4GUQA

Structure of muts139f p73 dna binding domain complexed with 20bp dna response element
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
200
Chain Sequence
b'EFIPSNTDYPGPHHFEVTFQQSSTAKFATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*GP*AP*AP*CP*AP*TP*GP*TP*TP*C)-3')
publication title Transactivation specificity is conserved among p53 family proteins and depends on a response element sequence code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 36
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4guqA00
4QO1B 2X0UA 3ZMEA 4G83A 3IGLA 2AC0A 3Q06A 1CO1A 2BINA 4AGPA 4AGQA 1GZHA 3WTVA 2J6WA 2J1YA 2WGXA 5ECGA 2RMNA 4IBSA 5AOJA 1CMOA 2J21A 1HJBC 4L0YA 3Q01A 4LO9A 1UOLA 2MEJB 5AOLA 4A63A 3WTUA 5AB9A 3D09A 3WU1A 3Q05A 2GEQA 3KMDA 4IBZA 4IBVA 5A7BA 1KZYA 2AHIA 1EAQA 3WTWA 3VD2A 2X0VA 4L18A 2OCJA 4IBWA 4LOEA 1T4WA 4MZRA 3KZ8A 1H9DA 4IBTA 4KVPA 5KBDA 1E50A 3QYNA 5LAPA 4AGLA 2J1WA 3WTSA 2YBGA 2J20A 4XR8C 2X0WA 4L0ZA 1LJMA 2H1LM 2FEJA 1EAOA 5G4MA 2P52A 3US0A 3EXLA 1YCSA 3IGKA 2BIPA 1TSRA 4IJTA 3D06A 1IO4C 3D07A 1TUPA 3WTTA 3D0AA 3D08A 3QYMA 3D05A 5G4OA 2BIOA 3WTYA 2VUKA 4G82A 1GZHC 2IOIA 4GUOA 4AGNA 5AOMA 3US1A 1EANA 2BIQA 4AGOA 4GUQA 1HU8A 2J1XA 4IBYA 2IOOA 3EXJA 2IOMA 5AOKA 1HJCA 2ADYA 2BIMA 4LOFA 3VD0A 5BUAA 4MZIA 2XWCA 5LGYA 5G4NA 3TS8A 4HJEA 5ABAA 3WTXA 4AGMA 2J1ZA 2PCXA 2ATAA 4IBUA 5AOIA 4IBQA 3VD1A 2XWRA
chains in the Genus database with same CATH superfamily
2DJMA 2PYEA 3H6JA 5E08L 1FPTH 3ZYOA 4G83A 2VLJD 4ZMNA 3HZYA 4G8GD 1W15A 1AZVA 1ETZA 2BSEA 2WBJC 2XKNA 1D2OA 3TV3L 1OSZB 4EI6A 3E6FA 1MQ8A 5FV1L 2WKOA 1C5CH 3ZTNH 2LW3A 1JD7A 2EDWA 1V10A 2WQSA 2JIXB 1JRHH 3L9YA 1XIWB 1I7TA 5DS8A 3DSFL 1J10A 1SN0A 3BX7C 1B6DA 3C09C 2VXVH 4IMKA 2XY2A 4JM2A 5ALCL 1DEDA 2UZXA 5KOVC 1NUGA 1SJEB 3QCUL 4KTDH 2W92A 1X5XA 3EF4A 5L4FA 5DJXA 1ZK9A 4NRZA 5KAQF 5I6NA 3QEQA 4PRAA 3SKMB 3T1FA 2EINB 4ZSOA 5IFHH 1OP3H 4HJ0C 4MX7B 4ZTOH 3QZBA 1J48A 1CN4A 4FNQA 4X5WB 1NCTA 5IUSA 1ZRUA 3UTTA 2VGLM 2ZCHL 3QYNA 3ELAT 3ARQA 4P4KD 2KLSA 3RNKB 1U8QA 1SLVA 3KHQA 5K59E 2GJ6B 4UDTB 1ZLUK 1CC3A 1N6UA 3OVUB 5HDBE 5IW6A 3QFDA 2Q10A 2NZ9C 1U8CB 5D1XC 3RIFF 1D9KC 2VISA 5EEVA 1ZY9A 1HX0A 2Y5QA 4XPAL 4Z7QF 4J4PC 5KSAC 3B7TA 1NLDH 5DS2A 1WFNA 3KJ6L 2YMOA 1HSBA 4C59B 3VXSB 3NQKA 2WSDA 5FYJD 3CN4A 3FU5A 4LPCA 2XXFA 1QLEB 2MQ3A 4X4YA 2X9ZA 2ZUQB 4WWKD 1EZLA 2IAMD 4XNQA 3WHXA 1N67A 2ALAA 1QZNA 4JN1L 4P3CL 5IREA 4CSPA 3VRJA 1S7WA 5H37G 4FCAA 3QA3B 6PAZA 5J3HD 4TLUA 3TBTB 2F08A 2FHBA 3DPDA 2FX7L 4N8UA 3ZE1F 4UTBA 2XZQL 3ZDZF 2NYYC 4TNGA 1MSPA 1TFHA 3MV7E 1A4KA 5EU4A 3ZHFA 4PP2B 2FO1A 5DJAA 3L3HA 4NWUL 4V1DD 3BZEA 1UT9A 2F19L 3QVAA 2WC7A 2JVUA 1J1PH 2BVPB 4LOFA 1BVNP 5LBVA 2NUPB 4XI5D 2BPBA 1INEL 4BXSV 2KPWA 3P4OA 4FNLH 5CINL 2WXNA 3PDGA 2PW1A 4OD3H 5D6CB 4ZNEE 1S7UB 1QO3A 1F4WL 5T1KB 2UXVA 3MI6A 2JI1A 4LL4A 1KYFA 3OWRA 4XH2A 5DMGC 3T0WA 2AQPA 4U3HA 1LDSA 3GSNA 3MCYA 3REVA 4OFQA 1KLUA 2V17H 3VFVA 5EEXA 3ZL1A 5L2KE 1Z7JA 4GSXA 4AVIA 2VZUA 2HT4D 3T08A 1JTTA 8CGTA 4NWTH 4YHIA 2HVJB 3IJSB 3M86A 2YQBA 1HOCA 3P9LB 5EORL 5I23A 2NNRA 1NGYA 4IK7A 5FYKU 4S2SA 2NY7H 3MV9E 4YZFE 1WG3A 5CJ8A 4EIBA 4HXAH 3EJYD 2FSEA 5D7IE 5C07B 3BGAA 1CU4H 3VRIA 1JTOA 2N3JA 1JZGA 4HUCA 1PZ5B 4FZEL 4UTBH 3SBQA 1ROWA 1HHKB 2CMRL 3BAYA 4ODVH 4HJGA 3QUHA 4R4FL 5LBSH 5DD3H 1P4BL 4B96A 2XZAL 4Q6KA 1U42A 1ZE3C 2WXJA 4LKCB 1X5AA 4UIMA 3HNSH 4ZAKC 5GRVK 1LO0L 3HMWL 3QBTB 1U8MA 2J3SA 2QHRH 4BJLA 4NAMA 3V5KB 1R3KA 1NFAA 3MR9A 4UTAA 2PMZA 5TDNB 1FVDA 1ZLSH 5CJ5A 3HRPA 3L6FA 5E8PA 5I0YA 4XCCH 4L37B 1G7IA 4WGVB 1DVQA 3CSYB 3K8KA 1IBZA 1B88A 2HMIC 1T22B 4PRIA 5ITFB 4BSJA 1IZJA 4CN4A 4DGVH 1Z9NA 1DR9A 2YPLA 5F1OB 1AIZA 1BM3L 1LM8V 4YFLI 2BSCA 1NL0L 4K8RD 4RESB 3TBYB 5AG8A 5JHDD 3D08A 5IB1A 3ZE0E 1KXVA 4BWTA 1CFNB 3MPCA 3P9WB 3WN6A 1KBPA 4A38A 4U6YB 2R7EB 3T0ED 1VPOL 1WP6A 2BP3A 3N06B 4M5ZH 5C6TL 4G5ZL 3U7WL 5A2BA 4GIPD 5FW8A 4GUOA 3GRWA 2NLJB 2EDXA 5D1XE 5FO8B 3AREC 3MFGB 2WVTA 3OAUH 4FQXB 4Z3GA 1JWSA 1XR9B 3B2UC 2F54B 1EXGA 3VFOB 5K9KB 1RUPH 1A6ZB 1JBJA 1NBCA 3QIUB 1KCWA 3CZJA 3SPIA 3C75A 5JOPE 4ATWA 3VD5A 3TEYA 1MXGA 1CD0A 5H2BB 3QXDA 1QFWL 1YECL 1MWOA 3WCYA 3KBHE 2X1PA 3TLRA 3T2PA 5I16B 1TTBA 5F93C 3GBNL 4NQCA 5B38B 1MDAA 2EO9A 3JTSA 1UVQA 3O6ML 1RZKC 2G75A 2H3KA 3UIYA 2OJEA 4U1JA 3EFDH 3W1ZA 1VHPA 4RWYL 1A14H 4BBWA 4HZAA 1GZHA 25C8H 5HVGB 1O5DT 1B6UA 4U3SB 3ZZ1A 4CNIA 5AVWB 5E2UL 1EFQA 3WFDH 1U95A 4Y89A 2F18A 2VUOA 1PY4A 3Q01A 1MJ7H 5DI8B 3WE6B 4FYRA 3TV8A 4NO0A 2GK0B 2QQKL 2H1PH 3TO4C 1KJ2A 3KPRD 3LPFA 5FAAA 1NIAA 4QRSA 4ZFGL 2OJZH 4K3DH 4JZOA 4ALAL 3HB3C 4P46A 2VDLH 4DEUA 3G5ZB 2DM4A 2COVD 3VWKC 2B4CL 1JNNH 3X13B 5LG6A 4KVPA 1L3NA 2CO1A 1IAMA 3B4NA 4TUJA 3WDHA 1CL7H 2W8CA 4IGBD 5DRWB 4JFPB 3PAYA 5E08H 4TTDC 2VDNB 4G42B 1AAJA 5DUBA 3BVWA 1I1CA 3O4LE 4XR8C 5CGBA 4DEWA 3AT8A 2EDDA 1BQ5A 3ETBJ 4WO4B 3TV3H 5D7LB 2E7BA 2WZ6A 3B2VL 3HPLB 1RL1A 1F00I 1T20A 3W9EB 4CU8A 5BO1L 3HAEG 1A7OL 3UCQA 4MA3A 1T5XA 4Z7UF 3BUBA 4JDVB 3CLFL 3DSFH 3DX9B 4KROC 1UJ3B 3EYVA 5AL8A 5CIPB 1PKQE 1FNGA 3L3OA 3QCUH 3B9VA 3QFJA 3GZKA 