4GUQA

Structure of muts139f p73 dna binding domain complexed with 20bp dna response element
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
200
Chain Sequence
b'EFIPSNTDYPGPHHFEVTFQQSSTAKFATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*GP*AP*AP*CP*AP*TP*GP*TP*TP*C)-3')
molecule tags Transcription/dna
source organism Homo sapiens
publication title Transactivation specificity is conserved among p53 family proteins and depends on a response element sequence code.
pubmed doi rcsb
total genus 36
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4guqA00
2GEQA 1EANA 2AHIA 3WTVA 1H9DA 2XWRA 5G4MA 1UOLA 4LOEA 2BIPA 4IBTA 2X0UA 3IGKA 4IJTA 5G4OA 1YCSA 5G4NA 3WTTA 5AOKA 2RMNA 1CMOA 2BINA 3WTSA 4LOFA 1HJBC 2BIOA 3US0A 1T4WA 2H1LM 2X0WA 4HJEA 1HJCA 5ABAA 4AGLA 5AOLA 5LAPA 3D05A 3D07A 1TUPA 2X0VA 3VD0A 1LJMA 4G82A 2FEJA 1HU8A 2BIMA 5LGYA 4L0ZA 2J6WA 2PCXA 5A7BA 2ATAA 4IBWA 5AB9A 4G83A 5AOMA 4AGMA 4KVPA 4AGQA 4IBZA 3VD2A 3D08A 3WTYA 3Q06A 3US1A 3EXJA 3EXLA 3WU1A 5KBDA 3VD1A 3TS8A 4AGPA 2P52A 4AGOA 3KMDA 4L18A 2J1XA 5BUAA 2YBGA 3IGLA 3D09A 3WTXA 2J1WA 4AGNA 4XR8C 4LO9A 1EAOA 1EAQA 2IOIA 3WTWA 3QYMA 4IBQA 3ZMEA 3Q01A 2OCJA 1E50A 2J21A 3D0AA 1CO1A 4IBUA 2IOOA 5AOJA 1IO4C 2WGXA 2AC0A 2BIQA 3D06A 3KZ8A 4L0YA 2J20A 2IOMA 4GUQA 5AOIA 2VUKA 1KZYA 4QO1B 4IBSA 2MEJB 1TSRA 4IBVA 1GZHA 2XWCA 4A63A 2J1ZA 4MZIA 3WTUA 2ADYA 3Q05A 4GUOA 2J1YA 5ECGA 4IBYA 1GZHC 4MZRA 3QYNA
chains in the Genus database with same CATH superfamily
3EFFB 3EO1A 1YDPB 3QQDA 3E38A 1S7TB 4WFGE 3IM1A 4H20H 4IGBB 5HDOA 3IMVA 1I4FB 5C09D 1I1AD 1XF1A 4OF6A 1IEAB 3OWRA 3ZDXE 4JFSA 1VEPA 2R51A 2OULB 1EZVY 3PWLA 3FO9B 4P4KB 1RZIA 8PAZA 2Z4QA 2XFGB 4E2OA 1ROCA 3K6OA 3CFQA 2J88L 3PXHA 1T5KA 3TWCL 3CLEL 5H35B 4HJEA 1HH9B 2ZWYA 2LGNA 1YMHA 2WUCL 3R0NA 3FQNA 3U4BH 4JGNA 1UT2A 3AWFA 1MCPH 1MH5B 1FJ1A 1VERA 2W8CA 4L29B 4OCSH 2W60A 4CILA 4CMMB 5FIEA 2H7WA 1KLFA 1JERA 1X5ZA 2OSXA 3RU8L 1WQVT 1F6LL 4QRPA 2V17H 2AV7A 2DLHA 1K8DB 1G94A 3QO0A 4JLRB 4CN1A 1B0GA 1CD0A 5GRJH 1C16B 4HH9A 3MLUL 4UNUA 5D1ZA 5DVPA 4NHCH 3NCXA 4O2FA 3MROB 4F8LA 4AQEA 4JKWA 3TOPA 1ZT7B 4QHKJ 5GIRA 1JTPA 2EEDA 3G08B 5HDQL 4IS6A 3WN5C 3ZHKA 3FCTB 2LW3A 1P7QA 1OGPA 5DRWB 1SQ2N 1CD8A 4N1CA 1D6EA 1OAUL 2LLGA 1X5FA 1D7DA 2QGCA 3MN8A 4N2MA 4RCAA 2FT8A 2GYSA 1QBAA 3TH3T 3RVUD 4Q0XL 3NACH 4IRJD 4K9EH 4GPVA 1W72L 1U3JA 1OHZA 3S3BB 4POZD 2W0FA 4FZ8L 2EACA 1L7IH 2UYLA 1JWSB 4OAWB 1PJ9A 4TN9A 1BIHA 1NIAA 3FOMB 3Q2CA 4DGUA 3AJ7A 2B4CH 2WLMA 5C0GB 4YPGB 4CDGC 3HNTL 1SXZA 2XIBA 4OD2A 5CGBA 4BZYA 1Q72L 1XZWA 3QZWA 1GS8A 4IQHA 3ATEA 5AYQA 4UANA 1IIIA 4G11A 5C0BD 3SDAD 1MRFL 1CB4A 1PD0A 1CFQB 3CSTA 5D2LA 5GS0D 2GBVA 3RTQB 4AIXA 1P84K 1S9XB 1G6RB 4GP5B 5FW7A 3NK3A 3QDGA 3ZUCA 4L8DA 3E2HC 2Q8AL 1K85A 3C9NA 4P2QE 4TSBH 3TFKC 3QUGA 1MVFA 3P2BA 2R0LL 3PWPB 2C9VA 1YVLA 3GTNA 5HVWA 3ILDA 4GSUA 3RIFK 4DSYA 4HF5L 2GUOB 2GSGB 3CN2A 4BWUA 3G5VA 3TONA 5G4OA 3ZTNH 4HAGA 3BIKA 3LIZA 4K7PX 1SOQA 4XVTH 2VITA 4M5TA 1BEXA 3VH8A 4YSOA 3VSQA 1O7DC 3TNMA 1X5AA 2QFRA 4I89A 1FNGA 5DC0A 5CEZE 8CGTA 1NUNB 2BSSA 1JYNA 1V3MA 4B53A 2OMWB 4FLQA 3T77B 1RZGB 3ZL2A 5IHUL 4KTEH 4M00A 4NUJA 4TVPD 3OG6B 5I75B 5IEKA 2G0KA 5JW5A 4I1NB 4MHHG 1R5VB 3INUH 1JXGA 3GUTA 5ID0B 3KLHC 3RKDD 1C5BL 5EU3A 3UPAA 4EZKA 5AZEH 3EFOA 2GC7C 4P2AA 1NGQH 1KTBA 4KTYA 4HJIA 4AGQA 3KM1A 3ZX1A 3T2LA 2DYSB 1MCDA 3SGDI 4LBEA 3GMPB 3SDCB 2F53B 2E86A 1HAUA 4PJBF 4UIKL 1CK0H 3SBRA 2VDOH 3H42H 4WTZA 1QYGL 5E4IA 3LRHA 3S37L 5CXPA 1BZQK 1Q9OB 3GINA 2H3NA 5AVTB 4WI9A 2HH0H 3R06B 4EUPB 1A8JH 1AHWB 5L7XL 3TZVB 2F15A 3IDNA 2OV0A 4K94C 3CFMA 2R0WH 3OMNB 2YUVA 4N22A 4NKDA 1J0JA 3UTTE 1KSRA 2CHNA 1LEKA 1B3JA 2Z4QB 4XCNB 5LJYH 4PRIA 3FB7A 4HALA 3SE8H 4LCYA 5DHXB 4G7YH 2IGFL 3QR0A 4ZO6A 5FEBA 3N40P 1JZ7A 2DQJL 2ZKWA 4PJ9D 5CF3A 1ZS8B 1PNDA 4ODTL 1U6AL 5LXGH 3F2LA 4LHQB 3BN3B 5MERA 4HKJB 3LOWA 4J12A 4KMTH 3AXIA 1S7TA 2K6ZA 3H55A 1S78D 5EV7A 3ARFC 2AQ2A 5C7XH 5T1LA 4XVJH 2HFEB 1DDHA 4NZUH 3LKRB 5TDNB 4NIKB 1KGUA 3PGFL 1QSFA 3P30H 3LV3A 3B4NA 2VXSH 1ZV2A 3IMRA 2O61B 2BOLA 4HK3J 1I85A 1DBML 1N7MH 4HKXA 3QUYC 1OE2A 2EVHA 1JUFB 1NGPH 4YSQA 1BZ7A 2GW5A 1ZVNA 2XZQL 4BM7A 1U8HB 4OH2A 1U9KA 2XPGB 2GKIA 4KV5E 4PJGA 4WK2B 5FWQA 4NKOA 2P80D 2RFXB 4FQLH 1K6QH 1U92A 1R46A 3P4NB 2WCPA 2GBUA 3REWB 1AVAA 4IKNA 4KHXL 1BGXH 5DVNA 3TF7C 2LVEA 4GQRA 4EN3C 3P4MB 2Y7LA 1JNNL 2OI9B 2H1LM 4JO4L 4NIYE 2RQ8A 4M8VA 4DN4H 5E6ID 5CR1A 3F5WB 2IPKA 3WKNA 4U49A 3V4PH 5K1JA 5INDA 2BIHA 4D9LL 5LGKA 4CU6A 2IBGA 3H3PH 5ESAA 3RQ3A 5GS2H 5E1AA 1LQBC 4UOW1 5DFVD 2HRHA 1BQHG 1BOGA 2OMNA 2X4TA 3I02B 3SBWA 4DGVL 5B39B 5JQ6L 2ZX9A 5IZ7A 1BM3L 4MS8C 3R7QA 4ANVA 3I9IA 2OM5A 2GTZB 2PPAA 1G7IB 2VKXA 1Q0XH 1OSZB 5JDSA 2ZYHA 2IWKA 1KT2A 5ESVB 1J5OH 3VUAA 2X1QA 1EXUA 3GLEA 4KZDH 3S3DB 3VXUE 2KL6A 1U42A 1OGAE 3F65A 5EOTA 1R5WB 1PD6A 3IPEA 2VYRE 2JB6B 1ZVSB 2D3NA 4JKMA 2WWKO 2YQ2A 3D18A 1LEIA 2V17L 5E1HB 5F8RC 4HPYH 4WW2F 4YLBA 1OTTC 1L7TL 2CIKB 4L37A 4U7KA 2OCJA 3IDJA 5D4JA 3VXMD 5I17B 3WEOA 4OZHA 2NYKA 1J8HB 2J8UF 1MCPL 3R19A 2RAMA 3FT3A 1EO5A 2R39A 4JM2C 1FNEB 