3WSQH

Structure of her2 with an fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
218
Chain Sequence
EVQLVQSGGGLKVPGGSVKVSCKASSYTFTSYGISWVRQAPGQGLEWMGDVNTYAGNTNYAQKLQGRVTMTTDTGTSTAYMELRSLRSDDAAVYYCARDRGYYAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system
molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Insights into HER2 signaling from step-by-step optimization of anti-HER2 antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wsqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wsqH01
1BD2E 1BFVL 3UTTB 5CGYD 1CGWA 2Q3ZA 2YSSB 3O2WL 2P46B 1XF2A 1JNHA 2OJEA 3MCKB 3CSGA 4XMPL 2ZUWA 4GG6E 2R39A 4ZOAA 3P30L 3Q5TA 3KXFD 3EO0A 2XZAH 4HS3B 4EI5C 1OGTA 2EH8L 3OPZL 1UWXK 4JO3L 4WDIB 1KTRL 3SGKA 4G8IA 1U95A 2V5RA 1VFBB 3PL6A 2Z31B 2KKQA 3FHAA 1I1AC 3QIUD 3GM0A 3KYOA 4ODSH 1HQ4A 4FTVE 4K3DH 5DDHB 3U4BH 4YDIH 5HHQA 4QF1B 4MXVF 4UOJA 1X5ZA 3TN0B 2RQ8A 4XBPB 4MQTB 4M7KL 4HK3N 2XRAH 2VTFA 3FT4B 1TETH 3MV01 4OI9A 2AJSL 3BVNB 1CICD 5IV2B 5JQHC 3MLWL 2ZNWA 3QAZB 3LD8C 1G7MB 1RHHA 1RULH 5GISL 2JIXB 4J6RH 1EGJL 1HQRA 1ZLUH 3E6HA 4DQOL 1UM5H 4I3SL 1A4JB 3CFBA 3L3IB 2QQLH 1CBVL 4HFWB 4IOIA 2A2QT 4K8RD 4D9RE 4XXCA 5HYQA 1FNEB 1RJZB 1IGTB 2Q76B 3F5WA 5C2BL 4LHUG 4KKAD 1NLBH 4KPHH 3VFUA 3BW9B 4KRPD 4G6ML 1UC6A 2Z31C 3EO9L 5B8CC 3RKDC 3EO1A 4FG6D 5F89B 1R3KB 4KK8C 1R5VA 3IFPA 4U1HA 3M17B 2IH3A 4WW1B 2VDML 3TN0C 1XCQB 5ALCH 2CKBH 3QFDA 4KJPD 5A2KH 2GFBA 3BE1L 5DRWA 2BMKA 5F7EL 2E6JA 1RUPL 4FQPA 4Y16C 1VB9A 3D3VE 1U3ZA 4DAGL 4H20L 3OAZK 3KS0J 3U82B 3W9DB 5JOFA 1CU4L 5FF6A 2FZ3A 1B3JA 1NC2D 1IEAB 5DYOA 4TUOB 4O9HH 3OAUH 3VFMA 3BQUA 3UC0L 5HY9A 2X05A 1ORSA 3D39E 4PY7A 5C3LD 2VR9A 2GITA 1AO7A 1EEUA 3LAFA 4KKCC 3MTRA 1OTSD 4YBHA 2R1WB 1AP2B 2H41A 4HAFA 1U92B 8FABA 4ZUWA 4P5TB 3T0EE 2Q7YB 1B0GB 3JWDC 3WIFA 1CFSA 4JJ5A 4U1JB 3B4NA 3QWQB 5MEOA 3H0TA 1U93A 5J6HA 3WDJA 4P57B 3CFIC 1JPGA 5HDLA 1OM3H 2YA0A 3V0VB 4Y88A 1DQLL 2R23A 2O5YL 3DXAA 3PXJA 3TBWA 1DBJH 3T4YA 4F3FA 1NCWH 4Z7NE 3OXSB 4EI5A 4XPGL 4PR5B 3ARDB 4MVBC 3HB3C 4MD0A 4I9WD 1H3TA 1FNGB 4LCYB 4FQXD 2M2DA 3SKOB 5IFHH 1ADQA 3MR9B 3IFOB 2X4OB 4NGHL 3ZE2E 5DQJB 4LAQH 4OT1L 3FQUB 1UENA 3QI9B 2GY5A 1I1AA 3SOBL 3BP4B 2BVEA 2DQHH 1JHTA 1A7RH 1YEJL 1U6AL 2F54D 4RFEB 2P5WA 4R96B 2Q8BL 3U36A 3E3QC 3KXFE 2AABL 2BJML 3AAZB 1IT9H 4RISL 5E08L 3FQXB 1SVZA 5C07D 4LSPH 4S0TD 4RDQG 1BBDH 4P5TC 5CZVL 3ULUC 1MCBA 4AQOA 2FECL 3KPRB 4ZUTB 2YD1A 2WP3T 4KV5E 1MUJA 1QFWM 2XICA 2YSSA 2C3GA 4OCWL 2VL4A 3BRGC 1UKQA 1KTLA 3P77B 3DVFA 2ITDA 3S4SB 1I7ZB 4R0LC 4PLJC 4GLRH 5I8OH 3ARDC 4DFHA 4ODWB 3ZKNC 2NY1D 4N0UB 4H1LH 4HXBH 4GXVL 5FYLL 1PZ5A 4I77H 2UZIH 4LVNB 4YQXL 1MVUA 4L8DB 2O5ZL 1ZLVK 2Z31A 3L3GB 2ICEB 2J4WH 3QI9C 4AG4H 5B8CA 4K71B 4KMQA 1HHGA 4X7TA 2VDPL 4XVJL 5DFWH 3ESUF 2J3SA 1KCVH 5DVOA 1G9NH 3D1MC 3TN0A 2W65B 5K9QI 5F88A 4XBPA 1C8PA 1FAKT 4JPKH 1CD0A 3CDCA 4Y4FB 3BVNA 3GMQB 5MEPB 5HHPB 2FRGP 4Y16A 1G7MA 3CFCL 1FZMB 5IK3B 2ED9A 3SDAC 4NCC1 2JIXA 1HHIA 4PBVC 3D85A 4RMTA 3BN9D 3HMWL 1A4JA 4J8RB 2OZ4L 3L3IA 3QUMH 2FR4B 2E5EA 3O8XB 1DL7L 3KNBA 1F4XL 4DN3L 4OZIB 4Z78A 1F42A 1TQBB 3WMSA 3HN3A 3QXDA 2O5XL 2IWGA 3MJ9L 2DQTH 3MXWL 1IILE 5JHDB 4LVNC 3WSQH 3RBGA 4IDJL 5D96C 5DQ9A 2BSSA 4YDVB 3CX2A 4K71C 2P1YA 4LKCB 4Y19D 1R3KA 1R3JB 4ZDHA 1R5WB 1KB9K 5KSBF 4JVUA 3AS0A 1C5CH 1UH3A 3LKPB 3IKCB 2YPLD 2YRLA 3QA3B 1W8OA 2P45B 3CDGA 3BUYB 2R56H 3QFJB 5ESQB 5J11B 1XCQA 1BREA 3ZE0E 1F3RB 1KN2L 4TUKL 4KTDL 3V5HB 1RY7B 5C0CB 4S1DD 2DQJH 1OGAD 4KMTL 4XTRC 3WUWB 3MGAA 3HA0A 5D70H 4Z95L 3W9DA 4I2XE 1OF2A 1IEAA 3FOMA 3BKMH 3R8BB 4KRNA 5B39G 3L1OL 4ZFOB 1IAKB 4WHTA 3PV6B 5GGTA 5FB8A 3LEYL 3IDMB 3G6DL 1HOCA 5IHLB 1QP1A 5C8JA 3MACL 7CGTA 2I26N 4N5UA 2ICES 4U7MA 4YZFE 1TQBC 2VKWA 3U7WL 3LV3A 1MFDL 2X1OA 4YHPB 1UGNA 4I9WE 3FAWA 2BRRH 3QDGD 4P5TA 4X8XA 2Q7YA 2EE2A 4WI2A 1B0GA 4C56E 3LRHA 1EBPA 2BVQB 3QUXD 3PHQB 5JR1H 4P57A 1NAML 1P7QA 1TIUA 4EDXB 1H3PH 2OJZH 5IM7B 2R2EA 1RI8A 5J11C 1ERNA 3TGXA 4EQ2A 4R0LA 1RJYB 1N4XH 1H0DB 1FV1A 5AEAA 3OXSA 1Q1JH 4PR5A 4KUZH 3ARDA 4U2YA 5C07E 3ARVA 1FNGA 3MJ6A 5CEYB 3RUGF 3MR9A 3IFOA 1N3NA 3CVHL 3SPVA 4KK6C 2X4OA 3QIWB 4M7JH 1A6WL 5I1GL 5IBUG 2D3VA 4YDLB 3FQUA 2VDKL 3QI9A 1I9JL 3ARFB 4ODUB 4AL8L 3BP4A 5DI8B 4CU6A 5EH1A 1MEXH 5D7JD 4AMKH 5F3BB 3OG4B 4Z7WB 4QOKD 3GJEB 5C6WH 4IIQB 5CJOH 5IB1B 3SDDD 1YN7B 4TSCH 1U8KB 5B39A 3VA2C 3RJQB 2RIKA 3RA7H 4KY1H 3MRCB 3EHBC 2VSCA 5CUSL 4YHIA 1T20B 4ZUTA 3SDAA 3HUJB 5HGAA 1YPZF 2FBJL 1AXTL 1BEYL 3KPNA 4K7PH 1IGFL 4XCEB 3SCMD 3TVMC 1VEOA 4OD3H 4JDZB 4FZ8L 3RVUD 3QWOB 2X5PA 3NFPB 2YUVA 3OKEB 5I76A 1ZMYA 2ZG2A 3ZMRA 1H5BB 3NCMA 5D1ZC 2A83A 3MRKA 2NY2B 2XPGB 2BVUA 4XI5D 3WO4B 3DX8B 4N0YH 5E03A 3ALWA 5H35A 2ICEA 1PGRB 3PJSA 3U9PH 3WNKA 4U1MB 4MA8H 3TIEB 3I3DA 1KXTB 5I16A 3IFLH 2H9GA 3SE8H 4RBPH 1U8PB 5E1HB 5GHWH 4LDOB 1KC5H 1XF4A 2Y5EA 1U8MB 2ZSWB 2NXYD 3VFVB 3B3IB 3QP3A 2BNRA 1H3GA 4KVCL 5FYJU 1JN6B 2B2XH 2J8UF 4U1IA 1VGEH 1FLRH 4UB0L 3TPKA 2Z93A 1FZMA 2JKXA 1QFOA 1T2QH 5SWQB 5I1DB 3U7YL 3DBXA 5EU7E 1N0XH 4JB9L 4Y19E 1TQCB 2YD3A 4WHCA 4OZGA 4PLOB 1YEGH 5EZOL 1TVBA 