 3O45B 5E6ZA 1KLUB 5DA0B 3V79C 3U4BL 2VLJD 4WDIB 2VL4A 3C2SA 2GSGA 4N8VB 5MP6H 4XNUL 3QO0A 3ZZ1A 4JFEB 4FQ2H 4X4XB 3X11A 5JOEA 3UC0H 2DLGA 2MKLC 4XPBL 3WIHA 4K55A 3MRKA 4KGJA 3A6OA 1D5BB 4NHUB 3OAYH 4GBXC 1CE1H 1U8IA 4KH2A 2IGFH 4N0FA 2EDQA 1N6UA 5JOFB 1T22A 3HS0A 5J9PA 3FRPA 4XMKH 4H25B 4GS7C 4DJMA 1T2QH 2XZZA 2VDRL 4F2MA 5FDYA 4OCRL 4UIKH 2ZNWA 3CX5J 4TUKH 3TNMB 2J8UE 3S34H 1JYNA 4AEFA 5M95B 1JNLL 1RK0A 3PQYE 4HIXL 4EDWH 5KSAC 2CR6A 3KPQB 4M9PA 4HIJA 4B5EA 3ROOB 1D3CA 4ONOA 1EPFA 5BS0D 1FG9C 2AI0H 1I7RA 2RCSL 4NFBA 1ED3B 1BVLB 4I48A 1MCOH 4NBYB 2WUBH 3O2DH 2R2HA 1R3HA 3TPKA 2WP3T 5HI5D 3VXPB 3CC5A 3TCLB 3TPUA 1F4AA 5B39A 3K2UH 1FDLL 2NR6C 4GKOA 2ATKB 4FMFA 4LASH 4PYGA 1YC8A 3L3OB 4OM0L 4M7KH 1ZT7A 5I73B 1X4ZA 2FATL 1FC1A 3GSQB 3TN0A 2EDNA 5E2TL 2DIAA 5CWSA 3W9EB 4EN3C 1O7SA 2PNDA 1ZVSA 4LLAA 3WMSA 3U9UB 2LFGA 2BHZA 4JZJA 3BH8A 5FB8B 4K8RL 4NQDB 4OCLC 2OI9C 2ZOKB 2BOBB 2R1YB 3OKDA 4YHZL 1I8IA 5A2JH 4NN6B 5EZIL 3CFKA 3T3ME 2MHAB 3FTGB 3FFCA 5BRZD 5SWSA 1UA6H 1HILA 1VGKA 4UT6H 1XF3A 3NIGE 3O4LD 4BSJA 4V1DE 5T3XE 5HYSA 5DFVD 1EFXB 5C0EB 4I18B 3BZ4A 2AEQL 2NY6B 3OHXB 4R7NB 1GHFL 3NCEB 3RUGE 5DMIH 4UNTA 4LAQL 4UTAH 4HUVB 5JW5B 3H8NA 4R8WH 5JW4R 3EYFA 1LGVA 2XN9E 5CBEB 3B8YA 2HRLA 1WFNA 3QCTH 2A74A 3I2CH 5I8OL 1DLHB 3ARFD 2MQ3A 1ZT4A 1F11A 5ICZB 5AUMB 5ADPL 1AH1A 2VN4A 1AE6H 3P30H 5DZLA 3B2VH 3OKNB 4G6JL 5JO5A 4WHTA 1FP5A 3QRFM 3SKJL 1U3YA 4PJBE 3EFFB 5D1XD 3SY0B 4RWYH 4F37F 1R0AL 2IBZY 5LG1A 4YBQD 2VITB 1HHGB 4I0PA 4G6AD 2DDQL 4EQ2A 3VXMB 5CGYD 4JG0H 5ACMA 1XR9B 3GMRB 1IGTA 4S11A 4HS3B 3RVTC 2GT9A 4WENB 5GS2H 1NPUA 2P8MB 3RTQC 1YUHB 1Y18A 1OAZH 3MRCA 4UUJB 4Y0GA 3HUJA 3RNKB 2VLME 2CIKA 9CGTA 5IFAL 5I1IH 1FAIH 1FNAA 5DJXB 1V7ML 4PJDE 4L9DA 2VC2H 4V2BA 1ZAGA 1BGXH 3R06B 4NZRL 4E5XA 5FO9A 1WICA 5IFJB 2BHYA 4UINH 2F15A 2E7MA 5AZEL 4X9FA 5F7KC 2X42A 3F6IA 4ELME 1EERB 3L5XH 4FQJH 3V4PH 1MHHB 4WTWA 3V0VB 1NCDL 3VCLB 4DEPC 3W11D 3FCTB 1J18A 1EEUA 3K4DA 4OFYD 5J3HD 1A02N 3EYUH 5JIIA 2IH3B 4GFTB 5DK2B 3PGDB 2XIDA 4OCWH 2QADB 1NANH 1J12A 5DJ0A 3I6LE 1QFWI 4QHUB 5FM5M 1F90H 5GS0H 1TZIB 1INEH 4QY8B 4X98A 3SE8L 4Z7UB 5DO2D 4LSSL 4OSUL 4JFDE 5E95B 3T2PA 1CBVL 2OXHA 4PJ9D 3KYMA 3GMOA 3S97C 3QDHA 4YDKH 4L4VD 1DANU 3MV7D 4ONGH 4TRPH 1EZVX 2WZPD 4YC2B 2OL3A 1QQDA 4GKNB 4RISL 1P53A 3HG1A 5E8PB 5I1EH 1VEOA 2BERA 2QQLL 1GOFA 3CH1A 4NNPH 3JBG7 3RWGA 3VXSD 5MERB 1Q1JH 2DWEB 4ZO8A 4U1JB 3TBWA 3SE4A 1SJXA 2PYED 4H8WH 1F42A 5IJKC 4FQIH 3WV0A 3QEUA 3WIFA 5I1GL 4PRAB 3Q3GA 2PN5A 1E4WH 4PY8J 1RZ7H 2VXQH 2DJ4A 1SY6H 2QHLA 2X1WL 2AJUH 1S7QB 4LSTH 2UVFA 5FECB 1KELL 4J12A 4PGEA 2WW8A 3L3DB 1RMFH 4ODBD 1JNNL 2OR8A 5MENE 1HYSD 2A6JA 3DXAA 3N1FC 5GRUH 1N6QH 4QYOA 5IHZA 3CMGA 2NNAA 1OGTB 4GMSL 1JF1B 5DLMH 1OTUD 1DP0A 1CL7H 5E8DL 3VWJC 1AGCA 2OR7A 2D2OA 1U8PA 4P59H 3TA3A 5DURB 2H2PD 1HI6B 2B20A 2F54D 2MQ0A 5EO1A 2PO6C 3QDME 3LKQB 1DUZA 2D4DA 4X6EB 1U3HA 2YN5A 1A5FH 1KTKE 3QJFB 1CN4A 1JRHL 1K2DA 3RL1A 3P0GB 2DRUA 4RAUB 1M05A 3GM8A 3MRHA 4PJIB 3E0GA 3DI3B 4W6YB 4ALAH 1QYGH 2IANA 1HH9B 5LGJA 5SWQB 4M1CD 3KPPB 5DS8B 1RV6X 3UTQB 2BVQA 1HH6A 1TFHA 2BVTA 4JM2D 2NW3A 3NZHL 1H8NA 3OB0H 4BH7B 1HXMA 4GG6F 4PRPB 3QNXB 2AJVL 2A73A 3M1BB 2NY0B 5EA0L 1E4XI 2B0SH 3B6SA 1SMAA 1VEMA 3MR9B 4OGXH 1QRNB 3HZMB 1DJSA 1C5BH 5FHAL 4HT1L 4Y5VA 5AYQA 3DPBA 5GGVH 1HNGA 4QHMA 5FUZL 4F7CB 4UOW0 3FQNB 5D7IA 3E6FB 1F8TH 2F5BL 5EPMB 5F9OH 1CD1B 4HFWB 1C16A 5FA4B 1RHHB 3IDJB 2OL3L 2AJ3A 4TSBL 1MFDH 4UU9A 1CF8L 3MZTA 2VOTA 1X5XA 3WUZA 3BI9X 4M7ZC 2X4QA 5ACZB 1EBPA 4JKLA 2AK4A 4PJXE 3QUYD 4NKDB 5DQDH 1RZIA 4NC2B 3UCRA 3ULUE 4RNRA 3UEZA 2NW2B 5EBWA 1B88A 3MLXH 4JRYB 4L3CA 2YD3A 4Y19E 1I9JL 1UCTA 4CN1A 3VWKB 4K8RD 5E2WL 3VD9A 5EFIA 4DGYL 1F6AB 4BKLB 2IALA 3VXOB 4G8IA 1MFNA 1NBVL 3D0LA 3MFGB 5LWYH 5GSVB 3OG6B 4ONHA 4P2RE 4R3SA 3QQ4A 2AW2A 3QEQB 5GZOC 3SKMB 1JGLL 4X7CC 1S9YB 1D9KD 2VDLL 4WCYH 3VXRB 2OZ4L 1XZ0A 2ZUSA 4PRHD 3MCLL 4TULH 5IB5B 