1AGFB 1ASPA 2X89A 5A2LH 4Z7WA 5FA4B 3D06A 4HK0A 3X1BA 1YQVH 2FJHA 3DRQA 2CH8A 3ARBC 4DKFH 4V1DB 1AY1H 1BMGA 2X4SB 1ZWIA 4ETYA 1ODAA 1CFTB 4G42A 2DQGL 4JJ5B 3EJPA 1M2VA 1GCFA 4ZTPL 2GIXA 1P7KA 5ES4B 3Q8EA 2CKBL 4U05A 5I6NA 1AQDB 4H2AA 2VXQH 1S7QB 3L9YA 3FQRB 3MLRH 3T6ZA 5T5FL 3IFPB 3ELQA 1WZ1H 5EZJB 1TG8A 4ES8A 1TPXB 1WZAA 4NN6B 3TGXA 3ARVA 5E2VH 3HI1A 4ZBJA 3HI5L 4FP8L 1REIA 4KHXH 2ITDA 4JHBA 3ZRCC 1K3ZA 4HC1L 2PPDA 3QJHB 4PS4L 3VG9B 5I73C 4KROD 4Q6YA 4DW2H 1JK9B 2VR9A 3VI4A 5IVXA 2BNRB 1NFDF 1QUNB 4RAUA 3VCLB 4FABH 4HIIB 3O6KL 4JEGB 3SCMA 3CLEH 2BFVH 1MHCB 3BSGA 3DPBA 2O6FA 3E8VA 2YMOA 1JGVL 2KLRA 4FD0A 4OZGE 4X80L 5JXAL 5J57B 3C6LB 3PL6A 4N2FA 5T3XD 3EJUA 3RWFA 4OGZA 4ZFOB 1G7MA 4JQXA 4UDUA 2FIKB 5IT2L 3GK8H 4H8PA 4PR5B 3QXAB 4FJYA 4YSCA 4ZNEA 5I1JL 4ICXA 1IIKA 5EZPA 5ITBH 1I1YA 2DQUL 5JQIB 4QRQB 4G8FA 1PZ5B 3F7VB 3L7EA 3VXTB 1J5DA 5IBTL 5IFHL 1U8NA 1HE7A 1QLFA 4PJHE 1HHGA 2O5YL 2XQBL 1LO5B 2W95A 5EFIB 5IJVA 5GRWA 5C1MB 1OF2B 3MYJA 3BKML 4HFWA 4PU2A 4N6QA 1NCJA 1GTNA 3RL2A 1BECA 4ZT1A 4M48L 4AIOA 3GJFB 4GSDH 1E7UA 3GJFK 4X6DF 3UAJC 1XO8A 5AUMB 1IL1A 2K7PA 2JKLA 2ZOKA 4H25A 1LK2A 4M02A 4UF7C 2YA1A 4LHUA 4ZUWA 2WO4A 4I1PA 4JDVB 1JK9A 3VI4B 1NMCC 1MJUL 2DQCH 1E6OL 2V9UA 1S6NA 1V8HA 3Q01A 4R3SA 3I9PA 3R8QA 3I3BA 1WS8A 1UA7A 1IEAA 3FTVA 2VR3A 3ZDZE 2VN6A 4NDMA 4BELD 2VDPH 1JDCA 2ZF9A 5AVWB 4EI5A 1DJGA 1RU9L 3DA0A 3T0ED 1INQA 1H3PL 1B2YA 4LE8A 1JK8A 1WIUA 2RHEA 3IWUA 4QHMB 5DZ9A 2OMVA 3RZWA 5F3HA 4P23C 3T0EE 4JG9A 5IY5B 4B3EA 3TA3C 1JXJA 1A0QL 3QRGH 2R0WL 3EHBD 1OGSA 4P2OA 2DKMA 5AD0A 2VLJA 1AR1C 4LCUA 2W94A 1BF2A 2YAPA 4FA6A 1CFTA 1ED3B 1QLRA 5FDWB 2YRLA 1RZKL 2DI8A 1XIWD 5GXBB 5IIEA 4QAMB 2HMID 1RERA 1X9QA 3A67H 5GJSH 4K3EL 2PYFA 4JY6B 5CD5D 3QS2A 3EDJA 5FF6B 5DJXA 4XMPH 2CAKA 3B56A 4HJ1A 5HHME 4PLJC 4I87A 6FABH 4QXGL 1FL3B 2CBOA 5AL8A 3DYPA 5D8JH 5IHWA 3RNQA 4PJ7E 3EG9A 2O6DA 4BCYA 3S48A 3FCGA 3HAEA 1F11A 4XI5D 4BZ2L 1PF3A 1YECH 3HS0A 5D7LB 2AS5M 2WQVA 1JZ3A 4LEOB 3IFOB 1CL7H 5LAXB 3BWZA 4IBLT 2PCYA 3CSBA 1JNLH 5E9NA 2E9JA 3IJ8A 5KSAB 2J6EA 3U2SA 2UY7B 5I5IA 1L6PA 1TUPA 3E1F1 3FS9A 4F92B 3V5KB 1RPUA 1GXEA 3OZ9H 1K8IA 5K9JH 3U25A 3S88H 1U8MA 3BJ91 4HIHA 4TUKL 4QTFA 4P2RB 3EHBB 5GZOA 5I66B 4WFED 1MFCH 3IJEA 3N0PB 4OZHF 4AMWA 3K4DA 2P8PA 5F6HJ 1GMEA 2MOQA 5E1AB 5IUCA 3REVA 5I8CA 4XTRD 4KRPD 2APTA 4OLZL 2UZPA 2CLRA 3DUSA 1A1OA 1XB8A 4IGBC 3KCWA 4ODVH 4ATWA 1IBFA 3BWUC 2BY3A 1F3JA 2EECA 4WW2C 3W82A 3RWCA 3KPTA 4EDXA 3MJWA 4U1LB 1IT9H 4QLRA 1P6AB 1XGPA 3DGCR 1XSOA 1SOXA 5C6TL 4G7RB 4XC1L 5IMKB 2E7LA 3X2QB 4NKOB 3ABMB 1R1CA 5J6HA 3PJLA 5SX4H 1PJWA 3E8UH 3NSCA 4G9DB 4Q9QH 1A9EB 4PY7A 3G9VA 1U2CA 4EMZA 1NC2B 3Q0HA 2DIJA 4JRYE 3L2MA 2NY3B 5CZRA 3P3YA 5C70A 4D0BA 3UEQA 2B2XH 3B1UA 4JZJA 5ICZA 4Z95H 2WVVA 4JRXE 1EAPA 3TBWB 2X6AA 4AEIL 4IOFC 1T66D 3GBNL 1RZ7H 1T1ZA 4TKWA 3MLVH 1G1CA 4K2UL 4J3WA 4TM9A 3IGAA 2X1XR 2ZUXA 2O5XL 5EOCL 3GSOA 1MAML 1P5UC 4YXKL 3OB0K 2CRIA 4XVOA 2QHRL 3KDMA 1VFUA 4GNKB 4HW6A 1D5IH 1JCVA 4U2ZA 1GTFA 3M46A 4NZTL 3MKGA 5EZOH 3EJRA 2QDVA 5CKGA 1LEGB 2NY0B 4CSSA 5E2JA 4AC2A 1FE8H 1GA2A 4C47A 4G80B 4GG6B 3V0VB 4LEXH 2GJ6D 3Q48A 2UY6B 4ECNA 4AXWB 1BQHA 3FQ2A 3CZJA 5JUEL 1WBYA 1JZHA 1D7BA 4XHJD 4ZD3L 5DD5L 2NZ9C 4F7CB 4K5NA 4NC1C 4NENA 1X4YA 1FYHB 1UT1A 1RZJL 4FTVE 4MAYA 2BNRD 2XNAB 3SQBA 3C2AH 2YXWA 5CJOH 5AOKA 4BCXA 2H3NB 4RFOH 3IKCB 3PWVA 4MQTB 1OPGL 5I2IA 5TF1H 4JZOA 4YIQB 1NDMB 2VXQA 4X8JB 4YH6A 5K59F 2WC7A 4DOHE 1BAWA 1A4BA 3FK3A 1Q8MA 3RNKB 3VWJC 2BC4B 1F13A 5HI5C 2HT3C 3FCSA 3OKYA 4PV8B 1F4WH 1KPUA 1J5IA 4PJAF 5C0EA 2QMKA 1S2EA 4L3ED 4LF3B 1MI5D 2EC8A 4NWTL 1GOFA 3BAIA 2QSVA 2DWXA 2A6JA 4ISVB 3SPHA 1PAMA 1QLEL 2MRYA 3IRPX 3DMMC 4CKVX 1CQYA 4M9PA 5EBWB 1NBYA 3SE3A 4PJ5E 2E47A 5E2VL 2FGZA 3LZFH 3ABKB 3BP6B 2CD0A 1CD1B 1KELH 1ZJAA 3AWEA 2F54D 3WU1A 3IXAA 1C08B 4GSRA 1QPPA 3PHOB 3ZGHA 3IGLA 3WD5H 3ZE0F 3M8OL 1YEKH 4RNRB 1XT5A 4LO9A 4E9LA 1JRHI 2HT4D 1OP9A 4BWWA 3VXMB 1EAQA 4B9PA 1DQTA 3K72A 1WWCA 4O2CA 3RB7A 3KPRB 1T5XB 3VXRE 2CA3A 4FN0A 4WK4B 4K55A 4QNPE 1IRAY 5DYOB 2J21A 5KSUA 4MS8D 3B9KC 2DWEA 2XWBA 4G9FA 2R4RL 2X9WA 4MKMA 1ACYH 4J7RA 1PG7X 4PJ5A 3S3CB 1MELA 3MJ7A 2AXWA 4ZXBA 4KTDL 3EFDH 1BXXA 2EVIA 1KPRA 3G6DL 3CMGA 2PABA 2Q10A 1N59A 2VQ1B 3H0TB 2XETA 1J5HA 5E0FA 4GS7B 3MV7B 2C9QA 3T8MA 1DHKA 2VO8A 4K9JA 2EABA 1ZHNB 4F7MB 3X13B 1OAKL 3WXWL 4W4NA 2ARWA 3SKOB 3U4EB 1M42A 4FJ6A 2FJSA 2G3XA 1HAWA 1U2YA 1AI1L 1Y1UA 3K8KA 4OD2B 4Q6IA 4H7VA 1EANA 2DLTA 3B2UD 4GKOA 4JPKH 3EBAA 3OKDA 5KYNA 4KHTL 2IALB 2ZXQA 3NQKA 4K3JL 1UOLA 1NTDA 1UURA 3L3OA 1J9QA 5DFVC 1EMTL 3IFNL 4YGVA 5CN2A 2JKXA 2HKFL 3W81A 1AOZA 2Y7NA 2BSTA 3VFRB 2YUXA 1ZANH 5JW4Q 4WHTA 2VDPB 3FH8A 1YCSA 2R7EA 3RDJA 4F3FB 1XD0A 2JKJA 3D4CA 2WMPB 4ZI8A 3WIIH 3EBHA 2DF3A 5DHVA 3H8NA 3Q13A 1Q0XL 2LT9A 1IEBB 4F7TA 1KIUB 4ABQA 2ATKB 1IGMH 4J8QA 4OIIL 4U7SA 3S5LB 5C9JA 1MFBH 3ES6A 4ZAKC 5HHOA 1E9QA 2P8LB 3SDCC 1F02I 2GIMA 5T1MA 4DZBA 2WZPD 4LSUL 1TETH 2DW5A 4NZRH 4NN5C 3K5SA 2FIRT 4BZ1H 1M9SA 1I3RA 4JLRA 5JW4N 4RGMC 2X2HA 4UT9A 5IW6A 5LB1A 4ZUTB 4F8PA 2PCXA 2ZAIA 3UDWA 4D94A 