4GUQA

Structure of muts139f p73 dna binding domain complexed with 20bp dna response element
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
200
Chain Sequence
EFIPSNTDYPGPHHFEVTFQQSSTAKFATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*GP*AP*AP*CP*AP*TP*GP*TP*TP*C)-3')
publication title Transactivation specificity is conserved among p53 family proteins and depends on a response element sequence code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 36
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4guqA00
2MEJB 4G82A 1IO4C 4AGOA 1LJMA 2BIQA 4KVPA 2AHIA 2BINA 3WTSA 4IBZA 4AGQA 3EXLA 2J1YA 3WTWA 5KBDA 3D05A 4AGLA 5AB9A 4IBYA 5G4NA 3WTYA 2RMNA 2X0VA 4L0YA 2VUKA 4IBQA 1TSRA 4IBUA 3WTUA 2J1WA 4AGPA 2J6WA 3ZMEA 1GZHA 5BUAA 3WU1A 3QYNA 3Q01A 3IGKA 2YBGA 3US0A 5A7BA 2IOIA 3KMDA 5AOIA 2BIOA 4QO1B 1KZYA 3VD0A 2H1LM 4IBTA 2BIPA 4L18A 3WTVA 4IBSA 2X0WA 5AOKA 4AGNA 1CMOA 2J1XA 5G4MA 2AC0A 2BIMA 2ATAA 2WGXA 4GUOA 3IGLA 1GZHC 3D06A 1UOLA 5AOLA 2FEJA 3KZ8A 4A63A 2OCJA 5ABAA 4XR8C 5G4OA 3EXJA 3WTXA 1E50A 3D0AA 5LAPA 2J20A 2PCXA 1TUPA 1T4WA 2J21A 1HJBC 5AOMA 2GEQA 3QYMA 4G83A 1CO1A 3D09A 3Q06A 1EANA 4L0ZA 4LO9A 4LOEA 4AGMA 2J1ZA 1HU8A 5ECGA 2XWCA 3TS8A 5AOJA 2IOOA 1YCSA 2ADYA 4LOFA 3US1A 4HJEA 4GUQA 3VD1A 2P52A 4IJTA 3Q05A 2XWRA 3D07A 4MZIA 1EAOA 5LGYA 1HJCA 2X0UA 3D08A 1H9DA 2IOMA 4IBVA 4IBWA 3WTTA 3VD2A 1EAQA 4MZRA
chains in the Genus database with same CATH superfamily