3ULVE 1BOYA 5I8CA 3FN9A 2ZOLA 1F6LL 5E6IA 2CDEA 5K9KB 3UTSB 2GK0A 3MXVH 2DLIA 4FFYL 4XWGL 4UQ3B 5E8EB 1S7XA 4JFFB 3L95A 4MAYB 1Y6KR 5CD3B 2EYSB 4XTRC 2W9DL 3QISA 4P99A 5DRNB 1ZVHA 4XP9H 3FJTA 4OQTH 4RFNB 2HJKB 3L5IA 1KJ2H 5I15L 2BCKA 2GFBB 4QRPB 4WNQA 2DD8H 4KROD 4AEIL 2ZUYA 4QTHA 3KYKL 3D39B 1IEAA 4AIZB 1KCVH 2Z31D 4NO0B 5DEGA 3T77B 3DOSA 4XP4H 1WUNT 2ZJSH 1IM3A 1T7WA 1Q8MA 1RUAL 5HDBE 3REVB 3SKUD 5IB1B 5E8OB 4X6CE 4HWUA 1WZ1H 3TZVD 1KXTB 2V17L 3PXJA 1CL7I 1YNLH 1T7XA 4HCRL 1DBAL 4Y16C 1MRFL 3KHOA 5FUOH 1KLFA 1N59B 1AGEB 1YEJL 2NXYD 2XWJB 1T0MA 4AYFA 2JK5A 2KL6A 3NPSB 4OLXH 3UTOA 4DW2H 2XKUA 4XPGL 3VH8G 4N0UB 1PGRB 3KPMB 4IOFC 4TSCL 1GVIA 1LE9B 1BQUA 1A2YA 1IAMA 4G7VH 3GZKA 3DO3A 5B38B 5KVFH 3IJYA 3OAZH 3SDAA 5CS7A 5DF0A 5F72S 2B5IC 1JGVH 3NABL 4UT9L 1DN2A 4FZEL 1NGXB 2DL2A 4N5ED 5HHVH 4D9LL 4HKBB 2LQRA 4XCNA 1RJLB 4C56A 4Q9BA 3KR3L 3SJVB 5GGVY 4JVWA 1FZJA 1I1YB 1BZQK 2R0LL 1CZ8H 1U8NA 5EU4B 5JDJA 2AJXL 3MV8D 4PREA 43CAA 1NKRA 4Z0XB 2OR9H 2EH7L 1A1OA 2X1QA 2HN7B 5L2JB 3FQRB 5SWSD 4LK4A 4RMRA 1EGJA 3I6GB 5IB3B 3VG9B 5BOPA 1WIOA 3FO0H 2O5ZL 2AEPL 2NY3C 2APVA 2WMPA 1YMMA 2G5BB 2X05A 4YXLH 1IKNA 1T1YB 3ULSA 4J6RH 5HD8D 4HKJA 1N64L 1CWVA 2W60A 4MJ6A 1CQKA 3QCVH 3DGGB 3NFPA 1RJYB 5I2IA 3GI8H 2DJSA 1JMZA 4EI5A 4Q9RH 2Z35A 3ECBB 4X80L 1HXYA 4Q97A 2M1KA 1I7UA 1I9EA 4I3SH 2VQUA 2VDKL 3BKJL 1MFEL 1D5MA 1MUJB 2VLLA 1Z9MA 4M6MH 5CP3H 4TUOB 1KN4H 2JTDA 2OQJA 4PLOB 2NY1D 3PWLA 3MRDA 4TN9A 4WI2A 1WJ3A 4E42A 1IM9B 3KLHD 1U8OA 2FEDD 1AJ7H 4YGAB 5FEBA 5FYKL 4NN7B 5DJDB 3JV6B 3LEYH 4IS6A 5F1NA 2CUMA 1BHGA 2HFFA 1ZLUK 1NFDF 3OSKA 4L29B 1UQSB 3QULA 4F3FB 1TCRA 4Z7WE 3DRTB 5IVXB 1RUPH 3H7BA 4JJ5A 1RZ8A 4JCMA 3T2NH 4XX1E 1W0VB 5L0QB 2NCMA 4FXKB 2DF3A 2KH2B 2CLVA 4ODSL 4YXKL 1S8DB 4KUZH 1G7QA 1G6RA 1QSFA 4PGBA 1A7NL 1I9RL 5M94B 1LD9B 4ESKA 1BM3L 2Y23A 4K7FB 3LQAH 2BVUA 4NP4H 3WUWG 2DOCA 1FL6B 4NIKB 2H6PA 4WHYH 2FX7H 3KXFE 5D70L 2ZCHL 1LO0H 3HZVA 5I6XC 3UDWC 4HGMA 4R2GB 1J0YA 4NUJA 5DRWA 5ESQB 4GRMB 2CPCA 3RDTD 2VXSL 4CMMA 5ETUB 5ITFA 2GITA 3RZCB 4NQEE 4NBXB 2G75B 4JQVC 3WO3B 3GSVB 3M17A 5TQ0L 5IGXL 3FRUB 4RMQA 4M9OA 5B4MD 3U4BH 1T0PB 5D93C 3ARGC 2R2EA 1NC4A 2CMRH 2DMKA 4XNUH 1H3GA 4PJAE 3WN5B 4KY1L 2NLJB 3CLFL 5C0AD 1XF4B 2BSRB 3QXAB 4IIQC 3DV4B 3PWJA 4PJEF 4NC1C 1VFOA 4DUWA 2A6KA 3KS0J 4FXGB 5DJYB 3RWHB 3UTTA 1CQYA 1MI5A 1T7VA 1Z0NA 2XOTA 1WBYB 4R90H 2XTJD 4JPKL 3MV01 2VDRH 3C6LC 3VGEA 1IEBA 3G6JF 1RHFA 1U92A 5D2LA 4HPYL 1JNLH 2DI7A 2AKRA 4YFDB 4HIXH 4BFEA 2NXZC 2VZSA 4G9FE 2VXUL 5EOQL 2RFXA 3VFRA 2V7NB 1JCKA 1ZWIA 3BJ91 5E8NA 2ARJB 2RCSH 1QSVA 4G8GB 4GBXA 2CQVA 4XT1C 4OGYL 2HRPL 1WITA 2GJ6A 1NBZA 1DFBL 2P4AB 4YFLF 5DA4A 3N06B 1EBAA 5E5MA 4EUPG 4WW1B 4LCUB 3TO2A 3VFSB 2HMID 3HTLX 3DETD 4OZIE 1WTLA 4X9IA 5GS1C 3P4MA 3E1F1 4OM0H 2HJLB 4NO3B 5H2BA 5KSAA 2K3TA 2YBRB 2IEPA 2FATH 2F53E 1NGWB 5E2TH 3RWFB 3ES6A 4O4YH 2LU3A 3BO8A 4WGVB 5GGTH 1KFAL 1XGRA 4GRLD 3TBTA 3O3UN 2FHBA 4ZUTB 1A8JH 5LJYH 4K8RH 2PTUA 3WJLA 1JGEB 4YHZH 5D5MA 4HUUB 5EZIH 4EXPX 4ZUWA 1R24A 4F7TB 3F12A 3MROA 1K4CA 4WY7L 3GBLA 1BJ1J 2P8PB 5FKPA 1KIPB 4KI5E 5HVWA 4UDTB 4IOIA 5T3ZL 2DTML 3OZ9L 2KZWA 3QRGL 4IMKA 4X6DB 1WZKA 2AEQH 3MLVL 3RWCB 5CLTA 4QXUL 5F7DA 4EN3A 1GHFH 2X70A 4LAQH 5IT2L 1G9NL 3VGGA 3P9MA 5SWZE 3MUJA 1F00I 1CFNB 1IGML 2I9LB 1EDQA 4JFED 1SYVA 2MWCA 1U3JA 2E9BA 3D2UB 5EBLA 2E3VA 2I9TB 1ES0A 3H3PL 3HMXA 3W9DA 4QT5A 5IQ9B 2DMCA 2D03L 1HQRB 1PKOA 5I8OH 1YECL 3CFJA 4MXQC 1TZGL 3BQUC 1P84K 4ODWB 5ADPH 5T33L 1A7RH 1LP9F 3S5LB 3LH2L 3SE3C 4DOHB 3IF1A 3H0TB 5INCA 4G6JH 3EO1A 1ZV5A 3SKJH 1IJ9A 3BSZL 4MZ2A 1FGVH 1IGYB 1R0AH 1AKJB 4G43A 5MI0B 5TE4L 4QLRA 4XVTL 4FOMA 1RIHL 2DDQH 2FO4B 5E6YA 2Q7NA 5KSBF 3VE0B 1UEMA 3BAEH 3BZEB 3TGXA 1I7TA 5J6GA 1Q9WA 5DQ9A 2Y6SD 1BREA 3MRMB 3T8XB 5AD0B 3OKMB 3BGMB 5IMOA 4OAWB 3MUHL 4YO0A 5KSVA 4N0CD 4TNVF 5C9JA 3VFUA 1KPVB 2VIRA 1H9VA 3GSXA 4F9LA 4XNQB 5ID0A 4N68A 2BSSB 3VI4F 4W81A 1GH7A 1YEFH 