3RGVB 2YPLE 3P0YH 5DEFA 1OP9A 2DQGL 3JUYA 2ZUVA 4NUGL 3CSYB 1MFCL 2EDLA 1BIHA 2NY2C 4Z0BH 5EORL 3QEUB 4O5LH 5DZLA 3C6LB 2XNAA 5IFJB 3QHZL 4NQSB 4PGJA 1D5XB 5ISZB 5EIIB 5KAQF 3S88H 1GSMA 1OGAE 1IGYA 5TH2A 4YDVA 4LKCA 1IM3A 5E00A 1R5WA 4LARH 3BDYL 1RUKL 1EJ6A 2BCKA 2HJLA 2ILLA 4NBXB 4Q0XL 1Q72H 3EYSL 3LKQB 3QA3A 3GI8H 3SGEH 2GT9B 3BUYA 4KDTC 3RX7A 2C4FU 3N1QC 4O2FB 3TJEL 1QLRB 3CXHJ 1PAMA 4X7EC 1MHPH 3KJ6L 2XV6B 3V7MA 5FUOH 3CK0L 1NGWB 2WLZA 2YMXL 3EYVB 5GRUL 1T04B 1M7DA 1PSKH 2W59A 4WUUD 4FXLA 5FO8B 3QDGE 4U1LA 4I0PC 2B1AL 4OCXH 4F37F 2HTKD 1E4XI 5BVJB 2I5YH 3C2SA 2X41A 2X6MA 2P5ED 3HG1E 1IAKA 1YYLL 1M71A 5MEQB 2EYTB 3RGVC 5BJTB 3IDMA 3QCTL 4GAGH 5F6IC 4L5FL 4YK4B 1SMAA 2HFFB 2CK0L 3TBYA 1I75A 4G5ZL 3O3DB 3S37H 2HG5A 3BH9B 1ROWA 3FFCD 4GKZA 4PS4H 3WKNA 4F9PC 4HFUL 1KBGL 3C6LC 4YHPA 3DYMA 5KANG 3V7AE 4N68A 5C0ND 1H3WM 1Y6KR 2BVQA 5T1DL 1P9MC 3PHQA 1D5MA 4ZOBA 1IJ9A 2A6IB 5C6TL 5BO1L 1NGQH 1BQUA 5AG9A 3HE7B 4EDXA 3TVMA 5FV1L 2XT1B 1IL1B 5I74C 3FO0H 4HULB 4QOKE 1ZT1A 3VFSA 2BRQA 1YEIH 4Z7VA 2P8MB 3ULVC 4U1SB 1RJYA 4UILL 2FO4A 5D1ZA 3LH2H 4NKMB 3VFRB 3MRBB 3O0RH 4PJEF 4ODTH 1NUFA 3PQYE 4ZMAT 3T08A 1DBBH 1LO2H 3B9EA 5DHXB 4MGXA 3TIDA 1UYWL 4N8VG 3V0AC 3NFNA 1U0QA 2HFEA 2DIJA 4NJ9H 1JVKA 5AD0B 2KZWA 4QXGL 4LSDA 3UTSB 2XY2A 3H42H 4POYA 2XTJC 5HDQH 1L6XA 4Z7WA 4HUWA 4YK4C 3GJEA 1IM9D 3K2UH 4M48L 1YN7A 5INCB 4IRSB 3V8CA 3QDJB 5BRZE 4KWUA 3OAYH 2I25N 4UTBL 4PJ9B 1WC7A 2UWEF 4QCIA 2EDTA 3VXRD 3LMJL 3MRCA 2R4RH 1JGEB 4ONOA 1T20A 4LASH 2GTWB 4MDIA 4NFCA 3N9GH 4GKNB 1NFDE 4BSVB 1T0MA 3VFNA 4XCEA 4OLZL 5LXGL 3H9HB 4JDZA 3RVVC 5DO2C 3TM6A 1FL6B 1PY9A 2DWDB 3BZDA 5T5NG 1JTTA 3NFPA 3OKEA 1RMFH 4U6XB 4HUVB 4ISVB 4L8CB 5D2LA 3JV4B 3CH1B 1D6VH 4XP5H 2DLHA 2CXGA 4AIXA 5JW4R 4HV8A 2HH0H 5FA4B 4AH2A 1VADB 3BD3A 5EU6B 2H26A 5C70A 4D8PB 1QHPA 1CLZL 3P40A 2P8LB 2BVPB 3VH8G 3V52L 4LHJB 1R0AL 3VW3H 1IQWH 4LMQE 4JG0L 4LCIL 2OCFD 4NC1C 5TE6H 1P4LB 2VDOL 3DMMC 2K7QA 1JFQL 4N8VA 4KDTA 1YNLH 2ZSWA 1U8MA 4IRSC 5EZJB 3UTOA 4X0KB 5J3HC 4PJ9C 4OM0H 3RWFA 4HDIB 1YEDB 1KXQE 3TZVB 1F6LL 1F4HA 1KPVB 2CMRH 3GSVB 3MROA 2JELH 4I0PA 3VDAA 5SWQA 4XC3L 4OZFG 4APQB 4Z5RB 2DQDH 3IDGB 2V2WA 3UZVB 5EOCL 1CQKA 1WICA 2IGFL 4MJIE 2WW8A 4Y2DD 4AEHL 3RGVA 4U0RC 4ZFOL 2XA8L 5D5MB 2W0LA 3HNTH 3WD5H 3QJHB 3GSNA 2BHZA 4PJCF 4NP4H 1QSVA 1D6EA 4F9PA 4ZS6C 2C3HA 4HCRA 3C6LA 4WUUE 1ORQB 5EIIA 4XNZB 2W9DH 2NX5B 3NZHH 5IHZB 1UKSA 1P9MA 2P5EE 1B4RA 1A6ZB 3LKQA 1R3HB 1FE8H 2ZOKA 4BZ1H 2GT9A 4ZAKB 5B4MD 3MJ8B 4EVNA 1QLRA 4GQPH 5F72S 5EU4B 4Q6IB 2OL3B 3UZQA 3FFCE 4MQ7B 4OQTL 3MCLL 2QQNL 1NL0L 1TZGH 3LKOA 4MHHG 3A0OA 4F57H 5BVJA 4M7LH 4PV8B 4KZDL 1JPFB 1EMTL 5IT2H 1DFBL 5E8NB 2OTWA 2HKFL 4BK4A 3OG6B 5GGSY 5I1CL 5DK2B 4NWUH 4DN4L 4L3EB 4OZFA 4JGJA 3BH9A 1SJEB 4I1NB 3V8OA 4KJYB 3D0VB 2FDBP 1OCWH 4NJAH 1D5ZB 1U8OB 1FYTD 5I30L 4GKSB 5IMLB 4ZAKC 4FQQB 5I15L 3DROA 3H3PL 2HN7A 4PJIA 2VUOA 1SM3H 2ESVA 3TA3B 3LKSA 1FNFA 2NY4B 3VXRE 3NACL 1B2WL 1YUHA 3BIAX 4ONGL 5CAYB 1UA6H 4FABH 1X5FA 2ZNXA 4D0DA 3JTSB 5AD0A 2Q87A 2QTEA 4RFNC 5B21A 3HMXH 3RVWC 2DM4A 5FCUH 1Q0YL 2AV7A 2AK4B 2IADA 1WZKA 2NMSA 3NA4A 5IR1B 2C3XA 1UZ8A 5MENB 5INDB 2C9AA 4NT6A 3DMMA 3C8KB 4G80A 1YC7A 3UDWC 5DZNA 5INCA 4IRSA 4PJ9A 5F1KC 3IXTB 2DQFA 5DJCA 4P9HC 5EA0L 2L4OA 1JGEA 2GTWA 1GHFH 2NY6D 3MREB 2DBLH 4GKNA 1F90L 4YHLL 1BJ1H 1T4KB 3SKNB 3H9HA 5GGVL 2PUQT 1RU9L 4F8QA 4NO3B 4QRPA 4U6XA 4HUVA 4L8CA 5GS1B 4JKMA 3JV4A 1L9NA 4I5BA 2MHAB 4UU9B 2VZUA 3TA3C 4QXTA 4HXAH 5FUZL 2VH5L 1SYVB 1VADA 1ZVYA 2V9RA 2OYPA 5EU6A 4KK9D 4PJFF 4D8PA 4PGCB 1FBIH 1VACB 2BVPA 3CMGA 1YY8A 4ZPVB 3QDAA 4OKDA 4NRXB 2OSLB 4HGWA 3FN3A 1P4LA 4PRDB 2MMXA 4R8WL 3B5TA 1FFNB 1N59A 3BKCL 4FNLL 4B53A 1S7XA 3V5KB 5MI0C 2Y1VA 1A5FH 2HRPH 4X0KA 1JTPA 1YEFL 4LP4A 1QFPA 3BRFA 2JCCE 1DLFL 4HDIA 4J3UA 3OKOA 3O3EB 5CJQL 5DC9B 2FSEB 4PJAE 3MV8D 4PUBL 2BOBB 1AY1L 1SEBA 4BSJA 4EOWL 2E9IA 4TSAL 3SGJC 2B5IB 3UEZA 3TV3H 1NCBH 4YXKL 1M7IB 3QWRD 4GG6B 5GJTL 1FFOA 3RPKA 1FAIL 1RZIB 4OZHB 1JWSB 4G6FD 5GS1C 1KIQA 2DF3A 1D9KC 3VXME 3T0WA 4LNRB 2MKWA 3FB6A 3K8KA 4GRLD 3CGTA 3I84A 2W1NA 1MSPA 4PREB 1KJ2L 3BKYH 2E7CA 4MNGA 1MJ8H 3SO3B 2NX5A 4X6CF 4DOHE 4YHZL 5FM5O 4XPTH 3P11L 2VXVL 1FYHB 2B39A 3SDCB 5C0BD 1A6ZA 4MQXC 3EOAA 1R3HA 4HHAB 4ZAKA 1N5AA 4ZO7A 4PJ7E 4Q9RH 5IVOA 4PRNA 5DS8B 2OL3A 4LIQH 1PX4A 3SDXE 1OAUL 4X4ME 4ALAL 4R2GD 2IFGA 3ROOA 4Z77A 1KIRB 4OTXH 2XWJB 5C0AD 3WNNA 1ETZB 2OK0L 4PJGF 4W70A 2B5IC 4IRZL 4QTHB 5KVGL 3OJ2C 1XAUA 1JPFA 3GSRA 3DX9B 4XNQB 3VXUD 2VZTA 5E8NA 3S9DB 1EX0A 2BSTB 1MIML 3WLWD 2HMID 1A0QH 3NIFF 3HAEB 5DK2A 4MMZC 3JUZA 1CE1L 4L3EA 4YPGB 1BLNB 3UDWA 4H0IA 1SJEA 2R1YA 1R5IB 1U8QA 2VZ3A 3WE6A 5IBLD 4PV9B 4KJYA 3DI3B 1Z6JT 4WY7L 3SO3C 1SY6H 2B7DT 2HVKB 1U8OA 3UAJD 4HIHB 2FATH 3KPMB 2W92A 1X5YA 4JRXB 3GFUA 2HT3D 2HRLA 4GKSA 1MLCB 5DT1H 4G6AD 2X1PA 2GUOB 4P3DB 3GI9L 4KQ4L 4PYHA 5HDBF 5E7FA 1BHGA 4UT7L 1EHLH 4LHUB 1S5IL 3TA3A 4OLYL 1NUNB 1ZK9A 1JZ4A 1X5GA 4FQLL 1XF5B 1MH5A 3VGAC 4JY5L 3JTSA 1N6UA 1I7RB 3X17A 3QZWB 4KKNA 2OQJA 5F1OB 4B7IA 3D39B 1J8HD 3RWIA 3L9RB 4OCRH 5IR1A 2VZVA 