1AHWC 4F7PA 3CFIC 3GF8A 7PAZA 5DEFB 5E4AA 1E3XA 4ABWA 4AGMA 5CD3B 1U2HA 2BXYA 2W92A 3MRCA 4NN5B 3HAEH 3DHMA 2I24N 3O4LB 2GK0B 3QK0A 4U1KA 4QRRB 5I5JA 5BQDA 4BFIB 5IMMA 4WI6A 2NNXA 3U6RB 2ZG3A 4XAWL 4H13C 4OZ4A 4N20A 1S78C 2BNQA 3DX6B 5GRZA 3ZBMA 1LLAA 5MENA 4ESKA 2H6PB 4PJHA 3US9A 5T5NG 2H1PH 3FULA 2WIIB 4XB3A 1PZUB 4FQ1H 4HDIB 3NT0A 1MDAA 1HXYA 2EC9U 3P4OA 2A1WL 3D2TA 3X1EA 4KX9A 5SWZD 4F91B 1R47A 1MPAL 4TLTA 4PJFE 4GRMA 3W9EB 4PWGA 5I1HL 2OR7A 4Y8AA 1ZGLP 4KK8C 5LCVL 4K23L 2B0SL 4OJFL 1H3VA 3GSNB 1G5GA 4YK4B 2P49B 2LAGB 5JW4R 3KVDD 4GRWF 4PB9H 1LM8V 1ND0A 4FFWD 3Q5YA 4RQQB 1OE1A 1UM4L 1OAYH 3NPZB 4A63A 4JPKL 3MGOA 2QR0A 3Q05A 3NIDB 3FC8A 1AIZA 2TRYA 3ME0A 4ZOBA 3ENEA 1ZJBA 2C1PA 4QXUL 3QQ3B 5EBGA 3CC1A 2VSCA 1BFVL 1ZDQA 3V0GA 3QYNA 1ORQA 3BT0A 1DBKL 2VN3A 4LPXA 3ZTJG 1BVLB 1OOAA 2OI9C 2R2EB 3W0WA 1WICA 1UUSA 4GRWB 2I32A 2ITCA 4NM4L 1P1VA 5E2TH 3RWEA 4HBQA 1L9NA 5CHNA 1Y0LB 4FA7B 5JLZB 5TQ2L 3KVPA 1T04A 3KH4A 5CMAA 1C8PA 2Z31B 1NUFA 4AITA 3SKNA 1NGXA 2CK2A 5JXEC 2VDKL 2HT4C 2WBWB 3QC5X 5KG9B 5MI0B 1AO7A 2VN7A 1ZE3H 2G3NA 3DRTA 1JJUA 4CC1A 3QNFA 5A6LA 2VKWA 4IHOB 4JM2B 1AO7B 4OLUH 1AG0A 1J1XL 1P6FA 2XVBA 3K46A 4MMZA 2XG4A 2OL3A 3CSYB 1LILA 4LL9A 1DLHA 1D5BB 3QRBA 5LAPA 2C3GA 1KB9K 4IU2A 4A66A 4TSBL 2Z8WC 3UX9B 3TN0C 5BW7A 1RZJH 2QADB 4NB7A 2PR4H 3FBKA 3BVTA 4XNUH 4GIPD 5LDUA 4OQ1A 3NCCB 5C0BB 4GRWH 3SDAB 4DFHA 2Y25A 5GS0H 1P7BA 3SDXA 4PJIA 4X5XB 2VW6A 2BX5A 5A2AA 3GMOB 4UCFA 3SIKA 1MRDH 2XC8A 1E8ZA 5L2JA 4O02A 3V0AC 2N1KA 5B38A 3NIFE 2J1KA 3B1TA 5JPMA 3D25A 4TXVB 3H54A 1SHXA 3C2AL 3MCLH 1U0QA 1LE5A 3NFPA 2XTLA 1WSST 2WTPA 3U0PA 5EEXA 4FKHA 3HNSH 4FEIA 4JPSA 3WG7B 3D7PA 1TTBA 2UXGA 3QDME 1BZ8A 3QYMA 4EF3A 2DLEA 2MPVA 2NZ9D 5E0QA 3TJHD 1S5HA 4I0CC 4NM8L 4WO4D 1KGWA 1DLFL 5GGTL 5E8EA 9CGTA 1CDGA 3OKNA 1OPOA 4IRSC 2JE8A 4YVNA 3UPRA 4F7EA 3HZMA 1KN4L 1TZAA 4M7LH 3ZE1F 1HXYB 2FLRT 2ESVD 4FQXB 5GPRA 2AK4B 2JJSC 4UM9D 1ZK5A 2DPKA 3AUVA 1WA2X 1P4LA 3X3FH 5KVFH 3LXAA 2EADA 2DS4A 3N44B 4EDWH 4ES9A 2VQ4A 1RUPH 4BKSC 5L2KD 5C08D 5F2FA 2O26U 5GZNC 4U6XA 4MNQE 4PEEA 5EZOL 2A9CA 1ETB1 1PQZB 3RL1A 5SX5H 5GGRB 1GZHC 1DR9A 1ZSDB 3UJJL 3RU8H 2NY5H 1YEIL 3Q3GB 4ELMB 2GJRA 4IOFD 5E4OA 4M5YL 3RUGF 5ACZB 5KW9H 4P5MB 4XAKE 5F7EL 2GIYA 1QUPA 4I4WA 2EDQA 5DQDH 2VZSA 3RY5A 1JZEA 2EDEA 1OTSD 4B96A 1AZUA 5T5FH 1I1AC 2AXFA 1UWXK 1U58A 2XWJB 4PP1D 4M3KB 3UJTL 1GJUA 1IAIM 2P8LA 5TPWH 1JF1A 5C9JB 2JSFA 2X4NB 4NRZB 1HL8A 4XRCA 2IWEA 4NQSA 2OMTA 4LNVA 4KMQA 2YEZA 2DYPB 3IBEA 4ADJA 4JMXA 2ZUYA 2W1NA 4OVVA 3IGFA 3D50A 1TJIL 2HRPL 1E9OA 3CZKA 3EYOB 4JFFB 4MXQC 3OJDA 3QPQC 3BO8A 4AGLA 1KZQA 2EYSB 3UTZA 1N6QL 4MJ2A 4PTUB 2H41A 3UYRH 1NBVH 2AK1L 2UWEA 2P28B 4XE0A 1KXVA 1MCQA 3DHUA 2J3SA 4JRXB 5BUPA 1ILSA 2X87A 3K0YA 5B8CA 4KK6C 2CQVA 4QWWC 4IBWA 1QX1A 4QXWA 3E6FB 4JO4H 2EVJA 1R9FA 4XN4A 4Z7WE 4TNGA 3CBKB 4W9HC 2DYRB 3BZFA 3LRKA 3O6MH 5E23A 1OM3L 3QEGL 2WXIA 4AL8C 1DVTA 2YOAA 3N5AA 5FKPB 3EJZD 5GSVA 4U1JB 4QTIH 4K5OA 1AZZC 5TDOB 2OX5A 4WW1A 2X05A 1NPNA 2NY7H 5IWLA 1NCTA 3D9AH 5JYLA 1K2DA 4L4VA 5BVJA 3N06B 1TO4A 4DEPC 4OFQA 2NXYB 2AW2A 5DK0B 5FYJE 1E28B 1H3TA 4F9PC 4MAYD 2MTPA 4XXCC 2Z7UA 4L9LA 4OF7A 4Y19E 5F97E 1WUNT 1ULVA 4LU5H 4KOBA 3ZTDC 1NBZA 4M61A 5DRZA 1A6AA 2IOOA 2LU7A 2OTUA 5J13C 4YZFF 1IFHH 3LH2L 3MUY1 4WWKB 3DX0A 5IR1B 5EPMA 4C54A 4ELDA 3QNYA 1KJ3L 3O8XD 2WBKA 5F0PB 5AOIA 2QKIB 5BS0D 1UA3A 3VXSA 2B3IA 2X4RB 3EHBC 2QTVA 3T8XB 3TH4T 4Z3GA 4XAKD 1I7RB 1IBGH 1RHFA 5FDYA 5J1TC 3EUUA 4Y2DD 3VFMA 1OT2A 3ARDB 5HGBB 3PP4L 4DP8X 2X09A 2LAAA 4XAWH 1CL7I 3C6EA 3LKNA 2I69A 3QZBA 3QNZA 3ZJAA 5SWQA 3BP6A 3BUDA 5FO8B 1X9UA 1NBYB 1V7NH 3O81A 4J4PA 3A21A 4KFMA 4YDKL 5GISL 5KVDL 2XKNB 1OAQH 2A6JB 4TQHA 5G4MA 5EU6A 3ARDC 3QJVB 2QQLH 4MCZA 4BSVA 7PCYA 5SWSD 4GG8B 43C9A 3BAKA 5HVHB 3AT8A 2P5WD 4WFEE 1CUOA 4PJ8C 1A3LL 2PWHA 3BIBX 4XBPA 5FK9B 4AX3A 3NVQA 1BD2A 2CE6A 3BI9X 2Y7QA 4U6VH 2BC4A 3NABL 3FQUB 3HE6A 4MQ7A 1G9NH 3BQUD 2YSTA 4OJFH 5M7QA 3VFOB 5I1DA 1LE9A 1WAEA 2APBA 1IC7H 2FEDD 1AQMA 2FVNA 3N1QC 2CR0A 2A4ZA 1VADB 3GMQA 3AROA 3DBXA 3QIWA 3S3PA 4LNRA 2XNAA 3SQBB 4MB3A 3D0LB 4OZGA 4HKBA 4WU5A 3HR6A 3AY2A 1C12B 2AVGA 1UVQB 2DIEA 2MNWA 4NBYB 5C07B 3BESR 3SE8L 1Q1JL 1OO2A 2HFFB 1YN6B 4YUEL 2MHAA 3I6GA 5D1XE 4GAFB 4QOKD 2RA1A 1TENA 3TBSB 1CE1H 5DJCA 4E9TA 1A6WL 2GJPA 2AABL 1IAOA 1THAA 1U8IB 1XQ4A 3MOBH 4IKIA 4F15C 3ZSTA 4H88L 4ZUUA 1KY6A 2XI9A 2MOGA 1M7DB 4JO1H 4YL4A 2NY3C 2O5NA 1IGIH 4BYHA 4AGOA 3IDMB 2CHDA 3HC4L 3VWKD 2A9NH 3MRRB 5LQBH 1U8CA 3B9AA 1AD0B 1Q38A 4K7FB 2VABA 4OCWL 3JWNG 4PJ6A 5BV7L 5C0CA 2YSSA 3C8KB 4HGWB 1JPFA 5FS5A 3V7AE 1C5DB 1YRKA 2IQAB 3QIBB 3SE4C 1I53A 1VFAA 1N9PA 1VFAB 4P2OD 4PRHA 3RUGA 3AT9A 4B9JA 4GYBA 3E7JA 3Q9QA 1HINH 3VRLE 1M71A 4M43L 1T20B 5B38G 5EUOB 4KPHL 4ZMVA 1OAXH 1XGTB 4JO2H 1JXKA 3ILEA 3QISA 3BKMH 2X4QB 2XXMB 3UTSB 4Y5XB 4ETQA 2KQMA 3L1OL 3UXFA 1T7ZA 3FZUD 5CEXA 2D4FA 4QF1B 3S96A 4M7JH 3QFJA 4MJJA 1HOCA 1Q0YH 4LASH 1XH0A 2ZWKA 4Y9EA 4KJYB 2V3EA 1B0RA 5FYJH 3AG4B 2HX8A 3T3ME 3KPPA 3WN5B 4YXHH 3MXVL 2Q3AA 4PRHE 1EAJA 5ESQA 5L2KB 3E80A 1FGVL 3REVB 1PFCA 4WUKL 