4QRQB 4Y2DD 4XZUB 4B9FA 2OMBA 3SYAA 1XCTB 1EH9A 2QADC 3ARUA 4M1DL 3SYQA 3G3LA 3QRBA 5DK0A 1MJ8L 2BIQA 3DBXB 1I7ZA 1S8DA 2OZ4L 4F24A 5TTRA 5EOTB 2H4EA 4KKLD 4AUYA 4R83A 4U1SB 1AQMA 4DPAX 1QI5A 3PYCA 1A6VL 1NA8A 5BV7B 2ZCHH 3N1GC 2UWEF 3G04B 3VFWA 4EN2A 2AK4E 2Z92B 3CQQA 3CXDL 4PG2C 3RB7A 1QSFE 2V5YA 2YKLL 1C7SA 2BSSA 2PPFA 5D72L 4XPAH 1X5KA 4D8PA 1JK9B 5F0LB 2YAMA 2G9HB 4CW1A 4KMQA 2WTOA 3KJ6H 4Y5YB 3V9CA 4K5NA 3VACA 2D7NA 4N3UA 2NSXA 2ZX7A 2IDUA 2EEXA 5GHWL 4YBHA 4JN1H 3F5WA 1KLFA 2O4EA 4M8RA 4P3CH 5EH1A 3RL2A 2EACA 5DD0L 4K8RL 4A67A 5A43C 5EF0A 1BQSA 3L17A 4CMMB 1TYEB 5CSZB 1JZ4A 1XB6A 4DPBX 2FX7H 3NZ8A 2XZQH 4F7PB 4ZZKA 4LHQB 2HRLA 4HW6A 3CMOL 4NWUH 3EYUL 3NA9L 3LX9A 2F19H 3D85B 3DPBA 3QUZD 4G80B 3B83A 3B9AA 4ODBD 5BRZD 3H3PL 4QRPA 1PLGL 3V4VB 2VR7A 3Q1EA 1INEH 5FDYA 2WGNB 2EE2A 4OZFG 3CFTA 5FLVA 1KCVH 3DGCR 3V0VB 2JCWA 4AK1A 1XCXA 2V2WA 3BJLA 1F4WH 5DHXB 5KBDA 5FEBA 3B7RL 3SCMD 2VMEA 1QRKA 3GMRA 3GTTA 4KZCA 2R27A 4V2BA 4Y1SA 4PREA 4PV8A 1IM9D 4AQEA 3ARGB 3L5XL 5E51A 5GS0C 3H85A 2VLJA 4HV8A 2QSQA 5ES4B 1WFTA 5CHNB 3JWDC 5CJQL 3GEWB 5EU6B 5G4MA 1YN7A 2LLLA 3IMVA 4OBRA 4PJ8A 1H6EA 4XWOD 5F7YC 5AW7B 3A24A 3PJSA 5EORH 4YHNB 4EXKA 3L54A 1O6VA 2WNGA 5GS3A 2M1KA 3WTTA 1NOFA 2BCMA 2J8UF 4JZJA 4ZPTA 2ADJA 2DM7A 3OXSA 4CC4C 1IC4L 2C1OA 5D8JL 1U8OB 2H1XA 4PS7A 3NPSB 4AX3A 4MCMA 2GJJA 1OAQL 3X11B 2CMRH 2GT9B 4BKLB 5DRNB 5I1DA 4R4FH 1DJXA 1WGVA 1X6LA 1P4BH 4CMHC 2XZAH 2IADA 2OA9A 4NQSB 5JLZB 4DTGL 5IROC 4TUOA 5C08D 5A16A 3KWUA 2FX8L 1LO0H 3HMWH 3MCKA 3BEWB 3PP3H 1OAYL 4JEGB 3WS3B 4ZNCD 3WNNA 2NXZD 4B7IA 5AAMA 3O8XC 4BHUI 5C3TA 5SV4A 5DK2A 5SWZE 1S9KC 3PRZA 5KJRL 1EXUB 3WDJA 4EIZC 3PHOB 2RA1A 2LVCA 3E8VA 4I1RA 3HS8A 2KYIA 5F7LB 3WD5L 2D0HA 3QDAA 1HZHL 3REWA 4N2FA 2EXWD 4NUJA 1BM3H 5DVPA 4BFRA 4EI5A 5IG7A 3RWGB 1NL0H 1TTRA 1SLWA 1G7HB 1WAEA 4N4YB 3RZCA 3CFNA 2JCCA 4AGPA 3RPBA 5KSBE 1CE6A 1WCBB 1CXEA 4K4KA 5C9JB 2IAMA 3KYKH 5KZCB 1I9IL 4EZMA 5GS1A 3BZDA 1BEYL 2ICWB 3K91A 5C6TH 4EZJA 4G5ZH 3U7WH 4KK9D 1JF1A 2A0LC 2L7JA 3I02A 3RI5K 1XZ0A 4G8EB 1YZZA 3EH5B 1X5ZA 4UF7C 4JFOB 3EYFA 4FA8A 4KKQA 4CJ1A 5HHMD 2C9UA 4V1DA 1I8LC 1O75A 4LSUL 1E3ZA 2J4WL 2MRYA 4WNSA 4F8OA 3ARTA 5E5UB 1MVUB 2YAFA 3OGCA 3MBEC 4A2GA 4X5LA 4L1SA 4N0FB 3QNZA 5CBEB 4WTXA 3VUAA 1ITCA 2L3BA 2QGDA 1UFGA 5B8CB 5I6LA 2P45B 2XV2A 3FUHA 3KZ8A 2VDKB 4PI2A 4X6EB 3PQYA 3QI9D 1FC1A 1QFWH 2X3AA 1YECH 5DJ8A 2EILB 1JZFA 3VMOA 4U0QB 3GBNH 4B0MB 2IEPA 4M8QB 2RQ8A 5DHVA 1C5DA 1QOKA 2BO0A 2YXVA 3O6MH 5EZJB 4E5XB 1LO5A 1XAUA 1XH3B 4OIFA 2NW3A 4HULB 4J2XA 2ICEB 5I1GH 4RWYH 3S35L 4TS6A 3J8F7 2Z31C 3HTLX 1TQWA 5GGTL 5ACZA 5E2UH 2WLIB 1IAKB 4H0GA 3CMGA 3II1A 2BIPA 4RISL 4RDQG 5FYJH 3THML 3MODL 1IC1A 1T04B 4MDIA 4MRCA 4DGYL 4DP2X 3EW3B 5L4MA 2FT7A 1OM9A 1YNKL 3EH4B 4RMSA 3FT3A 1NMCB 1H5BB 2QQKH 3N1MC 3KYMA 2PW2B 1Y0LA 2OZ4A 3VXRE 2HJKB 2WK2A 1UJTA 4Z1PA 4ZFGH 4KK6C 1IQDA 2D03L 3IJHB 1UEYA 4ALAH 1JE6A 2D31A 1IEAA 4GUQA 5BVJB 2E7LA 2D0GA 3FB8A 2C4FT 4YS4A 4NBZB 4WTZG 2B4CH 4LCWB 3CZGA 3CVIL 3AG3B 3VD0A 2EUZA 3UPAA 1JV5A 4MZIA 3TYGH 3QNXA 1CPUA 1EZVY 3EOYG 1J0YA 5EF1A 4PJCA 3UTOA 2FCBA 3BQUC 3M7FB 4Q14A 2CUIA 4W4OC 4HUXA 4N1CA 2APFA 1N10A 1B2YA 2X2JA 1IGTA 2DQIL 2X28A 3GSOA 3IU3B 4EUPA 1WQVT 5DHVH 4ZYKB 4TQIA 1NFDF 3WKPA 4JG5A 5BO1H 3NGBC 1A7OH 2NMSA 4GSRA 1AD9A 3PPEA 3LB6C 4PJ5B 4I48A 3W9DA 1YEGL 1G4MA 3JWNC 3UAJC 2DYPD 3V10A 3QUYD 3FBQA 5DJCA 4PRHE 2W0FB 4IKIA 1KF9B 4P5SA 5D7KE 4OFYA 5GIRB 2ZAGA 4JY5L 4Z76A 5HI5C 3F6JA 4M1DH 4DH2A 2OP4L 1EQWA 4J3TA 3TURA 1MJ8H 4KDWA 2OZ4H 2DH3A 3G5YA 2X4TA 1M7IB 2XA3A 3KXFB 1HC1A 5JIDA 3LIZL 1TJMA 3ISWA 3JVGC 5I66A 1A6VH 4YLBA 1LEKA 4J27A 2XTJD 4X6FB 1G9ML 4U1LB 1AXSA 5SWQA 2P5EE 2MNWA 4PJ7E 5EEYA 2DQMA 3OKNB 4GAYA 4MZRA 2YKLH 4I0CC 1V3MA 1KIRA 3VFTA 4DAGL 5DUJA 4JM2B 4PLKC 4EN3A 2GKIA 4K3JL 5D72H 4AIZB 2HLFD 2XG5B 4OIAA 1E9QA 4MKTA 2CJUH 5DHYA 1R24A 3ZQ9A 5D70L 1CS6A 1J9CT 1ZD6A 1Z5LA 1IBGL 4KDTA 4PAZA 2PWFA 3T1FB 1ACCA 1GZQA 2D7PA 4EUPH 4ZSOB 4OV5B 3LDBB 2WQAA 3ZKXC 1G1OA 1PPIA 1PQZA 1UOKA 4P23B 1OHQA 3G5XB 3GHBL 3HHSA 4F7EB 3BUPA 4K8RH 4LPTA 4WFHD 3QJOA 5A2IH 4QWWD 3CFQA 2BMKA 3ZHDA 2E56A 5J6HA 3CMOH 4AXWB 3EYUH 3K6IA 3NA9H 4NQED 1ND0A 1TNMA 3WN5B 2IDQA 2X40A 5IKCB 3KBFA 3CBKB 3H3PH 2WN3A 2CA3A 1PLGH 1CFSA 1Q9WA 2R29L 4FKHA 5J1AA 4BGLA 3IWUA 2OMWA 4NFCA 3ZL2A 5DZ9A 1D7DA 2K4WA 4NFDA 3WHXB 1KJ3L 5E8OA 3PL6C 3LZFL 5DFVC 3UJIL 4QNPE 1FZJB 4B97A 3LZNA 1YPZA 1DQQA 4NX0A 3AM8A 2E9JA 3L5XH 2IALA 2P49B 4AYEC 4LCUA 1WICA 3DX6A 5F21B 4OGYL 2VSKB 2AEOA 2VXQA 4LHUA 5EBMA 1E5ZA 2ZXGA 2NY0B 2WHVA 2YFOA 4TVPE 4YO0A 2PCXA 2Y06L 3O3UN 4HIIA 1KJMA 2HB0A 4I0PC 5CJQH 4YR6B 3WFCL 3TNMA 1FNAA 4ZMWA 3DJ9A 3DIVA 4CVXB 4XXWA 1J88A 2O6EA 3D25A 3FRUA 5ECJE 2DIBA 3V5HB 2FJUB 4DVRL 1NGZA 4K73A 2G5BA 2PW1B 2V37A 3RWCB 4M56A 1QO3B 4Z6AT 3FSWA 1IC4H 2W95A 5ESAA 5D8JH 1WZ1L 3K2IA 5HJDA 1EDQA 1OAQH 2B0SL 4XH2B 4KOBA 1WSST 3O6FC 3OC5A 4WJKB 3DC0A 4MQTB 3FW6A 4FNTA 1A6TB 3GSUB 2A4EA 4DTGH 1E42A 2XKSA 4FZ8L 4YHLL 1VKXB 2C9PA 1XSJA 2FX8H 2AJSL 4K9EL 4LDCA 1OAYH 2IC2A 4AVJA 5D7JA 4N8VA 1R5WA 4KUZL 3JWNE 