4ZUVA 4IDJL 4LLUB 3ABZA 4LKXB 1TXKA 3IS1X 1MHCA 4NZRH 3MBEA 32C2B 5SX5K 4GKSB 1Y6NR 4RMVA 4OF0A 4KWUA 5AZEH 5DMKA 4ZSOA 1O7VA 2OM5A 3DTXA 4NQDD 1L6ZA 4UMGA 3RTQA 4E41A 1NCDH 2FYYA 3ZTJH 1J1PL 3PXHA 3DO7B 1AXSA 3FOMA 3MFFB 3QXUA 4AENA 2ADGB 4MJ5B 1MCFA 4YK4B 5AZ2H 4X4YB 2YUXA 2KBGA 2X41A 1EFXD 4UIMA 4WJ5A 1OP3K 4YFEA 5DSCA 3QAZB 2DLFH 3T3PF 3WO4B 5SX4I 4U1MB 4AT6B 1T21B 3I6KB 2J8UB 3B5HA 3PQYB 3SE8H 1RD6A 4LSSH 4OSUH 4ODXB 3EOBB 3CCHB 3QPXL 2Y7QB 5CSGA 4AQ1B 5FK9A 4JFYB 4KJPD 1O0VA 5IF0A 3QUXB 3IXTB 1OT1A 4NBZB 5EO0B 3IGAB 1C7SA 4ORGA 4LHQB 5GZNC 1J88A 1U95A 1QHOA 1WT5A 3HMXL 5FYKD 4RISH 4KMTL 3OKOA 4QWWC 3TJEL 2H3NA 3BP7B 2QQLH 4PGZA 4MA1B 5IROC 4NO5B 5F44A 1QP1A 4NSKA 1X5YA 2H26B 4QRTA 2BY3A 4WWKB 3VFWA 3HZKB 5GSRA 4XBGB 3SDCC 3V5KB 1E27A 3VXMD 5I1GH 4G80A 5HBBA 3HNVL 3WLWD 1U8HA 1N5AA 5IB2B 3MJ9H 4PD4K 1BQSA 1FJ1A 3WNNA 4Y1AE 4HKZB 3UO1L 1R5IA 1KJVB 2RBLA 3E3QC 1KELH 3P11L 4MNQB 1P1ZB 2AXGB 1KB5A 4V1DB 1JNNH 5T5FL 1N6VA 5F3BA 4RFEB 3CFBA 1AXIB 5IEKA 3S35L 1G7LB 4LPYA 3MQIA 5A40E 5JHLL 1URLA 5IJKA 4HUXB 3RUGB 2VAAB 3TBVA 4GMSH 4I77H 3CVIL 4KUCF 3FT4A 5E8DH 3WS6C 2DQFA 1CLOL 3DX9B 2XN9B 3LS4H 4WFED 2QR0B 2GSIB 2BVPA 3ARZA 1LMKA 3QQNA 3U36A 1MVUB 3B9KB 3P77B 2J5LB 5F8QC 1JRHH 1HKFA 4JRXA 2V2TB 4M48H 3QXDB 2YMXL 5I8EA 3MXWL 5FO7B 4GMTL 1YMMD 1UJ3C 4PS4H 5CUSL 1QRKA 3OR7B 4PJBB 5GGRA 4H1LA 1KIQA 1P2CA 2X09A 3GSOB 1OCWH 4IRJC 1Z5LB 2XNAA 4XAWH 3NZHH 5CD5D 4MD5B 3QNZB 4LPUA 3LV3A 1CICC 1OPGL 1MRDL 4BELD 5C0ND 2WIIB 4NQSA 5EA0H 3DURB 1X5LA 2HWZL 1FVCA 4OLVL 1FFOA 2VLKE 4QRQA 3KPTA 2NX5E 4P46A 1DZBA 4LPTA 1NC2B 5FUZH 1FYTA 2NY2C 3DYOA 2CUIA 2NYYD 2X4OB 5FXCH 1WV7T 5JQ6L 1P7KB 3GSWA 4S2SB 1EAPB 1A4JA 4IRZL 5TDPB 3JV4B 3BGFC 4MNGE 2ZCKH 3O11A 4TSBH 1DE4B 2VZ3A 3DUHA 5I8KL 3VGAB 3QQ9C 1WCBB 1XCQA 5C0BA 4KK6D 3L3HA 4HK3N 4J23A 3WNLA 3NCCB 2Q76A 3QEHB 4CRPA 2UYLB 5D7JB 4HK0A 5BV7C 4ELMB 1S3KL 4G6ML 4CVXA 4LCWE 3CX2A 1T6WA 2EDFA 5I71C 3LIZH 4RMSA 2W38A 4JFHD 2EDOA 2VLRE 1I9JH 2IJ0C 1ZS8A 5AWNH 5E2WH 4H5SB 4LQ1A 1BBDL 4DGYH 3L3JB 4QGTA 1NCAH 1XGUB 2A2QT 1NBVH 1YMHA 1MLCA 1NUGA 1YEEH 2B1AL 1X3DA 3AAZA 4JFQB 2BSTA 4Q58C 1LEIA 5DWUL 3MJ7A 4CGTA 4UV4L 5C07A 5IBTL 4FQ1H 4HDIA 1JGLH 1A64A 3GO1L 2R4SL 2VDLH 1FO0L 1INQB 4DVBA 3BHBA 2DB8A 1L9MA 2FZ3B 1F4HA 3QI9C 2OZ4H 3RVVC 3VA2C 4ETYA 1UKQA 3FL7A 3MCLH 4GAFB 4LGSB 4L4TA 4UILL 4P23B 4LP5A 2A83A 3ZKXC 4PV8A 1R5WA 4CNIB 4ZFGH 4F9PA 4KVNL 3GRWH 1TLKA 5HGDA 1GAFL 1JN6A 3MRJA 4FFYH 5EUKA 4F37K 1JPGA 4HPOL 4LSUL 4KAQL 1DDHB 4ZUSB 2CDFA 3IAGC 2EO9A 5I15H 1GSMA 1VHPA 4IRSB 1TITA 2IMMA 3VW3L 4WHYG 43C9B 5KOMC 3UBXG 3IU3B 4PRPD 4AEIH 4I4WA 1P69B 4LCIL 3NACL 3KYKH 5J1SC 4PJ7F 5INDA 4OCYH 5KS9A 3BT2L 2O5YL 3T0AA 1RUAH 2ADJB 1QRND 4ODVL 3ZHLA 4JDZA 1XIWC 5IBUG 6FABL 4HCRH 1DBAH 2G9HA 3DUSA 3P0VH 4EOWL 1MRFH 4PRBA 5ALCL 4L8SB 1R5VB 2D7MA 1W0YT 1HDMA 2ZKHL 1KTDA 4YHYC 1YEJH 2X4PB 3KWWA 5MENB 3C60B 4NQXB 3DUUB 3ZO0A 4PJFA 1JRHI 1W0WA 2GJ6D 2HG5A 1YC7A 3B9EA 4XPGH 5C8JA 4Y4KB 4M00A 4JREC 4TSCH 4U1SB 4PJ5A 4ODUB 4PGDB 4AM0B 3QIUB 3TC9A 1UT9A 5BZWA 4HGWB 5KZCB 3T0EC 4EVNA 4UT9H 3NABH 4D0CA 2XWBA 3LB6C 3QDMB 4JRYD 2CGRL 4D9LH 2ITDB 4PJHF 2W9EL 2N56A 3MV9A 3D3VE 3L7FA 3WXWH 1WEJL 4POZD 4HW6A 3KR3H 4K94C 5DUML 1EO8H 1A6ZA 4PJCF 1BD2A 2VABA 2R0LH 3C5SA 1OSZA 3L3IA 2ZSWA 3KPRA 2AJXH 3RWIB 3W39B 2XY2A 5EO9B 4Y4HB 3PJSB 4JY6B 3HB3C 2MCG1 4DVRL 1H3TA 2EH7H 3S37X 5JMOC 4P2OB 2HKFL 2ZPKH 1FRGL 1PKQE 5T1MA 2E5EA 3EGSA 3QEQD 3VMPA 1QSZA 2O5ZH 2AEPH 5FV2A 3S8WA 3I02A 1V5JA 3VXRD 2FR4B 1FG2B 1Z9SA 3HRZA 5E5RB 1N64H 1M1SA 2E7HA 3HE6A 2A1WL 4U1IA 5KVDL 4P2QA 4G42B 4X80H 3MOQA 2E6PA 5L88L 5D96C 5C0CE 3UTSD 2HLFD 3OG4B 3CIQA 2BVEA 2YWYA 4CVZA 2EXWD 2V9RA 1ZLSL 4JFFD 5GHWH 3O3DB 3GMLA 1D6VL 3IDIA 4HULB 5E2VL 3VXUE 1FPTL 1YNKL 4QNPF 2Q86A 3PWNB 5EC1B 2QL1A 3G08A 4OV5A 4HWZB 1GC1C 5CP7A 2YPLE 3MRQA 1UM6L 2GKIA 5FYKH 1BECA 3D39D 1BJMA 1I8MB 4EDXB 3X14A 4NO0D 4S0TD 5MEPA 