1A47A 1INDL 1T7XA 3U36A 1KWKA 2AHIA 1MRCL 4JN1H 3MODL 3LIUA 3U7WL 5K69A 3MRFB 1IKFL 2XBDA 5AQ0A 5I1LA 2VLRD 4WWNA 1S3KH 2AK4D 4UM9B 2ESVB 4QHUB 3AG1B 3DX8B 1ZGLB 3FFCD 1K8IB 1S7WB 3MJ8A 4G1MB 5GGTH 4PJ8A 3WKQA 1RIUL 1KIQA 2D3JA 4KNTA 4BH8B 4JM0A 4PJCB 1WC7A 1GIGL 3HNVL 1PLGL 3MBXL 4LEOA 3WTTA 2OKMA 4LVEA 4FNLL 3V5DA 2XZAL 3PV7A 5IBTH 5IFHH 4G43B 1I31A 4MNGB 5F44A 4L8BA 1XZ0A 3VMPA 4K71C 2ZXCA 4WU7A 4MD4B 4AWJC 3HC0A 4KXZH 2PPCA 3HE7C 1OARL 4GS7C 1TKWA 3KYKL 3ZO9A 3F85A 2D9CA 4PJDA 1J5CA 5JLZA 1IM3B 2HG0A 1UA6H 3FB5B 1XX9C 1HQRA 1PG7H 2CRYA 2ZSWA 4YQXH 3S0PA 2JIXD 3B8YA 4R2GB 5E03A 5BZWA 1CGSL 4URKA 2AQPA 2LHAA 4GAYA 2P4AB 5SWZA 4XGZA 1YQVL 4JFQB 4ZMAT 1MVUA 3DX9B 4L3EE 3S36X 3QQ3A 3D3VD 3DO3A 4YAQB 5FX3A 1LP9E 5ILTL 1HCFX 3TBVA 4H40A 4QMEA 5D4IA 3TV3L 1BGXL 4BFFA 2GAZA 3KGUA 2HLFD 2HTKD 1SN0A 2HFTA 3MX0B 4PRAB 1AE6L 3DECA 4APQC 1DJWA 4YBLB 4H0IA 3GLDA 2YA0A 4M43H 2CBQA 2AEIT 5DRZB 5IWLC 5HD8C 2F74A 4XPGL 1WT5A 1KTCA 3O3EB 3E6HA 4J28A 4KKLD 4YHLL 1UD3A 1KJ2H 3CBJB 4AQAA 3PV6A 4XCCL 2E74C 4FNUA 5K9OB 1B9KA 1YMMD 2OSLA 2BNUB 5J1AA 4R3SB 1U3ZA 4NM4H 3AGWA 1QASA 3T9WA 5C09E 5CEZL 4JDVA 4QTHB 4ABUA 1NCOA 3MLZL 2C9AA 2X1PA 3T71A 4X5WB 2ZQKA 4PJBB 1ITBB 4FI6A 1SY6H 3TO4D 2VDLB 4HUWA 4HUWB 4G7VL 1E9PB 2ICCA 4S10A 2G2RB 3T2OA 3F58L 3QJOA 5KBNC 3L3IB 3MODH 4MX7B 3CDZA 2E9IA 3IKKA 4D3CL 1DVYA 3IDGB 3KH3A 1C8QA 4X99A 3B2XA 5E8OB 3FH7A 4H8QA 1CE1L 5LCVA 4KI5C 4X4ME 2C9UA 5B39G 3VTMA 2Q86A 1F4AA 1ROWA 4PTUA 4Y9CA 4GI9A 1YPZB 4NNYB 2CR6A 3H2PA 1BQLH 4LCIL 3VQLA 1T7WA 3RAJH 2KI6A 3ESOA 4OM0L 1I1AA 3X3GH 2ICWB 3H9YA 1S5IL 1F2XK 3DKHA 4U1GB 1KIPB 2KERA 3CGTA 4A2EA 4G3YL 2YIHA 5I6PA 4DF9A 2EYRA 2APVA 3LHAA 4R90L 4BQ6A 1DEEB 4XCYA 4OLYH 2E8YA 1YC7A 2DLFH 1SJXA 2WP3O 2DOCA 2XG5A 4OCWH 4NNYA 5EOCJ 5F7AA 3VFPA 3EOAA 3AT0A 4B5ZA 1RUML 3C60B 3BZ5A 5EIQA 4PWFA 4X6EB 5F1OB 2Q5BA 4L1TA 1L9MA 3NZ8A 4XCFL 4OIBA 1S9KC 3K6SA 2ATAA 1GYWA 4KZCA 3DVGA 2GFBA 2KC0A 1OGAA 3GIVA 5TQ0H 2H2PC 2YD3A 1FVCB 1YYCA 2IPTL 3MLPA 2HWZL 4XZ4A 5DU7A 1IGTA 2Z6FA 3QDGE 4QGYA 3FRPB 4FL4C 3MO1B 1OM3H 3JWOH 2WTRA 5DMGD 4A2HA 1MFDL 1LP9B 3WTXA 2ESVE 2FB4L 2VRAA 1FPTL 1BX2A 3GUFA 4HMCA 3RWJB 1IZKA 1KLGA 3TO4A 5C8JA 2ZKMX 3WNNA 1T66C 4IMKC 2C9SA 3QUZB 3EW3B 2JQZA 4YL9A 3BXNA 2AJYL 3VDCA 2DWEB 2XWBB 1EFQA 2J8UE 4JAMA 1HH6A 3OKLB 1EEZB 3FNKA 4XMPL 4MMXA 2BP5M 4WNSA 3AG3B 1H9VA 1TYRA 3VX1A 2IH3B 1B88A 5GGQL 2QQKH 3BFWA 3QI9A 4HISA 4HV8B 5BW7C 4LIQL 4RETB 1JNJA 5EOQL 3UJTH 1I7UA 3LNFA 3I3EA 3GI8H 2AMGA 4GRLA 3SOTA 4KO9A 4Y5XA 7FABH 3AU1B 3C6SA 1NGWB 3GPSA 4LAQL 3VXRA 2HLAB 1M71B 3BP4A 3AGVA 1NPUA 3K81A 1CFSA 1OP3H 2QL1A 2A0LD 3CFKB 3RGVB 4ZFZB 2KPNA 1Z9PA 5FHAL 1C5DA 2IQAA 3QIBA 4KJPD 5BZDA 3K0WA 4LOEA 1MZZA 4XO4A 3ROOA 5B1CA 5FC9A 2VDPL 5EBLB 4LSTL 2V5YA 5B1KA 5IHUH 4DERA 4IHOA 3V5DB 3I9AA 3O8XB 2QADC 4LPYA 3WIFB 43CAB 3DRTB 1OLZA 4XNZC 1RJYA 1CT8A 1KBWA 2Q20A 3KYNB 4JDZB 5T1DH 4XBGA 1PCSA 1WC7B 1KXTB 1ZLVK 1JMXA 5DEZA 3ILPB 3MFGB 4YEFA 2Y36L 4S1QL 1IEHA 3OKEB 1NCAH 1AGDB 2QBWA 4P5KA 4QRSB 3REWA 2JELL 5I1KH 2YAOA 1WD8A 3FN0H 4MAYB 4FQHA 2ZWZA 2NSQA 3LH9A 1VACA 3GSQA 4DETA 5AOZA 1UWYA 2X0VA 4NUGL 4DVBA 3FTWA 1VACB 1KJ2L 1R24A 1LWJA 1LK3H 3UG3A 4PGZA 1XAUA 2XFXB 3FOLA 3PDOA 4HSAC 1AHKA 4DTGL 5DHEA 1KXQA 3KWXA 1URIA 4OFYD 5DGRA 2WZ0A 3CH1A 1WLHA 1ZY9A 3SYOA 4NOBA 2R2HB 2XICA 3DXAB 1ET5A 3EOBA 3C75A 3C2SA 3QFJB 1MCFA 3ZN6A 1HKLH 4BK4A 1KCRL 2EINB 1A3RH 2ICWA 2J1XA 1KGJA 4FFZL 4OGAC 3X1GA 3F7PC 2EICA 3QWQB 4N6RB 2W9EL 1B9ZA 4MA1C 5KANG 3NCWA 4J3OC 2ORBL 2P5PA 3L3KB 2N1TE 3HLAA 35C8H 5HTSA 3QBTB 2VLME 3FSAA 3NN8B 1E5UI 1OZUA 2WNGA 3JV0A 2AI0L 1UYWH 4D8PB 4BBWA 5F96H 4I3GA 2ROYA 2VLMD 2PO6B 4DO4A 2V37A 1IAKA 5FOJA 1CLYL 3QPQD 3VFMB 2MPAH 4JFPB 1PZ3A 5LWYH 5DUPL 1JDDA 1LNUB 3QG7L 2HKHH 2BSED 1A9VA 4MMYA 4AIEA 1ZLWH 4M7JL 1AXSA 3HB3B 3GRWL 3MBWB 4L5FH 1GJIA 1T0MB 3U82B 4K94L 1RPKA 3QR2A 3SDCA 3C5ZC 5CZXC 1GOHA 4K5PA 1Z9SB 1KTDA 3O9WC 5E2UH 1MWAB 1I3RB 2MHAB 2IDCA 3B8SA 4P99A 3OF6A 2G9HA 2PXYC 4Z95L 1CFMA 2QGDA 1HILB 2Y4SA 4L23A 3CFJA 5CBAB 5C08B 1JZ4A 2AZAA 1UATA 4KNUA 2JK5A 3EGSA 4FYSA 5F72S 1IKFH 2YXMA 4CADA 2J5WA 5IEKB 3B5GA 2C9PA 1S46A 4TULH 4OLXL 4ACPA 4OGAD 4LEBA 3FU6A 4ONOA 1BMWA 3ATDA 4AUUA 4CSTA 3MRLA 3QZNA 3L95B 5EF3A 1FYTB 1U3HC 3FQUA 3JTTA 4MQ7B 4KJWC 3TWCH 4DPRA 1F4XH 4KRPC 4WJ5A 2JV6A 3EGXA 1O6VA 2C1OA 2J55A 1SJEA 1IJNA 2NXZC 1G9HA 4WJG3 4E9SA 2E76C 3NZ8B 2VLKD 4JJOA 2QKIC 4ONGL 1EFXA 3MZTA 4EIBA 4FFTA 2XV0A 4JE0A 3ARGD 2VDKH 2X4PB 4KRPB 1MFEL 5DVLA 3OAUL 3QE5A 2Z1PA 4I3RH 3QNZB 4JHAH 1ZPUA 5HYJD 3W5NA 1E9OB 1LO0H 3DURA 3KGTA 2J6WA 3SDDD 2XDHA 3UYOD 3L95A 1PSKL 5I15H 1T0NA 1UG9A 4HWZB 3U4KA 1B4JH 2CLVB 4E5XB 3VNZA 5F7HA 3US1A 3GXUB 5AD0B 4V2BA 1E7VA 1PZSA 2QQNH 1EJOH 1H8SA 2ZP9A 1OP4A 32C2B 4NPYB 2JK5B 1MW0A 4P3DA 3ULVH 4LVNC 3CPLA 4AIZB 3FUHA 5KSBF 5JORA 1VHPA 3PABB 4JO5A 1KENL 4ONHB 3DVFA 4FHJA 4X6BB 1NWPA 2X10A 5CBAA 4UBDC 4YBHA 4TRPH 1SZNA 3IJSA 3L3HB 5IB1B 5KSAC 1RIHL 3ILQD 1QATA 3SDXE 2Q86B 4NDMB 3MV8A 3UACA 1RZJC 3FUJA 1IGFH 5D2LF 3TCLA 4AEHH 4AJYV 4OZIA 5EZIH 3SE3C 2F19L 1HHHB 1ORSB 