4PB9H 3I9GL 1E9PA 5F8QC 5FX3A 3H2QA 5FK9B 1ACZA 1CXHA 3TBWB 5JO5A 3MCLH 4DETA 4LCCA 1CFNB 1HFUA 3LKNB 1NINA 1SHMA 1SN5A 4NNYA 3SJVE 1UURA 3F83A 5C0AD 2AQSA 5DZNA 3ARFD 4G72B 3L4ZA 2JSFA 4OGZA 3UOAB 4YDLC 3IKCB 5KSUA 4IBYA 2ENYA 4QAWA 4Y88A 1N0LA 4Q6YA 4ZUSB 3E2HB 5KS9A 1FO0L 4YHML 2DAVA 1IGFL 4UUJB 3DPDA 5E9DA 3N55A 4ZDHA 1P9MA 1IBBA 5JLZB 4JRXE 4F15B 3IU3A 3GSRA 1F2QA 1JGEB 2HLFC 2HUEA 5GSRA 3V7MA 3GMLB 2FHFA 3BE1H 1UA6H 2DM4A 4BV1A 1O6SA 2HFFA 3P1VA 1SPDA 4D3CL 5LHDA 5ACLA 5EORH 4LSDA 3FPXA 2Z9TA 4YHKL 4KQ3H 4CW1A 4HG4K 3NZUA 3HA0A 4BKLB 1ZT7B 5FYLD 5KN5A 1NGPL 3QEUB 4Z9KB 4QY8B 3P2BA 1M7DA 3IWVA 2KL6A 5EU6D 3FUNA 3NIGB 2AVGA 3OAUH 3CN1A 1Q0XH 5CIPB 3SQBB 3GSNL 1NEPA 3BD5A 4XMWA 1AKJA 4B9JA 5AAMC 5GRVK 5DQ9A 2F18A 2HAZA 1JZ4A 2EEAA 1BQLH 2BWQA 2P5EA 4ZZKA 3MNDA 3OQRA 4OFVA 4KKZA 5A43C 2GJZB 2HJLB 2ZYRA 3FZUD 4N9OB 4K5NA 3PWPE 4K7PH 5JPNB 1MQKL 1EHLL 2XVGA 5IWLA 4JHZA 4PJ9B 4MB1A 1R19A 2FATH 4R9HA 1V7MH 4IRJB 5DF0A 2RB8A 1MI5A 4NZTL 1OOAA 3NAAL 1RH8A 2CD0A 3K3QA 4D7BA 4X5WA 1N0XH 4ORZC 3PWVB 5F9OL 4J2XA 2Y3NA 4X98B 2XZZA 4TLSA 3Q8BA 1J18A 1DANT 2X9XA 1BJ1J 2BOCB 1OQXA 3VD1A 3Q9PA 1L0QA 3V5DB 1XIWB 2APFA 3W9EB 1B0GB 4J3BA 1X5FA 4D0CA 1XF4A 5I16B 1CIUA 4PJDF 5DHEA 2UXTA 3TCLA 3AABA 3ZE1F 1KEGL 3V4PL 5LJYH 4ZPTB 1QUNA 4OCXL 1G9HA 2D4DA 2DL9A 3MNVB 4HJSA 3QWRA 2XA3A 1DVFB 1LJMA 1SJHB 1TJHL 3QEHB 3LRHA 2FJHB 1G9ML 2CHNA 3UG4A 3MLSH 4DP8X 1F11A 2A3TA 3OHXC 3ZQ9A 4Y4FC 2AW2A 1Z3RA 2X88A 3DBXA 1UB6A 5BZWA 3HOGA 4K3JH 5CEZE 4LVOB 2VDKL 4BM7A 4UANA 5LCVA 3K6SA 2IAMC 1GZPB 3JWNC 1X44A 3UO8B 2P44B 3V0AC 1NAKH 1S3KH 1G7MA 1BOGA 2EDBA 15C8H 1S7XB 2YD5A 1TVHA 2L7JA 3TYFA 5IKCA 2XWZA 4LLYB 1RLBA 3MBEA 3TM6A 2VXTH 1AJ7L 3GSNA 3NSJA 3BSZA 4J27A 4Q9QL 3KL0A 3T4YB 2UWEE 2P42B 2V7NB 4PJXB 1E67A 2HLEB 3CFEB 2Y5TB 4LFHG 2C26A 43CAB 4ZMZA 1MF2L 4JDTL 1KB5L 4X5LA 1ZLWK 3M1OA 5BVJA 2MKWA 4LCWA 5C7ZA 4KMTL 1IGCH 1RZ7L 4XBEL 5CMAA 3SQRA 4RIRA 2EDRA 