4MCYB 4L29B 5MENA 2DQUL 4NQDD 2BY2A 1I85C 1EA9C 2A9NH 4WW2C 5FA3B 3VI4F 3GIZL 4A2LA 2PTTB 3RWGB 1BZ9A 1N6QL 3NA9H 3OX8B 3K4DA 3BISA 3OB0K 1D5BA 1AXIB 2AJYL 4XBGB 3LEVL 4GMTH 4AJ0A 3SGJA 1GAFH 5KSAD 2ZZUT 4UT9H 2R2HA 2BP3A 2C26A 5GZND 5L88H 4NRYB 3TF7C 3FZUD 1RZKC 2DYPA 2BFVL 1P2CB 5GS1A 2C5DC 2B8OT 1D9KA 1JK8B 2YZ1A 2MHAA 4UU9A 4MHHI 4NQEB 4N8CL 4LQFH 4ZNEE 1OAZL 4HUMB 4X99B 1HHHB 4R4NC 5I1JL 1SYVA 1OSZB 1RV6X 5AWNL 1DVFD 5FYJL 5GGRY 3WDHA 1CL7L 3MV8E 2EE9A 2ZKHH 3QO0A 3MNWB 4PGCA 1P5UA 1I9IL 3UP1A 4B0MM 5L2JB 2EYRB 2NXZB 3KAAA 2LFGA 4FFWC 3WFCL 4PRDA 1CQYA 1CXEA 2FH6A 1T21B 3OJDB 1G6RH 4TNVK 2I9LA 2KQNA 3V5KA 1RK0A 3SE9L 2EO9A 4KC3B 4L4TB 3T0EC 2YBRB 4HS6B 4HIEB 4H5SB 2EKSA 5EBWB 1EFXB 4Y1AB 5CMAB 5DRXB 5HXMA 3NCEB 5JLZB 3PWLB 4GRWH 3MRIB 1F3DH 4KFZC 1JMXA 2V17H 2VYRE 2FSEA 1WSST 2BOBA 2R29L 2C4XA 5AZ2L 3OR7A 4HKZB 3LKRB 1M7IA 2GK0A 3FRPG 2AEPH 4GG6A 2DWEB 1RZIA 2ZUYA 2EE3A 1OVZA 1OTTD 2VDLL 5C0BE 5EOQL 4JPWH 4MJ6B 1BMGA 1I7TB 3RDTD 4LLUB 4LNRA 3VFTB 4ZXBC 2DQCH 3AMLA 3CX5K 5HD8D 5F7WC 1YA5A 4LIQE 1FVDB 4WI5A 5KZCD 3KJ4B 3OKNA 4OV5B 3DSFL 3CSPA 5CGYC 3S34H 2BSRB 5C0AE 1F58H 2VLLB 4FTVA 3VCLB 1BFSA 1HXYB 3VXUE 4KAQL 1RIVH 5TF1L 3EGSB 5FHBL 2P4AB 5L0QB 2K1MA 3WS3A 4AY0A 5E1AA 3RNKB 5BW7C 4OF6A 1GIGL 3LQAL 2J1KA 4MQSB 4JHWH 2VXQL 3QIUC 2YN3A 3L5JA 3Q5YA 3QXAA 2E9WA 4M3JA 3D69A 5ICXB 3HZMB 3INUL 1QBML 3E8UH 5DMIL 5DC0A 3HAEA 3O41A 1F2XK 5D4QA 3T0VA 4CVZB 2PO6D 3ARQA 1I85A 2DLGA 4WW2A 5DRZB 1XFPA 2JJSC 3MGOA 4H8WH 5DZOA 2VLKD 1R5IA 4LU5H 2A1WH 4PV9A 4O4YH 1U8IB 1FL5A 4YC2C 4I0CC 4JY6B 4PRHD 4K94C 3BZ4A 4KI5F 1VEPA 4JRXA 1O7SA 1J1OH 4YXHL 1J8HE 1MLCA 3LB6D 4JO2L 3AMKA 2DDQL 2AKRA 1AJ7L 4KKAC 4Y4KD 5FAAA 2Y72A 5A16A 3DUSB 4PJDE 5F9OH 5L2KB 1G0DA 2AGJH 5T1MB 3OJVC 5IQ7L 1BQSA 1LP9E 1QUNA 5HPMB 3GRWA 3EYUH 3KPPA 4GW1A 3NCCB 5DUPL 4WNQA 1BJ1J 3HI6L 1IFHH 2HJFB 3MBXH 4AYFA 3P9MB 5FOJA 2IBZX 4G6JH 3VGFA 5J89A 3VD4A 2Y36L 1RIUL 2W9EH 4JZOB 3HE6D 4NSKA 4HK0A 3D39A 3VD3A 4DZBA 3UJTL 1I1YB 1IC1A 5BMFH 4QXWA 3TT1H 4JDTH 1ZA3B 4JM4L 4MCYA 4L29A 2MKLC 4QRQA 4XHJD 5TQ0L 3V5DA 5FA3A 43CAA 2H1PL 4DK6A 5C7XH 1N5YH 3IDXL 2PTTA 3MYJB 3T0EA 3RWGA 3VG0H 2QADD 1KCUL 1KCLA 1W0VB 4GRMB 1CGSH 4C56B 1LNUA 2YKLH 3O4OC 1T1YB 2CJUH 5EB9A 4F7TB 2J7LA 1BFVH 5E2WH 3PIQB 2IAMB 3FONB 4NKQB 3C5ZB 5CWSB 2OTUB 1NGZA 3KLHC 4TTDD 2FIKB 4JRWA 2VQ1B 3U79A 1RZJL 4S10A 5DA0B 5L7XL 2GTZB 1WIPA 3MNZB 5SWSB 3PGCB 3SKMB 1JK8A 1UWXH 1IAIM 4ZXBA 3G6JB 4PRBB 3GSOB 4NQEA 5E4IA 3QUYD 5IHUL 2EH8H 4X99A 4JO3H 4GRWE 4CN6A 4L4JA 5C0FA 5EFIB 4FQJH 4V1DD 1QFWL 3C09B 2KPNA 3MLRL 4YBQC 1C1EL 3TCLA 3FOLB 3KXFA 5HYJB 4XMKL 5KOVC 4NQCD 4M7KH 4NO2B 4H1LB 3TH3T 3EZJB 4FQXC 2DI7A 2YBRA 4H5SA 5EBWA 1EFXA 2AJSH 5CMAA 5DUBA 5BW7A 1Q9LB 1QO3B 2X9WA 3MRIA 3MLWH 3CXDH 5DJAB 4BZYA 2QEJA 1CXFA 3QIUA 1YNTB 1I8MB 2YD5A 5GISH 3ZDXE 2O61A 1XF3B 4HKZA 1EGJH 1FZJB 3LKRA 4P46B 4DQOH 4KU1A 3NIDE 3QBTB 4IRJD 5D8JL 5F7DB 4U1KB 3IJHB 2PYED 3CPLA 4LLUA 2JJSA 1N6VA 5C2BH 4LFHD 1GL4B 2BOCA 3QEQD 1FCCA 3BO8B 1ZVSB 1BWMA 3EOBA 4OV5A 1G9ML 2PTUA 1NCAL 1WZ1L 2FCBA 5KTEH 2WBJD 3EO9H 3MRMA 4IM8A 4JPVH 5T5FL 3VDCA 1G7QA 3QQ3B 5I8EB 5I1AB 1XR9B 4R4FL 3ARBB 5D7KE 5E6IB 2DAVA 4HJGA 1X4XA 4N5EC 1QRNB 3VJ6B 2EDYA 4UIKL 3OAZH 3S36X 3BE1H 5F7EH 3F58L 1XIWB 4NHCL 2AAVA 2D9CA 3MMEB 1C12A 3IU3A 4H20H 1TMCB 2Z4QA 1CU4H 1R3LA 5T33H 2C1OB 3BOVA 4PRHE 4YFLF 1G9NC 2VOTA 4P46C 3GB7A 4QRTB 2EEBA 1RZFH 3UC0H 3ROLA 5DD0H 1CYGA 3VU2A 1FHGA 1JRHI 2CKBA 4CVZA 1Z9OA 5C6PB 3FMGL 5DRZA 3GNMH 4MSWA 2UVEA 1JGLL 3C08L 4ZO6A 3ZKQD 5HSFA 4MYWB 3TCXA 3KLSA 1DN0B 1A3RH 3BPCB 1A6TA 2FJFA 3MRGB 1JGVH 3BN9C 4HZLB 3C5JB 3HNVL 3STZB 4KI1A 1KLGB 4RRPA 1KTKE 2L0DA 1LMKA 2C1PA 2VB5A 3MA7A 2X70B 1UWEL 4NOFA 3ARBC 4L8BB 2DM7A 1Q0XL 3MRQB 5HVHC 2R0LL 1L7TH 1KJ3H 3DUSA 4Z7OE 5L2KA 3HUJF 4HZAA 5L8LB 3UXFA 2R0ZL 5IROC 5T1MA 3U4AA 4H26A 4RGOH 4O00A 4XPGH 4I2XA 1IQDA 5HPMA 1HXMB 1BBJA 1XIWC 4OZ4B 5EU7C 3I2CH 1B6UA 4UQ3A 1BJ8A 1PKOA 4QKXB 2HJFA 3MRFB 4NGHH 1UB5B 3X14A 1WWAX 3GKWH 1BM3L 4M6AA 2Z92B 3SOBH 5IB3A 3PL6D 4UT6L 4U6HA 5IOPB 4JFQA 3O6ML 5KJRH 1PG7L 2AABH 3MYJA 3V4VL 5F44A 1U2CA 4FQXA 4S1DC 5E08H 4EBQH 3E6FB 4C56A 1W0VA 2DIBA 1UB6A 4K3GA 2DN7A 4B7LA 15C8L 4F7TA 4V1DE 3GHEL 3HCVB 3PIQA 5CWSA 3FFDB 5L9DL 1V3JA 2AV1A 1XGUB 3OB8A 4JG1H 5GGQL 1F8TL 2FIKA 2VQ1A 4OCWH 2CUHA 2GTZA 5ESVB 1KT2B 1LDPL 3MNZA 3TBTB 3BP6B 1A7PH 2FGZA 4UUJB 5GGUB 1F3DJ 1S8DB 4PRBA 25C8L 3R8QA 3G08B 3FL7A 4RSVA 1ZLVH 3W39B 4PP2B 3BUTA 5FYLD 5FYLH 1JYXA 4Y4HB 4YQXH 1RUQL 2O5ZH 2RHEA 5CBAA 1IAMA 1AQKH 4UV7L 2XKNB 4XWOD 5J1AB 4S2SA 4WTZG 2GHWB 2VDPH 1BAFL 4Z0XB 1BZ7B 5E5MA 3ZT6A 5BRZB 4BUHA 2PYEE 5F9AC 4NO2A 4H1LA 4MB4A 3I50L 3F7PC 3QEQE 1TCRB 1E4WH 1QO3A 4OLUL 2CQVA 2CDFB 5DJAA 1B90A 4YHNB 1CFQB 2PW1A 2P7TB 4GMSL 5D7JC 3QIBB 5IG7A 4P46A 3X3FH 4G8FB 4EJ1C 5BXFB 5FKPA 3D0LB 2OZ4H 5FK9B 2FGWL 2D4FA 3SDDC 3CLFH 5KSUB 5KS9F 4U1KA 3IJHA 4HSQA 1NCDL 1IC4H 3PXHA 2J8HA 5EBLB 1F4XH 1KJMA 5HPOA 1M7XA 2VR4A 3NN8A 4YHOL 1HEZB 4JN2B 2O5XH 3MLVH 4RWYH 5DJXA 2DKUA 1UACL 3MXWH 5D7SL 2BVOB 2F19L 4IDJH 3FN0H 3QUMA 