2BVPB 5DLML 3U46B 2OSYA 1WRFA 1VESA 3HC2A 3RX5A 2AXJA 1AC6A 1RK0B 2XVKA 5HHVL 1PL3A 1JPST 5D4QA 1MNUH 3RJOA 3UG5A 2ODIA 2ZKHL 1Y18B 4FTVB 2NSXA 4N90E 1MFVA 4K8RC 3QG6A 4JM2F 4N2GA 4QWWD 4JREC 1CVSC 2COQA 2FECL 3PWJB 3U6XS 4WW2B 3N42F 1OGTA 3L3JA 2Y6SC 2HUEA 2IQ9L 2DIBA 3WGUB 1XB3A 1FO0L 1HXMB 4L05A 5CU9A 2EDWA 4P5TA 2H32H 3WJLC 1XF4A 1U8NB 2R9HC 2EKJA 2EYSA 4N5UA 3FFOA 5F71A 5AYTA 5C0CB 3T0EB 4G7YL 2CGRL 4LXFA 4AQ1C 4TMPA 4FLSA 5E6ZA 5KZCD 5C97A 4YN3A 3QRFM 4AC4A 1MFNA 4X4MA 4Z3JA 3EFDL 2DJSA 3ATBA 3WFZA 3A4DA 3ZDZB 3D34A 5H35A 1KFGA 2G3MA 3VTTA 1AG6A 1NUDA 4TTDD 4X4XA 5SWZB 4AQ1B 2W59A 4HG4J 5IG7A 4I0PC 1MN4A 1EZVX 3CVHH 2WLHA 3SPVA 2XRAL 3QHFH 1A8ZA 1VGKA 1G9NL 2OMXA 2OMXB 3OLDA 4KK8D 1T6WA 5FW8A 7TAAA 3WHXA 3FQTB 1FFTB 3UG4A 1MHHA 1JD9A 3VD4A 4OV6F 4YJZL 2PTUA 4I0PB 4OQTA 5CLTA 4LSDA 3GMLB 2PNDA 2CJTA 3Q2WA 4RMBA 3BEVB 3UEZA 5I8EB 3PNRB 2WQXA 1YDPA 1HX0A 3ARQA 4W9ZA 4R7NA 3MNWB 1KJMB 2WXQA 2XXCB 4F2ME 5LNGA 3TXAA 1XF5B 3T1FB 4S1RL 4JL1A 1MJ7L 1KTJA 3HG2A 1IBHA 4XC3H 2Y7QB 1S9WA 1U8KA 3NCYP 4ZOCA 4ZJ9A 1HDMA 5BZDB 1W72A 4NXKA 5DUML 3BC9A 3FF7A 5J1SC 2PXYD 3GRWH 4L5FL 1N0LB 4G7VH 4X6DB 4DHLA 2IG2L 1I3UA 4LP8A 4X8XA 3FYEB 1NC2A 2Q76B 4M3JA 3GXDA 4XN7A 5EEUA 2R1XB 4MA7L 5H4YA 5HGDA 3T5WA 3UCQA 5CZXD 1SOKA 2MMXA 5FKAA 1RVFH 2IMNA 1MQ8A 1F90L 4X8CA 4F93B 4RRPG 5FR3A 3G5XA 4OZHB 2FR4A 4GAJL 3L4YA 1WPCA 4H8WH 1TEFA 2CIIA 2FT6A 4EVNB 5B7MA 3BUTA 3PNWA 5EU6D 3MRQA 5DS2A 2OL3H 4DKEL 5HHQB 3PAYA 4HWEH 4QR7A 3FQXB 4DGIH 3TF4A 2EVGA 3D1MC 4UAOC 1KNOA 3POHA 3TT1L 1I8KB 5FO9A 4ENED 4KK5D 4Z0XB 2OPCA 4NGHL 4X5XA 1JDAA 2C34A 3OL2A 4BV1A 2EDDA 3NJLA 4M4PA 3UH8A 4JQVC 4GLRH 4PJGF 2WBJC 3ESVF 2I25N 2RCSL 1QSFD 1YUKB 2YPKA 2WB1A 1B0WA 3L6FA 3IN2A 1F4WL 4KKNA 5BQ7B 1AXTL 1HDMB 4KQ4H 4L4VD 2ITEA 1E4WL 2HJKA 1T3FA 1IKNA 1XF5A 5JHLL 3SO3C 5PAZA 4MRCA 4TQEH 2MQ3A 4N2HA 3VI3B 4F2MA 4BFIA 3O2VL 5IMMB 4Z77B 1LHZA 4I88A 4ZFGH 5J7CC 3D85A 3BGAA 2NNAA 2H32B 3U1PA 1M3JA 4PY8I 5JQ6H 1T4WA 1A6UL 4E42A 1RK7A 1H5BB 3SO3B 1HOEA 4B27A 3RWEB 3QWRA 4Y1AE 4MXVF 2DRUA 1QHQA 5ICYB 2D2OA 5E00A 1CI5A 3VXUB 3DTXB 3O6KH 1Z7JA 3BO8B 1PZCA 4MRBA 4RAHA 4HKXB 2XSKA 2JXMA 3KYMB 1E65A 4HIPA 2YN3A 2AFNA 4XCEA 4AENB 25C8H 5I16B 1H5BC 2F54B 3ME0B 4AG4L 1OLLA 1G0XA 4ELKA 1HKLL 4P9HL 1QO3A 1LE9B 2F54A 4F3FA 3FTUA 3UJJH 1NIEA 2OMYB 3ZQ9A 4CVXA 1TVBA 4UV4L 4PJ9A 2GG1A 1TNNA 1TQWA 3D09A 1BM7A 2GHZA 3OR7B 1IBDA 4NRYB 3CN0A 3LNIA 1U8PB 5D2NE 3GKWH 4J3TA 4PJDE 2CJUL 4I18C 4RGNE 2DQGH 2JI1A 1INEH 3IN0A 4W9CC 1W2KT 5E5MB 3KPQB 4NQEB 3SBPA 1PDKA 1W0WB 2OMUA 4RGMB 1BYNA 1U41A 3H3BC 3R06A 2DLGA 3X13A 1E9PA 2F1AA 1HCYA 2A73A 3VAEA 4XWOD 3APNA 3HIZA 2E6PA 4Z78B 3LS4L 4MDRA 3WL9A 4OZIB 5LQBL 1GZHA 2BCKA 3CZGA 4OLWL 3OSVA 5HYSB 3MCLL 3D4ZA 4PJ5B 5CP7B 3RVTD 2VR6A 1N0XL 2A77H 3AS2A 1DBBH 2NY0D 3JWNH 3QQ4A 3A0OA 2W80C 3K6DA 4WEUD 2R4SL 4ERSL 3Q9PA 2HH0L 3IGUA 5CGMA 1QVOA 2LQRA 2CRMA 2D0GA 2OJEA 3SKJL 2JJSA 1H9DA 4N2BA 3CPLB 3MJ9L 1QW9A 3DNKA 3U0PB 1G0DA 1HSAA 4I0KA 1A0QH 2UUDH 4MHHI 5C6TH 4I8DA 3RBGA 3HUJB 3AAZB 2I9LA 4FYRA 3R7RA 3I9GL 4Y4FC 4KITB 3APFA 1ZHBA 3NUKA 4MA8L 2P80A 4MVBD 5CJQH 5IROA 5FM4A 3DV6B 3J27A 1KBBA 4YK4C 1HQRB 3EJSA 4G8GB 4TS6A 5CM1A 3AZUA 4XP6L 2BSTB 4JM4L 3FTZA 3JWDC 3LPOA 4RMUA 4WVRA 5FFGA 1YNKL 1R3HA 4ISVA 3RVTC 1Y7VA 5D7KE 3HC0B 2YRZA 4KWUA 5D1QD 4GW1B 1JS4A 2NNAB 3ZZ1A 3LCYA 2V2XA 4UIMA 4KXCA 1W16A 3H7BA 1XXFC 1FSKC 4PHZA 3FMGH 3MFFB 3OAUH 3TN0A 1ZHNA 4F7MA 3TCXA 3Q1SL 1UCBL 3LSOB 5KAQG 3V5HA 2CM6A 4PVNA 2HG5A 5K9JL 4JCLA 4JBSA 3T3MF 1M05A 3EGSB 2ESVA 2JWYA 4F80A 1NBVL 5MI0C 3STBA 1NCWH 1NMAL 3FQTA 5MEND 5AB2A 1UM4H 1G1OA 1MCWM 4XNZB 3CLFH 4NQED 1J8HA 3ML9A 3ULVL 4WKXA 3MLWH 4Y1SA 4ALAH 4HS8L 4JE4B 4X0NA 1KYAA 3LD8C 2BFGA 1TZIA 2ZXAA 3GSWB 2PTTA 4P5MA 5DJYA 1HTYA 5D7LD 1RZQA 3DOSB 1CE6B 4KKBC 3RB5A 2YLKA 3FQXA 3HRZC 2F5BH 4D8OA 4CC4A 2B08A 4PGEA 2H26B 1YEFL 2V9QA 1C7SA 1KCSL 3P0GB 1ZLEA 3H4HA 2V3DA 5EZIL 1ND0B 1FNFA 1YA5A 2A77L 3MKKA 4LHUG 1I9IL 1BSIA 1W9XA 4FAAB 3P3TA 5B7FA 2IDUA 1CD1A 5FCSH 4MDJA 3RTQD 1MNUL 2MKLC 5DD6A 1GSKA 1WGVA 1Z5LB 3MRJB 4Y7MA 1AC0A 2VISB 3TH2T 2NQCA 4R84A 1JPFB 3VGAC 1SJHB 3VXUD 2VISA 3F7KA 2E3VA 3FSVA 5ANMA 4N1EA 4R8WH 3HJEA 3PL6D 1AD0A 1LDPL 2J8UA 2X70A 4JFEE 3QJQB 2IDFA 2D4DA 1T2XA 4RMVA 2VABB 5CEZH 1GS7A 3FT1A 1A4AA 4ZG1A 3NFPB 5CLZA 4IRSB 1AOHA 3VGAB 2WUCH 3VRLF 2ZUUA 1A6VH 2VH5L 5DK2A 5HYJE 3U6RA 3CH1B 3QAZC 5A3IC 5B38B 4IRJB 4FQXC 4CJ1A 4NZFA 3S7GA 1Z9OA 1RJZA 2E7BA 1FQ9C 1CXLA 3O3AA 3BN9C 3B9KD 1PG7L 2EIJB 2CJUH 5KBMA 4PWKA 4M03A 2ALAA 2SODB 3VFPB 3WAKA 5DMKA 4PAZA 2L3BA 4OM0H 4AXWA 2DM2A 4NP4H 3X14A 1Z1WA 3F00A 3T0VA 5GS3A 5BRQA 4EZMA 3QAZB 2OBGA 1EJ8A 4JDTL 2WZPA 5ADPL 5I1AA 4K8RL 1GR7A 1YN6A 1J1PH 3PDGA 4AIZA 1TIUA 3CFBB 4MA1B 1JTOA 2MTAA 1ZLVH 2W91A 1IQWH 4WI0A 3T65A 3GI9L 2DAVA 4OGXL 1J11A 3UCRA 2ERJB 5KTEL 5FUCE 2CLVA 4E5XA 2FECI 3D0VB 4IBZA 1CI3M 1DN0A 1EGJH 3MFFA 1QAWA 2PO6C 1S7SA 3WIHA 4JHWH 2ZXBA 3DMMD 2BFVL 3WI9A 3QUMA 3HUJF 5EU6B 1B4TA 2X53A 4G70B 4XBPB 5FK9A 1WEJH 5BNXD 1X9LA 1EHXA 5H2BA 4N2CA 5KVFL 1WZLA 5L4IA 5KN5B 1KELL 2Q7YA 