1ZXQA 5E99L 5I9QB 5I28A 5ECJE 4OFKA 1OAYH 4F7EB 1CGTA 1MXDA 2J8UE 5HDQH 4OLWL 3RAJL 4NC0B 5E1GA 1S9KC 2C7FA 4PJ7A 2ZAHA 1Q9LA 4M1GH 5GRZA 4BJLA 1J9QA 5CJXA 3NIDB 5LBVA 1M4KA 5I74B 4NQDA 4Y4FD 3MHZA 2UZYB 2NY3D 4U6XB 4B7LA 3VD3A 1KUMA 4G8AC 2QSTA 3MOAH 3ZYZA 2CUMA 5DEZA 3QI9B 4LRNH 4IKJA 3PWLB 3SKJH 1RSYA 4HJIA 3FBQA 4F15C 3NCBB 5J5EA 4XCYB 2CXGA 5HGDA 3GI9H 3EDEA 5KANG 4G6FB 3RFRA 3H54A 4V33A 2EDLA 4Y1AA 5DR5L 2DJUA 1J0KA 1NBQA 4EVNB 3ZKMC 1CD0A 1LGVA 4PW4A 4DF9A 2OTWA 4PJGA 5D1QB 3HI5L 1TU2B 4AMWA 4Z7UA 1JK8A 3ERXA 3FU9A 4P2AA 1PZCA 1MWAL 1OCZB 3FFCB 1VERA 4GQPH 3QIUD 3L95B 1ACCA 4KOCA 2ADIA 5GGVL 5HI5C 1QBMH 3BAYA 4J3OF 2LV4A 1TNMA 1CDJA 3NSYA 3SKOA 4E9SA 1XGPA 4WW2A 4WO4D 1DJWA 1HINL 4L23A 4RMTA 4DERA 4P4RB 5IHLB 5DD3H 1OZUA 5B39A 3CXDL 1DR9A 4UQAA 1NKRA 5HHNA 2W07B 2J5LB 4LL4A 4YHIA 5EEYA 4UTBL 4NWUL 2J12B 3P3TA 4YXHH 2UY6A 5KJ7E 1GGBH 4BSJA 5FCUH 2DQFA 4MDRA 4F7KA 2NX5B 2W59A 3S5LA 3GHEH 3KXFD 1LP9B 4TNGA 5AL0A 5F7AA 4X5XB 4XNBA 4E5XA 3HFMH 4OCWL 2NZ9C 1WJ3A 2WXLA 3BT2L 4JAMA 1DJZA 5K9JL 1RY7B 2MFNA 1QLFA 1M1XB 4ZYKB 3QT2A 1YECL 1HCVA 5H4YA 4URTB 3DA0A 1AHKA 2F0CA 3IRPX 3K91A 4NS0A 4ODUB 2VISA 5D1XB 2YSTA 5FKPB 4RFOH 2F15A 2EC8A 4B41A 4XNDA 4JO2L 1P7KB 1MFDH 2R0ZL 4XXCC 3FB5A 4PUBH 5HYSG 1T6VN 3V6OA 2A6JA 1SOXA 2WWKO 1KC5H 2Y7LA 4G1MA 4N2CA 5DU7A 5HVGB 1NUDA 4LHUB 5E2TL 3HZVB 1FGVL 4WUKL 1RL1A 1SQ2N 2NY0B 1WFOA 4J39A 1DVFC 2IH1A 2ZD0A 4GAJL 4WW1A 4Y2DC 2X6MA 1OD9A 5KVFH 4MMXB 3SDDA 4GG6B 3D9AH 5F9JA 3S36X 4JFYA 4PWFA 4DPRA 4AJ0A 1K4CA 3C6SB 3LPOA 5KJ4A 1CFSA 1ZTXE 3ZSTA 4MNHA 1VIWA 5I19H 1RUPL 3EFFB 3CQFA 1AZNA 2DQJL 3BDXA 4L3EB 1EHAA 4MB3A 5FUZL 2HKFH 5BS0D 3RA7L 3JQOB 1NMBH 1P5VB 3UTOA 3QJXA 5ESVB 