1ZS8B 4NZDA 2VLJD 3LQZA 3QEHB 5I8EA 3ARBA 3O3BA 2YPVL 5BV7H 4JM2D 1JE6A 2ZWLT 3CFJA 2O26U 5DJ0A 2IALA 3UJIL 3RY5A 3DXAD 3DYOA 2YPKB 1IC7H 1KN2H 5IROA 4YJZL 3GBNL 3BGFC 1F11A 1FG2A 4LSTL 4TUKH 4NUJB 2FHCA 4WTZA 1F4YL 4HKJB 4KTDH 1XIWA 1YY9C 1XR8B 2X4QB 3MMEA 1DQMH 1U36A 1VFUA 4MJIB 5FYKL 3VMOA 1RVFH 2W0KA 4XPAL 2E7BA 2YPLA 4IHOA 4OUUA 4MNHA 3V7AG 1WJ3A 5I66B 3QDME 1VFOA 1DTUA 3LEYH 3O81A 3G6DH 1VPOH 2P5WD 4AT6A 4DKFH 3UTQA 3HR5B 3TPUB 3F7YB 1SHMA 1OGAA 1MFDH 4AQ1B 1P84K 1DN0A 2ZJSL 4PTUB 3HNSL 3HC0A 3BPCA 4W6YB 1IKFL 4P9ML 4HZLA 3C5JA 2I60L 2IMMA 4PJ5D 4CNIB 2VLRB 2X70A 1NAMH 3QRGL 4LPUA 1HIMH 3UTTD 4L8BA 1HILA 3MRQA 2SEBA 1NMAL 3HZVB 3BYTA 1JNLH 1ZA6B 3MLYL 1CIDA 1JYNA 3QDGA 1BP3B 1AHWB 2Z35B 1E6OH 4W4NA 1HXMA 3STLB 9CGTA 2GSIB 5I17B 4OZ4A 3HG1A 1NGXA 5E4EB 5FHAH 2HJKB 3QQ9D 4Z76A 3FO9B 3MRFA 5I9QC 1A6WH 5I1GH 4NC0B 1HH9A 1I9JH 3WS6C 5C0DB 3KPLB 2Z92A 1G7HB 2Z31D 3RKDD 3OKMB 3SY0B 4C58B 4F58H 1OAKL 4KK8D 3S97C 1FO0L 2EC9T 3QO1A 1TCMA 1ZEAL 5IOPA 2PF6A 3JTTB 3TN0D 2HT4C 4P2YA 4Z9KB 5F7KC 1IGCL 2HTKC 2VZ1A 2QSVA 3GSQB 3MO1B 5CUSH 5FYLE 2OR9L 2A73B 2GSGB 4RNRA 5D7JA 1UM4L 4Y16D 3OZ9L 4TTGA 5CJ5A 4GAYA 2FBJH 4ZSOE 3S35L 1AXTH 1BEYH 3IDNB 4QOKA 3JWOL 4YHKH 4MXWL 3VFGL 2JIXD 4M8QB 4FZ8H 4UAOC 5ESVA 3SDDA 3PQYA 1U3HB 1CGYA 1BF2A 1BVKB 2FJHB 1QBLL 4NKIL 4BZ2L 5ITBL 3G08A 3CFDA 4F7PA 4DKEL 4KKCD 3RWHB 3QXWA 3W39A 3X13A 1VGKB 4UDTA 4OKVB 3U46B 2CRMA 1WBZB 1A9EA 2XKNA 1JYWA 1B0WA 1Q94B 4Z0XA 1JF1B 1RUAL 5BRZA 1BQLH 3AM8C 5IQ9A 1VENA 4LPXA 1QLEL 4ZTPL 1HHJB 3TFKD 4X6CE 1S9XB 2XKSA 4ONFL 4R7DB 3WEXB 2MPAH 4KVCH 1A47A 1B0RA 1YC8A 3PP4L 3PDOB 2CDFA 1NFDA 4R7NB 4YHNA 5DMKB 3HB3D 1U8JA 4OIBA 4X6DF 3MNVB 4JB9H 4G8FA 5D7IF 2HFGL 2AERT 3FO1B 2IBZY 4HMCA 2GEEA 2VLJE 2NYYC 3D0LA 3IS1X 5IVZA 1IZJA 2F53B 3WNMA 4NO0B 5E70A 2H3NB 1FDLL 5GGTH 3Q48A 3VWJB 3IU4L 5EBLA 5FGCE 2B1HH 4GLRI 4XNXL 2IPTH 4S11A 3DXAE 5HGDB 5C1MB 1NUGA 4F33A 4PJGE 2GAZB 3OKDA 5CHNA 1P6AB 1S9YB 2BVOA 2MTPA 1ITBB 1LEKB 3QHZH 2WZPD 1AKJB 4OCSL 4P5TD 4WO4B 4N9GA 4NQUA 3NIFE 3ULUD 2FWOB 3GJFB 1YECL 5IHBA 3BDYH 3QEHA 3LKNB 1KN4H 4WWKB 4G8GE 3HZKB 3DX6A 1QSEB 1PKQE 2A77L 5HVFB 5H2BB 5C9KA 3RNQA 2P5WE 2V2TB 3KJ6H 4K23L 4EIZC 5GRUH 3VGHA 1DEDA 2HVJB 4YO0B 2AJVL 4R26L 2X4QA 1PBYA 2ICWA 3ARDD 4UBDD 3ZKND 2B1AH 4OF3A 4TSBL 4X6BA 1ZGLA 4MJIA 3RPIB 5LBSL 1JL8A 3MUJA 3QR2A 4G7VH 2EDXA 4PJ5E 4I3RL 1ZTXL 4L3AA 4MDJA 5HDBE 3WS6A 1YYLH 4OB5L 5I66A 2QL1A 1AGCB 3C60B 3JSSA 3VXMB 5SWZE 3QI9D 3UTTE 1CTOA 1R3IL 2APXA 4HIIA 4OM1L 4L5FH 4F9LC 2CK0H 2WINB 5IB2B 3BJLA 3VRJB 1E0OB 4WUUA 3F7YA 4JR9L 4HFUH 2XZZA 4MAYB 4DFIA 1LK2A 6CGTA 2JLLA 2P5EA 4OJFL 1G9EA 4UTAL 5IIEA 4CNIA 4GBXB 4Y2DC 5EO1B 2EIZA 4FOMA 3QCVH 3KPRD 3SDAD 4JLRB 4HJJH 2YEZB 4WWKC 1CD9B 3W0WE 1KIUA 4QNPE 2GK2A 2H6PA 4K3JH 3F7QA 1HKLH 4BFIA 2D7TL 5IJVB 3GBLA 1UVQB 2WANA 4WV1B 2LTQB 3DTXB 1UM6H 4CBPA 1WVZA 3T3PF 3STLA 2PNDA 3CFKB 2H8PB 4MB3A 3VRLF 4HK3J 2HJKA 1UYWH 3FO9A 1U8NA 2VXTH 3PNWB 1A14H 4MJ5A 5C0DA 4OCYL 3FB7A 4QXGH 2DTML 4BUGA 5K9OB 4YAQA 3SY0A 5B4MC 5E24E 1M4KA 3AM8A 1H15B 4M1GL 3JTTA 3GGWA 1PFCA 8CGTA 5JO5A 12E8L 2AK1L 4UTBH 1MI5B 4KDVA 1NFIB 4MAYC 1UXSA 5IMOA 5JZ7C 4Y4FD 2BNRD 3LMJH 1S7WB 4PJ8B 3DO3A 4MS8C 3RL2B 2X9YA 2A73A 1NSNL 4MA3B 1NMCB 4XTRD 3RIFF 1F3JA 1D7FA 3IDNA 4OLZH 2PYFB 4M8QA 4RMUA 3WFHB 4P99A 3PWJB 3G5ZA 1TJGL 3X12A 3O8XD 1BVKA 1H3UA 2FJHA 4NQVA 3VXRA 1G7LB 1UJ3C 3WHE1 3FTGB 3RWHA 3VXNB 4E41B 2WWKT 3ZTNH 1JGUL 2XN9B 4NCC2 1NCUA 4OKVA 1MOEA 3U46A 5JHDD 1WBZA 3TC9A 1ZWIB 3GSNL 1E28A 1TPXB 3CCHB 4M6ML 4LCIH 5FGSA 5C0GB 5TE7L 1JF1A 5I1IL 2VDOH 4HCRL 2MQCA 4OD2B 4M62H 1JFQH 3VXPA 2VXUL 3QNYA 2CD0A 5I2IA 2VKXA 5T3XD 2ZCKH 1MCKA 1S9XA 1KB9J 4JPIB 3WEXA 3AB0C 3NFSL 3BXNA 1ZGLM 5SV3A 3U7AA 3EOTL 4M7ZC 3T0XA 1UH2A 4HIJB 4XGZB 1CTNA 1WFOA 1ZXQA 4UQ2B 4XC3H 5DUML 5C0CD 1NMCC 2Y06H 1J10A 3MNVA 4KK6D 3ULUE 1QVOA 1SJVA 3FO1A 2ZCLH 4AENB 4D94A 5AYUH 3ET9F 4AEHH 2W60A 3RZCB 1T7WA 3E2HB 2BXYA 3CLEL 4NZTH 4DUVA 4F9LA 4HF5L 4FZEH 2AJ3A 4KH2A 5I19L 2VC2L 3Q0HA 3WXVL 5FO9B 5KW9H 4U1NB 1BGXH 2GAZA 2JK5B 4QHNB 2C4FT 1CGXA 1A2YA 2XQYK 4FXKB 1LEKA 2VAJA 1FGNL 2LU4A 4X80L 4GUPA 4C83A 3I6GB 2NY7H 4Y2DA 4LGSB 2FWOA 3EHBD 2H45A 3QSKB 3LKNA 4WWKA 1QSEA 1ZT4B 3S96B 3U0TB 4LF3A 2F8XC 3TBVB 3BHBB 3D2UB 1NBZB 4L3CA 5KSBB 2PR4L 2HVJA 5JW4M 4OQTH 4YO0A 3QULB 5GRYA 3MCLH 1SJHB 2QQNH 3UPAA 1IGML 3RPIA 2ADIA 5JNYA 4XXDB 4QYOB 1IZKA 3QIWD 2R0KH 3L6FA 4WFED 4KZDH 4C4KO 3T65A 4LMQI 1EMTH 4NWTL 5HI3C 3KPRE 5C09B 3VXMA 1UFUA 1T1XB 3L5HA 4RFOL 1CN4A 2HKFH 2YD4A 3E2HC 5DSCB 1OAXL 1HSAB 1UZ6F 4X8JA 5IB2A 4DN4H 3VRJA 3IAGC 1E6JL 2YXMA 3N85L 4MAYA 3R0NA 4JE4B 5D6DC 4XCCL 4N0UE 2N4IA 3ZDYE 2ICWI 5FIEA 4M1CC 3OKYA 3GSWB 2E27H 1S7SB 2YEZA 4O2EB 4PJ7A 3V6ZB 2X4TA 5I30H 2F74B 3SGEI 2CSPA 3F65A 3B8YA 4GRLC 3H3PH 3SDXA 1XGRB 5IJVA 4X4MA 1UJ3A 2GCYA 3CFKA 5JMOC 1BF8A 2NY2D 3NACH 5F96L 4ONGH 5GS0C 5CP7B 2A9MH 4MD5B 4PP1D 4D9LL 4Y5YB 3PNWA 3W5MA 4LLVA 1KCRL 3SO5A 2M8XA 3RUGB 4DTGL 4P5KB 2ZP0T 3DWTA 5T1LB 1H15A 4NYLA 3MJ7A 2OBGA 1AXSA 3P73B 4YWGL 1DCLA 1MI5A 1SYSB 1JNNL 4TVPL 