1HEZA 5INCA 3DIFA 2WQRA 4JFFE 1U3HB 3DPDA 5HJ3A 1MXGA 4YHKL 3IDNB 3RTLA 4KOCA 4PTTA 1SJEB 4IBQA 4EUPA 2NY5L 4AI7A 3KWVA 1Z66A 4G6MH 3MLVL 4BJLA 1ZK9A 5D72L 1FIGH 2NXZD 5FB8A 1HHIB 4OCYH 2E9BA 2NRDA 2ETWA 4N2NA 3JTTB 1RK0A 4ODXB 5LGJA 4HV8A 2VDML 5AZ2H 4IGBD 3N1PC 3BT2L 2WV3A 3P3SA 2IH3A 4H8WL 4NKIH 1QFWI 1FG2A 3D4GA 1XSJA 3SZ6A 5BV7H 1UWGL 1CF8L 2O5ZH 4OD1H 3MJ7B 5IROC 2D7NA 3VDAA 3N1FC 2VDRB 1HILA 1HXKA 2OJEB 1V7ML 3QARA 5LWYL 3MOQA 4JHZA 5KYXA 5E9AA 3U7AA 1GYVA 3RRQA 2W5PA 1C7TA 4HUUB 4I0PD 3LQZB 5DD5H 2K3TA 4DEPB 4LCCC 2WBXA 3RGHA 2QQKL 4ANKA 1KEMH 2X3BA 1FG2B 5F9WB 3MRHA 5CP7A 3TJHC 4NZUL 1DUZB 4OLUL 2F5AH 3CVCA 4P57A 1T2JA 4NSKA 1E8WA 4TNVF 2VWEC 3RYMA 1G7PB 3BP7A 1QKZH 4I9XA 3LKSB 5FYJL 1AIFA 4V1DD 3QPXH 4G1EA 1PGRB 1HIML 1MCSA 4G72B 1IBZA 2QEJA 4RFEA 4WW1B 3P0VL 2VDOB 2FO8A 4LDEB 1QACA 3V0FA 4PBDA 2B16A 3QQNA 4XZUB 1Q94B 3WLBA 1UXLA 1P2CB 1IGCL 1OZTG 1YEDA 2X4PA 1DSFH 4W9EC 5FM8A 3SGKC 5IKCA 1EFXB 3MR9A 3KBPA 3WNPA 1RSYA 2X0WA 4OV5B 5HYQB 1RXLA 4WU7B 3OJDB 5ALBL 4CVZA 4PS7A 5J0BA 1R19A 3F8UB 2HCZX 2NMSA 3L7FA 2BNQD 1MHPH 2WLYA 1ACXA 4JREB 3GT6A 3UJIH 4O4YH 1R3LB 2VDQB 3D2UD 3JT0A 3B2MA 2VLJB 4OZIE 3CDYA 1P9MC 4DCQB 3OKMA 5AOMA 3S5LA 6FABL 4UIKH 2R1WA 4WI0B 5ALCH 1J9SA 1DP0A 2XWXA 3HI6L 4OKDA 3WTYA 4X7CC 4JY4B 2AANA 1UQSA 1UWEH 2VUYA 2Y69B 4HIIA 4XP9L 2DV6A 1MCNA 3T0EC 4AW7A 5JXED 4AGPA 1MAMH 1L9QA 4OAWA 4L8SC 4LSUH 1CN4A 1WYJA 3VA2C 1FNAA 1OQXA 3M07A 4HHAB 3SQRA 2IV8A 4HOWA 2EIMB 2XA8L 3S8FB 4FCHA 1YQ2A 4Z7UB 5AWNL 5IEHA 1AACA 3SE9H 2GJ6E 3CZNA 1D2PA 5A6MA 5BMFL 3WFDH 2GT9A 3FQRA 2YD0A 3KDMB 1XGUA 1BREA 1S7QA 2WD0A 1OK0A 3KL5A 5E94B 4ZS7H 1R3KA 1KBPA 2OR9H 2WGXA 3OV6A 4OFIA 1EEQA 1JGUL 4Y1TA 3HAEG 2VLRA 3KYAA 1YY9D 2OFQA 4MJIE 2H0EA 1IAKB 1NEPA 2XXGA 2BPBA 2IOMA 4OLWH 2ZUWA 1WBZA 4KKBD 2Q6WB 2NTFB 2NX5D 1TJHL 4APQA 2QVMA 2AQNA 4JANA 3Q44A 4MWFB 1ZOXA 1IUZA 4Q4EA 3QO0B 5FA4A 4Z7WB 1Z5LA 4P9HC 1WHOA 3WIAA 5D6DA 4WWOA 1DQJA 2YD5A 3SYCA 3L7EB 3LB6D 1IKNC 2P5ED 2FO4B 5D96B 1YNTA 5DJ6A 4AK1A 3BVWA 1NGWA 4F58L 4HOXA 3CLFL 3HVDA 2CNZA 3IDMA 1Q1JH 4RAVB 1MWAL 1F3RB 2HWZH 4PJ7A 5BO1H 2H45A 3SKJH 2GUYA 3TJEH 2OTWB 4JG0L 2GEEA 1CE6A 1IGYA 3G6JE 4JQVA 3UYRL 3HE7A 1MI5E 3IK2A 3INOA 2CPCA 2W9DL 4GAYB 3VGBA 3RPKA 5EN2A 1FYTD 1NEZA 4AKQA 2BNRA 1R3IH 2HRPH 4P46C 5F0MB 4QCIA 1BQ5A 1KB5L 3QFDA 5G5DB 1YNKH 3N85L 2FQGA 3UBFA 2C3HA 2W65A 1SEBB 4TL5A 2BDNL 1UVQA 2NY6B 5FGSA 2CKBB 3C5ZD 4ZUSB 3QDGD 5FKAB 5AW1B 5C07A 3NIFF 3MRGB 3D0LA 4OZGB 3JT2A 5B39A 4UAOB 1URZA 2G2PA 4PM1A 4QRSA 3CSYA 2IBZX 4G6KH 4OSUH 3DROB 5DFTA 3HI6H 4LCWE 2VERA 5C71A 4JQIA 4UNTA 2DWTA 3WUWB 1BD2E 3VD5A 2ISDA 4MAUL 4AKOA 5HY9B 3MV9B 3QRLA 5GJSL 1OWRM 4YNYB 3WIFA 3NDYE 1WV7T 4R4ND 4WI2A 2G5BA 4Z0BH 4AH2B 1SXSA 3EG9B 2YFNA 1BAGA 1MQKH 2VZ1A 3O11A 5HHMB 1K5WA 2VZTA 3ZKQD 2P52A 4TLUA 3GRGA 3GBLA 3KLAB 4ODWB 2BMKB 5EORH 4F7CA 2YXFA 5F9JA 4A55A 5I1LB 3RGVA 5B21A 2WN2A 2PYFB 2XV3A 2A74B 4DFIA 3IDJB 1CFNB 3CVHB 5E99L 3IF1A 5EN2B 3KLHD 1JGLL 2X2JA 1FF5A 2UVEA 4NFBA 1T0PB 2Y22A 2H9GB 1WA0X 2CUIA 3L4CA 1UGNA 1AS6A 4AT6B 1PKQA 2C3XA 2P5WE 3QJUB 2VLLB 2FJFA 4N3TA 3QFJD 4PB0L 1HK6A 1PKQE 2P5WA 3DARA 4QHMA 2ZX5A 2EXSA 2MEJB 3L3DB 1T20A 3NTCH 4ZMLA 4GRMB 2K7QA 1XB6A 1EZUA 4WO0A 5KSVA 4FABL 3O6ML 1I8IB 2BY0A 2PWEA 2IANB 3OAYK 4BGDA 3A4AA 2C8NA 2WXKA 1JHTA 4MWFA 3LPWA 2JCCF 4FFZA 3DVNA 5F3BB 5FAAA 3CX5K 4GRWE 5IF0B 3U1SL 3OG4B 5L0QB 4H4NA 4NKIL 2VGLM 4BA0A 5I1CH 1RULH 2BRRH 2WTOA 3F5WA 4I77L 3ULVD 4RA3A 3VGDA 4PI2A 2ZYRA 3QWOA 1EH9A 5EIIB 2HVJB 4M7KH 2CG9X 3U30C 1NIFA 1KGYE 1NCCL 1ONQB 2XIDA 1DSWA 1GKEA 3B3IA 5TE6L 5DGQA 5IT2H 2VL5B 3X3FL 2VC2L 3MRKA 5C9KA 3ZYOA 3WS3B 4R0LB 2DQTH 1U92B 1QSVA 5D1ZI 3ERXA 1RURL 3UTPD 4HHAA 2AXGB 4GH7B 5BZZA 4G6AC 2ENYA 3UBGA 5DEFA 4AQAB 4F57L 2DBLL 4AYFA 5E2WH 5ELIA 5IESL 2PKDA 2Q9OA 2FAUA 1PZ5A 3F7VA 3O6FB 4G9FE 4WNJA 4ATTA 5IW6B 5BRZD 3UGEA 4XNAA 3D05A 3BPLB 4AM0B 3WCYA 3ULVF 1QEWB 3RGVD 5GS1A 4D0DA 5EF0A 4OF5A 1VGEH 2YFOA 1E5BA 1KBVA 4MB5A 5I0YA 2FX9H 2OMWA 4IMLB 4NRZA 4Z8FH 4FQLL 1RAMA 3C6LA 5E08H 5KSAA 1FE8L 1SLXA 4LLDA 3ZL4H 4LSTH 5TF0A 2WO3B 5F7DB 2DH3A 2P46B 4J4PC 4LDOB 3DSNA 1BVZA 2MPAL 4HCFA 4ZUVA 2YD2A 4FXGB 2FBJL 1YEFH 2WSDA 1PYWB 4P04A 4IU3B 3K3QA 3L3OB 1SGKA 1YPZA 1M7IA 3JWDH 1CC3A 4MCZB 4BSVB 2AQ3A 3DWTA 1VDGA 3UC0L 1VFMA 4WAFA 1SLVA 4XO5A 4FI7A 1XGZA 3GDCA 1L6XA 5GSRB 5J11B 1F3DH 1LDPH 4JY6A 2L4OA 4RRPM 1E4XI 1X3DA 2XHNA 1BYOA 1NMBH 1R3JA 5F7WC 4WEMB 5FOBA 3T1WA 3LN4A 1JFQL 1UGKA 4HSCX 4H20L 2XX1A 1EHNA 3WV0A 1QLEB 4QNPF 2K8QA 3NOIA 1NM4A 1O0VA 5D4HA 3RWDA 1Z3RA 1I1RA 2QKIA 3LPFA 4NSKB 4JQIL 1FLRL 3TJEL 3M7OA 2XTJE 3MA9L 1DJZA 4AYID 4P4KD 2IEPA 4QTHA 1GHFL 4ZMYA 1DO6A 3DYOA 4WFFD 2EDKA 2FWSA 3UPRB 5EH1A 5J1AB 1YEGH 1N3NB 2X4SA 3GMPA 5K9OA 5A40E 1FV1B 2I07A 2WVUA 3DRQB 1K4CA 4PRPD 1FGNH 3DC0A 3ZL1A 4HJTA 5C6WH 2YAEA 2ALWA 5BMFH 3WFEL 3ZMNA 1MF2L 1GGIH 1U8LB 2BCMA 4GO6B 1ZTXL 2JCCB 4L3CB 1RKRA 1TJGH 1E42A 1EJFA 4IBYA 5AAWC 4L8CA 1KTDB 4GQPH 1U4FA 1E6JL 1DQDL 5FUZH 3MRPB 2PWFA 3TVMD 4C83A 4MASA 3HC4H 5DJZA 4A38A 3QUZC 4KTGA 3WO3B 1ZVYA 2PXYA 1U21A 2VDMB 