3HNTL 1NAKH 1T1ZA 5HI4D 1QSEE 1QD0A 1CDYA 3EYSL 1YEHL 5HYQA 2YD9A 2IAMA 4XVUD 3OKKA 3EOTL 4ZS6D 3QDJE 1VFAB 4YQXL 1QLRB 4UB0L 4ODSH 2C5DC 4YXKH 2ADIB 2BY2A 4DN3L 1A7NH 4P57A 4QTIL 5CEZL 4NUGL 4P2RB 5JTWA 1BM3H 3FOLB 4X5WB 1AD0A 1DEEB 2ADFL 3IAQA 5EZOL 2JB6B 4BSWA 1OQOA 5D70H 2ZCHH 1W8NA 4MZ3A 5FGSA 3ZL4H 3WIIH 1ZHLB 1BQHB 5IFHL 1SBSH 1L7TL 2NTSP 3SGJC 3BKMH 2DQGH 4O51B 1OLZA 3BP4B 2BXZA 4MS8C 2FB4L 3GBML 4FQXB 1CLYL 4K3JL 4JDTL 3MBED 3UAJC 4JDVB 4ZD3H 3T0DA 4U6XB 3FRPG 5JORA 5IGXH 2CJUL 2X4NA 1RZFL 4YHKL 4E41D 1U8NB 5I9QB 5ISZE 2JJTC 2HLAB 1QR1B 4JHBA 4EQ3A 3CZFA 3QH3B 3RY4A 5CEYA 2P49B 3IKCB 3TH2T 1NGPL 4KY1H 3CLFH 1CFSA 4PP1D 4FFVC 5CMAB 4ZFZB 1N2RA 4JFOB 4ZXBA 3T3PE 4X6CB 1L0YA 4JFXB 4JQVA 1L0QA 4HKJB 1S9KC 4OZGF 2BK8A 12E8H 4U0RC 3GMQA 1M7XA 3GUTB 2Q20A 1QFPA 4JPKH 4YHPB 5D7KD 5HVGB 2VUYA 4GG8B 1Y0LB 2EDDA 3DVNA 3L9RA 1AHWB 1FL3B 4WIQA 4XCYA 5ICYB 4YHOL 4MQSB 1OAYL 5CEXA 4HPYH 1BEYL 4L1DA 4P4KB 1R3JA 3RVWC 1IM9D 1QPXA 1EHLL 2ZUVA 1I1AC 2E8YA 2MCPL 1F6FB 3STZA 4JQIL 4IIQA 2AJZB 5IMMB 3H2WA 4IEFB 5BW7C 4OGYH 4PJDA 1KBGL 2HRPH 1BF2A 3ZTJG 3CPLB 1TNNA 4X5LA 1MFCH 5HHNB 5C09A 2XKNA 4U7KA 1AGBA 5F88B 1DFBH 5K9QI 4PRDA 2JCCB 3LZFH 4OLEA 5E24E 4PJ8B 5E94B 2UWEE 5HYSG 2V9TA 4ZFOL 3FQXA 4U1GB 1I3UA 5JXED 1LHZA 4KRLB 4K3HA 3JWNC 4XXCA 4ZO7A 2E9IA 1D5ZB 4HJJL 3P9LA 4LF3B 4I3RL 4JO1L 4XP6L 5T3XL 1U8JA 2FIKB 1TTUA 3FB7B 5FO8A 4WY7H 5IW6B 4R2GD 2COQA 4FXLA 4JFDA 4RX4A 4LMQE 5GS1A 4LGRB 5E1HB 4PG9B 2DTMH 1DANT 1UXWB 1YEGL 5EUOA 3BYYA 3QRGH 2MSPA 1I4FA 4N5UA 5CHNA 3QIBB 1JHLL 2YD5A 5J13B 4CN4A 1CE6A 4KRMB 4R26L 5IT2H 1G9NH 2H45A 3V4VL 3Q5TA 3M17B 1FL5A 2GAZA 4PGCA 4N90E 1TVHB 4KKBD 1RY7B 2I07A 3IDGB 4YH6A 2PW1A 3ZKMC 3EAKA 1N0XH 1IAOA 1F45A 1WK0A 3H3PH 2EEDA 1C8PA 4MD4B 3SGKC 3F7RA 1YECH 1I9IH 2NY4D 4F33A 4KK5C 4Z7WB 4JN2B 3U7WL 5MEOB 5T33H 2BVOA 3BYTA 2VDQL 3BW9B 4X7DC 5JLZB 2EKSB 3O6KL 1JZ7A 3OKEB 4NM8L 5FF6B 1JK8A 1PSKL 1S7UA 4GKZA 4M8QA 4NQVB 4U0QB 1U8MA 3V6FB 3BSZH 4NM4L 4JKMA 4MAUL 3D48R 5CJQH 5TE4H 4WGWB 4XVTH 1RIHH 3RQ3A 2P5WA 4N1HB 1LEKA 4OKVA 3H42L 3LPGA 5IMLA 1FYTD 3PDOB 1GZQA 4G8GD 1SEQL 4Z5RA 3MLPA 1PG7X 3KXFB 1U93A 3DIFB 1F3DH 2EDJA 1MHEA 4KK8D 1NKOA 5HGBB 1QLFB 4N9OB 3TFKC 2OCFD 3TVMC 2NY7L 5JPNA 4GS7B 4NQEB 3NFNB 1YY9C 3DX7A 3CFEB 2B1HH 3IJSB 1K9TA 1A6UL 2ATPB 1OD7A 2EIZB 4IDJH 3A6CL 4KXZH 5TDOA 3OJVC 1D6EA 1I7ZB 3AXLB 4GRWE 4NT6A 3K46A 3ORJA 1M7DB 5DZNA 1MIEH 3WLBB 3MUY1 1ZLWK 1BVZA 3U46B 3G6DL 4PJAB 4OT1H 4PG2A 3BE1H 5EOCJ 1CG9B 4HIEA 4J3VA 1KIRA 4NKOB 4O00A 1J1PH 1CFTA 2R1XA 4X99B 1KC5L 3R0MA 2KDGA 3ARSA 3KGRA 2C3VB 3EYOA 4GW4B 3VFNA 5EBMB 3WKNA 1SHMA 4EKXA 3PWVB 4Z77A 5EU3B 4MMZC 3KPSE 3BKYL 2NY5H 4BH8A 4R7DB 2GUOB 2QKIA 5KANG 1T0NB 4L4TD 4G9FB 1FZKA 4I9WD 4NN5C 2I26N 3FB5A 3QG6B 4PY7B 5DJCA 2IPTL 3U6RA 3QPXH 4MDIB 3T0XA 2P5EE 1TZHB 4MCZA 4K3EH 2OI9B 4MX7A 2XZCL 4DQOL 4X7SH 3EYQD 3U4EA 4QRRA 1VFBA 3FQTB 2W0FA 3E3QE 4RIRB 1G1CA 3TT3L 4DKFH 5B8CC 5GS0C 1TETL 3GGWA 4OCXH 5HGAB 3EOAA 1YEDA 3GMNB 4OLZH 4C55A 2HT2C 1PW3A 1VERA 3MPCA 4KMTH 4WHCA 1HIML 4OZIB 1AD9A 1BFOB 3F7VA 4MQ7A 2AP2A 3QNYA 1N0LA 5FYJE 4Y19A 2F53B 4JZOB 1AKJD 2YZ8A 2EIEA 5GQBA 5CZXD 5GGSA 5DJAA 3BUYA 5BQ7A 3HNVH 2CKBB 3FQWA 5IHUL 2VL5B 3RY6C 5CEZD 5KVEL 4G8EA 1T1WB 4RGNE 3UO1H 4ZNEE 2OSLB 1J05B 2HP4A 1ZHBB 4Y5XC 4XZUB 3MNVA 1CD0A 2X89D 3P11H 4N8VG 2VWEC 4H8WC 3PDGA 3WEXA 1WWAX 4KJQC 5T5FH 1AC6A 5HGGS 5JIKA 4LSQH 4PJ5D 2P46B 3S35H 2B4CL 4L4JA 1IL1B 4RGMC 4XWOD 3QDAA 5IVOA 3SDCA 1I85C 1JZ4A 4RSVA 3CVIH 3G5YB 4PJHE 4LL9A 4PB9H 4O5LH 2YXFA 3JUZA 2OP4L 1FNFA 1BZ9A 1CLOH 3V6ZA 5ICXB 1IGJB 5ESAB 2P1YA 1C1EL 4NPYA 1X6LA 1MY7A 5E7FA 4FFWC 7CGTA 1C5CL 3K80A 1CGUA 1FORH 1S7VA 4P3DB 3TP4A 4JPWL 1T80A 3MXWH 2YZ1A 4U1HA 4GMTH 3P0YL 5CUSH 1BMGA 3QUKA 5IKCA 5I19L 1NUFA 3WS6A 3HE6D 3MGTA 4PLKD 1T1XA 1DQLL 1JPSL 5A1AA 1QEWA 1BWMA 3I75A 4URTB 3P73A 4D0BB 1OPGH 1MRDH 2LU4A 1C12B 1EEYB 2I60L 1G7JB 1DN0A 3BZFA 