1KGXA 2R59A 5I8EA 1G5AA 2LQRA 2A73B 2CRYA 2E7DA 3F6LA 2APWA 3RPIA 3DSFL 1X5AA 3WN5B 2JI3A 2BP8B 1HAWA 1P1ZB 4N2MA 1XVSA 2GBUA 4L2YA 5IREA 2WLLA 4I0PB 3LEYH 5CWSB 4P4KB 4EUPH 5SWSE 1AIFA 4BRJA 5B8CB 3AQZA 1D5MB 2J6EL 2OJEA 3QVAA 4OLUH 4DWHA 4XPTL 1HN1A 4WEBH 1K4DB 1P1VA 1AY1H 1D9KA 2X44D 2VDOH 2R29H 4Y2DD 4KWUA 1QEWB 5EA0L 3BT0A 1WAEA 1WITA 3P02A 2NQCA 3RP1A 4HMDA 1HSAA 1RZJL 3G6JA 1CF8L 4RZCB 1OW0C 4TNWK 1IM3A 1QHOA 4OLYL 3R1GL 1F86A 2H6OA 4D0BB 1IARB 5GS2D 3O4OB 1T7WA 3QS3A 1HZHL 1BP3B 3DRTA 3ISRA 2VXVL 4QOKD 4DVBA 3NCYP 3K6OA 3N1MC 3L7FA 5FGSA 2XN9A 5BV7L 5DK0B 5F3BA 3RVUD 5D1QC 5AAWC 5BRZE 1WD9A 4R4FH 2BCMA 2CJUL 3CFNA 1H15A 5DJ0B 4PGDA 4PJIB 4HG4J 3WMQA 4PJBB 2FLBT 3WTYA 3KLQA 4G9FE 4AMXA 2H6PA 3TWYA 4G43A 3WS6C 1ED3B 3EADA 2VDQH 3QNZA 4J3TA 4OBSA 5I17A 1XH1A 4LF3A 4OZFB 5E2VL 3HG2A 3MUJA 4K3HA 1DYZA 2JTYA 2WXNA 5LWYH 3MFGB 5C0IB 5E2WH 3PV6A 5FV2A 2X3CA 2YQBA 1ROCA 4UOQA 2VQUA 3Q3GB 3UERA 3BISA 3HI6L 5JHDD 3KYMB 1ZVNA 5LGHH 4KXZI 3AXLA 2ROYA 3HPJB 2Z4QA 4JNXA 3HZYA 4DHLA 3VRJB 1KIQA 4H1LH 4M5ZH 4ZQTA 3ULSA 1GS6X 5IMLB 1P6AB 3RZCB 5J6HB 1Z9LA 4ZMLA 1XGTB 4G6KH 1DVYA 1FVEA 2IFFL 4FHBD 3RWHB 4IQHA 4Q9CA 4XNMA 1F90H 2GUYA 4UTCA 4HF5L 4MYPA 1N26A 2JCCF 3TA3B 3ZGIA 1FIGL 2PWEA 2CUIA 5DJ8A 3TONA 2WN3A 3ULVE 3CHPA 1LDPH 3V52L 3GIVB 3WE6A 1KBVA 4NFBA 3RVXC 4YDKL 3Q5TA 4L4TA 3I3DA 3RVTC 4KQ4H 5H37H 1AO7E 3QEGL 3W0WB 4MD0A 3QORC 1RZKH 1BA9A 3GUTB 3HAEA 3TZVB 2Y9RT 4OCYH 3TPUB 4L8SC 2J4WL 1IVTA 3VWKB 1UYWH 2MMXA 1KBGH 3AMKA 4W70A 2NY0C 3B9DA 3WG7B 3MRKA 4LLUA 4OIIL 2GIMA 3DYPA 4PRDA 3A22A 3FUJA 3S88L 3BRDA 5DS2A 1EH9A 1SJVA 1JPSL 2F1EA 2X5PA 2XTLA 1QA9A 2EACA 4JDVB 5D2NE 1WC7A 4HIHA 1OTSC 3KPPB 4ES8A 1IC7H 