5IHLB 2EVFA 1O6SB 2YEQA 1KXVC 3KPSE 5GSVB 1A5FL 2KDYA 1DZ0A 1I1FA 2VITB 5ESVA 3FO1A 4YHOH 5I1EH 2K4WA 2ZCHL 1HQ4B 2FBOJ 2H47C 5IQMA 4YXLH 2VZOA 4FFYA 1EJOL 2WLJA 4DTGH 3QCTH 4FLRA 1KTLA 4IW4C 3KXFD 3HMXA 4FKEA 1GYUA 5IV2B 2GSGA 5ID1B 3CUPB 4X5QA 3ZE0E 3V6OE 4BDVB 1SEQH 3ZGIA 1XCTA 5DTFA 4PV8A 1CDUA 1MHPL 1BZDA 3WNLA 3UP1A 2NR6D 1FFPB 4KBPA 5G2NA 1J18A 1NDMA 5E95B 4JNXA 2H0FA 1BXAA 4UDUB 2IH1A 4O9HL 5C0CD 3RTQA 3HS8A 2ZKYA 3L9RA 4LKXA 4M8QA 5KOVC 1G0YR 3A6BL 3TT3L 5D7JA 3RZCA 1PBYA 4PJAE 5CCHE 4RGNB 2CBTA 2MCG1 1T89C 1AQKL 4XVSL 3V7MA 4O2EA 5CHNB 3RY6A 1WDAA 2NSMA 1IC1A 4Z7IA 4CU7A 5DJAB 3I6GB 3V95A 1A7BA 3MLZH 2ADFL 3TYFB 3PP3H 1YMMB 5GGVH 3SPIA 4N90D 1TVDA 3FAXA 3MMEA 1FO0H 2R59A 1CXFA 2O61A 5GGUB 5LBSL 3BAYA 2F8OA 4QXGH 4GT0A 5EU7E 3FYIB 3AACA 3CE1A 2A6KA 4NAQA 4UV4H 1YEGL 2X2YA 1E4XL 5BPPA 3GXTA 1RJYB 4JDZA 4HUMB 4GOSA 3IT8D 2WQWA 4ZW5A 1XGTA 1MCRA 2EXTA 3MUHL 1ZT7A 2DMHA 2EDHA 4NZJA 3EF4A 5ISZA 3ZVVA 3CZFB 3G7TA 1NLBH 2QPDB 4FCAA 4WUUD 3L3JB 3HG1E 3RUGB 3ARFA 3M7FB 4GKZA 4WV1A 9PCYA 5JPMC 1IZJA 1OCOB 1UEYA 4FERA 2HJLA 1BLNA 2WKLA 1DVUA 4ENEC 5HDWA 4FFYL 1FRGL 4LLVA 2GC4C 4OI9A 1C5CL 3MJ9A 1U3YA 4MXQD 1ZXKA 4ANXA 1LE5B 3QEHB 3HKZA 4JHVA 2QSQA 1YEEH 4EI5D 4LVOB 2CBPA 3D25B 2OW6A 5EC2B 3VFNA 2E7DA 4ZUUB 1H15A 4X7EC 3TESA 4W70A 4EJ1C 2FH6A 3U0WL 1W0YT 4C59B 5LN8A 3ZKXB 4FGMA 3OKLA 4MYWB 3HLKA 3B9DA 5L6YH 4I2XA 4OCLC 2OSWA 3G5WA 2F8IA 4XB8A 3F7YB 3MSPA 2RBLA 3I02A 5JXEA 3BKCL 2X6VA 4M6OL 3ZKXC 1GW6A 1EHAA 4ZPTA 1S3KL 1JVKA 2ODHA 3BAWA 1F00I 4HJ0D 2QSCH 1XMEB 1GIGH 4XE5B 5ESAB 3P69A 4DIXA 1XDTT 1QRNB 4XBEH 1FNHA 5D7SL 1CLCA 4KMLB 4A7VA 2BP8A 3CPUA 3H7BB 5I30L 2EXWC 3F84A 4XPBL 4EI6B 1YUHB 4NUQA 3HAEB 1FCCA 2YEVB 2OL3L 3AS0A 4KC3B 4PGCB 4DKEH 3WAJA 1J1OL 3WEXB 2CUHA 4JRYA 2R0KL 2QHRH 3OQ3B 2CSPA 2BWDA 1L0QA 3GSXA 5F3FA 4ZTPH 5JA8B 3P1VA 1IB5A 1IKOP 1CYXA 1HFUA 3UTSD 5A2JH 1UXMA 2XYCA 1TQTA 3PWPA 1UM5L 3W5MA 4AVHA 2VMJA 2QPUA 4XN9A 1M56B 1JD7A 3ZPDA 1XBDA 3L9EA 4OF8A 3B7YA 1EHLL 3FONB 2PO6D 3CHRA 4HC1H 2FX8H 2OMTB 1R4XA 3AAZA 5F7YC 2VQ1A 1LMKA 1CQKA 3CXFA 3H0TA 3Q6GH 2VMCA 4IBUA 1BBDL 3QHTC 3NJFA 5D7LE 4XNUL 2AJXL 3CFJB 3ULAB 2A6IA 1YJDL 2G9HB 2JB5L 1E43A 1RUQL 4YPGA 3N43B 2DQEL 4IBSA 5KSUB 3WFBL 3B2VL 3VQ2C 4LRIC 5CGYC 1ODUA 4R26H 1KCKA 1BMZA 2AJ3B 1KC5L 1U95A 4EI5B 3KD4A 4O58L 3LZFL 1T1XB 2IDSA 4Y2DA 2V33A 4DK3A 2J1YA 3ZU8A 1FDLL 4LVNB 3V55A 4MMYB 4LHUB 4ZUWB 4Y19B 1UZ6F 5C3TA 1AXIB 3WL9B 4OUUB 2H0PA 3OM3B 1JPGA 2AV1B 1K2DB 3BQUC 2WK2A 5H37A 1OB0A 2X28A 3GSUB 3N43F 5C07D 4E41B 4YSRA 5F9OH 2Z4TA 3QUXB 4FNLH 2EDMA 2GJZA 4YDMA 4E41E 5F88A 1MLCA 4HZAA 1O5PA 4H1LB 4DP0X 3BFQG 1IBBA 4NX0A 2XJKA 4NUGH 1BD2D 1N2RA 1A7OH 2A4EA 3ALWA 4KI5E 1F41A 5DS8A 4PJDF 1EEUA 4PN6A 4LSRH 5DT1L 3FN0L 1K5NB 4ZAKA 1VRSA 5F1IA 3SYQA 1CLZL 3MNZB 5KVEL 1O7VA 3WSQH 1EEYB 2V6HA 2FIKA 3OC8A 2OLDA 1LXMA 2BSRB 3G9AB 4KI5F 5AOLA 2I9TA 4H5SA 3U2IA 2M2DA 1MLCB 1KIUA 3TBBA 2KH2B 3NZHH 5E7BA 4ZFQA 5I16A 3CC5A 4JKKA 1QRNE 1ET8A 3ALXA 2BNQE 4HU2A 4OZFG 5HJGA 1HCVA 2CDGA 2WYIA 3VXUA 3BUIA 4DVBB 4BE5A 4R90H 4HXAL 4N85A 4LLMA 2AJSL 2O72A 1JOIA 3ZUNC 3O6LL 1QG3A 4FQ1L 4TNEA 5KYWB 3G6AB 3G5VB 3TLRA 4HIEB 4DGYH 2JQMA 1MCWW 4OZGF 5BZXA 3GZKA 3GIZH 1WTLA 2IFGA 5CAYB 2YAMA 4ZTEA 1AQDA 2ZP0T 1EBAA 1XR9A 1XAKA 1ZA6A 3MLYH 1IGJA 4L1SA 3KGRA 2BSDA 4XCFH 5DD3L 3B9KA 4HULB 1CK0L 3KXFB 1UB5A 2NXYD 3GBMH 5KG9A 1BFVH 2V8LA 3AS3A 3QXUA 1GGTA 1KPRB 2Y1VA 4ZXBB 3L13A 3GXPA 4P48A 3T2PA 1AGEB 4F27A 4PJFB 3MOBL 4DQOH 5H37G 4XX1G 1FAKT 1GJWA 4L4TB 4QAWA 4WHYG 1JWUA 3H6JA 3IDXL 3K91A 4LCWA 3PQYD 4LL4A 5D1QC 5C0GA 3RVWC 5T33L 3UO1L 2J1ZA 2YUWA 4DVRL 1OAJA 4GAGL 2XQYK 3C6SB 4IOSA 1G7QB 3HMXH 1IC4H 4LQFL 4QLWA 2GQHA 1S5IH 2YGNA 3MBEA 2OQJB 1NAMB 2P7TB 2DQJH 1CGXA 2DD8H 3QI9B 2LE9A 4K3GA 5HBBA 5FGBA 1F4HA 3RIFF 1SVBA 1JZDC 4I13B 1A1OB 3MUGA 4L5FE 1TF4A 1XCWA 3C60D 3GMOA 3FMGL 3BRFA 4Z7NF 3WFCH 2DYPD 1WISA 2X4OA 4N9GA 3OZKA 4K3JH 2NCMA 2YGQA 5JDSB 5EUOA 1WG3A 5SV4A 5CCKL 3EOTH 3FFDB 1FFNB 1Y6NR 3P40A 5AW9B 5HHNA 5BO0D 1D5RA 1BOGB 2R69A 4KXZI 5BVPL 1PSKH 3RWJA 3NACL 1HI6B 3ULSB 2F7PA 4PMEA 2AV7B 5JO5A 3WYRA 1IBYA 4MVBC 3IXTB 1FZJA 4KV5F 1S3RA 1VFOA 2MQGA 4K7FA 3TZVC 1GAFL 3UADA 2XQ0A 1SFHA 2VUOA 3KYOB 5AAPA 2W0KA 3K71B 1KJMA 1BG1A 3BPNB 5TE4H 1YMHB 2VNCA 2A74C 3H3KA 3SE4A 2AK1H 2OXGB 2C26A 3T0WA 2UX7A 3ROLB 4OT1L 3ZXAC 4QRRA 4A2FA 2FYYB 2VLRE 4FX5A 4GT7A 4UWQB 3VNYA 5C0BE 3GMNA 1IGCH 5KOMC 3N50A 1BQHB 2NY2B 1P5UA 3OX8B 4JKLA 4LVHB 1RZIB 4GQ9H 2XKUA 3MJGX 4TULL 1DZBA 1GVIA 1KC5H 5DA4A 1NICA 2F7QA 3O2WH 3LKOB 1FCGA 4WI3A 1B6UA 4YLQT 1WK0A 4JR9H 4KH9A 5BRZB 1EAOA 1ZT4A 3L2NA 5CINH 4DP5X 3O6FD 3KR3L 2K9UA 1RY7B 1XH1A 1V3JA 2CALA 2EDFA 4JN2A 3VYPA 3IVKB 2ARJQ 2XN2A 1E6JH 1IEBA 4OCRH 5DHMC 2UZYA 1A7OL 3WDJA 1N10A 5I0ZA 2XYBA 4NQDE 1JWMB 1YEHL 3KM2A 1JTTA 4YHIA 5AOJA 1BZEA 5L0QC 1S7VB 1K3IA 4KQ4L 4ZW8A 3WNOA 2A0LC 4F9LC 5I71B 2AGJH 5CP3H 3H85A 3JXAA 4XNXH 2X6BA 4HS3A 1HXMA 2AEQL 4WSKA 5E8PA 4JDTH 4JB9H 1CLYH 2VSKB 1A7RL 4KQ0A 5MEPB 4MZIA 4LCYB 4R7XA 5F7EH 5DJ8A 4JS7A 1NKRA 5D9SB 5DJ0B 1FNLA 3D3VB 2WLIA 3DJRA 