2ZONA 3AACA 3I74A 3HN5A 2XNAA 4JJ5A 5KJRH 1DUZB 4FQIH 2YUXA 3RHWK 1EUTA 2J8OA 4DP7X 2ADGB 3DMMC 1BMGA 1JJUA 1FIGL 2VXQH 3KPSE 3C6SA 1JK8A 1M57B 1FL6A 4X6CA 3D9AL 1SUHA 5C0GB 5DVKA 4KTGA 3F6LA 1T2QL 3ARFA 4ZJ9A 3BZ4A 4R9HA 3T04D 4DOHE 3V6BR 3C6LD 4KRPD 3C12A 4RAVA 2VW7A 3CFUA 1I9IH 1N19A 2DWEB 1BEYH 3NK3A 4MBRA 4BRJA 3AITA 3G6AB 1KBWA 3D33A 1CDCA 3FAWA 3ZT7A 4BFKA 3F7PC 4YSRA 1BP3B 4Z78B 1I1AC 2FAUA 4PW9A 3L5JA 4CC1A 4QT5B 2WYIA 2O5ZL 4LSUH 2J4WH 1HXYB 4FFVD 2WLLA 1M05B 2B59A 1YEFL 3RTQC 3SBRA 1PX8A 5TPWH 3DROA 3T6WA 2C3XA 5BZXA 2Z64C 4R7VA 4PV9B 2FH6A 5F0JB 3A3YB 3QNFA 1T0PB 2PTTA 1CCZA 3W39A 3B9KB 5E5RB 1KGYE 3H3KA 4K3EL 5I6KA 3VXME 2ESVA 3HZMA 4GRMA 8FABA 3QULB 1B4LA 2B3IA 2D3LA 4P2RD 4C55A 1TTAA 2R0LL 1WTGT 5K9JL 3TN0C 3L7EA 3EDEA 4NQDD 2CHDA 2VDLB 3S35H 4QO1B 1QLFA 1F02I 3BRFA 3RL1A 3CPLA 5GGTH 3O6KL 4AUJA 4Q2ZB 3ME0A 4F2EA 4RISH 5D5MB 1DFXA 5D1ZB 1P9MC 1UKTA 2EO1A 3MODH 4WHTA 5CS7A 3THMH 4BFJA 4DGYH 2XICA 4PH8A 1RZIA 1YNKH 2EAEA 4JG9A 4HSQA 2WIIB 2QV4A 5DA4A 7PAZA 1PZCA 3WLWD 2X6AA 4MXWL 1AANA 4LLQA 5DSCA 4KNUA 4IRSD 3A0OA 3LIZA 1K72A 4S0SD 2D03H 4KV5E 5JHLL 4C56E 3TBVB 3ULVF 3MRNB 1T89C 3KPLA 4G11A 4H1LA 5BZDA 3DWTA 4RZKA 3CXHK 1JHKL 1B0RA 2PWHA 1U3HC 1VGKA 1K2DA 2HKAA 2R2BA 5C08A 1XGTB 4E9SA 2V7HA 3CVIH 5CJBA 2PWDA 1XGRB 2J5LB 2XN9D 5I1CH 5H4ZA 4CNIB 1MVYA 1J8SA 2B1AL 3MJWA 5IQ9A 3GMLA 4ZODA 4ZS6C 4N2LA 5EPMA 2YAHA 5ICZB 4JCMA 4OLUL 3WEAA 5I71C 5I1KL 3UAAA 4L3ED 1U93A 5CGYC 1G6VK 4J3OG 3T6VA 4R5TA 2DQIH 1AYOA 5C0AE 2NPLX 5AW6B 3WS6C 2LAGB 4WFED 4PHXA 4I4WA 3RUGB 4MB4A 2DLFL 5LDSA 5F1IB 5C0FB 2JB5L 3VXTB 3BJ91 2ERJC 3MRCB 1YEGH 3OZ9L 4YX2L 4DK6A 5AZEL 3RX5A 3W5NA 2Z4QA 4XMKL 1NWPA 4UOQA 2O26U 3DX7A 4DNLA 4UNVA 5D1QB 3ET9F 3HCVA 1AQHA 3KD4A 4GBXB 5B39G 4NHUB 1CWVA 2OP4H 4R7NB 3FRPG 3BUYB 3FO9A 4ZI8A 3D1MC 3EADA 43CAA 3SPGA 3LIZH 4BFBD 1UA7A 3LZQA 4LPXA 1CYGA 5I2IA 1FVEA 5MI0B 3UMNA 4Y16B 1T20B 4BRVA 1G9MH 3APDA 4HHAA 3M17B 1GOHA 1LP9F 4U1NA 1GS7A 1T5XB 5CZXD 4NCDA 5CU9A 5BS0B 1LNUB 1ZWIB 4N90E 4ORZC 2AABL 3U25A 4R4ND 1W72L 4LSVH 4DAGH 3C5ZD 2WTRA 2XX0A 3IGUA 3QI9A 2PXYD 1PD6A 1CLVA 3MLRL 2XJKA 4GG8A 4K3JH 4Z0XA 5HGDB 2WNXA 4BIKA 1KT2A 5MEQA 1MW3A 5D70H 4BSVB 1KTDB 3T9WA 4JFFE 1FZOA 2HFGL 1ZXKA 4KX8A 3RPIB 3RVTD 3SBPA 1IBGH 4YFDB 4PJBA 5IT2L 5GGSB 4MXVF 1S8DB 4HH8A 2Z7ZA 5LXVA 3QORB 4GQZA 1YY8A 5JDSA 3WFHA 4EZKA 4W6WB 1NBZA 1Z2KA 1X5YA 3LH2H 2Z91A 5KJ4A 4GB9A 3S5LB 3GHBH 3AS2A 1RZ8A 2E6JA 3CVHL 3VI3E 5IB5B 4LXFA 4PJAF 2CNZA 2WVUA 4JQVC 1ZHLA 2H9GA 1UOWA 2XV6B 4MAYC 1ZT4A 5H35B 1J8KA 5IGXL 2IDCA 4M7ZC 3U1PA 1GS8A 3U9WA 4L4VB 1WFOA 2IDFA 3PXLA 1KEML 3ZL4L 2UY7A 2R29H 4LE8A 2Y5EA 4OM1H 4ZG1A 2EXSA 3UPRB 1D5MB 1D6VH 1FFNB 2R1XA 4YDLC 3RI5F 3COOA 5SWSE 2MCMA 1IC7L 3D39A 3B9EA 1KJ3H 4KXZH 3LZFH 2IH3B 3LEVL 3UJIH 1KB5A 1KXTA 4NZDA 1B4RA 3EBAA 2GHZA 4XMTA 4OGYH 4Y5XC 1T4WA 4CUCA 1C5BL 3TCXA 2E3VA 1HEHC 2Y06H 3WFCH 3BH8B 1N2RB 1Z9OA 3UBXA 3KLDA 4DPRA 1DHKA 4L4TA 4UM8A 2DWXA 4ODUB 4Y9EA 5CU5A 1HK6A 3NOIA 3DOSB 2DQDL 3NJMA 4CU7A 2H0PA 3KLQA 4OAWB 4DVRH 2QKIB 2NR6C 2KI6A 4JM2F 3QHTC 2HJFA 1XF2B 2AJVL 1N8ZA 2PWEA 2ZKYA 3S3SA 2PP7A 4Y4FD 1O7DC 1U9KA 1QW8A 1WZ1H 2I07A 3BWAA 5HHQB 3G6JA 4PV8B 1PZ2A 1Q1PA 5GGSY 3D0AA 3IAPA 3OAZK 4LP4A 4NC2B 3IJ9A 2KZKA 2VLJB 4HPOL 3CZSA 1RPKA 3FB5A 4GRLB 3V6ZB 3MXWL 4G8GB 5HI4D 3Q5TA 4FTVA 3ZN6A 3EHBD 3RLSA 3S8WA 4FZ8H 3NSFA 4YHLH 5FLUA 4ZD3L 5ISZE 2AJSH 4K9EH 4IRJC 2X4QA 3BLBA 4GUPB 3RJQB 4HCIA 4EVNB 1I8KA 4KUZH 5E1AA 5BMFL 6FABL 5IB3A 1FC2D 5CEXB 3ZTJG 2FR4A 1S9XA 5C71A 1YQVL 4OQTL 2IH1A 4PTTA 2LT9A 2FH8A 5CWSB 2WQRA 1FIGH 4GT0A 2AXFA 3QIBC 2BSDA 4CSZA 1KTLB 1YEKL 3P69A 2BP8A 2J1ZA 2DL2A 4M29A 3T8XA 3BSGA 2BH0A 2O93L 3ZGIA 2H32A 5FB8B 1CIUA 2OX5A 1I85C 2R2HB 4CU6A 3VXOA 1QLRA 4OZIE 2J12B 5DEGA 1DCLA 2HRPL 2QPDB 4KX9A 2NY6C 4P4KB 4RFNB 3TH2T 2OMXB 1DP0A 3DUSA 4WK4B 3VGEA 2W94A 5D7EA 4Z7WB 1R34A 3SY0A 1G1KA 5F9JB 2P26A 1XF5A 3EBGA 3IM1A 1UUSA 2YEQA 2O5ZH 4QHMA 3QJFA 4N1EA 1A3LL 5J9PA 3R06A 3DHJA 4FI6A 4WNJA 1UGKA 5IBLC 2CRZA 1YEFH 1RZGA 4I2XB 3WGUB 3S8GB 2B7DT 5KANI 2AVFA 4FQLL 4NPYA 2EECA 2P80A 4MZ2A 1G7LA 4F2MA 3ZIMA 4WWKB 3T3PB 2OMZA 1O6SB 2EEFA 1GOFA 4N25A 4BD4A 2CHNA 3BCDA 2YSTA 2PWGA 3L4TA 4K3EH 3QYCA 1NFIB 1XIWC 5FX3A 1JF1B 3ZKNC 5I73B 1P7QA 1N5AB 1FFOA 2VERA 1E5BA 1MHHB 2R0LH 2ZNWA 3D69A 3NABL 4NO3B 5I30L 5K9JH 5D1XD 1JF6A 2ICES 1IJ9A 4LLUA 4G7RB 2EXYD 3O6KH 5FYKE 4WW2A 1SYVA 2H32H 4KKAD 4UQCA 3VRLF 3A47A 4Q74A 5F8QC 5D2LA 1QATA 1RSYA 4W6YB 1ZHBB 4BA8A 1K4DB 2CLVB 4U7MA 5ADPL 3I3BA 2JF1A 4HOWA 4DKDC 3RJOA 2RCSL 3X3GL 3WY2A 4DO5A 3FQXA 5JHLH 3LN5B 1C5DB 2NYYD 2LGNA 5BXFB 3E38A 1A7BA 1JHKH 4QRTB 3UABA 3V0FA 1JWMA 2XG4B 4N20A 3RNQA 3D0VB 3GKZA 3MV8B 5ACZB 1W72A 1Z9MA 2YN3A 5KG9B 2WTPA 2J1XA 2RFXA 2Z0BA 4OLUH 5I1KH 1YUHB 3OKDA 5BZWA 2YA0A 1A3RL 1AKJA 1R1CA 2ZUQC 4X6DA 2ZG1A 3BOVA 3I6SA 3RTLA 1UTDA 3WKYA 1R5VB 1O7DE 3HNVL 3KYMB 4OUOA 3ZRSA 5AVZB 1K8IA 3ATAA 3GMMB 3TZVC 2YRZA 4XMUA 2AJ3B 2DLFH 1OK0A 4GXFA 5JTWA 5HYSA 2JB5H 2Y7QA 4MNHA 2F58L 4WWOA 1QHQA 3NPZB 4YX2H 3CVHA 3NCEB 4LU5L 5AZEH 2A3TA 1HH6A 5MHSD 