1UXWB 4OZIE 1NAKL 4PRIB 1MFBL 5EA0H 1S7WA 3RL2A 3PABA 1YNKL 1TENA 4FHBD 2NY3B 2ENYA 3HMXA 3CJJA 5JHDE 4LLDB 4JN1L 4YDKH 4F2MB 1MFAL 1FH5L 3OGCA 1RU9H 1ZHLB 3RL1B 3LS5L 4G3YH 5FGRA 3RGVD 4XPFH 3ARSA 5IBLC 1YPZB 5IMMB 2FB4L 2IH1B 4LHQB 1Q9OA 2R8SH 1NBVL 1G7LA 2RCSL 3QFJE 3SQOH 5KVFH 4J2XA 4OGAC 4IJ3C 1MCOL 4WUKL 3PWNB 1MHHA 3P4OB 3UAJC 2RFXA 5KBNC 1KJVB 3C6LD 4B50A 1S7UB 4Y5YC 2HT3C 1ZWIA 5ISZD 5C0CE 3G6AB 4G6AC 1RQ5A 5I71B 2JJTC 1CDCA 5C0GA 4G8EB 1EDQA 4RDQF 4R8WH 1QR1A 3BKCH 4OD2A 1K8DA 3E1F1 3UO1L 5BVPL 1YZZA 5E8EB 1YEFH 4OCLC 3ULVD 4YBLC 3BEWA 1BFOA 2V7NB 4TVSa 1MCJA 1FRGL 5CJQH 4XGZA 3ARPA 2VABB 4XAKD 2EDHA 5BOPA 1HHKA 1YN6A 1UWGL 4EOWH 4PJXB 4TSAH 3U48A 4K55A 5L8JB 2R69H 5GJTH 2J8UB 1N7MH 3T2NL 1KB5L 5DQDH 4ZNEA 4ODBD 1MY7A 1T7YA 5ECJE 3RU8L 2CR6A 4U1NA 1DQDL 1XMWA 1E27B 1LD9B 3MV8A 5AUMB 1JHLH 5D6DA 1DUYA 5KSAC 4D0CA 4I4WB 1K9TA 1CICB 5GZNC 1FSKC 1I3UA 3P11H 1JBJA 1S9KC 5I71C 1CDIA 3EW3B 4OSUL 4XVSL 1GC1H 2WWMD 1C7TA 1PJ9A 4NN5B 4D3CH 5ADOH 1ZT4A 5TQ2L 3S96A 3U0TA 4GRLA 3HE7D 3I85A 4W6WB 5DO2D 3TBVA 4Z7WE 1RUML 3D2UA 1NBZA 5F7FA 1B6DA 4R97B 1W72B 1QOKA 5CIPH 4WHDA 3IDIB 1I3RB 1OAUH 1WBYB 2ESVD 2NNAB 4ALAH 5ACZB 2AQ2A 1WBXA 1X5IA 1QPPA 1IC5H 5LCVL 2OK0H 5ERWB 5C0BA 4QYOA 4IRZH 5LGHL 2X4RB 4KRPB 4OI7A 5C09A 3HUJE 1LO4H 6FABL 2N7BA 2V5MA 1MIMH 5DSCA 4OGYL 5F8QC 3O2VH 4DVRH 5C86A 1CE1H 2F8VA 4MA7H 4XNUL 4PGDB 1W8NA 4J23A 2PW2A 4UOW1 1LEIB 4IRSD 5CSBA 2OX5A 3QDJD 3TNMB 5C0AA 5J3HD 4PJ9D 4WY7H 5E8PB 2MQ3A 3HLAA 3VXUA 2APFA 5D93B 1OTTC 3GO1L 1S7SA 4O2EA 3V6ZA 3G5YB 3RDTC 4K2UL 3UPRA 4KQ3L 2F74A 5DHVB 3GI9H 3RKPA 3DVGB 1BECA 4H88L 1XGRA 3FCTA 4UT7H 1Y0LB 1NBQA 1GRWA 2ATPB 3CIQA 4R97C 1S5IH 5TJWK 2I24N 1SY6A 4JJHA 5CCKH 1UCTA 2HWZL 5FO7B 1MCWW 1KFAL 3BMVA 4XNMB 1OAQL 5JIHA 4OIIH 2C7UB 4JANA 5CP7A 4JREB 1CT8B 1YMHB 4Y5YA 4JY5H 1F00I 1T03L 2A0LC 4PJEB 2W0FB 5EU6D 5CS7A 5IGXL 5EOTA 3RUGA 2JJTA 4WENB 4XX1E 1LWRA 3S37X 2DQUH 5I0DA 3VE0B 3PGFL 5E9DB 1DZBA 3LSOA 4BFBD 1AQDB 1AGFB 3DVNB 1SYSA 3NCJL 4PRIA 3UBXG 4FQCL 3RFZC 5IB4B 4EDWL 3TZVD 3LEVH 4EIGB 2PCPB 5AYQA 5ISZE 2OI9B 1MAML 5D6CA 4APQD 2UWEB 3B2VL 3QCUL 5BS0B 1XGYH 1JZ2A 1LO0L 1IMHC 4FMKA 4PJDA 3RL1A 1S9WA 4H8WC 1M05A 1LP9A 4L1DA 3ZYJA 2NTFB 4Z8FL 1TJHH 5IMMA 2F54B 5GS2H 2IH1A 1PEWA 1CVRA 3TYGL 4L9LB 3V0WL 1XGPA 1ZSDB 3ULVE 1F02I 3GKZA 3WIIL 1YEEL 2ZSVB 3P4OA 4ODHL 1A7OL 2IBGA 2HFTA 3HFMH 2CO7B 5FYJD 1S7UA 4JREC 4OFVA 5FYJH 5KSAA 1VFAA 3L3DB 4XAKE 2ZG1A 3BGMB 4XNYH 1I9IH 2YD9A 2NX5D 3GUTB 4TRPL 1KPRA 4Y4KC 4OZGF 2BNUB 2DM3A 4G8EA 1EVTC 4S1SH 1CLYL 4NZUH 5IVXF 3WFCH 2YR3A 1IAIL 1KOAA 3L7EB 4ZAKD 3IJSA 3IAPA 3PWPB 4RCAA 1INDH 1FIEA 4XAWL 3O3AB 2IFFL 1RJCA 2OL3H 4MJ2A 4JO4L 4AK1A 3HE6C 3UPCA 2R29H 3HC3L 2Q8AL 5DURD 5ESAB 5HHNB 2YD6A 4QHKI 3WLBB 5F6HJ 1S7RB 1G6RA 3T0AA 4CADA 2VDLH 2DLFL 3ZL4L 4Y89A 4M4PA 5T3ZL 1IAOB 4RAUB 4X6FB 3ZHLA 5J9PA 4ZFGH 4M93B 4HC1L 4EUPB 1E27A 2UY6A 1I7UA 3O3UN 4L3ED 2CXKA 4LEOB 3I02B 3BDBA 1MRDL 4PJCB 4GH7B 2ADFH 3BP7B 1I9RL 2X7LA 1UH4A 5EO0A 3RDTA 4X9BA 4F7EB 4XRCB 1SJXA 4LEXH 3UTSE 5A2JH 2BXZA 1Z5LA 1U8HB 4KK5D 5FHBH 5BZDA 5C9JB 1MJUL 3BPNC 4CVXB 1LE5A 4O58L 2D0HA 1K8IA 2B4CL 2NNAA 5DEGB 3QDJE 5ACZA 3O2DL 3QG7L 3FQTB 2VXQH 4UDUB 3TA3D 3KYMB 5HYSA 4LVOB 3CU1A 4HPYH 4ZFFB 4KVNL 1FG9C 1K5NB 3INUH 1CDUA 5CJ8A 2E3VA 4HEPG 5DMIH 4XCFH 4QY8A 1UCBL 2AK4D 3JXAA 4Z7VF 5MEND 3CVIH 3MRNB 3HC4L 3GSUB 1JWUB 1JUFA 1XGTB 2DLIA 1LEIA 4ZQKA 4U3CA 1XCTB 3NZ8B 2NCMA 5E8PA 1IKNC 1SBBA 3ARWA 1J8KA 1DBML 5B3JE 2MNUA 4XWGL 1A6AB 1IGIL 4MAUL 2C3VB 1NMBL 4U6VH 4YXHH 2LVEA 3W11D 4JO2H 4WU7A 4M6OL 5DHVA 3GMOB 3HI5H 1AJ7H 3DVGA 5C0IB 4GXUM 5F1SA 4X9FA 4CDHA 3MRLA 5IBTH 3O4LB 1D9KD 3F62A 1G7PB 1AGDB 1X5HA 5DRNA 4GAJL 4PRHA 3QG6A 3WL9A 3HI6H 4HIXL 4XNMA 1KUMA 2C7UA 5F1NB 1PLGL 2DBJA 1DBAH 2IANB 4I18B 1MRFL 2D0FA 2Y36H 1RIUH 4PJEA 2W0FA 4MZ3A 5GGSA 4FFZL 1JZ7A 4Y4KA 3UJTH 4F80A 2AQ1A 4JM4H 4K9EL 1GJIA 5D2LF 1WAAE 2H1PH 4MQXD 5D5ME 1DSFL 1AGFA 4K3HA 1KCUH 2XQBH 1Z9SA 3EAKA 1AGEA 4YEFA 2CLVB 2XZAL 3HE6A 3NCBB 5FYJE 2IC2A 3U4EB 2EDEA 3GMMA 1NC4B 4X7SH 2NX5E 2V5YA 5I1HH 4KUCF 2H32B 5JXAH 4W68A 4P2RB 2V7HB 1RZJH 3ILPB 1Z0MA 1NANH 2NTFA 1INEL 1OPGL 4HLZH 5KVDL 4ODSL 2BHUA 2FEDC 4X5XB 5GSRA 5IHUH 4X6DE 4YDIL 4LFHG 2WUBL 4ESKA 3FQRB 5CSZB 3MLRH 3VD5A 4I18C 1TETL 4LCUA 3G04A 3BGMA 3BPOC 2CDEA 1XH3A 2XG4A 4TN9A 2E9JA 3SDCD 1JRHH 1WISA 1RULL 4XMKH 4PJFB 1GGTA 4PB0H 2A6JB 2A74A 1UM5L 2APWA 5DMYA 2QQLL 4TNWF 4V1DA 5LKNA 3K1DA 4L3EE 1WIOA 4LLMB 4K8RL 4ZSOB 2AJUH 5IEHB 5LG1A 5T5NF 1W72L 3TH4T 4WFFD 4YDJA 5B38G 1CK0L 5ESAA 4XMLL 5HHNA 4KPHL 3PHOB 3IVKB 3MBEC 5H37H 4PLKD 4CN1A 1JJUA 2DKSA 2E6PA 2HLAA 5AZEL 4D9RD 1AIFB 2JB6A 1HN1A 1YJDL 4U6YB 2OLDA 4YEEA 1OT2A 2E8YA 3K3QA 4LLWB 1CGVA 3NABH 5EC2B 1OQXA 3CC5B 3KHQA 1QACA 1EERB 3MLSL 5TGBB 4W4OC 4LEOA 3BP5B 1G9MH 4F37K 1EGJA 1QQDA 1WZ1H 4PJCA 1VCAA 5ALCL 1IKNA 1OWRM 1N8ZA 2ZOLB 2NR6C 3BP7A 1PYWB 1Y6MR 1ZHKB 5ID1A 4AIZB 4LLYB 5I1EH 4JRXD 3QEQA 2AK4E 4O9HL 3VRIB 5C9JA 3U0WL 3OAUL 4OQ1A 4CVXA 3QPXH 1H8OA 3F58H 3QJFA 5JPMB 4LHUD 1S7TB 2FJGA 1RZ8B 3KYMA 3Q6GH 