2IDTA 4POYA 5HI3C 4ORGB 1HIMH 2X1WL 4U1IA 4B9FA 2H6PA 2WXPA 2MNUA 2ZPKL 4G8EA 2R8SL 5DUPH 5C0AD 3U4EA 5D7JB 4N2EA 1KYFA 1JI1A 2B4CL 3ARDA 4JRFA 4U3HA 1YJDH 2IFFL 1NDGB 2GY7B 1FWXA 3O6FC 2Y36H 1GRWA 4XOEA 2OYLA 2J5LC 2RALA 3EBIA 5HGAA 3TIDB 5D2LE 1D9KD 1JYXA 3DO7A 4U1KB 1FZKA 4G6FB 1FFPA 3MOAL 1VZIA 2KUTA 4G71B 5IVOA 3KPMB 4DAGH 4ZFFA 1Z0MA 3V4PL 5C2UB 3A4FA 3EFOB 2WXGA 1JZ6A 1FO0B 1RH8A 1LYQA 2OMZA 4YDVA 3NSDA 3ESMA 5DVMA 5E1QA 1QFUL 2Z31D 1NJ9B 3L9BA 1IE5A 3HS0C 4N8VA 3AXHA 1T5XA 3FRUA 1Q0YL 1SUHA 4LASL 3GMMB 3FFDA 4PRAA 4TQ8A 4ZO8A 5DMGC 5L6YL 5E9DA 4Y2OB 1N5AA 1R5VA 1CXKA 3MCG1 3SY0B 5JW5B 4FYTA 2EIDA 2FSEB 2WANA 1G84A 1KGIA 1CTNA 3AB0C 1E4XH 1R3IL 4PWJA 4HIXL 4XXWC 1Q9LB 1XGRB 3MUGB 1A4KB 1HU8A 4QKTA 1P5VA 5IJKC 1MEXH 2LLNA 2OX5B 3OPZL 1C08A 5HHMD 2FUQA 4O5LH 1UZGA 1CXIA 4LIQH 4F9PA 4JFHE 2Z9TA 1MAJA 4LP4A 1M4KA 3VRJA 1YPZE 1SBSH 4NWUL 1IC4L 4LQFH 4MNQD 5SX5K 3EDDA 2MKWA 5KJ7E 4XVJL 1QQDA 4LMQI 1ZLWK 5B8CB 3DUUB 1AY1L 2I27N 1MFMA 1KBGL 3X11B 4L8BB 3U1QA 3VXPB 4XWGL 2D7OA 4Q6IB 4KK5C 4WUUE 5C86A 3AREC 2XIIA 4NBZB 4IHBA 3RIKA 4WCYL 1DCLA 4RFNB 4PG9B 5E8DH 4BK5C 2FHFA 3FUMA 4AOFA 3MRLB 4UT7L 5B8CC 4X8JA 3V52H 2GITB 1X5XA 2XBTA 3HTLX 4BUHA 4PG9A 3W2DH 2G2NA 1V7NL 4YFDB 3KXFA 4H44C 1UZ8A 2B0SH 5JW3L 1R34A 1KYOJ 5C0AA 4PREB 6PAZA 3BMWA 3N44F 1MCJA 2FQEA 1H8NA 1VEMA 4GBXD 3WY1A 5EEZA 4N0UB 3GHEL 3V6FB 3WS6A 4AQZA 2VUKA 1LO3H 1D9KA 3FT4B 4XNQB 2BOBA 2F19H 1NAKH 5C0AE 4LLWB 4Y5VC 3VWKB 3BVNB 1KG0B 1NFIA 5C0RH 1QNZL 2BVOB 4R5XA 1MCEA 1VZGA 4U0RC 1KJ2B 3HG1B 5EF1A 1DVQA 4L48A 1CF1A 1CR9L 2ICES 2YK1H 4DGVH 4BFJA 4DUVA 4MBOA 1PQZA 3RL1B 4LZKA 3HR5A 2WLKA 4NKQB 3VWKC 6TAAA 4Y5YA 4G8IA 3MGTB 5DLMH 5HGGS 4WI5A 2EILB 4OR1A 2C4XA 1FVEA 1PTZA 3ULVE 2E9GA 4PW4A 3B5HA 1AKJD 3NFSL 2WW8A 2QQQA 5B1AB 5E6RB 5GIRB 2GHWB 3BZDA 2IAMA 5FYJD 5KVEH 3C8KA 4HGWA 4RZCA 4TQPA 1BWMA 1CMOA 3GDBA 3CG8A 3HZYA 2XPYA 4OU3A 1VB9A 3ZE2B 5J6HB 1YEWA 2K0RA 4UYPA 3EYFA 3LEVH 4GXUM 3SCMC 5CJ5A 1YJDC 2FL5B 2CO1A 2A9NL 3ZZLA 2F1EA 3V7AG 4CMMA 5JOFA 4Y88A 1IGIL 2NDFA 3FQWB 3JUYA 4U1LA 1A64A 5E9DE 1LJMA 4GFTB 3V4UL 2GABA 2HVJA 5I6XC 3P0VH 3L2LA 1WE5A 2GJZB 3IAQA 1IAOB 4ORGA 1P84J 1L0XA 4HT1H 3CJJA 4PJGB 3FSOA 3EGDA 4UTAH 1FH5L 5IVXE 4LP5A 2RQEA 3FAWA 3KS0J 3ARDD 4Y2DB 1RK1A 4AZ8B 3PRZA 4L18A 4PIBA 1V3LA 2OTPA 4Y16A 3RDTA 1H3XA 2BSEA 1OAQL 5BS0B 3IB4A 4N2DA 1QBBA 2DIAA 3ZT5A 5DDHA 5EEVA 3ILPA 1FN4A 4UQAA 1H6UA 3QRGL 2KZ1B 2ZTBA 5EBMB 3GSOB 2P24A 4WWKD 1QFOA 4AM0Q 3AVEA 3IVKA 1AS7A 4JM2A 3PHQB 2YKKA 3OLGA 4X7SL 2BP0B 3TBYB 2YAQA 4FQCL 1OCRB 4KKRA 1Z5YD 1A6ZA 3TPUA 4DQOL 3CDGB 4QRTA 3FONA 4OB5L 3JTBA 3VDBA 3LX9A 1L0PA 1BWWA 3BE1L 5CN1A 4B9KC 3PUCA 2IQ9H 4BA8A 5ICZB 4MMZC 3VE0A 2YD1A 4QDGA 4PRIB 1KCWA 2WXMA 3MVSA 5K39B 4LSVL 1CBJA 4V33A 3PIQB 3PIQA 2CDEA 3LH2H 3VI4E 2Q7AA 3AY4A 4LARH 3WN6A 5F9JB 3VE0B 3LN9A 4EO5A 2FYYA 3W0WB 4XP1L 3ISWA 3FXIC 2VAJA 3EZJB 4NQXB 1JL8A 2HMIC 1LVEA 1P4BH 3ABGA 2D31A 2Q8AH 4HPHA 3TBYA 2H0JA 2E4FA 3RWCB 1CICD 4UAHA 4EDXB 4YNYA 2Y1AA 2QR0B 2EDOA 3NA9H 2WUBH 1KJ3H 1CTMA 2QLYA 3H7LA 2FWOB 4JRXD 3P11H 3WDHA 3ZT7A 2ZONA 3TA3D 2N4IA 1OARH 2BWIA 2LTQC 1YN7A 3ZDWA 3FT2B 3HJ0A 2R4RH 1CVRA 3ARWA 2XXFA 3IS0X 2V5MA 5F7FA 2X3CA 3G5ZB 5TK2A 5ERWA 1FVDA 1E27A 3FT2A 3L5WA 2P3YA 3V52L 4EN3A 3FPYA 2B59B 3GSNL 4P59L 4DQAA 1NEZB 2JLLA 4R7DB 2B1HH 3THMH 3K2IA 3MQIA 5DUBA 3OJ2C 5B1BB 4LLYA 1CFVL 3FCBA 5F70A 3T2NL 4LCCB 4MQXC 4YXHL 3O2VH 5CCGE 3IAGC 2R8SH 4YSTA 3X1NA 1DVFA 2AKRB 2BHYA 1OSEA 2D0HA 2R56L 1WO2A 2AEPH 2GK0A 4UTBA 2FGWL 3DK2A 4PD4K 5GRXG 2FO4A 2O30A 3GZPA 5I1GL 2WN3A 4P2QB 4Y7OC 1I7ZB 2YMTA 1U33A 4X7FC 4BFBD 2WP3T 3ZW3A 2WIMA 3QORA 4ODUB 5HDRA 3V6ZA 5HPOA 3DHPA 4OD1L 4WKZB 4FG4A 4ZK8A 2SEBB 1MCBA 1JPSH 2O5XH 1PLGH 3MBXH 4JFDB 4UOJA 5D2LB 4HX1A 3OAYH 3C5XA 4OFPA 2X6MA 1FFRA 1BAFL 1IGJB 4LLUB 4CA4A 2CGZA 2PW1B 1MHCA 3KR3H 4O02L 4F1ZA 2AXFB 3JZYA 4WO4B 5MERB 5D5MF 2MQ0A 1G7JA 1JK8B 2BP3A 1MWOA 3CHXA 1JZGA 2XY2A 3ZTJH 1INQB 4I4WB 5IUSA 5I8KH 4XP1H 5E6IA 2BZCA 1KTKE 2WXOA 4X4YA 4YGVB 3Q6GL 8FABB 5E6UB 4P5RA 4TL4A 5I26A 4YSAA 5KUMA 4YHMH 3JV6B 4WHYH 2XWCA 5GGRA 5GS2D 3AQZA 2UZXB 4U1MA 1BZOA 1BEYH 3AMLA 4R8WL 1ZS2A 3ARPA 4U6XB 1TQUA 1L9RA 2ZPKH 4FQPA 4WO4A 1HINL 4NC2B 1A6TA 3RY4A 2B20A 4WGVB 5KVMC 1JMZA 5I24A 5D1ZD 2O1AA 2R1WB 3SKOA 3F6JA 3RVVD 3AW5A 5FECB 5JIPA 3QJXA 4LKXB 3OKKB 2AK4A 4M8QB 5E24E 4Q9RL 4OZIF 3OPUA 4U1HA 1OPGH 5D7IA 2ZUTA 1HCZA 3ZZSA 4R4BA 1RUKH 5TGBA 4WKZA 3VMNA 1OF2A 1C16A 4HH9B 3PV6B 4K8RH 2FJHB 3P0YH 1G9MH 3CHPA 3HZYB 4YWGH 4HJUA 3UP6A 2WVTA 1DVFD 1EUTA 2WGNB 4OV5A 4JRWA 3OQRA 4Y5YC 1U8QA 2WLZA 1S7UB 4ZSOB 4AVKA 3LIZH 2EDXA 1AGCA 5IK3B 2DWYA 2D73A 3QUHA 4UQ3B 1ZAGA 3B34A 3QUYD 3H42L 3HZVA 3OVUB 4PB9L 1HHJA 2FX7H 2J2ZB 2VRKA 4ZXBC 4E5XG 3K72B 3D18B 4XPFH 2YBRA 1CU4L 2GAZB 2PCFB 5I5MA 4Z7OB 3KWWA 4CMHC 2J72A 3KBFA 4N1HB 1DFBL 1LGVA 3FB8B 1FAIL 1N18A 1QWNA 4TUOA 1XIWB 2C3WA 4M5SA 3VSTA 2Z0UA 2XN9E 5EO1A 4CGUB 5D8JL 3ARFD 4X7SH 4BZ1A 1FPTH 2FB4H 5IB3B 2KBGA 1AYOA 3V4VB 3C08L 1UFUA 2PCPA 1Q9KA 3LEVL 1F2QA 3VD2A 1CL7L 4OIFA 1WCBA 3HA0A 4P3CH 1KV7A 4AQ8C 4KKCD