4G9FD 2X0UA 3MBXL 5GQBA 3BGFB 5HHOA 2QVKA 4OI9A 4HHWA 1J9SA 1YMMB 3HZ3A 3Q9QA 3T65A 5ICUA 3BO8B 1K3IA 3QG6A 3SIKA 4PRPA 3P2BA 2XN2A 3GLDA 5I8EB 3QPQD 5KVFE 4GMTH 1UD2A 4B9ZA 4KX7A 1T5KA 2P8LB 3GSOB 4EUPB 3ZR5A 3R7QA 3LXUX 3IFPB 5AVXB 3CFBB 4L8CB 3TH4T 1HNYA 4IS6B 5J06A 2CXKA 5KOMC 4NO5A 4M7JL 3QC6X 5GGVL 3UJTL 3W37A 2PCPA 1CIDA 2AABH 4GT7A 5DJCB 3F7LA 5JHDB 1W72H 1GS6X 1U8PA 3K71A 2JI2A 3OJDA 3MLRH 3Q2VA 4M5YL 2WO4A 4N2IA 2XFXA 1S78D 1F3JB 3MMEA 3T0EB 2B3RA 3APMA 1MI5A 4Z76B 3EDJA 5DRXB 1MW0A 2HFGH 2R9HC 3IK2A 1EFXA 5ALBL 5IT2H 3VXUA 1KPRA 3C2AL 6PCYA 2TRYA 2MOVA 1X9UA 4HLZG 4DK3A 4J2QA 4NQDA 5JQHC 1DVSA 3BVTA 3RHWF 1E5CA 3NFNB 4NEHB 2BVQA 1NC2D 3LXCA 3CVHH 4PWJA 5SWQB 2IWFA 4R5VA 2XPYA 3BH4A 3WMPA 1ORSA 3GINA 4FABL 1RZJC 4NPKA 5AW8B 5IMKB 3ARBA 2IFGA 4ZX5A 2KLTA 1PDKA 4TUUA 1AC6A 5EN2A 5I0XA 5IGXH 3RVWC 2BNUA 3Q0HA 4AVHA 4UINH 1UWFA 3ZSTA 4BZ1L 5DMYA 1BXAA 4PTUA 5DHYB 3ZL4H 5I1AA 2FIRT 3QJTB 5ERWB 3HLAB 4AI7A 3D05A 2Z8RA 1BLNB 1T21A 2HRHA 1IC7H 3ZU8A 1WZKA 5C0ND 1MCJA 4MXQD 5DC9B 3PWPE 3WV0A 3LEVH 2CHWA 2DS4A 3P40A 3HG0A 4XB7A 4OQTA 2VZVA 2C9SA 3FONA 3VQ2C 1XR8A 3QDJB 1IARB 2BERA 1C5BH 2I26N 1QNZL 3MOQA 2CO7A 3KS0H 4HU2A 1LHZA 2HPTA 3KPRB 2K1MA 1BQLH 4HUMB 1QABA 2K0RA 4L8DB 5EFIB 1IILE 2DQDH 4MMXB 2MNJB 1TU2B 2WXKA 1WDAA 4GW1B 3EJJX 5TD4A 2W9EH 1L7TL 1QP1A 1DBBL 1UB5B 3DX2A 5LNGA 4FQXC 4P4RA 5IQOA 1DJGA 3EGSA 2AJVH 4UQIM 5E8OB 5LQBL 3QJVB 2BWIA 2GAZA 4IGBB 4GSUA 1PZDA 3QIUC 2P5WD 3V6OC 3VXSE 2APVA 4ZX3A 3DI2B 4D0BA 4KUCD 3UGUA 4LP8A 3OMZA 2Z9TA 4X99A 4C47A 1LK2A 4FYSA 4HPOH 1N6QL 2XXCB 4YO0B 3MXWH 4ELKB 4HIIB 1AGCA 3HRZA 3MJ9A 4ZUVA 5INDA 2YBRA 1WYJA 3NACL 3QCVL 4HZ1A 5HGHB 4QY8B 4ZD3H 5IVXB 4WEMB 3FCBA 3FCTB 1Z5HA 2FWOA 3D25B 4GKNA 4F9LA 1B0WA 3DIDA 5EF3A 2LFEA 1HZLA 4B0MM 1NGZB 3CDZA 6FABH 2AEWA 2FQGA 4IBZA 1QSVA 2V9QA 1YQVH 3OB0K 4OQTH 1SXCA 3C5ZA 3PIQB 4PBXA 4YDJB 4ADJA 4M5TA 4MMYA 3UGEA 1UWYA 2ADFL 5M94B 4Y2DB 4ZUWB 4TTDD 2AQTA 3N6YA 5IW1B 4R3SB 4IBTA 1DQDL 5FYJU 4P3DB 1JXGA 4LEOB 4WNQB 3LHAA 3L9RA 4JGJA 2YD1A 4KRMB 3WAJA 1I8MB 1SJMA 3K72A 4JL2A 1KIPA 4ANVA 1TTGA 2HRPH 3WNLA 1R5WB 4N22A 4NNPL 3ZKQD 3B5GA 2P8PA 1P6AB 2DMBA 4ES8A 4KROD 3WMSA 3HVNA 4D7PA 3EOAB 1GYCA 2WCPA 3JWOC 1U2CA 2E59A 4WI4A 5JNYB 2OTUB 1XB3A 3MROB 3TU6A 1A3LH 2VLKD 4BKTC 4WK2B 4HWBA 3ZUNC 5SV3A 5CILL 4RMVA 5C07E 4WO4C 3C60B 3EYOA 3EFOA 4FQLH 3RWJA 3IJYB 1RKRA 3L48A 4WI8A 2VDPL 1BPVA 5MEOA 4DVBB 3CG8A 4LVNB 3QUKB 2H6PB 1S9WA 3K81A 1D5ZA 1NGXA 4OFKA 4GI8A 3EXJA 2FJSA 2BDNL 1UJ3C 1MCBA 4HPHA 3GMQB 4H0IA 3ZRCC 3NABH 5I30H 1T2XA 3MV7A 1A1MA 1NANI 1Y6MR 1C16A 1CR9L 3MOBL 3QUZB 1CGUA 1KOAA 4MVBD 5EO1B 4G6AD 5BRZB 1E30A 4ZMVA 2CGZA 5K1NA 2UZIH 3P4NB 4ZQKA 1W80A 2MQ0A 3DROB 4ZNEA 2NX5E 2Z6FA 3EZ8A 5BQ7B 5BV7C 2V0AA 4Q9CA 5AL0A 5ADPH 2CG9X 3SCMB 1WE5A 2IBGA 1IM9B 2JSFA 2RCSH 3A6OA 4QCIB 1SOSA 3LEXA 3MGTB 2YUWA 3BP5B 3EH2A 3IXAA 1TTFA 4YXKL 1D5IL 4WI9A 1EIBA 4H26B 1CGYA 1Q9KA 1G7PA 5L2KA 3ZYJA 3WNKA 2MEJB 4KPHL 5IF0A 3RL1B 4Y5YC 5HYEA 3TIEB 1IM3D 2V8LA 5F3HA 1T1XB 1XCQA 2O6FA 3ILQD 1L9NA 1A3RH 1TT6A 2F54E 3MV9A 3BH9A 2J43A 4FG4A 2NXYD 4YNYA 4LLQB 3CQFA 5D7IA 2NY4D 3VXRD 1S2EA 4AIXA 4EMZA 1NEUA 2JCCF 2F58H 1AI1L 4CN1A 1SNRA 1DDHB 5BZDB 1VEOA 3Q8BA 1BBDL 4LU5H 1QPKA 3T3PF 2OFQA 4FNRA 5FUZL 1CBJA 3JZ7A 2WBJA 3S4SA 3MBXH 3V0WL 5C08B 2V7HB 2FHCA 2PPCA 4AQAB 2YARA 3LRLA 4DKTA 3LQAL 1XMEB 1ZDSA 4Q52A 2NXZB 4YHYB 1T83C 3OKKB 4ZW3A 2ZKMX 4HQQL 3VGAB 1J8HD 3IGKA 1N68A 1GR7A 4FKEA 3ARGC 3KH3A 3EDDA 3LPPA 4MD0B 4BHUA 1JIBA 2ZCZA 4H5SA 4TNWK 4XP5L 2QQNL 4P57B 5AYQA 5KTEL 2WXGA 2GTZA 4M7JH 3UJTH 5GGVH 1KGCD 4X2UA 1O7VA 2PPAA 4KJYA 3PGDA 3QXTA 1MKFA 4PRHD 2V2XA 4M5YH 4DFHA 5E6RB 3L7FB 5D7KD 4URTB 5LCVL 4UQ2B 1NMAH 5ALBH 1QWNA 2BIMA 1NINA 2DDQL 3C2AH 5FCSH 1G6RL 4KAQL 4RIRB 2E8YA 1NDMB 1QFUL 4JDZA 5D1XA 3RX7A 1RJZB 1D9KA 4NN5B 3W56A 3IFNL 5I8KL 3NPSC 4J4PA 4S1RL 2K70A 4D0DA 5KSAA 1T03L 1M71B 2VLLA 4U1NB 3UG5A 2P5ED 4Z7AA 4FABH 5D7LE 3H9SD 2MKLC 3D5OF 3HW7A 5CCHE 4O9HL 5EEZA 3LRMA 1BMWA 2WTRB 1YY9D 4G7YL 1MRFL 1UT2A 1WUNT 3D2UA 4BZ1H 1I4FB 1UH4A 2IGTA 1AGBA 4F5CE 3PFQA 5LJYH 1CTOA 2CR3A 1TQSA 5CZVL 2IXQA 5AVQB 3TBWB 1R75A 3K74B 3P77A 1VIWA 5E4EB 3IGFA 4A63A 5AOLA 4ILDA 1TKWB 2R15A 4ONHA 5FUCC 2AGJL 4AL8L 1GA2A 2QJDA 1U8JB 4PJCF 2RD0A 4MD4B 3ULVC 1WA1X 1U8HA 2EDKA 5CP3A 4JHUA 1ZHLB 1NPUA 1BZOA 2P44B 3PWUB 1QNZH 2W1NA 1J8RA 1TCRB 4EDXA 3AC0A 4N0UE 2WINA 5DRZA 4CADA 4AT6B 5SX5K 1ZSHA 4LF3B 1WITA 1ZTXL 3CHSA 4PJ6A 4U7SA 3HHMA 1DBBH 2XLLA 1OIOA 4BH8B 1QSED 3MYJA 4QHUA 3SKNA 3WDIA 4Z8FL 5LQBH 1N4XH 2IDSA 3KCWA 1NGPL 3QWOA 1SLUA 3CDCA 3VCLB 5KBLA 5LVEA 4KO7A 5CMAB 2DI9A 5ILTL 4P06A 3UC0L 1V8HA 3PGCB 5HI3D 1OCZB 2NTSP 2P52A 4AG4L 1YNLL 1WC7A 5B8CC 4M93B 1N6QH 5JQIB 3STZA 3O4LA 5CEYA 1E90A 4TVPD 5IMLB 5TQ2H 3QCVH 4X42A 2F1BA 3WY1A 3NP4A 1IBYA 5ESVA 3SGDI 2EYTA 1K4CB 4M3JA 4NJAL 1F6AA 4X7TA 3QZLA 2BCKA 4RGNB 2JJWA 5B39B 1J05A 2ICEC 3HG3A 2DYPB 3AT9A 3QUYB 4M8UA 5I6XB 1I7RB 1N8ZB 1NCJA 1PKQA 1P4IH 3IN0A 1HKLL 1KGUA 2ADFH 4RMTA 3T0DA 3VVVA 3MRHB 1E28A 2K8MA 1NEZG 1KGIA 2W81C 4D2NA 1DQDH 1N3NB 