3CFIC 3HCVB 2HWZH 3ZDYE 1NBYA 4OLVH 3QUXD 3CAFA 4NO2A 3OPZH 2Z8SA 1IAKB 2HVKA 5JOPE 3Q6GL 5FDWA 4HUWA 1UJ3A 5HVHC 3RHWF 1UWEL 4CJ0A 4ORGB 5TQ2L 3TBSA 4IRZH 4XRCB 3BDYL 5FKAA 3P4NB 3QDGB 2MQCA 4WI4A 2IG2L 3W5MA 4WWKD 3MUZ1 2IAMD 3EO0B 4FQQB 4L9LC 1KB9J 1CFQA 1S3KH 4G6MH 2DQUH 5FA3A 3GIZL 1K8DA 4QHNB 3U0TA 3CSYB 3OL2A 4NNXA 3CD4A 1L6XA 1RULH 1NCTA 2X4TA 4BFBD 5HI5C 4V1DD 5T3XD 1INDL 1IGIH 2HJFA 2R1WA 3QFJE 1J8HB 1BBDH 3OF6D 4FN0A 4M1DL 2NTFB 1ZA6A 2PUQT 3DECA 3O81A 2B1AH 3G5ZA 2Y72A 4LBEA 3WBDA 1RIVL 2X4UA 2FSEB 4Z7UF 3MCG1 3HC3H 4UV4H 5HGHB 2V2WB 4U7SA 1JWMB 3GO1H 4WI5A 3ZT7A 4DFHA 1FO0H 4MWFB 4X0KA 3VFTB 2XN9D 3NH7L 1WSST 1HHHA 3SDDB 4WUUA 4UILH 1I3RB 3PL6B 2XY1A 3QUZB 4KVNH 3ZYOA 4YDVB 3FO1A 5C0IA 5DFVC 2E7LA 3W0WE 4P9HL 5EC2B 3ZYZA 1HWGB 1NGZB 4S1DD 2PYFB 1AQDB 3PP3H 3VW3H 1DBMH 4ZXBD 4OZGE 4NCC2 3ZTNH 3V6OE 3IVKA 1T7ZA 4LCIH 3NACH 3CSPA 3VWJB 1NGYA 5T1KA 1U8QA 3EBAA 1YEIL 2YPVL 4TNVK 2O5YH 4TTDD 2BFVL 2PO6B 1BOGA 4ODVH 3S98A 4Y1AB 5EOTB 5T1LB 5C92A 6FABH 4MD0A 3OBAA 5F1SA 4EOWH 3O6FA 4NCC1 1JVKA 5ALCH 2ZKHH 3DV6A 3T1WA 1EMTH 2VLMD 1E28A 4XI5C 5D9SB 1R3LA 1XH3B 1IQDA 1OF2A 2PTVA 3GMPB 3JTTB 4XCEB 2W0KA 3D18A 3WSQL 5D1XC 5CJ5A 1CTOA 4XNXL 4NOBA 5DMGD 4YBQC 3PV7A 1LEGA 5D7JD 4ODTL 5ABDE 2V5RA 3MA7B 1TJHL 3PWUB 4P5TC 1KPUA 5D7LA 4O2CA 5CGYC 4XMPL 4WO4B 2CGRH 5IEHA 2Z91A 4FTVA 3C6SB 4PJIF 1WEJH 5ESVA 1XGQB 2C7UA 2V9QA 5DUMH 4HEPG 3KLAB 5HJ3A 3LKOB 4GW5A 2GTWA 4HMEA 1MHPL 5F7NC 5LGHH 5C0GB 4TOYL 3GMMA 1B3JA 3I6LD 3KS0H 3PWPA 5F7YC 2AJSL 3MRLA 3LKPA 4RZCA 4APQA 4O02H 3E2HC 4M93B 2HKFH 1UB6B 1FRGH 4LLQA 5BZDB 3T0EA 4YPJA 4JFDD 4LLVA 4RX4D 3AAZB 4QEGA 1MRCL 4DK6A 3STLA 5KVDH 3AY4C 3IRZA 2VLKB 1X5ZA 4P23D 2NX5B 5I30L 5L88H 3L6FA 3W11C 3ARBA 4GH7B 2XFXB 1NL0L 1OSPL 5EN2B 5J3HC 4PRIA 1WVZA 1ZLSH 3MYZA 2A83B 4U1LA 1HYRC 4JM4L 1I8LC 1D6VH 3DVGA 4OTXL 4J3UA 5F7WC 4DCQA 1YDPA 1JIBA 1FPTH 4MNGB 2DKMA 2QQNL 1YNKH 3TWCL 5DHYB 2SEBB 5DRZA 2BHUA 4U1NA 2JIXA 2WNGA 3V95A 1UM6H 3RA7L 2A6DB 5DO2C 1FZOA 3LMJL 1QZ1A 4LCWB 1Q72L 3X12B 4PJ9C 1NCCL 5F9JA 1DL7L 4I4WB 1MH5A 4KQ3H 4OD1L 4M5ZH 2F74A 2NZ9D 3FQUB 3EOTH 4YQXH 1NQBA 5MEND 1CIUA 4PPTA 1FZMB 2P5WD 3F62A 1JFQL 2L7JA 4YBHA 5ACLA 1A4KB 4X7EC 1SBBA 4ZNCD 4DN3H 4L8CB 5DJZB 4QTIH 5CEZH 4NUGH 1W72A 3QQ3A 1A7PL 4O58L 3SDXE 3UJTL 4P5MB 4Y4KD 1BLNB 4Z7QF 2ADFH 5EZOH 3HI1B 2HVJB 4D3CL 3NCFB 5KZCD 1X5HA 1P6FA 5IFHH 1L7TH 1AO7B 4KI1A 4AJ0A 2ESVA 5H94B 2VE6A 1GZPB 2FB4H 4WFHE 4Y16B 4K3JH 1CLYH 4JDTH 3LQAC 2CSPA 2X4RA 4DWHA 3BPCA 5CSBA 3LQZB 1K3ZA 5ALBL 4J3SA 2EZ0D 1MJ7L 3ARDB 1HEZB 1HYSC 4JZNA 4Y4HD 1ZGLM 1CGSL 4YNYB 3RPIA 4D8PA 3KPRB 1F3JA 2FLBT 4GG6A 5BXFA 1OTUC 5EZJA 4F7EB 4V2CB 3SGJA 3HLAB 2HFEB 1MJJA 2LVEA 5T5NG 3KAAA 3U4AA 2PETA 2EC9U 4JB9L 4B0MM 2H2PC 2BNUA 4EI6B 1S9WA 2C3HA 3E6HA 3LHPL 3SKNB 1A7BA 4K94L 4XAKE 1QKZL 4YDJB 4ZQKA 4YHOH 4GAJL 3A6BH 1OAYH 1TDQA 4B7LA 5E9DE 4CVZB 1BEYH 3TNNB 2E27L 3KNBA 4AH2A 4M1CC 1JPST 1EHLH 4JM2C 1BZ7B 1WFTA 2MCPH 4LLWB 4QOKB 4B41A 2NY3B 1Z2KA 1BX2A 1LQSR 1D5IL 1KBGH 3HPJA 5CP7B 3ULUD 1MJ8L 1NDGA 3C5JA 5DQJB 4KZEL 1I8KB 4JY4B 1RK1A 3RKDD 5C08A 4Y19D 3D3VB 3R1GL 2EXYD 4J8RA 1U41A 2DQIL 2X7LB 3U7YL 4NNYA 4N9GA 2CKBL 3CXDL 4KK9C 2J2ZA 1HHKB 4NRYB 1I1AA 4HJJH 1BBJA 4HWEL 1CR9L 2A9NL 5IMKA 4BSVA 5BW7A 1T83C 1PKQB 3IS0X 1GC1L 1RU9L 1W72L 4I2XE 3QYCA 4I3RH 4XP6H 4X9HA 3W5NA 5C0JA 2VDMH 5T3XH 3S88H 3QIWA 3V5DB 1MELA 2CR3A 3FT3B 4X83A 5FYJU 1RVFL 4D9QE 3QUYC 4BA8A 1SJEA 1MWAB 3EFDH 1PDKA 5C0CB 2ZCLL 3JTSB 4FQXD 1Q94A 4ZAKC 2DBJA 3F6LA 5DJ8A 1YEKL 4QHKJ 3O2DA 4K8RC 1JHLH 1U9KA 3U9PH 1X9QA 1U91A 3VXUB 2X40A 4R26H 3V4VH 4NQTA 4ENEC 5GJTL 4RBPK 3T04D 2APWA 2HTLD 3VRJB 3WNOA 3UTZA 3VFVA 1KG0B 3DROB 1CK0H 3N9GL 1BJ8A 3IDMA 4Z7VE 1D9KC 5I6XB 1QSEB 3ZE1E 4RA3A 1AIFA 2X2YA 4HS6B 5IVXF 4ETQB 1QFOA 3LKRB 1S9XB 1S7TA 1HK6A 2VDQH 1TPXC 3G6AA 3O6KH 2IH1A 3NZ8A 3QFDA 5DTFA 2YN3A 5B38G 4NM8H 1U8LB 5J06A 1T5WB 1PSKH 2VZTA 5C7XL 3DYMA 