3L3OB 2FL5B 3IRZA 3PG2A 5DC4B 4YXLH 4ZFFA 2XWBB 3BESR 4NNXB 2Y7QA 1LILA 1EUTA 3D39D 1WWBX 4N0FA 4J3WA 4BQ9A 4NDMA 4PJGB 3FMGH 4PJIF 4FFWD 1HNGA 2QLVB 4NFBA 3TWCL 4DCQB 4JDVA 1JWUA 5F9JA 1JGLH 3C08H 1OM3L 5HGGS 2J88L 4XP4L 3VFWA 3ULSA 1ZLSL 1DBJL 3I75B 1NCWL 3BEVA 4UI2A 4NPYB 4HMDA 2AXGB 4G8GB 4WWID 1EXUB 4OIAA 4NZJA 4E0RB 1RK1B 2VDRL 3U30B 1UWEH 1PKQB 4QHMB 5HYFA 3IJYB 5IFHL 1WK0A 4PGBB 1Q0XH 4UIMA 4R4BB 5JW3L 1DQTA 1SQ2N 3AS3A 3K0WA 3O6FB 3LPFA 3QXVA 2R2BB 2R0ZH 1A7RL 4P4KB 5CKGA 2X4PB 3P9LA 4FXGB 4KKBD 4NQED 5JMRA 5EC1B 3G5XB 5I18L 1I4FB 2COQA 5EPMB 5F3HA 5EZLA 3QDMA 1NAMB 5JQ6H 1ZKAA 7FABL 2IANA 4I18A 5SWZB 4KZEL 1FPTL 5BV7C 3MODL 1MCPH 1J0ZA 2VO5A 3M8OH 4JM2C 1BBDL 4HWBL 2B0SL 1T22B 4UT6H 4EKXA 5GPRA 1K85A 2NXZD 1CS6A 4YGVB 3O6MH 4OZHE 2D31A 2YUXA 5CBEB 3OL2A 1P6FA 3RWCA 3V4VH 3HKFA 3ZDZE 1P69B 3CVHB 4L4TD 2KUTA 1MREL 1EFXD 4POZC 4Y1AD 4BFEA 1KELL 4OLEA 3T2OA 2WQRA 3U4EA 1QLFB 4AM0A 5I8OL 3GHEH 3W0WB 3QUKB 4QO1A 5L9DH 1MIEL 5GGQH 1F8TH 2HTLC 3MBEA 4OAWA 4I77L 2UZIL 2V7HA 3KYAA 4MCZA 4R6UA 3MLZH 4P0DA 4AG4L 4G9FB 2CGRL 25C8H 4RIRB 2IQAA 4P4KC 1KCVL 2MCPL 3HPJB 4Q2ZB 1G9NL 4WI7A 3PE9A 4W4OA 4OLVH 1RZ7L 4JPKL 1S9VB 1RUQH 4WFFE 2V2XB 4UV7H 4M3KB 5FECB 3CX5J 1N0LA 3TYFA 3WBDA 1BAFH 1INQA 4ZYKB 4CMMA 4ETYA 3KG5A 4K94H 2ERJB 4LSRL 4GW5A 5CEZL 3IGAB 1KTDB 5EBMB 5H94A 5J06A 4KKLD 3QQ9C 4P23B 1FVEA 2EDFA 2EDDA 4NIKB 1AGBA 4OLUH 3T0BA 1RAMA 4LLMA 2EZ0C 3BIKB 4ZSOA 5IEHA 5JA9A 4OI8A 2VL5B 3DIFB 3LN5B 1DUZA 2JE8A 3PHOA 5ITFB 5K59E 3L7FB 4BQ8A 3WSQL 2FGWH 1XT5A 4JRXE 3HRZA 3GIVB 4QGTA 4U6YA 4O02L 5DMGC 2VLMD 1C5CL 2C3WA 2QR0B 4YHOH 5GGRA 5AAMA 3LCYA 5TGBA 3QAZC 3BP5A 3KPSB 3QQ4B 1UACH 1ZVHA 1Q9KB 2R56L 2XWTB 1W0WB 4YGAB 1HDMB 2OZ4A 1PYWA 1MAKA 2YC1B 2ATKB 3DI2B 1MLBB 4G9DA 2XFXB 2DQJL 5D1QB 3NVQA 4NQXB 1V7ML 3KLHD 4X6CA 1GVIA 3BKML 3OTTA 2AJZA 3MJ9A 4WU5B 3GBNH 3GHBL 4LSTH 4EZMA 5ETUB 5L2KD 1T5WB 1F4YH 4DEPB 1QYGH 1EK3A 1RZGB 2VLJA 1Z9MA 5TDPA 2FX9H 2FL5A 1S7VA 3DHJA 4X9HA 1X3DA 4U7SA 2XWBA 4JM2A 4V2CB 4YH6A 4NNXA 1G0YR 4YBQD 1B4JL 1NLDL 1GZPA 4QRSA 1U91B 2I07B 3TFKC 3L95A 3PGDA 3SE3C 5C0EB 4PJGA 5CFHA 3D25B 3EFDH 4HKXB 2GJZB 2ZJSH 2XZCL 4MX7B 1IKFH 4NQEE 4PBXA 4X7CC 4C56D 4DGIL 2I60H 2G5BA 2NY5H 1R24B 3D48R 4Z7UF 4PJBF 2R0WH 2VXSH 4G8GA 1QHOA 2IAMD 1PKQA 4QHMA 3C5ZD 3IJYA 1MCRA 5D1QC 3TESA 2Z8SA 5FEBA 1OSPH 5SX5K 1NMAH 1LK3H 1FGVL 1J0YA 4H0GA 4LCCB 1YDPB 4D9QD 1A1NA 2R2BA 5SWSD 5I8KH 1MEXL 3ZKMC 4AMKL 3DGGB 4P4KA 1TLKA 4FXGA 4JFXA 4DEPC 3FQNB 1JGDA 4L4TE 4PJ5A 4F7MB 5KG9A 5EC1A 4Y1AE 1I4FA 5EPMA 4HWNA 5CJOL 1NAMA 5JW4N 5SWZA 3UTTA 4WIQA 2EC9U 2HKHH 3VFOB 3RA7L 4PRPB 3MCKA 4LRIC 5GXBB 1UQSB 1ZEAH 4QT5B 4HS3A 1JPTL 4L9DA 4OD3L 4UBDC 4MA1B 4N5ED 4WDIA 4J4PD 4ELMF 4LPTA 4J3TA 4PD4K 2WBWB 2OR9H 1VFBA 5E2VH 4BQ6A 3WFEH 5DFVD 1NQBA 4KJQC 3OZ9H 3QUKA 4NN7B 3W0WA 1GGCL 2DI9A 1CE6B 3S35H 3VD9A 2YD7A 3FKUS 3VFGH 4Q6YA 1H3XA 4X98B 4P46D 4JFEB 5DDHA 4QF1A 4F15B 1ED3B 4Q9CA 4LCCC 1T6WA 3FT4A 3QXUA 4KI5C 3Q6FB 2FYYB 4NKIH 1QBLH 4LBEB 4RIRA 4BZ2H 1EJOH 4Q2ZA 2WM0A 3IFLL 4DKEH 5IV2A 3WNLA 5GHWL 3IDJB 1WFTA 2EO1A 2G2RB 1S9VA 2V2XA 4Q58C 5FECA 5BCAA 5K9JL 4ZYKA 2BDNL 1K4CB 3LDBB 4HFWA 1CFTB 3IGAA 5HJ3B 1NH6A 1QSFB 3ARBD 3MRRB 5E6ID 1J0HA 4BH8B 1QLEH 3X3GL 1FNEA 1RJZA 1IGTA 2Q76A 4XP6H 5EBMA 4ZTPH 3ZE1F 1X5AA 2X40A 3TJHC 2VLME 1WWCA 4ONFH 4MA1C 1QRND 2Z91B 5M7QA 4RGNB 3N50A 3BW9A 4X9IA 3VXSB 2CR3A 4XC1L 1MJ7L 1XIWD 2FECI 2VL5A 4Z0BL 4NN7C 3OXRB 4O5LL 5F89A 5E99L 5ITFA 3L7FA 3M17A 4WW1A 3BSZL 2EDNA 3S88L 2AS5M 4F15C 1FDLH 3SE3A 4LARL 3MV7B 5EUOB 4XNXH 2QR0A 4Y4FC 1IGJB 4JY4B 1Q72L 5L2KE 3GI8L 3QQ4A 1MVFA 4RGMB 1BX2B 2UYLB 3DV6B 1W0WA 2XWTA 1HDMA 1MHPL 1P7HL 3V4PL 4P2OB 3WN5B 5JOEA 4TUOA 3NH7L 3QPQC 2ATKA 3MLTB 1PSKL 1DBKL 5FM8A 3ELAT 1MLBA 1U3JA 2XFXA 4JQVC 2EECA 1WUNT 5D1QA 3LDBC 3O8XC 2EH7L 4NQXA 3U1SH 4OCXL 4WW2F 2A77H 4UINL 2R1WA 4WU5A 1AP2A 1V8HA 1U92A 4XPHL 2AJVH 2IPUK 4R26H 1AE6H 3R1GH 5E2TH 3S4SG 2DTSA 4JFFB 1NKRA 4M00A 4Z18A 4TSBH 1KEGL 4U1JA 5F9WB 3LQMA 5LBSH 3HG1D 4PS4L 4I3RH 4R9HA 1DANT 4UNTA 5DLML 4OB5H 1RJLB 1EO8H 3MV9B 1R3IH 3IXAB 3V0VA 3PUCA 4LRIA 4OM1H 1U91A 2ADGB 2I07A 4CU8A 1H3VA 2CIKB 3ILQD 5C0EA 3IDUA 1W0YT 3VI3E 5DJ8B 3B6SB 1RURH 2Y07L 3HHRB 2N1KA 3D25A 4D9QE 2H2SD 5SWSE 2GJZA 4I0KA 3TO2B 4ZO9A 3WKMH 4LCYA 4RGMC 3G6JE 3SKOA 2OP4H 4UV4L 5ANMB 5DQJA 3LEXB 4P2OC 3WN5C 3LH2L 1R24A 1I1CA 5ID0B 1SEQL 2NLJB 1L9MA 4LDLB 1LO5B 4RMVA 4RFEA 1OT1A 4ZODA 4LOUD 4R96A 4CGTA 1XGQB 4I8DA 4NKDB 1CDJA 4NJ9L 1DP0A 4LCCA 3RWEB 3DO7B 3AAZA 3PQYD 5HYJE 3FQXA 2ORBH 4P2QE 4XP9L 5HDQL 3WDIA 3FQNA 3G9AB 4F7MA 1X7QB 4BA8A 3K2UL 3KPRA 3MRDB 1OARH 3S98A 4Y4HD 3WHE0 3MUHL 3SQBA 3P77A 4NN6B 1FP5A 4Z7NF 1BVLB 4DJMA 4LASL 5IF0B 3S4SA 1I7ZA 3N9GL 4S1RL 4M1GH 5BRZD 2BK8A 12E8H 5JUEL 2AK1H 4ODWA 1OAYH 4N0UA 4FQIL 5DVMA 3ZE2F 5ICZB 1JMZA 2Q7NA 1RMFL 4YIQB 3QIWC 4L8DA 4YDLC 5F1IB 3L3GA 1D6VL 1NSNH 1YY9D 4XP5L 3ARFC 1DN2A 1CE6A 2WNGA 1Q38A 2HH0L 3QIBD 1F4WL 4KROB 3WUWG 4DWHA 2YD8A 1FNLA 1HKFA 2W65A 1ED3A 4IIQC 4PJXF 3Q6FA 4LBEA 5JXED 3VW3L 4Y4FA 3GMQA 4NQDB 5MEPA 5C08B 