3N0PB 1NMCC 1R3LB 1H5BC 2MHAA 1TR7A 3FB5B 3ULAB 5BUAA 3E9TA 3NMEA 3EGDB 5TDPA 4ZMTA 5MERA 2XTJB 1CK0L 1MHPL 2A73A 2CALA 4NNPH 3GLEA 1N6VA 2AK4A 3U0PA 1H3GA 3IDJB 1QSFA 2JQAA 5E23A 3AWGA 4X7SL 5IK3B 2OSLB 1QWHA 2XY1A 3S98A 2JTDA 4X9GA 1RPQA 2OS7A 1FL5B 3IETA 2ZWKA 4G70B 3NIFB 2Q5BA 2AEQL 3MUGB 3KPSD 1RUML 3OD3A 4WUKL 3ABKB 3V7AG 3DVNB 2BC4A 3NFSL 4LLMA 4LIQE 5CILH 5AOZA 2H32B 3AREA 3LNHA 1AMXA 1YPZF 3BN9C 2MOQA 2VDPH 5DO2C 1HI6A 3V9FA 3VH8A 2PKDA 4JCWA 4AEHL 5JR1L 2CE6A 5DJZA 3TNNA 4MJ5B 5HGBA 4NQVA 2KH2B 4OLEA 3FT0A 3ECVA 2PCFA 3V5DB 3VGFA 4JJOA 5L0QB 5DHDA 2X4PB 4R0LA 3HC0A 1PY0A 4ZDHA 4NQEB 1CR9H 2X2HA 4WAFA 5I76B 3MOBH 1S9VA 4PLJC 5F7DA 1U8KA 1KPUA 4WK0B 1AIFA 1EAPA 2F15A 1I3UA 4P2QB 5HBBA 3H2QA 3LEYL 3SDDD 2V9RA 4IOIA 4M8VA 5HVWA 4TV3A 5FUCE 1UGNA 3WEBA 4PHZA 4R7DA 4JKMA 1F8TL 3FFCD 1KXQE 4OGZA 1MFNA 2DKUA 3DIFA 3VXMD 3IDNA 4WDIB 2XPGA 4W6XB 1RXLA 2BSRA 2LLNA 4JM2C 1R4XA 1D5IH 3L3GB 3BWZA 5KVGE 3VFNA 2HX9A 4QR7A 4C57C 5JORB 3TO4A 3HC2A 1XSKA 3X1EA 3WXWL 2DQJL 2Y07L 2C7UB 2PLTA 4KPHH 3ILPA 3CGTA 2ED8A 2V2TB 5JPMA 4H88L 3EYQD 2Y1YA 3VXPA 5KVEE 3LDBC 3VWKA 1NIBA 4WCYL 1HHIB 4P23C 1LEIA 4LOVA 1E65A 3OMAB 5DR5L 3ABMB 2JJTC 1AI1H 3ZO0A 1IJNA 4XN2A 2VR5A 1BBDH 1KELL 3IDXL 5FUZH 1TNNA 3FQRB 3WN5C 2CDGB 1IEHA 3AABA 3V0WH 2L0DA 4P2OD 5CGTA 1D5BA 1NM4A 2XQYA 3LQAH 1W72B 3GM8A 1JG9A 4OFIA 5FGCE 3CSTA 5BOJA 5FO7A 1H19A 3KPNA 3PJNA 1NPJA 2DIAA 1KMGA 4HQQH 5LWYL 1RP9A 5SWZA 3SN6N 3MCLL 2ZWSA 2LFGA 3H6AA 4R7LA 4U6TA 3MRQB 3TT1H 5A6MA 3V6FA 1G9EA 4P99A 5C0AD 3EAKA 1O9ZA 3Q8EA 1H9VA 1PSKL 2QQNH 4XP5H 5IM7B 2NY0C 4MNHB 3UP6A 3MJGX 3BP4B 5KTEH 4NXKA 2FBOJ 4GINA 2QQQA 1P6FA 2QTVA 3CVHB 8PAZA 1OWRM 3C6LB 4KRPB 3FF7A 5KSBA 1QUNA 2ZWZA 1WD8A 4FXGB 1PX3A 4N9OB 3SE3C 4AYID 3QG6B 4PG2A 4MXVE 2QR0A 4N2BA 2DDQH 3W81A 3ZDXF 4AMKL 4BWWA 1G6RH 3N43B 1JWUB 3QR0A 2OMYB 3FU7A 4KAQH 4OF3A 4KI5C 5C97A 3EOTL 3IFNH 1KFAL 4JPVL 5D71L 5I8KH 4S1RH 4ABQA 1AQ8A 2DB8A 2AV7A 2OL3A 1NWOA 3QQ9C 4BFIA 1T03H 4UV7L 4AYDC 3DJZA 1D3CA 4JG0L 3RIAK 5KN5B 1MUJB 3A6CL 4FCHA 4O9HH 3K71B 4N90D 4G7YH 5A40E 1MRFH 1DUYA 3VSTA 1Q90A 2YUVA 2VB5A 3LKPB 2N7AA 2XFXB 4PJ5E 5TK2A 4DEPB 3KL0A 1V3LA 2P3YA 1EJFA 3CSPA 4LHUG 3S3DB 4NKIL 4A7SA 3IMUA 3CFDA 5CZVH 5CSBA 4LFHD 4WGWB 4P2RB 1I1AD 2GSGB 4E41D 2GFBA 4HOMA 4GW5A 4GAFB 4UMSA 4HGMA 5E4IA 1K8DA 5C0EA 3HZKB 2A6KA 3QG7L 1QRNE 2AGJH 3I3DA 4RFOH 4AL8H 3EG9B 3M1CA 4IHOB 3KXFE 4X8XA 5FDWB 3JV6B 2VWEC 5EUKB 4XMLL 4ICXA 1CXKA 2P1YA 3B3BA 1FO0L 3GI8L 1GGIL 5EZLA 1DTUA 2ZYHA 2BNUB 1KB9K 4HGWA 4IRSB 5IJBC 5JW4R 3VXRA 4ZMQA 4UDUA 5FO9A 2RR3A 1PD0A 1L4IA 1ZTXH 2XWXA 4GYBA 4H8WL 1IGFH 2X9XA 1DDTA 2UX7A 3MO1B 2QVIA 1UENA 5AVYB 2XWCA 3TN0D 1ZS8A 2DQTL 4OFDA 5EV7A 1IUZA 2GK2A 4Z8FH 4JVUA 1NGPH 5CN2A 1R3HB 2XN9B 1IEBA 5ILTH 3FQ1A 3BUDA 4HKJB 4Y19D 2AJZA 1YEEL 5B1JC 3UC0H 4AG4H 4ANXA 1YNLH 1JGEA 2AZAA 4CSSA 3TT3H 1QBAA 3P9MB 4WWPA 1M7DA 1CLCA 4L3EB 5KEZA 1KEGL 4UB0L 5DFWH 1G7QB 1ZEAL 5ITBL 1EA9C 4CC4A 1RK0A 2OTWA 5D9SB 1CO1A 3MUUA 1CGVA 2HUEA 3B9KC 3RVUD 4ODXB 1S7XB 1A4BA 3IKCB 3BAJA 4NJAH 1SJHA 1JXDA 4AH2B 1CBVL 2QZ5A 1OQXA 4LEXL 3N1QC 4KXAA 1E9PA 4LAQL 4GQ9L 5AENA 1HJBC 2CHXA 4LLDA 1XXDC 2BNRD 2WWOA 4UNIA 4Q89A 2BP0A 4PRHA 1RSFA 1HKLH 5CLTA 5D1ZC 2H47C 5J12B 3I85A 4M1CC 4PJBF 2EDJA 4KKZA 3O8XA 3W5MA 3A4AA 4FKKA 4XMPL 1XWVA 5CGYD 3KWWB 4WI7A 3BEVA 1JUFB 5EZIL 4DIXA 1GC1L 1M7XA 3N40F 5HY9A 4IBWA 4KMLB 2MNUA 4QHPA 4JN2B 5A1AA 4AC2A 3T09A 4TNFA 1CK0H 1MHPH 4NOBA 2K8QA 4PY8I 3UERA 1EHLH 4BSWB 2P5EA 4IIQB 4PJ7A 3CDZB 3MGOA 2YBGA 3TCLA 1BCIA 4X7SH 2J5LC 5E5LA 2PXYB 2N0MA 4YE4L 2OXGB 2JJSC 1CLYL 1PLBA 3F00A 3DO7B 2AEQH 1RUMH 4WUKH 2G2PA 4XVOA 1C08A 3NFSH 3OXRB 2YAEA 3IPFA 4KI5E 1F0LA 3ZE2B 1TSRA 3W0WD 2CCWA 1EJ6A 2ZOTA 3F12B 4JFQA 1I8LA 2QMJA 4OVVA 3WAKA 1Z6JT 4YOKA 3TPUA 4PYGA 2BS8A 5JR1H 2YWZA 3MBEA 3T0XA 1MHCB 1CFMA 2H3XC 3VFMA 1DSWA 3CUPB 2P8PB 3TL5A 1W0VB 2QELA 3FOLB 1H0DA 3LKSB 4PR5B 5CN1A 5D1QC 1VFAA 1ZHKA 2LVEA 2X70A 1CICD 4KMTL 4GBXC 4NAJA 1GPOL 3IRPX 4H1LG 4OFVA 1HJCA 5IB4A 4TSCH 3BVNB 2VM9A 3VX1A 4NP4L 3KPMA 4GAAA 4KJWC 3EYOB 3LEYH 2OQJA 4HUWA 5MI0C 4Z77B 2WSPA 3G6JF 4Y16C 2Z31A 1MRDL 3E7JA 1OLLA 3D48R 3RVXC 2JNZA 3GSWA 3TF4A 1F8TH 5F89A 2BXZA 4J28A 5DDHB 2VWEE 3ZZQA 4NRXA 1N0LA 1NIDA 5CF3A 1BF5A 1YG9A 3BKJL 1GJWA 4LCCB 1S5IH 4MAYD 5EU7C 5JIIA 3UCRA 3FHEA 1GY1A 4KFMA 1ORQB 3VYPA 3WLBB 1SVZA 2W80C 4YDZA 2XTSA 2Y7OA 2DQJH 2Y07H 2ATKB 3QC5X 1A5FL 4I5BA 3CVBA 3R7RA 1PLCA 2VLME 4AUUA 5IJKA 2HPOA 4H88H 3DVFA 4HIPA 5ECGA 1HSAB 4J6RL 2MTAA 3UH8A 1RUQL 3QORC 2ZXQA 1F56A 1ZANH 2FVNA 1BD2D 4N6QA 2XVGA 3NIFF 4XP4L 3SDCD 3NEOA 5J7CC 3KPQB 4Y4FB 4J39A 4RQQA 3ORJA 5DR5H 2NT0A 1MXDA 3VDBA 4LNRA 1ODUA 3C5SA 2KUTA 3JT0A 4DZBA 3BQUA 1HHGA 1KELH 1XCWA 3FQUA 3IDXH 5JIQA 4W4OA 1T66C 4FQQB 5HYJD 3G5WA 4PGBB 15C8L 5EIIA 4KVNL 4RX4A 1ANUA 1BFOA 2ZOWA 4NC0B 1UD3A 2BRQA 5EO9B 4PJ9D 4AKPA 4E9QA 2CR0A 3GS0A 4NKMA 3UO8B 4LNVA 2Y6TE 4PGZA 5J6SA 3UAJA 4PPTA 3RVVC 5LWYH 3MCLH 2H6OA 2OK0L 1HT6A 3T6XA 2I24N 4X6BB 1N9PA 4FQ2L 3CBRA 5D5ME 1OAKL 3KBEA 1KULA 4JY6B 1DEEA 2K3TA 1FCCA 1PSKH 