4WU5A 4NM4H 4MAUH 4WVRA 4L3EB 1DQQA 5GIRA 4J3TA 4IHOA 1NJ9A 1N7ML 4GUPA 3ARGB 3UZEA 5TFSH 1KF9B 2B2XL 1C5DB 2W65B 1V3KA 3EOYG 1SEQH 1R3JB 5I16B 2J88L 4KROC 3SGKA 4WUKL 2VQ1B 5L2KA 4JPIB 4KJWD 2Z31C 4LFHD 4LRIC 5D6CB 4RAVB 3T2QA 4NDMA 5EZLA 3TLRA 1C08A 2N4IA 3BXNA 2H8PB 2NY7H 1EHXA 2A0LD 3MRBB 3U0WL 5MP6L 3HRPA 2IPKB 4FQ2L 2BDNL 2I27N 3HC0A 3C6LB 1A6UH 5CJBA 3C5ZA 1NDMB 3A6CH 2NXYC 4HZLA 3EYVA 1AR2A 1CE1L 5C0FA 2FIRT 2NXZB 1PD6A 4P4RA 3MYJA 1F5WA 4O2EA 1IC5L 4X4ZA 3G6DH 4KTYA 4ONFH 3CVHA 4S10A 5CCKL 4CADB 3RWJB 1X5FA 1KC5H 3SCMB 4C83A 3H9HA 1UB5A 4JAMB 4OUOA 1ORQA 1UXSA 1NFIA 3MUGA 2EDBA 1CGWA 3PV6B 1FQ9C 4Z78A 3DHJA 3T1FA 4NQCE 2ED7A 3DRQB 3TN0C 5HPOA 5CBAA 2AI0L 3OXSB 3BKYH 4MNHB 3WFEL 5ERWB 2D4FA 4JZJC 4Y88A 3O2DL 1G7HA 2CXKA 3CUPB 4WUUD 1XGTA 4UZGA 1HQ4A 1IEHA 4LASL 5DC9B 2XZCH 3FFDB 4DQOH 2D7TL 1DEDA 2DKSA 1NFDA 5HD8C 3TT3H 4KPHL 2DQEL 1TETH 5J7CC 1QVOA 1WBXA 1KJMA 2V6HA 1FLTX 4MQXD 5I74B 5EIIA 1Q9KB 2UWEB 2YEZB 3MACL 3FB8B 1MOEA 1MIML 3C8HA 5T1KD 2P8LA 3PE9A 1PYWA 1RSFA 2VLRA 1A0QL 1IC7L 2PW2B 2A6IB 1U8MB 4RQQA 1UA6L 4K23L 2C1PB 2NY1C 4HJGB 1B2WL 1ULVA 1J5OL 2VSDA 2CDGA 3KLHC 5IW1B 5JPMA 3KXFD 2V2XA 5IHUH 4K9EL 2BNQE 5B8CA 5KVEH 5F96H 3RWDA 3BWUC 4ZS7L 1L0XA 1TQCC 4DTGL 4RA0C 5I17A 1QNZL 4QRSA 2YD4A 4BQ6A 4PR5B 3AS2A 4UTAL 3UPRA 5FOBB 3BQUB 5JNYA 1YY8A 1OTTD 4X6DF 1KT2B 3I9GL 2B4CH 3L3KA 2EYRB 4H0HB 1SEBB 1NAMB 1XF2B 1DQJA 1JWSB 1TVBB 4H1LG 2BNRA 1XCTA 4PJIE 3KYNB 5E1AA 4R6UA 1NCWL 2OJEA 3D0VA 2M26A 5DHVA 3AU1B 4H26B 1PZ5A 3HAEB 2WWKO 2ZSVB 4LHUB 4PJEA 4W4NA 1UG9A 3HI6L 3PG2A 1A6AB 3CVHL 1J0JA 3BN3B 3MNZB 3PHOA 3WCYA 5JDSB 4CW1A 3GIVA 4YHLL 3MCKA 4IMLA 1CLCA 2MPAH 3BVNB 1HSAA 2ENSA 3VA6A 3DWTA 3G6JA 3KDMA 4JG0L 5I19H 3NTCH 3H9ZA 1RIUL 4QHKI 4Y2DA 5TDNB 3U83A 4LAJH 3HR5B 2ORBL 5HHOE 5EORL 1CI5A 5B4MC 3MLTB 1QFWM 2I60H 5D1ZA 5BS0E 2AXJA 3L7EB 2UUDH 3QA3B 4JPVL 1B0GA 3MRFA 2DS4A 3VDBA 5DD5L 1NGQL 1B4JL 2V7HA 3D85A 4LLMA 1JNHB 3ZYIA 1BGXL 3Q1SL 2CIIB 4JRWA 5FIEA 1A6TB 3NN8A 4Y4FB 1UWEH 2QSCH 4UINL 1S7WA 2IFFL 4P9MH 5TQ2H 5J1AA 4FABH 3BDYH 3SPVA 2XTJC 4KV5F 1DUYA 5HXMA 3ULUH 5ANMA 2D0HA 2F53D 2IG2H 3OR6A 4OF6A 2VLJA 4MQ7B 1CYGA 5D6DC 4GRWB 1S78D 1PZUB 2H32B 4GQPH 4CDHA 4OCWL 1S7RB 8FABB 5ID1B 3VFPA 3GIZH 3JV5A 2YSSB 2ZG3A 2D7NA 1EVTC 5HYJE 3IFOB 3GJEA 3QP3A 4KI5D 4MHHI 1CCZA 4I5BA 5DUBB 3HZYB 3FKUS 2FJHB 3SKOA 1KYOK 2HMIC 3DETC 3KPSB 1QG3A 3A0OA 3PABB 2J8UF 2CRZA 3KPLA 3PIQB 1UH3A 4L9LA 5LAXB 2W0LA 1RIVH 5SWZD 4HAFA 1YN7B 1Q9LB 3LQMA 4YAQB 1A9EA 4GRLC 3CZJA 1H5BA 2P5EB 2Z93B 3G04A 4RWHA 1FFNB 4NNPL 1J87A 2ZUWA 4PV9A 3T4YA 3DBXA 1YNTB 2YPLA 1EXUB 2WQRA 4QRPE 3ROLB 1LP9A 4D9RE 3HNSH 3QZWG 5IB4A 3T2OA 1OWRM 5K9OB 3GNML 2EEBA 3QUMA 5DC4B 2VDNL 1JHTA 1T5XB 4P9HH 4JLRA 2VXQL 1QO3B 3IU4L 3F7YB 2VSCA 1FV1A 3MGOA 3IKKA 2DWDB 2APBA 3BWAA 1F02I 1OD9A 4LSTL 3QDJA 2WBJA 2DJUA 4S1RL 2FD6H 5KSBA 1X7QB 4J2XA 1U3HC 3D69A 1YEIH 2YPVH 1HHJB 2BFVH 3ZKND 3PGFL 3GSNB 3GSUA 2OTUB 5BRZA 1UVQB 5JHDE 4RGNB 5DZOA 3V7AE 2A9ML 3LN4A 4G6FB 3O4LA 3V8OA 4TQEH 1LNUB 1QLEL 4WI3A 4UT7L 1KPRA 5LBSL 2YR3A 1G0DA 3IFNH 1X5GA 3K0WA 2WWKT 3ESVF 4A2MA 4JHZA 1S5HB 3RUGF 4JG1L 3WSQH 3O41B 4IRJB 4XNXH 5A2LH 2DMBA 3SJVE 2CKNA 1CICB 1CDGA 3B2UD 5IOPB 5T1DH 3C09C 2BX5A 3KPNA 4Y5VC 1CT8A 1TJHH 1WWBX 4ALAL 4XHJD 4LSRL 5A2IH 1CFQB 1KJ2A 5ISZA 2Y6SC 3QBTB 3ARFA 4R4ND 3FAWA 2JB5L 2UV3A 3OXRA 4U1KB 4N0CC 5DJ2A 1FFPA 1ZHKB 1MHPH 3LKSB 4Z95L 4TOYH 1F97A 1ORSB 4C4KO 1IBGL 4NKMA 1RJCA 3BGFB 1A7OL 4PJBF 4Q9CA 4B53A 5C70A 1ZEAL 3F65A 1MWAL 3MLZL 3G5VA 1ZTXH 1SYSB 3JXAA 5GGVL 5ILTH 5DD6A 5E4EC 1OOAA 5F89A 1F8TL 5F9OL 3BISA 4LIQL 4PJGE 3GHEL 1YA5A 3SDDD 5JA9A 1H15A 5DVMA 3FHAA 5GGSY 1AGFB 3PL6D 3L5WA 3FB6A 4XGZB 3QUZD 1NL0H 1OSPH 4OFKA 4JM4H 2LU7A 5EG6C 4OTXH 2CK0H 5FCUH 5BVJA 2E7CA 5EB9A 3TWCH 4K3GA 3QUML 2PYEE 1FNSL 2C1OA 4NOFA 2WAHA 1PY4A 2ERJC 3U30B 3QWOA 5J0BA 4EIGB 3VWJD 4ELMF 1U8KA 3AY4A 3LMJH 1GYAA 5D2NE 1B0RB 