5HHPA 4OJYA 3WHXB 5AVYB 3LQZA 3MRGA 3T65B 1FFTB 1E5CA 2BS71 3Q2VA 1PY4A 4KK9C 4LGSB 3ZRCC 2V8LA 3KGTA 4TPRL 4JM2F 3V0FA 1ZRUA 3VXNB 3RVXD 3TF7C 2D9CA 4NGHH 4E36A 4DOHE 1HHHA 1AGBA 2AQNA 3QORD 1BVLB 3TNMB 4QHNB 4YMPA 2WSDA 4MS6A 4OLZL 2E7MA 3K0WA 4JL2A 3EXLA 2QJDA 3BPOB 5CZVH 4ZTPL 1Q1JL 1CLOH 3GSOA 5DYFA 2FYVA 1A14L 4X9FA 2L0DA 3DX4A 4JPIA 3MV8A 5HJGA 3TFKD 1QSFD 3B5TA 3UIYA 1ET7A 4TVPE 1BGXL 3LVTA 4P9HH 4IMKA 4BQ8A 2VLLA 4JGMA 4R5TA 4WWOA 5F0PB 3VCLA 2GITA 3QQ4A 3QA3B 4JFXA 2P8PA 3VSVA 3O9WC 2GG1A 5L88L 4P3DA 4OFYA 1HOEA 4NCC2 4R26L 3S36H 5KUKA 3U0TA 4M7LH 1A1NB 1E28A 5ACZA 3MZGB 5IBLD 3MGTB 4P57A 1OARH 3N50A 4KK9D 5FYLH 1ZSDA 2AJVL 4G9DA 1JG9A 1QRND 3BZEB 4EBQH 4KK8C 4Y19A 2DL2A 2KDYA 2FX7L 2R1YA 4JY6A 2Y25A 4CN1A 4F9PA 5IFHL 1V7NL 1M71B 3RDJA 3UBXI 4DEUA 5GS0L 3RNKB 3H9ZA 3H6AA 3N85L 3BQUA 5DRXA 1T1XA 3OKKB 5JIPA 5HHOA 3JXAA 2VRQA 3TT3L 2YEVB 4NPYA 3CVCA 2Q7NA 1TCMA 3M1CA 5HGAB 1MIMH 1XHHA 1C08B 1BD2A 2AEWA 4RDQF 5BO1L 5I6LA 1ITBB 1U4FA 1L6ZA 2Z91A 4M7KH 4B3EA 3LDBC 2BK8A 2NNAA 5MP6L 2H1PH 1YMMD 3SCMD 2J21A 1FVCA 4NP9A 2RHEA 1XDTT 3KPRD 2GEQA 3ARBC 3X1EA 2AQPA 4KXBA 5GHWH 2FX8H 4GW4B 4RDBA 2X87A 4N0UB 1KXTA 5DMGD 2ICWJ 3O8XC 4K3DL 5FA3A 2GT9B 5IT2H 3IBOA 1HU8A 2HH0L 3JWOH 4BUHA 1JXGA 3CJJA 2ZXDA 2LTQC 2R2BA 5KW9L 4DK6A 5GJTH 3C5SB 5C0RH 1QYGH 2BNQE 1A7BA 3KVQA 1HDMB 5DJYA 1FGNH 4KV5E 1X9LA 1KENL 2DQ6A 4H13C 3IXTB 2GTWB 4JJ5B 5F7KC 2JKJA 4O4YH 4N0FA 4AMKL 2VLKD 5B39G 3H56A 2K6YA 3DURA 4GW5B 3S5ZA 1L7TL 4MZ2A 4EKXA 2F2HA 3W38A 1VGEL 3ZUCA 3GSXB 3D2UA 1GIGH 1MCBA 1UH3A 4O5LH 2AJZB 4JFEE 5LNGA 3FU8A 4UYPA 5IB3B 2LR4A 2XZCH 3OKNB 4QYOA 3KEHA 3S5LG 4BWUA 2AJ3B 3ARPA 4E5XG 3PWJA 2W0KA 2LW3A 1DEEB 2ARJQ 