3KPSA 1L0YA 4TVPH 5DJDB 5IQLA 3R8QA 1EWHA 4K0OA 4JO3L 1A0QL 1IKOP 2HSIA 3JVGA 1HHJA 3V4PL 3CFJB 4F8PA 4JL1A 2FZ3B 4WF7A 3MNMA 4AQZA 2QKIC 2WNKA 3WTYA 1T1WA 3OHMB 4M5SA 1OTUD 1KXHA 4AMKH 3TEXA 3WO3B 3RWDB 1P4UA 3NJXA 1XHHA 1J12A 1KIUA 5D71H 1KFAH 4JPVH 4XO3A 4AK2A 4MQ7B 1M1XA 4OKVA 1L9SA 4BFOA 3X1FA 2BRRH 2YQ3A 4YHZL 4H5SB 1PL3A 5C70A 3ROLA 2KZ1B 3G7TA 3LJ3A 4UV7H 1HN1A 3P4LA 4GRLC 2ZD0A 4JG0H 3DLQR 4DJMA 5D2LF 1YNTB 1ED3B 4DP4X 3N5AA 4F7CA 3A6CH 3SDDA 3B8YA 3PHQA 3RUGE 2EIMB 3LKOA 1NMBL 3ZE0B 3PWLB 3AY4A 3FF8A 3KDMB 3L5IA 4M4RA 3H55A 3ESMA 4NKIH 1WBXB 3U46B 3VXMA 4AE1A 5BW7A 1CDYA 5LUMA 4WFGE 5D1QE 3UBXG 3I75B 3FOMB 3NUKA 4XX5A 1WBYB 5BRQA 3SYCA 3TBSB 3ZDYF 1RUAL 4FQJH 4U3CA 4CBZA 4UIKL 1HESA 3QG7H 1GXEA 5EG6C 1PCSA 3FFDB 1Y6NR 3FO2B 4G5AA 4F1ZA 4FA7B 2Q7YA 2FJFA 1CG9B 4D7BA 2AI0L 4PY7A 2VLLB 3GKWL 1E3XA 2DWDB 1RY7B 4WU5A 2I32A 4XMLH 3U4AA 2WWKT 2N59A 1GGIH 5E8NA 3DURB 1MY7A 3RKDD 4P4KC 1WAAE 4RFNC 5F6IB 5BS0E 2GSIA 4H8WH 4PS4L 1WFIA 4C56A 5EBLA 3F83A 4EKXA 2UXTA 5IJVA 1BVLA 1MFUA 1JNLH 1TF4A 3PDOA 4HSCX 4BUGA 5IHZA 2DQTH 3P77B 4FNUA 1GY2A 2CJSA 3PWPD 3K5SA 2GJRA 2Y69B 4XNYL 3CC5B 2DEYX 1YEEH 3CN2A 3GUFA 4AGLA 2OMVB 2KQNA 3K2KA 1UEMA 4WWKC 1N59A 1SHMA 2IAMC 3OR6B 3QQDA 4UB0H 4YDKL 1KEGH 4MFHA 1ZEAH 3WFEL 4XP9L 5GS1C 5C9KA 5E6YA 2FDBP 3NH7L 1ONQB 2J7LA 4HAFA 4W9EC 5C0AA 4JRFA 3PJLA 4POYA 5I5IA 3LS5H 2APXA 2YSSB 3O6FA 4DKAA 5I73C 3DK2A 1CBVH 2YPVA 4LEXH 2WWNA 4LAQH 4OKDA 4ALAC 4L4VE 1ZV9A 4GQ9H 1D7FA 4G9FB 2DICA 4YFLF 1ZJAA 2A6IA 4LQFH 4PGEA 3VD7A 1JV2A 3K6SB 4P5TD 2WLYA 4O2EA 4U1KB 1P0SE 4XI5C 3UTSE 5GGRA 5J6GA 5L88L 4QPEA 2OCFD 4GKSB 4XMPH 3S36L 1FE8L 2GTWB 2ZZUT 3WHE1 4FJZA 4AGNA 3DGDA 2B1OA 5EZIH 2QKSA 3BUQA 2NSQA 1GC1H 4AMXA 2W60B 1YC8A 2H8PB 2XWEA 1RFDL 3H0TB 2F68X 1THAA 2EYTB 1NAMB 2JKJA 3IAGC 2VDPB 4U1MB 2AJXL 4X7TB 1F6AB 3TM6A 1UM5L 2QLYA 3VQ1C 4J8RA 2CRMA 2BP5M 2HT4C 1MPAL 2Z4TA 4YE4H 3LPOA 5AOIA 3NCJL 4IBUA 1A4JA 3CV5A 1CDHA 1CLYH 3RU8L 2G0KA 4NYLB 4JBSA 4A7GF 4QRUB 4HOZA 5K93A 1QBML 2RGSA 3GMOA 5TH2A 3M46A 4IMLA 4JFFA 1MWAA 3FUKA 4GY4A 4DCQA 3OC8A 3DYPA 1BA9A 3DO4A 4H40A 5T1KD 3EJYC 1I1AA 1ID2A 1KCLA 5FW6A 3CBJB 4LQ1A 1ZTMA 1CXHA 1O9VA 4QXTB 4DESA 4N9GB 4WQOA 1FIEA 2VE6A 3P3SA 1NCGA 2NY2D 1MNUL 2G30A 1NC2B 1JPGA 4G8GE 1N5YL 2E7LC 2A73B 4TSAL 5H8DA 3VI3A 5CD3A 3L4YA 3RTQA 3KYNB 2XQYK 4RCAA 5C6WH 3KLAA 3BGFC 5A6LA 2FWUA 5IBTL 5IEKA 5DCCA 2MCG1 4KMTH 1MQKL 1GPOH 3BSZA 3I6KA 3MZGB 1MJJB 1GSMA 1T0NA 2RJMA 1TEFA 5FK9A 3DK0A 1BAGA 4NXSA 5D55A 5DZJA 3O2DL 1XAKA 3WJJC 4KVCL 4ISVA 1Q0EA 3TN0A 3IDIA 3RDJA 5SWSA 4F8QA 3EDFA 3PS6A 4LSTL 1MRDH 1FORL 2HVKB 4HOXA 1T5WA 1FVCB 4Y19A 1P9MA 2VQTA 3TNNB 1ZGLP 3M1BB 3WHE0 3F05A 4NQVB 1EO7A 4K8RC 3BKJH 4W1TA 1A1NA 4PEEA 4JQIA 1PZBA 1LD9A 3RIAF 4R0LB 3TIDB 3WENA 4XCYB 4KH2A 3T0EC 2ZP9A 1ADWA 5CCKL 4GO8A 1XF3A 4Z7WE 1A5FH 5F7DB 1T89A 3CHOA 1BIHA 4J6RH 1RUQH 3E1F1 4I3SL 4EF3A 3U1QA 3D18A 3APFA 4XP4H 2NX5D 3NIDB 4OZHB 4XXDB 2VZOA 1MREL 1L6PA 4I2XE 1SXNA 2P5WB 4JANA 4U6HB 1R3IL 5E5MB 3ZE2F 1T1ZA 4KGJA 1U58A 5GRYA 4POUB 4B5ZA 1B0GA 4YSQA 15C8H 1XH1A 4KVNH 3WS6A 1Z9SB 5ISZA 3DYOA 1B2WL 1J0HA 5CM1A 5IOKA 2VRAA 1TVHA 3GZOA 5K59F 3TPKA 4H25B 4K3GA 4BFGA 5JPMB 3D50A 1NAKL 1QQDB 2NOYA 3DX8B 5HDBF 3WKML 3U0TA 4QF1A 4XGZA 3CZFB 2OK0H 3QO1A 4I3GA 1TO4A 4ANUA 3FU3A 4FQ2H 1QSZA 5AG9A 1TITA 1SRDA 1QG3A 1SXAA 2PABA 1TZIA 1AGDA 1G6RB 1OAKH 1X6NA 4NKDA 4FGMA 4OCWL 1NH6A 4U1HA 4ZO8A 3RP1A 3FO1A 5IP4A 1FFPA 2NNFA 3ARPA 1WF5A 5GSRB 1TJGL 1L5GA 2AMUA 3O9WB 2CLRA 1I8AA 4FLOA 4QLRA 1WGOA 4WW1A 3BIKB 3I6GB 1A0QH 3CH1B 3OHXA 1OZUA 3AQZA 3QJUB 4JO3H 4LPVA 1JPST 4HAKA 3S96A 2VJXA 4WSKA 3V4PH 1DJHA 3BFQG 3IWVA 4MMXC 3WTVA 2CWRA 4OZIA 3HR5A 3SDAD 4UANA 4MWFB 5FO7B 1IL1A 5D6DC 5KYXB 2WN2A 3WJLC 2NNCA 3MV8E 2ICCA 1QFPA 3UZQA 3WMQA 1A2YA 1N7ML 4IGBC 2GITA 3UP1A 4RAUA 3HI5L 1QWUA 4P5MB 4O2CA 3MLTB 1RJYB 2VLKB 4HISA 4XCNB 1RIHL 2UZYB 1CI5A 4JPSA 3L9BA 2OSWA 2X9YA 1UB6B 2XXMB 2NQCA 3AW5A 3UEQA 4PLOB 4WUUD 2UUDK 5ICYA 1NMBH 1QUNB 1SDDA 2BVOA 5I28A 5J4MA 1OXYA 2D8KA 1FL3A 3RKPA 4ONGL 4NSKA 2Q20A 3LRKA 1HQ4B 4JQVA 4RBPH 4H7VA 1XF4A 4MAYA 1AS8A 1YMME 3SQBA 1RUAH 3RRQA 4Y2DC 5JIHA 4UIKH 4PS3A 2Q86B 1E5YA 4F3FB 5T1JA 2GBAA 3LQZB 2AXGA 2AI0H 3GKWH 4YBLB 2ZE0A 2WQXA 1RK7A 5GGUB 2EXTA 2F61A 4PRBB 4KKLC 2J88L 4PYHA 3B7UX 2ZKWA 3OX8B 1BQHB 1UXMA 3T4YA 2YA1A 1BZ8A 4LARL 1NCNA 5B3NA 5EA0L 4GKOA 3HE7D 5HDOA 1M3IA 4U2YA 4Y5XA 2DJUA 5JHDE 4PS4H 3CFDB 1JGDA 4PG9A 1QVOB 3SDXB 2GFBB 3T0EE 4DZ8B 2FT6A 3MBWA 1MFCL 5DHMC 4PRNB 2AEIT 1BPLB 1YEDB 1IQWH 3EUUA 1E4XL 4XAWL 2Q87A 1IM3B 2J57A 4XNYH 4LRIC 2DW5A 5DQ9B 1EEYB 2NR6A 3C60C 3FTGB 2CLZA 4MKMA 4N2DA 5K39A 3UYPA 5G5DB 3CIAA 4YDKH 1SN5A 4RWHA 4ZX6A 2BVTA 3FCSA 1JYVA 2NXYB 4XP9H 4A55A 3PABA 4LVNC 3VD1A 3MJ7A 5IIEA 2Y36L 3L3IA 2NY4B 1M4KA 3NH7H 3VXRB 2CIKA 1KIQB 3FMGL 2BOLA 3QEHA 4XNXL 4Y4HD 3VW3L 4B9JA 1UM6L 1E43A 1MCNA 1HXMB 2JB6B 4PRDA 3Q06A 3K80A 4C83B 2COQA 3ZE0F 3V9EA 2P4AB 2F7QA 2NW2A 3QUZC 4YPGA 2R69A 4HK0A 1AS6A 4PB9H 1MH5A 1HH9B 2VIRA 3DI3B 4N2EA 4J23A 3MA7B 1GZPA 5HJBA 2RMNA 1OTSD 1RUKL 2WM0A 