4KKAD 1UWXH 3QI9B 2AV1A 1DL7H 1HOCB 2PO6D 5E0QA 4M7JH 4MA8L 4Y1AD 5T1LD 4ZG1A 3I84A 3AMLA 4MA7H 1F2XK 2WUCH 2FJGA 1OP9A 1FC2D 3ZKXB 1BIHA 1K4DA 2IQAB 3O8XB 1LDPH 3BPNC 5HPMA 1WC7B 1MLBB 4HAGA 5EU6E 4MDJA 1JFQH 1XR8B 3QFJB 4X8JA 1HHIB 4MJIE 4POUB 4LKCB 2W59A 1MCCA 4TULL 3UTPE 1A7PH 2ZUQC 4HX1A 4O58H 3UJTH 4HXAH 4X4MA 4F7PA 4PJ9A 3TBYB 5IIEB 4D3CH 3WFZA 3GB7B 3BIKB 4XH2A 3WLWC 3MV7A 1WZLA 5KVGL 1P5VA 4WO4D 2F54E 2EKJA 3C5ZD 3OJDA 1XIWB 4MMXC 3VD4A 2UZYB 1IRAY 5GGUB 4LNRA 1KJ2L 3S36X 5F1KC 4WEBL 4WI6A 2DD8L 5ALBH 3VGFA 1MJ7H 3VXSA 3AGVA 1J0ZA 1IT9H 1UACH 1YPZE 1YQVH 1A1NA 4XP4L 1G7PA 4YGVB 1KCSH 3W0WB 3DGCR 2ED8A 3TESA 3O3BA 4MSWA 4S1QH 1WZ1L 4JREB 4YEFA 1IQWL 1YNLL 2H9GB 3IJHA 1UYWL 2XQYK 3S4SB 1XEDA 1A6VL 3H9SE 2GCYA 3SGEH 2R39A 3MO1A 2VLKD 3RHWK 1LK2A 3UBXA 2P44B 4YLQT 2YRLA 3MRIB 1NEZA 3Q6FB 1WAAE 1M6OA 2GTZB 3FONA 1QKZH 1BF8A 4G7VL 1NCNA 3VXQB 4GAJH 3LSOB 2DM7A 5AYUL 2BY1A 3ARVA 2AXFB 4LVOC 2E27H 1JGVL 1T20B 4U31A 4NHCH 1IKNC 1YN6A 2IADA 1XFPA 2UY7A 1KCLA 4NYLA 3IFPA 4LCCB 5CD5C 4Y5YA 1G7IA 4LCWD 4PP2A 5C0NC 1MJ8H 2BOCA 2MJWA 1A9BB 2X4SB 2X9YA 5IM7A 1SJHB 1VADB 2VLRD 2WINA 5HY9A 5I1DB 2WP3O 3R1GH 4CUCA 2P7TA 4Y89A 4K3DL 5DD1H 4DZBA 2DQIH 4KRPD 2NYYC 2Q8AH 3U7YH 2XT1B 2CKBH 3CXDH 5J11B 3FAXA 4G8FB 2FRGP 5D1QB 2VKXA 4P5KA 4HWEH 4ISVA 2A9NH 2MKWA 4MHHG 3KYOB 1QPPA 1RU9H 1W72H 4KK6C 2VNCA 2DKUA 4ZPTB 2PXYB 1FGNL 1RVFH 3U2SA 4YHNB 5E56A 2JF1A 3P9WB 1YYML 4Z0BL 4OZHE 3K2MC 1U2CA 2ZCLH 3VFOA 1MF2L 3L3GA 1YEKH 1AJ7L 5JR1H 3MLWL 3ARDD 1S7SA 3T4AA 1KNOB 4X6BB 3MJGX 5KN5B 2Z4QB 4KU1A 2MFNA 2DLHA 3HE7B 1RUPL 4AMKL 4H0IA 4PJ7A 2K7QA 3SBWC 1P7QA 3N9GH 3ULUF 5JIPA 3OB8A 4HK3J 5IVZA 5GGTA 4BZ1L 1AGDB 4KZDL 1VKXB 1G9NC 1VENA 4EBQH 2YXMA 1ZHNB 2ZG1A 1EUTA 4M6AA 2ICEA 4QRUA 3DX8A 1JJUA 1F58L 3KJ4B 4IJ3B 4HUNB 2Y9RT 5C7XH 2Z92B 5D1ZD 4QHLB 2D31B 3PNWB 1LO0L 4X5XA 5JW4M 2O61B 1FNGB 2WWMC 3WHXB 1N7MH 1S9VA 5J1TC 1FVEB 3CNKA 3SDXB 1AY1H 4LRNL 2OTWA 3MREA 2B2XH 4RFOL 1D9KA 3VG0L 5DDHA 1I1FA 4JR9L 4W70A 4Z18A 5EDXA 2YC1B 3ULVF 2RAMA 4PTTB 1JUFA 3D3VD 4P0DA 4YX2L 2B7DT 3CDGA 4PJCA 5DYOB 2CMRL 3VH8B 3U0WH 5GS3A 3MJ8A 2BDNH 4HMDA 4QCIA 2ICES 2CLRA 5CGTA 2HT3D 4N9GB 1ZT1A 3UPCA 4ELKA 1N4XH 3RNQB 1ZGLA 1IC5H 1UZ8B 3FFCE 1TTGA 2Z31A 4LU5H 1F2QA 4LRIA 4R90L 3TIEB 5CGMA 5CCKH 4CU7A 1VACA 3MRNA 5HDBF 1BVKB 4XCFL 3TZVA 4X6CF 5HHPA 1GGYA 1RZKL 1F13A 4DZ8A 3BH9A 4YIQB 5KOVC 4POZC 1P4LA 2WBKA 1K6QL 3VXUD 3WFEH 4QF1A 3GK8H 4FG6C 4BJLA 3HC4L 5E9DB 4NRZA 2OYPA 2CLZA 1EV2E 4WV1B 3WJLC 4AIOA 4G9DA 1HINL 2GJZB 2YPLD 1OGAB 5E2JA 4LLDB 3O9WA 4OGAD 2AJYH 2APFA 2D7TH 1QSED 4CMHC 4KPHH 4IMKC 3LPFA 2DQEH 1WWWX 1ACZA 3OAUL 5FYJL 4O4YL 2J7LA 2PTTB 5GGTL 1B90A 2OMBA 4Y2OA 2JCCF 5AG9A 1OB1A 1JZ3A 4JFPB 2GK2A 4M3JA 3QDJD 2WBJD 3X13B 2HLFC 3O4OB 3MACH 3BPOC 3V9FA 1MIMH 1BQHG 2EXWC 4Z7NE 3MV8A 3LN5A 1P4IL 3GSNL 1A0QH 1IC7H 4FFZL 2VISA 4Z7OE 5D7SL 4K23H 4MNQE 1B2WH 4RFNC 5FV1L 1J5OH 4I2XB 4XNMA 3V5HA 1AQKH 4K9EH 4A6YB 4ODHL 4JANB 1KTLB 4X7TB 5IJVB 3P4OA 4ZS7H 4J1UB 4DTGH 3HUJE 3D25B 5J6HB 1QNZH 5HI4C 4L8DA 1ZA3A 5DK0B 4OI9A 3MGAA 1HWHB 2IFGA 4XVUC 3I9GH 2G60L 5EZLB 3WUWB 5I1LA 3DX6B 4OUUA 1RZGA 3NPSC 3R8BB 1QUNA 1PQZB 5ISZD 1ITBB 2QQKL 5FGCE 3F5WB 4OBSA 4BUGA 5E00B 1HN1A 1NCWH 3T65A 1MJUL 4OZFA 4QKXB 1A7RL 3WL9B 3MYJB 1QFUH 4WHDA 4Z7VB 1BQLH 2Y5EA 3S96A 3SCMD 5A16A 3CLEL 3HI6H 1LE5A 3CVHH 2ICWA 1FGVL 4OZGA 4F9LC 3V6OA 4Z7WF 3EDEA 3TVMB 1ZLWH 3H9HB 4YHLH 3MJ9A 3MNWB 3BX7C 3BAEL 3MBEC 1MCJA 1XT5A 4GLRH 5I76A 4WI8A 3PHQB 3LKNA 2HYMA 1MY5A 4LFHG 1RIUH 1PY9A 4HBQA 5CAYB 2ORBH 5EORH 1LO3L 1T89A 4NWUL 5DI8A 5DEFB 4RRPG 3LEXA 3LN9A 4JPVH 3REWA 1QA9A 5IV2A 5DD5H 4YR6A 3CXHJ 1U58A 4GW1B 1NGQH 1B4JH 1YEFL 4HKXB 4W68A 3RDTA 1HQ4B 4PP1C 3HG1E 1ETZA 3QO1A 4F7MB 3Q1SH 3MRPB 3I3BA 3OKLB 4B7IA 3GI9H 2C3XA 2FLRT 2IFFH 2DQHH 2ZZUT 3PGCB 3RWEA 2FCBA 1QVOB 1Q38A 1X44A 5ENWB 1J9CT 5BOZG 3ALWA 2F8VA 1UM4L 4OD3L 1AP2B 2R8SH 4NN5B 4TUJB 