4ACPA 2YXFA 1QRNE 5HHPA 1KLUB 1NEZB 5IK3A 1JGUH 1YNLL 4J1UB 3MA9H 4OM0L 1X5XA 3UMTA 2OXGA 3MPCA 4J8RA 4RMWA 4JQVA 4M6MH 4HUNB 1K4CA 2FR4A 4KDWA 1CFTA 3O8XA 3JZ7A 4CUCA 1H5BC 1WZMA 4BH8A 3EBAA 4OZIA 1CXIA 4W6XB 5DD1H 3KYNB 2CIIB 3NFSH 3MRHB 4PP1C 3WO4C 1GZQB 5JHDA 3WD5L 4E5XB 4NP4L 5DUMH 2YOCA 1A3QA 1CLOL 5EBGA 3OXRA 3HZYB 3T2QA 2B20A 4IS6B 1R3JA 1ACZA 1KULA 4MJID 1EEYB 1GXEA 3LKPA 3IKCA 5J1SC 2QV2A 4KROC 3TO4B 1S7QB 4HBCH 2FD6H 1MWAB 2ID5A 4M43L 4R3SB 3CLEH 3QFJA 3T77B 3WIHL 4HS8H 5GIRB 5ESQA 4HF5H 3WXVH 4JY4A 3GBMH 2E9BA 2Y5TB 1TZIB 3LIZH 1BQHB 4X4XB 3V5HA 2HT4D 5C0CA 5KS9B 5MP6L 3WUWA 1FGNH 4X6EB 4X80H 4OGZA 5I75B 1QTYT 2Q3AA 4P2OA 3TT3H 3WN5A 1TQCC 4ZFOA 1CDBA 3PV6A 1P84J 2VLRD 1A7QH 1NBYB 4M7LL 3WFZA 1KJ2B 5IT2L 1U58B 3J8F7 2PR4H 1I3VA 5J56B 3S6CA 2Z9TA 3H6JA 2VIRB 4NWUL 1BOGB 2ENSA 5DD3L 1FIGL 2HT2C 4HWZB 3A6OA 4PJHB 3ARRA 3RHWF 1RJLA 2YUWA 2GJ6B 2AXJA 3L3JB 3L3KB 4NWTH 4M1DH 4Q74A 3TO4C 2WP3O 3BT2H 3VMPA 5IM7A 3IXAA 3ZE0F 1OCWL 3OGOE 4XHQA 2ADGA 3SJVB 1K2DB 2CIKA 1A1MB 3BPLB 3B9KB 3CD4A 5DJ8A 4OQTA 3JVGC 1H0DA 5CIPB 2L7UA 4ZUSB 2XZQL 1FN4B 4L4VB 3TO2A 1E6JH 1HK6A 4NCDA 5CEYA 3N85H 3DX7B 2DL2A 3QIWA 4XCCH 3T8XB 3VWKB 3VXTB 2H2PD 1SM3L 1P7KB 3N1GC 5M94B 3ARFA 4ODUA 5DI8A 4K07A 2YN5A 5F3BA 1GGBL 4LCWB 4NM8L 4YZFF 1UA6L 1CG9B 4FABL 4LL9A 5TE4H 3ES6B 4D2NA 2NYYD 1JV5B 4IIQA 4M5YL 5IB1A 4YNYB 4HG4K 2BC4B 4XX1G 3RWEA 1KGCD 3DO7A 1U8KA 5FCUL 3MUGB 1U3HD 4KHXH 2CKNA 1VA9A 3H9SB 4IEFB 5HI4D 1HZHH 2YK1L 5F96H 1E4KC 3HUJA 4IMLB 5E8OB 1GC1C 2WWMC 4OBSA 1TZHB 4PB9H 1MNUL 4NHUB 5LQBH 1ONQB 1KCRH 3ESVF 3HE7C 4HH9B 4N1EA 4DTGH 3QWOA 3BAEH 5L6YH 4GW4B 1BVLA 5IF0A 1GHFL 2VN7A 3B9KC 2DBLL 3QHFL 1H5BA 3C2AL 1OP5K 1IBGH 1ZHBB 4WEMB 5I1KH 2XPGA 2CH8A 5ILTH 1MJJB 1NAKH 4YIQA 5C0JB 1MFBH 3DX8A 3VWKC 2X1XR 5F1IA 1YMME 4H0HB 3NIGF 3ZT5A 3PP3H 4JN1H 2VMFA 4U1MA 3TIEA 3MV11 1MFAH 1J0JA 1U8PA 4JFDB 2F9BT 3H7LA 4G7YH 5D1XB 2F53D 4NO0D 3VFVA 2FB4H 3B3IA 1NBVH 2MQ0A 2RCSH 4GXUN 1KEML 1JN6A 3Q1SL 5HHME 3U0PB 1KLUA 2EIBA 4P3CH 5GJSH 5E6YA 1NEZA 5CD3B 2QADB 5I1DA 2HRPL 3DVIA 4ONHB 1AKJD 4IDLA 5GRJL 4WO4D 5FDWB 2F58L 4LK4A 3GJFH 5IW3A 1LO3L 5AG8A 2PETA 2AI0L 4WWKD 3OHXB 3UO1H 3MQIA 3CSYA 5BVPH 3LS4L 1QSED 3TV3L 2DL9A 1DE4B 3NTCL 3KYNA 3QEUA 5ABDE 5JW5B 1EHAA 1B88A 3ALPA 3MRPB 3P0GB 5IFJA 2VITB 4NQSA 1D5XA 5ISZA 4JHZA 4JKPH 3MFFB 2Q86B 1C5BL 4LRNL 1UWGH 3RI5F 3P4MB 2FEEL 3HS0B 4Q7DA 1EEYA 1QBBA 1T3FB 5C0RL 1Y6NR 3TO4A 1S7QA 2D2OA 2VLRE 1FNAA 2A6DB 5LGJB 1KB5H 2XACC 3C60D 3T77A 4XPTL 3VXMD 4O2FA 2ZUTA 4X6DB 3JVGA 5D7IB 3RU8H 1NGWA 3EYVA 1TZIA 1T04A 4NQCB 2JB5H 3TZVC 5FO8A 3OV6A 1C08B 4APQC 4MAYD 4Q9RL 2GQHA 5JZ7D 1FJ1B 5EUKB 4MS8D 2X09A 4QHUB 4UOW0 5MEQA 4BJLA 4FQ2L 2EYTA 4GBXD 5BJTA 4XVSH 5GRZA 4E42B 1A4KB 1YYML 3T3ME 3T1FB 3LHPH 4QTIL 5CJBA 2HFFA 1HH6B 3LRSB 3O3DA 4BYHA 1MCHA 1RUMH 2BERA 3SGDH 1U58A 2RB8A 4ZOEA 3GMPB 2IBBA 4JRYB 4PIRF 4LVHB 4QRRB 2QHRH 4XP1L 1CDGA 4XNZC 1S78C 1BOGA 1E4KA 3P9WB 5LCVH 2A6IA 3L3JA 1FFPB 1I8IB 2R1XB 4OFDA 3HE7A 1IL1A 4WHYH 1MCSA 2QHLA 1K2DA 4LSQH 4WGWB 2P8MA 3B9KA 4U1SA 2QQKL 5DVKA 2IPKB 5CIPA 3ZTJH 4NKMA 2X10A 4Q6IC 1KGCE 3MRBA 4HAGA 3VFRA 1NGPL 5KN5B 1P1ZB 1ZT7B 4XNUH 4Q9QH 5DT1L 5ACMA 1P4BL 5A2LH 3DX7A 3D18B 1MI5D 3VWKA 5J7CC 3VXTA 1EHLL 3IF1B 4X9GA 1P7KA 4EI6B 4F7CB 5J13B 3UTSA 5TFSH 1VERA 4LCWA 4CRPA 4K2UH 3P0VL 3ES6A 1JV5A 2F5AL 5F6HI 4LQ1A 3QISA 2BC4A 3QDJA 4MNQE 1A21A 1YEKL 3S5LB 3MXVH 4XCYB 1GOFA 4UZGA 4LVHC 1MCDA 2A9NL 4HUXB 3ZSSA 2E7MA 1OAQH 4E41D 4IMLA 1C16B 2XN9D 4MXVE 4BSVA 1TZHA 1LQSR 1ONQA 3A6BL 5IGXH 2QBWA 4KK5C 1FL6A 2DWDA 4ZUUB 5D2NB 4U6TA 4YHML 4ISVA 2DIAA 1A3LL 4TQEL 2F53E 3PGFH 1GAFL 3CH1A 5FV2A 1ZHBA 5L88L 4GSDH 2FX8L 1MJJA 2OJEB 3NCJH 2FNBA 2NY4C 5FA4A 4FQCH 2AQ3A 1PQZB 1J1XL 4EDWH 3RVXC 2GI7A 3WXWL 5GZOD 5J13C 1Q8MA 1OGTB 3I9GH 2P8LA 4B41A 3NAAH 2D0GA 3WO3B 3B2VH 5D72L 1LO0H 4PRAB 5A2FA 4JFDA 1U95B 5DR5H 2LV4A 1FNSL 2CRZA 4JVPA 5HI3D 3PL6B 1KF9B 4Z8FH 3RZCD 3KPTA 1MWAL 3MOAH 5EZJA 2YA1A 1QSEE 3KYOB 5F7LB 2VZOA 2ICWJ 1YEDA 2JTDA 4HEME 1YEEH 1ZLWH 3TZVA 3THMH 1A7OH 1NFDF 1KPVA 2WAHA 4X5WB 1V7NH 3GSVA 5HHQB 3RY6C 3CSBA 4Z5RA 4APQA 1XZ0B 3IDGA 3W11C 1A6VH 5T1KB 1T0PB 2N56A 1WAAA 1OP3K 4XZUB 1D3CA 5D5MA 5D2NC 1CLYH 2R4SL 4WI6A 4M1CD 3QJHA 1MQKL 1F6FB 4A6YL 3E6HB 2AEPL 3IYLW 5JW5A 3LY6A 4HGKC 3MRPA 3D2UD 4XAWH 1ORQA 4WRLA 3L3HB 3MFFA 5HYQB 2KQMA 4U1GB 3F5WB 2DQCL 3HC3H 5IHZA 3RTQB 3P4MA 2D7OA 2Q8AH 2UVFA 1O5DT 3QH3B 5CKAA 5GS0D 5GS0H 3VFUB 4P48A 1P53A 3S34L 2A6DA 5LGJA 2Q1EA 5C09D 4JKWA 2DLFH 3BH8B 3MJ8A 1F58L 4X6DA 5CP3H 5T3ZH 5EU4A 4Q6IA 4MQ7A 4HC1H 1EEZB 2LAAA 5JIPA 1NDMB 3AY4C 3QFDB 1FJ1A 5F7MC 4PV8A 4QHUA 5DRWB 1RZJC 5IWLC 4MLSA 4NBZB 5IB5B 3RAJL 1TVHB 1A4KA 3GK8H 1AD0B 3VFMB 3BQUB 5MHSD 4JRYA 4XT1C 5DK3A 5HY9B 4O58H 3DARA 5FYKU 3SKJH 2B4CH 3D0VA 4PY7B 2GITB 3O2DH 3QG7H 1MI5E 1A6UH 1AO7B 1HWHB 1QFUL 4HLJA 4OGAD 4IMKC 1D5ZA 2R9HC 3RTQC 4H8WL 3X11B 2A1WL 4FP8H 3SDCC 1FFPA 4O4YL 2EDQA 8FABB 4KVNH 1ZV5A 3O6LL 4ZUWB 1HI6B 5EN2B 5IMLA 4FQQA 3FQWB 2D03H 3WIFB 1CFSB 4JJ5B 3V6BR 3BZEB 3BZFB 5T1LD 4LLAA 1U93B 