1SLXA 4NN7B 3TVMD 3EJSA 1Q94A 1ZA6B 4J3UA 3S36H 1FE8H 4LSRL 4H2AA 1J8HB 5GZOD 1EVUA 1P7KA 5IV2B 1JZ2A 3O2DA 2FECL 2K9FB 2BY1A 4XVTL 3SCMC 2VXUL 1RFDH 2CM5A 3QDJE 5C0IB 4UNUA 3HR6A 1MF2L 2YZ1A 3QIBA 3BE1L 2GCYB 2ARJQ 1JNHA 3EFFB 3LKQB 2AJXH 4W4NA 3MREA 5DQDL 2FYVA 5HYQA 4N2HA 1UM5H 4K5MA 3KPRE 4WI0A 5F7UA 3DRTA 1JFHA 1I85A 4LLDB 1JPFA 2A99A 1MPAH 3T77B 1P5UB 4XWOC 1I53A 4S1SL 2BVEA 3WFBL 3NCJH 1I9RL 2ZUVA 2AQ1A 3EGXB 3ZKMD 4QJ5B 1MCIA 2CKNA 1QBMH 3QNYA 3U30B 2ZUSA 5KSUA 3LXBA 4N24A 3RDTD 1I1YA 2A1WL 3C5JA 4XNDA 1X5HA 3OF6D 2EIKB 3OQ3B 4EIGB 3W82A 1MNUH 2P5PA 3M07A 3DRQB 2DLEA 1N5YH 1DO6A 4TSAH 1KTRL 1G9MC 2H7WA 1BG1A 2R69H 4PJ7B 5IVXE 5T3ZE 2WLMA 1VFUA 3H9SB 1OSZA 3ISYA 4HYTB 3P2TA 1XVSA 4UAHA 4BCZA 5IBTH 1DN2A 5I5MA 3VWJB 1MQKH 1AR1D 4GXVL 4FEIA 3I9GL 4ORGB 1M9WA 2NXZC 3N91A 2VUKA 4U1IB 2DEWX 4KKRA 3SE9L 2JIXA 4YHYC 1XIWA 2CDEB 3HVDA 4O51A 4TQEL 5FW7A 3VGAC 1HXKA 3O2DH 1C08B 1EANA 2R56L 5KVFH 4KVCH 3PXJA 4PGCB 4XX1G 3TOPA 1SJEA 3V55A 3QWNA 4UZUA 4JFQB 2Z7YA 4LSTH 4MJIB 3PWPA 2Q2EB 2EXWC 2QTEA 3DDGA 4GOSA 2VW6A 4OF8A 3RX8A 3SKMA 4F7MB 1J0IA 2BOBB 4A6YL 4KRLB 4MX7A 1JD9A 3VFRB 3KJ4B 5G4NA 4X5WA 2DKMA 1AMYA 3WUZA 1ASOA 1ZHKB 1SN2A 4NQQA 3V0IA 3H7BB 1YJDL 3AXIA 3Q6GL 3RNKA 4FFYA 4KK9C 5CCKH 3ZBMA 1KGWA 4GRWH 4L2LA 2VOTA 2BXYA 3BMWA 1U8CA 1MFBL 3KPMB 4I3SH 4NN5C 3S4SG 2D7QA 5I1JL 1QSEB 5J89A 5E1GA 2WZPD 3DXAD 1UXLA 4JFHD 3UTPD 1MREH 4RNRB 1SOKA 1R3IH 2TRHA 3VXSA 1UD6A 3SODB 4JGNA 3BP7B 5K5YA 2AP2A 2ZXCA 2CKBL 3QZNA 4CVWA 3FUEA 1WA2X 3QA3A 3GXNA 5ANMB 3KMDA 9CGTA 1B2WH 5KBNC 2B9AA 2JV6A 1JZHA 5AW5B 2XOTA 3ZZSA 3U0WL 4ZUUB 2Q8AL 1NAKH 3DX4A 4Q6IB 4PP2A 3WKMH 3VD2A 3QQ3B 5E4EC 3II2A 2P9RA 4YJZL 5BRZE 1ITBB 2BVPA 1X5IA 4DKEH 4OCWH 3V52L 4MJHA 4NRYB 2IGFL 4Y4KB 5D6CA 1S7UA 1TJGH 3I3EA 1NCAL 4UV4L 2DLIA 3I6LE 3ABZA 5T1KA 2JKIS 4DP6X 5I8CB 3WNJA 1EAOA 4N86A 3M6DA 5EIIB 4G7SB 1IGYB 4X9BA 2DI7A 1KBVA 4HS8L 1UM4L 4FJYA 5DUML 4K9EC 1OHZA 2TSBA 4M1GL 4JK0D 2ED9A 4NKMB 4RFEB 2G4EA 4H4NA 4W9FC 1DVFD 1MCPL 2HVJA 2P42B 3IJSA 4HCRL 2BIOA 3P9LA 1N7MH 3L45A 3RURA 1CFQB 2AJYL 2C1PA 3HI5H 1WEJH 1D7BA 4W9DC 1Q4NX 1U4FA 2DQEL 4M93C 4ZBJA 5C2UB 1RIHH 4TNEA 3MLXL 4X80L 4OJEH 5LGJB 3INUH 4MA7L 3FK3A 1HCYA 4RRPA 5C07A 1SXBA 1PTZA 3FQTB 1PZ5A 3QR2A 1CE1L 3QRLA 2CBPA 4XE0A 4KUCF 4HH9B 1WRFA 3GXPA 1FO0B 4OD2B 1ZLWH 3Q2WA 4RGNC 4ONGH 5DZNA 1T1WB 3SGDH 3QUYC 3FT9A 4LKCA 3CWGA 1SDAB 5ABAA 5I6XC 1H3VA 5AVRB 1E6JL 5DWUL 4HJSA 1MFMA 3H9HB 1U8LB 4FC3E 5HDRA 4ODTL 4OI7A 3V5KA 2L7UA 2MPVA 4OKVB 4PCYA 4EAEA 3EO0B 3DECA 3GBML 2VN7A 3GXMA 5HGAB 4NCC2 5TDNA 1EHKB 5EBWA 4M62L 2HCZX 1IB5A 5JA8B 2LQRA 5J0BA 2WLZA 2VR8A 2J88H 3CSYA 5FIEA 2YR3A 3SDDB 1T22A 5ITFA 2NX5A 2XTJC 4BFNA 5E00B 4U4IA 4PJ5D 4F8TA 4FA6A 5EA0H 3FFCB 4J12A 3E3QC 3FQNB 2IBZY 1EUUA 3VXMB 2EE6A 4YEFA 4GO6B 1CFNA 2VN5A 2HLFC 2R7EA 2N4IA 4U6YA 1P4LB 3PUCA 1D6EB 3GZQA 1JL8A 1I1FB 1M6OB 4Y1AB 5GRJL 1E4XH 1ZS2A 4JMXA 1QRND 2ZPKH 2FJFB 2NLJA 4GSQA 4PLJD 1WZLA 4HIHB 2Q7YB 5EBGA 5FO8A 3HS0B 4OZGB 2V5TA 5KJ7E 4MYPA 1XR9A 2F54A 2NDGA 4HWZB 3ZRFC 3VFOA 5DGQA 5K9KA 1A6ZA 2Y36H 2HT3D 3QIUA 2G2RB 3FMGH 4XNXH 4QWWC 2EYSA 1OB1B 3VW3H 2VCOA 1UM6H 1MCOL 1NLBL 2JH2A 2WYHA 2Q7AA 3C8KB 2IPTL 4L0ZA 5H2BA 5KSBF 5L0QC 2X87A 3O2VL 4HLEA 2L7EA 4YSCA 2ARJB 4P2OB 2ZCKL 2Y2WA 5B38A 1IV8A 3WOVA 1OOAA 3T2LA 3TJPA 1RUKH 2DLHA 4TQHA 4IJTA 1JPSL 4LSRH 2ZUYA 4BH7A 4OF7A 4HKXA 4APXB 3GSRB 3QQDB 2VM3A 3H1ZA 4YHOL 4U3SA 4P23D 1WFUA 2ZF8A 2RHEA 4XVTH 4MDRA 4JRWA 2WNWA 3H3BC 1HNGA 3KH4A 1MF2H 3U6RB 3BE1H 2F7RA 5C0AB 5BPPA 3KNBB 2NCMA 3AWEA 3WE6A 4XBPB 5DQDH 3BRDA 2CA4A 2W38A 2GK0A 1NCWL 3A67L 2FO4A 5T33L 2QGEA 4NKQB 4LLWB 3T8MA 1LILA 3FT2A 3VH8G 4A6YA 3QZWA 3OLIA 4S1SH 3WFBH 1JV2B 1LK3L 1I9RH 5K1VA 1AQDA 1B3JA 4OCSL 3S2AA 4MQXD 2HG5B 1GJUA 2A4ZA 3G5ZA 4HUUB 3SDXF 3RWEB 2CO2A 1EK3A 3X13A 2XN0A 1JMXA 2A1WH 1XGQB 2FO8A 2QBWA 2AK1L 5DRWA 4JFPA 5EF2A 5J5EA 4W9KC 3P3YA 1OP5H 3JYCA 4P9ML 4YC2B 4TLKA 1KYAA 4G42A 3S8FB 1BXVA 1IGIL 1RU9L 2NY0D 5DEFB 3QPXL 4ZMXA 1QUPA 2BINA 5IUCA 5D7LA 1HILB 1ZPLA 4IKNA 3OMNB 4F92B 3HPLA 4GW4B 3W9EA 4NUGL 4GXVH 1FJ1B 3I9GH 2ZOKB 4RGNE 1A4JB 1Q38A 2CUAA 4M6AA 3D0LB 4JDVA 4CVUA 5F88B 3DX9A 1G5AA 4F5CA 1UJ3A 2R56H 4NZTL 1YQ2A 5CIPA 1A3QA 1KBGL 3BWUF 4E41B 4UQEA 2EVFA 4QRQA 4BCYA 1XCTA 1J5CA 2VE6B 3MJ8A 3FT4B 5EHFA 1MFEL 4AM0Q 4AV4A 3QUML 3LTVA 1QR1B 4L9LB 3DBXA 4QUOA 3QW9A 3VI3B 4A6YH 3C6LC 4KRPC 4LPUA 4U1SA 1IAIM 2XTJE 3DGGB 3FJTA 4K7PX 5JPNA 4FXGC 4N0UA 4R2GB 1LEGB 3G04A 1YJDH 4ZUTA 3SE6A 4YIQB 3Q6GH 4XN8A 4NI3A 3E3QE 1T0NB 2Z92A 3OJ2C 1F1AA 3DTXB 4N6RA 2LU7A 1CDGA 3MC0A 4M03A 1I3RB 4M7LT 1MFBH 1OD9A 2ZUUA 3MRBB 3OKMB 5I1JH 1JK9A 2DTML 2XQYG 2BVYA 1R19A 4RDBA 4CSTA 1OV8A 4Y5YA 4N2GA 3CU1A 4Y19B 1HQRB 4AC4A 2W5PA 1L0QA 4U33A 3IPEA 3ZY7A 3IDMA 2CKBH 4OGXL 3ATDA 4JRLA 4DEPC 2DWSA 1QPPA 5CCGE 4ZO9A 4ZTPL 1N70A 4PJ7F 4XVJL 1OAZL 1PGRB 5GPRA 4W9ZA 3V4PB 2Y9RT 4F7PA 5I0ZA 3U0WH 3I9PA 2Q8AH 3TTYA 1NBVL 3BP6B 4LPWA 4R90L 1NUDA 4XMZA 3DUUA 4NQEE 4KJQD 3NTCL 3D8MA 3D85A 4G80A 2BNRB 2CIIB 1G9HA 1TQTA 3V4VA 3MCG1 4FFZA 1WZAA 2OULB 3V52H 3VXNB 