5IG7B 4E0RB 4LHJB 5IR1B 5KSUA 5AZ2L 1LWRA 5BJTA 4KJYA 4LSDA 4PJAF 4EUPB 1VB9A 2NMSA 5C0AA 1WT5C 4R4BB 5CKGA 5CJXC 2WV3A 3DXAE 2DLFL 4U2YA 1N8ZA 5C0DA 3FZUD 4M61A 4HIIB 3FO9A 4L8BB 1JV5B 4KUCD 3BMVA 3OGCA 2GY5A 4NQCB 3MLUH 3ILPB 1FHGA 3O3AB 4HH9B 2DQCL 1M7IA 2MNUA 2QSTA 5D6DA 2FWOB 5JNYB 1NH6A 3FN3A 3IXAB 5DRXA 3TO4D 4WEUD 5FFLA 1FIGL 1JGDA 1OL0A 4N90D 3LDBC 5F93C 5E7BA 1UC6A 3WD5L 4XX1G 3PF2A 1M71B 5TGBA 3VFMA 4FNLL 4OJFL 5E1AB 1HSBA 1RUQL 4ZUUA 4XXDA 4EZMA 4ERSH 1GGBL 1IILE 3GJFB 5DHVH 3RL2A 4Y5XB 2IANE 1PBYA 3IDNA 4ZDHA 2PCPA 4R0LA 1IZJA 3MOAH 2VERN 2XWTB 1J0IA 2OBGA 3GNMH 3MRRA 4OZIF 3W82A 3TEUA 3WS3B 5I66A 4IDLA 2VDNH 1WBZB 1JPFB 3MJ9L 4NRXB 4RGMB 4XC1L 3RGVB 1H0DA 1Q9OA 3IU4H 1AR1D 3KPOB 3GSRB 4WU7B 1PX3A 4GRLA 4UTBL 1XGPB 4S1RH 4GOSA 1JYXA 4L1HA 3RJQB 3O0RL 4KKBC 2YKLL 5GRJL 3LRSA 3U0PB 1R3KA 3PGFH 1VCAA 2BNQB 1T04B 5D7IE 5A3ID 1N3NA 5TJWK 2A9MH 4YHIB 2Q87A 2OK0L 4ZYKB 1MCNA 1IGCL 1QLEH 1K5NB 4I77L 4KI5F 3MMEA 4YBLC 3ZMRA 4UT7H 4Y4FD 5LBSH 5EIVA 2NY4C 2OZ4A 4M4PA 4OIBA 2NQCA 3HPLB 2FL5B 3BESR 4M3KB 3VXTB 3O45A 2FJFB 3LS4L 2AK4E 1KLUA 1S7WB 2Y5TB 4JG1H 4HQQH 4WDIA 3BP6B 2Q7YB 5L7XL 3GRWA 4WFGE 4N8VA 4UQ2B 1FSKC 3DSFL 4JFEA 4X4XA 4M48L 3PP3K 4P46C 1G84A 4KKCD 1FN4B 1A3LH 1D5BA 4LSRH 4NHUA 5J8OA 1X6NA 4QO1A 2Z9TA 4PS4L 5HYFA 1ODAA 3BN9D 4W4OA 1KGCE 5JOFA 2JB5H 4KK8C 4H25A 2EC9T 1OCWL 4XAWL 4O2FB 5HVHB 5F1IB 4X6FB 2Q8BL 1WFUA 4Z95H 4HV8A 1IBGH 3TNMA 3KPSD 1A7OH 2ED9A 5H35B 1F3RB 4HCRA 1ZEAH 1JZ5A 1MWAH 3QJHB 3KPQA 2IBGA 3IETB 3MLZH 4GXVL 3ROOA 3DMMB 5FOJA 4OZ4B 2FX9L 2D7OA 5HHOB 3RX8A 1ED3A 2HFGL 5HHXL 1BVLA 5BS0B 3V8CA 4LIQH 4N8CL 3GHEH 3VXPA 2ZCKL 3TCLA 2E9WA 1FNEB 1CLZL 2ATKA 3G04B 1JYWA 1MCPL 4LDEB 4Q7DA 3L3OA 5EBGA 1NANI 3GSQA 1P7QD 3W9EA 5FYJD 3WE6A 3LIZL 3QUMH 4JHAL 2GY7B 4JCLA 1FNSH 4MB5A 3U9UA 1BIIB 4JGJA 3VJ6B 5FB8A 4UDUA 4NQDA 2ZOKA 2BOBA 2R1YA 5AWNL 5I1HL 4M6NL 3BEVB 4MYWB 2MHAA 2CRMA 2UZXB 3FTGA 4F9PC 1NCAL 4MA8H 4RGND 5EU7E 4G6FD 1B4RA 5JA8B 3ET9F 2YUZA 1YEEL 4OD2B 5HYJB 1BFTA 3ESUF 4R97C 2Q6WB 5H8DA 1EFXA 5C0EA 3C8KB 4I18A 4FQ1L 1KCRL 4H20L 4R7NA 4GAGL 5IWLA 2VDOL 4YPGA 3AUVA 3VRIB 2LTQB 4HUVA 5C2UB 2QLVB 2G2RB 5JW5A 4CJ1A 4G5ZL 5MI0C 1P9MC 5IW3A 5MHSE 4ZFGL 3GRWL 5CZXC 5CBEA 2AABL 1KLGB 4C56E 4GAYB 5KVGH 1DLHA 4Q2ZB 5F7LB 4FQLL 2XPGB 5ICZA 5AUMA 2EE6A 1XF1A 1EHAA 3NGBC 4WEBH 4U6YB 2M2DA 4GT7A 3OKNA 5E03A 4MGXA 3EFFA 3SY0A 4Y7MA 4LLYA 4OCYL 1IGFL 5MEQB 2VITA 4XWOC 1HHGA 5D1XB 4GXUN 3TCXA 4YFLI 1IQWH 3BPLC 3VXMA 3P0VL 3QEGH 1UYWH 1XR9A 1G7MA 3GMRA 4HS3A 5CSZB 1ND0B 5D4QA 1A6VH 4P5TB 1RJZB 5JHDB 5FUCE 1YUHA 2QEJA 1ZSDB 4UUJA 5JOPD 2ICCA 3RNKA 4KKLD 4WW2B 2EDTA 4YK4C 4XBPB 4ZPVB 1MCLA 3Q5YA 5DJXA 2J6EH 3O9WD 5AYUH 1GL4B 3R06A 3IAPA 4Z76B 5DMJB 3QAZC 1EEQA 3HE6C 4PLKC 4NJAH 5DT1L 3QXWA 3WXWL 2JCCE 1MHHA 1YJDL 2R2BB 1EO8L 3R4DA 3V0VA 3VCLA 2AK1L 3RVVD 3FCTA 4FP8L 4HHAB 4ZO9A 4I1NB 3G5XB 1HCVA 4HEME 5CILL 2IH3A 5DK2A 3O8XD 3PGDA 2ZPKL 4K3DH 1QSFE 4TVPE 4ZMAT 3EHBC 3QFJD 5F1OB 2XTLA 1DTUA 4QHUA 1GOGA 1MCWW 1TZIA 5IK3B 4QY8A 3LD8B 3HHRB 4Z7UA 5F3HB 5CIPB 1A1MB 4KTEH 2BY0A 4PRNB 1T3FB 3FT2B 5JW4Q 5T3ZE 2P43B 2YPKB 3TT1L 2KKQA 4WWKC 2HA1A 2IAMC 1FGNH 2LAGB 4P2YA 3NAAH 5GHWL 4MCYB 3UZVB 1YYMH 4PJGB 4Z0BH 3FO2B 3L1OL 3HI5L 1XIWD 4L4VB 2HAZA 4GKNA 4UNUA 3MJ6A 1MF2H 4OCSH 4FQHB 4LOUD 5E8PA 5D72L 3N0PB 1KXQE 5EU5B 4C58B 3MLWH 1RUKL 1KEGL 5MERA 2DWEA 4U1JA 1NAKL 3W0WD 3WDJA 2PYEB 4LDLB 4AMKH 4PRAA 3UTTE 1MI5E 5D2NB 1S7QA 3QXVA 4BZ1H 1IFHL 4KZDH 3LB6D 2QQQA 5FECA 3L3DA 2R56H 2CUHA 3NMEA 1FVDB 3IRPX 4XHQA 5D2LE 1F58H 4R96B 5EU6B 3UBXB 2F8XC 3ZL4L 3O3EB 3WFDL 3WIIL 1OGTA 4MJIB 3VU2A 1MPAL 1SBSL 1JF1A 4AG4L 2H41A 3M07A 2P24A 3BKML 2DQGL 4LRNH 3SBWA 4RFOH 4S1DC 1CXLA 1G1YA 5IBUB 4KC3B 4ZXBC 3VG0H 4JKWA 1HI6A 2IADB 4JR9H 4ZD3L 1OAXL 3ZDXE 3SQBA 3LKQA 4X6EA 3QJFA 3BP5B 5F9WC 4TTDC 4RAUA 2F54B 2R23B 2EYTB 4PJIA 1DVFB 3TYFB 4YX2H 1HH9A 2H32H 4P3CH 3K8MA 5SWQA 3KPPA 5DS8A