3HC4H 2D9QB 1J1OL 1JPGB 1L7IH 2GW5A 1I8LC 2W38A 3V4UL 4WI4A 4KHTH 3TBWB 2W0PA 1KACB 3BFOA 3IS0X 3T4YB 3H3KA 5F9OL 4PRID 1DBMH 3IF1A 4E41E 3C8HA 4PLKC 4EI5B 2XN9E 2NY3D 4MD0B 3EYUL 1NMBH 5JHLL 2AK4A 4KGLA 1IFHL 3IRPX 3MBXL 5INDA 1JHKL 3C8KA 2W9EL 4ELME 3OBAA 1I1AB 3EUUA 1G9MC 2P49B 3IXTA 3TT1L 4OLWL 1JHTB 4JDTL 4XCYA 4X7DC 4HLZG 4HUXA 3U36B 4HJ0D 4PBWD 5C7XL 3RY6A 1N5YL 5D7LE 3ZYIA 1PLGH 3MREA 5IW6B 3I6LD 3GM8A 1T4KA 3SKNA 1YQVL 2YKLL 4XBEH 2CJUL 4NO3A 5D2NA 4ZUUA 3LD8B 5LJYH 4K9EH 3RWJB 4K3EH 3KYKL 5E2WL 4ZS7H 1K6QL 3QYCA 3Q5OA 1MUJB 5ADPH 35C8H 5EIVA 1UJTA 1DSFH 5LAXB 1KTLB 2ITDB 1PQZA 3BMWA 4OBRA 1HINL 1VACA 2OXHA 5F70A 4ZPVA 4NRXA 2OSLA 4B5EA 3ZE1E 3K8MA 4PRAA 1PZ5B 4FQJL 1FFNA 5D71L 1MVUB 3LOWA 4NO5B 5H37G 5EZIH 5B8CB 3WV0A 1INEH 1OPGH 1HHGB 4LGPB 2ARJB 4GFTB 4X7TB 2NZ9D 4EXPX 4ZD3H 5KVDH 1U42A 5CILH 1LE9B 4JHBA 3O6KH 4LSVH 3HAEG 3O3EA 2FLRT 4X5WA 5KSBE 5F88B 2WUBH 3LZFH 3PWVB 5D9SB 4WI3A 5IEKB 1XZ0A 3AY4A 4CMHB 5T1KA 4YX2L 5IWLA 3CXDL 4OZHA 4XZUA 4TOYH 4Y16B 1JWSA 4NC2B 4UNVA 4WEUD 3EIFA 5C09E 1HHIB 1I1RA 3D85B 1AR1D 2OR7A 1KENH 3GSXB 4KKBC 5T3ZE 4NBYB 4HWEL 4PREA 2VDQL 4KRMB 4JQIL 4K8RH 3KNBB 3L3HA 1W72H 4IMKA 4JKLA 3RTQA 4Z78B 3QXDB 1CK0H 3QH3A 3F6LA 4XMLH 32C2B 3SDCA 2NXZC 1YEHL 2A0LD 2D7NA 4HHAA 5AZEH 1Z9LA 2CK2A 5JIIA 5KTEL 5DQ9B 2JCCF 3BH8A 2BSSB 4JPVL 1ULVA 3QZWG 1YJDH 2WMPA 1J18A 4ZDHB 5DS8A 3UYPA 2AXFB 4PJAF 1EEZA 3NMEA 5MHSE 1I8LA 3MLSH 3MFGB 1KIRA 4IOFC 3CDGB 1NDMA 2XWJA 2AP2A 1CL7I 1ETZA 4QTHA 4CMHC 4XNQA 2AEIT 3DX9A 4G6KH 5D7KD 2X4NB 5DHYB 5IB5A 2ZCHL 2BSTA 1TVHA 2NW2B 2Y23A 1OF2B 5T33L 3QRFM 1AD0A 3FOMB 4XB7A 3RUGE 2BSED 4YPGA 1BLNA 5CZXC 5DHVH 3U0WH 4WHTB 1A02N 1RZFL 5DD0L 5FB8B 3KJ4C 3IFNH 1HOCB 1FVCB 3GDBA 5C8JB 2J6EH 2HVKA 3GNML 4M5ZL 4PRIE 4HIHA 3X11A 3KPMA 3LV3B 1ZANH 2VSDA 4HUKB 3W2DH 1A3RL 1DDHB 4PJ7F 2NY0B 1HI6A 3R06B 5EN2A 5JTWA 1JGVL 2BY1A 2GUOA 4OGXH 4P3DA 4KKLC 3FQWA 2K7PA 3SDXF 3OKLB 4UNUA 2UY7A 3BZEA 3BZFA 5L0QC 3AC0A 4M61B 4LHUA 5CINL 3TWCH 4HBQA 5DD5L 1P7QB 3UYOD 2R2EB 4Y7MA 1CXLA 1YPZE 2J88H 4XP4H 5E9DD 2CPCA 1OB1B 4QHKJ 1PG7W 1ZLSH 3EFFB 1L7TL 1KJ3L 1XF5A 43C9B 4R0LB 3QEGH 1I7RA 1FV1B 4RGOL 3QZWA 3REWB 1SBSL 3I6LE 3KLAB 4N0CD 3G9VA 1ACYH 2VDRH 3I2CL 3L9RA 5EDXA 1IEBB 5E2UH 3QDHA 1N3NB 3SPVB 1NCCH 5BS0D 5JW3H 4X5LA 3CH8A 3GKWL 2A6KB 3RVTC 1EHNA 1EFQA 3T04D 5DFTA 4PG2C 4R90L 3OX8A 5HHOB 4RAHA 3V2AR 1A7NL 5KJRL 5I18H 4X83A 5IW6A 4XBGA 1RFDL 3IT8D 3RIFK 7FABH 4EBQL 5B39B 4CAGA 4KZEH 1FPTH 3H8NA 3MODH 5ACLA 2NY0C 4HWBH 5EU3B 2B0SH 4NRYA 3O2WH 4HT1L 4PJXE 5HHVL 3RWJA 2P47B 3LN4B 4XMPH 4YHIB 1P2CA 1C7SA 4WJ5B 3SDAB 3STBA 2J8UE 5HGAB 3P30H 1XEDA 2YHGA 3KPNB 4JG1L 5LAXA 3Q2CA 4U3XA 3OPZH 3S7GA 1HHHA 2ITCB 3PWPD 1MREH 1OSZA 5I76B 1KELH 1A7PL 3MNWA 1JPSL 2ZG3A 2A83B 3AREB 3MRKB 3CZJA 2XYCA 5L2JA 5I0ZA 4LGRB 2EYRA 1MIEH 1FO0B 1TDQA 4WTWA 3EYQD 4JZJB 2XTLA 4P2QB 1T21A 3OJDA 4NO5A 5D96B 5H35B 2FO1A 1AQKL 1CI5A 3EJYD 5CGTA 3PJSB 4L4TA 2CGRH 2WUCL 2ARJA 4HS6A 4HIEA 4M6NL 4Y1AA 5DRXA 5JLZA 2MCPH 3PWLA 5I16B 1QG3A 2H9GB 1LE9A 2NY5C 4X4YB 3H7BB 4EUPH 3VA6A 1RZ7H 3PWVA 5D9SA 1XF4B 4J3VA 1XF1A 2IAMC 5IBUB 4G42B 5SV4A 5IEKA 3C5ZC 1X44A 1ZAGA 4LPYA 1WZLA 5EUOF 2BNRB 4FFYL 4X4ZA 1E4WL 2DWEA 4JKKA 4I3SH 4U1IB 2DMBA 1CBVH 2Z93B 4MJ6A 4LSRH 1I7TA 5CEZD 5CEZH 1QR4A 3ZT7A 4P4RB 4RRPG 1WTLA 3VFTA 3DBXB 3GSXA 3X3FL 5GSVB 2AEQL 4OZGB 1FVDA 1TVBB 3CDFA 2X1WL 3CLFL 5IVXB 3H9ZA 5TPWL 5DEFB 3TH2T 3C09C 1IC4L 2BSRA 4G6MH 3AREC 4RA3A 2AXHA 2VLLA 3BGAA 3MLVL 2AJXL 4RWYL 32C2A 3VCLA 1EO5A 1HXYA 2XNAB 2YA2A 4JZJC 1MF2L 2VDMH 1IGYB 3BKJL 3EGSA 5TH2B 3FN0L 1IM3B 1NANI 5E00B 5GRWA 4O02H 3HR6A 4J4PC 2BCKB 2AXFA 2HJLB 3RNKA 2VWEC 5BV7L 1RUPH 4QXUL 5DFVC 2DB8A 3DPBA 3DYPA 4DAGH 1QFWI 3JWOC 4TPRL 3VMNA 1IC7L 2EDWA 5E2JA 5ICXA 1M7DB 3HZMA 2X4NA 5DHYA 2X2YA 1DQML 2NW2A 3SN6N 4PJEE 4U1LB 1PD6A 1Q9WB 2IJ0C 1V7MH 4RAVB 1RVFL 5FOBB 1ADQL 2W9LA 4FRWA 4M7LT 1M71B 3RIAF 3GHBH 4IOSD 4PG2A 2ED8A 1FVCA 1VPOL 2VZSA 1U8IA 3O4LD 2FEDD 5E9DE 2G9HB 2AW2A 3UTZB 3TBYB 1VESA 4JY6A 4DKFL 5FGBC 2HG5B 4GKZB 1V3MA 3QDMD 1MRCL 5EULV 1DDHA 5KVEL 2IAND 1I1FB 3R06A 5E6IC 1JZ8A 1B4JH 1NLDH 3CNKA 1I3GL 5IJKC 3LN9A 1DQLH 2UWEE 2O5YH 3OKLA 5BS0E 2Z8RA 1D5MB 1DQJB 1H8SA 4M61A 1NFKA 1HIML 4C54A 3TVMB 2EEAA 2F54E 2YS4A 2XZCH 1ZT1B 1OB1A 3VFSB 4L8SB 3EFFA 4Z7VB 4DGIH 3P9MA 1JNLL 43C9A 4H1LG 4DW2L 4OT1H 2FO4B 5D1ZB 3REWA 1WITA 4JZOA 3KLAA 5SX5H 1E6OL 3UYRL 3ARYA 1I1YA 1IEBA 1YEJH 1NC4D 1ZA3A 3O11B 1U6AH 3NCFB 5FHAL 1T7VA 3TIDB 1J11A 4KTEL 3NFNB 2Q8BH 1FGVH 3MBED 2HFEB 2H32H 4UMGA 5HHXL 4P2RD 2A6KA 5CD5C 2BJMH 3IDYB 4JEGB 2QQQA 4RISH 1A64A 4GRMA 4F58L 3NIGE 2MSPA 5HHOA 4HUWB 1T1YA 2PXYB 5CZVH 5I73B 3PWPE 3LRGA 1EZVX 1JIBA 3DUHA 2BHYA 2ZUQB 4Q97A 4PYGA 2IAMA 3FONA 3C5ZA 2OTUA 2CUIA 1WC7B 4QCIB 1PZUB 2NR6D 5EU3A 4PJDF 2AEWA 3LN4A 4DGYL 1MFEL 4WJ5A 5SWSA 3PGCA 1LP9F 4MDIB 2VERN 3SKMA 3AXLB 2DICA 1T0MB 3G6JA 4YHKL 3VFNB 3GSOA 4PTTB 1JPTH 3L5XL 4H25B 1FQ9C 2ITCA 1WEJL 5EFIA 4GXVH 4L8SC 4S0SD 1G7JB 5C2UB 5D2LB 3AREA 3R4DA 4M4RA 3O9WB 1GGCH 4PJCE 3ILQC 1FO0A 4HV8B 4XVJH 3FOLA