3B2PA 2FLMA 4P2QE 5T5NF 5DA0B 4WSGA 2AAVA 5INCB 3V0VA 4Z3IA 1J11A 1FLRL 2WZ5A 1NCAH 4UV4H 1VJSA 2K7PA 4TRPL 3GC3A 3S6CA 5CFHA 3QH3B 2G2NA 4IRSC 1ZLVK 1A6AB 2F6AA 3OF6A 3ARGA 3B2XA 1TVBB 3FN3A 3HNTL 2HJLB 4HS8H 3IGLA 5DUMH 3VMNA 4L5FE 2BHUA 4M1GH 3JBG7 5CHNA 5HPOA 4UT9L 4Z7OB 4OLZL 3U0TB 1CFVL 3L3JA 1QYGL 4M6ML 1MCPH 4HCRH 4K3HA 4U2ZA 3WIHL 1SMAA 2Q3XA 3E6HB 5KYWB 2XWBB 2O6DA 3ECBB 2AJYH 3UTZA 1XGPB 3OLGA 3GM0A 4NKDB 1AHWB 4YHNA 2DQEH 3FO1B 4U6VL 4TOYL 1CDBA 3MLXH 4X80H 1L5GB 2D3NA 3GMNB 4MA7H 1MLCB 4NNYB 3OHXB 1G0DA 3W0WB 1EEUA 1X4ZA 1U8OA 3X12B 1S7VB 4QNPF 4R5XA 2E47A 3S96B 4N2NA 2QZQA 1CE1H 2GT9A 2QHLA 4BKLA 3T1WA 3GXTA 5DRNA 2HLAB 1PLAA 3MNDA 3ARDD 3V95A 3C5XA 4NQSA 5JLZA 1XEDA 4P9HL 4Z0BL 5FYLD 1BOYA 2Y3AA 1E6JH 1H6TA 3D4ZA 5DWUH 2Q76A 3BEWA 3SJVE 1CICB 3J07A 5J12C 3WS3A 3GNML 4ODTH 1PJWA 3DX3A 1WS7A 3GBMH 2BJML 3LRGA 4XOBA 5B3JF 2MCPL 4XT1C 1EXUA 3U9PL 1X5FA 3VJ6B 4M62H 3PHOA 4UOW0 3ZKSD 4Y5VB 1I3VA 3KPPB 1QEWB 1L6ZA 2ITDB 2WZPA 3O3EB 5F7FA 3MSPA 5CZXC 4FG2A 3QP3A 4Y88A 4IIQC 1PAMA 1G7HA 1GKEA 4F57L 2ZOLB 3NYKA 1KXQA 3PV7A 4YGAB 4I87A 1WCBA 1TJIL 3QRGL 5C9JA 4R4NC 3MAWA 2PXYC 2I7SA 2ICWA 2ITEA 1U0QA 2DMCA 2LTQB 3L1OL 3MFFB 3QGVA 4LESA 3UG3A 2EIDA 2EQDA 3OMIB 4Z7NB 4KWUA 1ACXA 1E8YA 3NQIA 4G8EA 4KXZI 3A4DA 4LCIL 4LIQH 4DUWA 4JFOA 1YUKB 3FB6B 1FUNA 2K78A 1GYAA 3H4FA 1BD2B 4Y16D 1TQCB 3KW7A 1MVUA 3KYOA 3SDCB 3RIKA 3UL4A 4N0FA 5CBEA 2WVVB 3DSNB 1PY9A 4M4PA 1MCOH 3UROR 4HKZB 5B8CA 2L8AA 4B6ZA 2IPTH 2E6QA 4X6EA 1USQA 1NKOA 2Q0ZX 4U6XB 4JO4L 5AAPA 2ZXEB 4MZ3A 1SZNA 4ZOAA 4BK4A 3L5WB 3O2VH 3QT2A 5HYJB 3VNYA 5IMOB 5KUKA 4TL5A 5LN4A 2RQEA 3M8OH 2ZCKH 4M8QA 4HIJB 4E5XA 4P2RE 4OZ4B 3SGJC 5EZJA 1XDTT 3RAJL 2I9LB 3WY4A 1EPFA 1XH3A 4JB9L 4G8IB 4NOFA 4PJ9B 2QT6A 1UQSB 3QORD 2ICEA 5K39B 1JPSH 4YSOA 4JO2H 4KTEL 4XAKE 3MRJB 5JXAL 1HFUA 1RI8A 2X4UA 4YHOH 3LN9A 2XVKA 1UZGA 5T1MA 2WLIA 1IAKA 1SVBA 3V4UL 3L3IB 5EO0B 1T04A 2NYZA 3L95B 4JVPA 3RGBA 3QEHB 2H41A 4LCCC 5T5NG 2EDHA 1XD0A 1XB8A 2VJ8A 1T7VA 4NIYE 4CRPA 5KS9B 2IBBA 3FAXA 4YDVB 5IVZB 4FFWC 1NCWH 1R46A 1H5BA 3A67H 3QUMA 4LB8A 5T33H 2C7FA 2PW2A 3GDBA 2HJKA 1T66D 4L4VD 4IKKA 2DM2A 4NM4L 3Q6FB 2MFNA 1M42A 2A9AA 2A6DB 5J8OA 1LK3H 1LVEA 1LMKA 2VSMB 1GZPB 4OCSH 1FRGH 5BVJA 3UTSD 3P30L 3B3IA 1LWRA 3QRFM 3QIWD 1BLIA 2XN9E 4IKLA 1NPNA 2LU3A 1CDJA 2AK1H 2KS0A 3SDYL 4ONFL 4Y4FC 1QR4A 4L3CB 2XVLA 4C4KT 3TEZA 2DBJA 4P9MH 4PJXB 5FGSA 3ZQWA 1IGIH 4L3EE 2WUBL 5F70A 4BDVB 2QFRA 3DV6A 3FXIC 1R0AL 1T7WA 3QPXH 2X1XR 5HI4C 5D7SL 4MCZB 3DRTB 4TLTA 3IU3A 1DJSA 1ZKAA 1ZLDA 3P4MB 4RMBA 4WFEE 2Z7UA 3I50L 4AM0B 4ZYKA 1W0YT 1KWGA 3ZT6A 3TEUA 4KV5F 4I8DA 3B8SA 4PJ5A 4ABVA 2V7NB 2QPEB 3QNYB 4Y8AA 3TTSA 2WW8A 2W0FA 3HMXA 5TE7L 1KBGH 4WRLA 1YAZA 1GGUA 5E4AA 1MAJA 4GRWB 1DQJA 1G94A 2DIJA 5GIRA 4ZUSB 5JZ7D 2IMMA 3CAFA 1MFEH 2NDFA 4P07A 3QUMH 3TWCL 1IBDA 1QRNA 1VCAA 1OSPL 3E0GA 1RJCA 4GRLD 4TL4A 1M7IA 1BZ9A 3KXFA 1H3WM 4RH4A 4O00A 3BZ5A 2C3HA 4L9DA 1NCUA 2A9NL 2PUQT 3OAYH 4X6FA 4XPBL 4HALA 3JTTB 4U1LA 5TQ0L 1TEGA 3N1FC 1A7NL 3C8DA 5FYLL 3OKNA 2BSBA 4O51B 1QI3A 4LEEA 1FYTD 5IOPB 2YK1L 3F84A 4HX1A 3VSUA 4AIZA 2XG5A 1W16A 2DTMH 4KNTA 2ROXA 4YHKL 3SEPA 4JHAL 2O5YL 3PWPB 3KM2A 3WIHA 3ZE2E 3JWNG 1A9EA 4IOSA 3IMSA 4OV5A 3QR1A 2WO2B 3FCUB 4OGXH 2VR3A 4YVNA 3PP4L 4P23A 1H8OA 3K0WA 1HTYA 4WSJA 2Z8VC 3G5XA 4YHPB 4A2EA 4F7EA 5LNDA 2RALA 2QVMA 3VX0A 3HMXH 4N2CA 4XVJH 1OAZH 4K2UL 4E42B 3POCA 4XO8A 3D2TA 1A65A 2JJTA 4HUNB 4HUVB 1C8PA 1IKNC 1NBVH 4R90H 2KT6A 4AXWA 4A7UA 1QA9B 4UAOB 3NTCH 3WN5A 3RBGA 2EDNA 5F3BB 5IKCA 4CA4A 2EXYC 3UX9B 4P5TB 4DUVA 1W2KT 4ZXBD 1FG9C 2CBOA 3UOAB 4KKAC 2Y2YA 4PS8A 5EWIL 3NZHL 1HAUA 3BKCL 1FLRH 5ENWB 3S37X 4TRPH 3F85A 1FZJA 3UZVB 3FUMA 5B4MD 5F6IC 1HEZB 1NC4D 3L4CA 3VI3F 5F9AC 2FSDA 3KEHA 4PJFB 5GSVB 1K5WA 4YR6A 4OLZH 1DQKA 1PU0A 5LBSA 1CFVH 1QYGH 4M6MH 4CVXA 3QUXD 1DN0B 1OT4A 3WIHH 3T4AB 3DHMA 4WJG3 3V5HA 4FHJA 3SE3A 2Y7LA 4IRZL 3KG5A 4U6VH 4TOYH 1J18A 1R33A 3IFOB 3RWCA 2XTLA 2J72A 5E6ZA 1ZVSB 4H8VA 4KQ4L 1UCTA 3GPEA 1OP5K 5E2VH 1YEWA 2EP6A 3CX5K 4LLVB 2NY2B 4QAMB 2A38A 4GKZA 4XTRD 1BF8A 1BWMA 4AGOA 3I84A 2M83A 4ADIA 1A6TA 3GSUA 5DQJB 4P9HH 2PR9A 4Z0BH 3CN1A 5IBUB 1VKXA 1I9EA 2O6CA 2JXMB 3MV8D 4TLSA 4JUSA 1BJ1J 3GNMH 2C1PB 2BJMH 2ZWLT 3C5JB 2MCPH 4ZMYA 1DUZA 5LGYA 3U9PH 3DVGB 1MDTA 4G71B 2ZX9A 1BQUA 2ENPA 3QPQC 2ADGA 2K6WA 2YD8A 3S2CA 2E7MA 2GIMA 3WGVB 2HX8A 4X8JB 2DI8A 5C0GA 1V5JA 5JOEA 4F80A 4G6ML 3J27A 4M7LL 3MXVL 1OLZA 3EO1A 4F57H 3KGTA 4BZ2L 2WZ0A 1M2VB 3PAUA 1TJIH 3E80A 3QRGH 3OWEA 4QHNB 5AW3B 3QAZB 2C3WA 1LXMA 4W9JC 2DWEA 1YMMD 1S78C 5EEUA 3L1OH 3G6AA 3S48A 3QFGA 1T6VN 2VKWA 4PW3A 2WKGA 1WLHA 4PMFA 1ZK5A 2VLRE 4LCIH 1NCIA 2WANA 5DFAA 4PJHB 5EBWB 4Z78A 4CKQA 2VDQL 1L0XA 3CX5J 3B37A 4WEEA 5LNEA 4QT5A 1HXYA 1WWWX 4ZFOL 2NX5B 5MEND 1M05A 1MHEB 2WXLA 2JKNA 2X7LB 5KAQG 2K6ZA 4QD2E 5H37A 5B1JA 4DP1X 3VFUB 5FKAB 3WEXA 3QUGA 4NFBA 4GO9A 3CSBA 1BGXL 3QWQB 4JO4H 4JMNA 4PV9A 1T6WA 4DP8X 3EJCA 1YO4A 4OZIF 3B9KA 3IKKA 4JDTH 4UZSA 5I6PA 2J20A 5AYUL 3QULA 1ADQL 4Z9KB 4LVHB 3ETTA 4JB9H 3RAJH 4DKEL 2R39A 1I75A 4R84A 1F3RB