4G8FA 1KGWA 1VFBB 3A0OA 3RWFA 3VJ6B 4D9RE 1MHEB 4BZ1L 2J1YA 3DXAE 4JG1L 2R56H 3D05A 1QTPA 1JMZA 1P84K 1BOYA 3O8XD 1U92B 4TUOA 3SE9H 1T1YA 2CM6A 3EW3B 1MJJA 4WFHE 3ULAB 3GMMB 5C0CE 4HIIA 1QSZA 5FECA 1F4XL 3EH1A 1MW3A 1KJVA 2HLAB 1RULH 1NMCB 3CZNA 2FWOA 2E9IA 3BKYH 5FA4A 1WHOA 4EPSA 1DN0B 1FL6A 3IMSA 5HHVH 2X2HA 4NUGH 4UOW1 5L2JA 3STLA 5I1AB 4KVNL 2JNZA 3QEQA 3TWCL 3FQXB 3DX0A 1YUKB 3CLFL 3KM1A 4K9EL 4LHJB 1KJMA 3DVIA 4AGNA 4AEFA 3U4BL 2A6KA 1E3XA 4I9WD 4X5QA 1CK0L 1F5WA 1XGYL 3ARGB 1VKXB 4AY0A 3DBSA 3D4GA 5D2LE 3UZQA 4FQHA 1PG7L 3DGDA 1LWJA 1WGVA 2EDTA 4J1UA 2DMHA 4W9LC 1IC5L 2AI0L 4XPHL 5DEGB 2PWGA 4XZUA 1NC2B 4M4RA 5M7QA 1LQSR 5D70L 3CPLB 4POUB 1C9SA 1GOGA 3KW7A 1T1ZA 4YQXL 4WNJA 3EYQC 4YHZH 3DIVA 4RISH 1HX0A 5GS3A 3KLAB 4YVUA 3FB7B 2BNUA 1PL3A 3CHRA 3K80A 3VVVA 3ZKSD 2CDGB 4CSSA 5E4EB 1INQB 4ZPVB 1SFDA 4HLEA 5HJ3B 3NRFA 1Y6MR 1QUPA 2EE3A 1T3FA 3OTTA 4PG2A 3G04A 1QLRA 5DC4B 3SY0A 1USQA 2CHZA 1HEZA 4G3YL 3UYPA 1U8NB 2FTAA 4FJ6A 1YQVL 4NN5C 4TLUA 4K8RC 3VACA 1PVHA 2ATPA 4KXDA 3MLRL 3X1BA 1I3GH 1RURL 1AGDB 2ARJB 3POCA 4BZ1A 2PTTA 1A5FL 4XH2A 4F9LC 5AW0B 2EXSA 3FT4A 3VX0A 4I0KA 4NOFA 4F33A 3WSQL 4UU9B 1UT2A 1PZ5B 4IKLA 3FRPB 4F8QA 3GBEA 5JQ6H 4R0LA 4GMSL 5L9DH 5CJ8A 1DQDL 2C9RA 1N64H 4IKIA 4UZSA 5AKSA 2UWEF 4AQ1B 4JRLA 2IIJA 1R47A 3MODH 2LAGB 4FFTA 4FQCL 4KKRA 2VDLL 2JI2A 5JMRA 5ILTH 4NPKA 3H2PA 4QRUB 3UTQA 4DO4A 3IF1B 1DQLH 2JXMA 3FQTB 2MJWA 4Y7OC 1N4XH 4X7EC 4YWGH 1HL5A 4CC0A 3QRBA 2LOEA 2WB1A 4JG0L 3JTSA 5JW4N 2J8UF 3AGWA 4GKZA 5TPWH 3L3DB 5FDWA 5ALBL 2BOLA 3WKPA 2Q7YA 3MRJA 4MA8H 1ETZA 2FHBA 3NA9H 4I5BA 2PW2A 1MCQA 4FNLH 5FYKL 3KVDD 5EU5B 2ZUYA 3EJPA 2JH2A 2E59A 3UJTL 2F1BA 1XAKA 1NDTA 2QPUA 4P59H 4X0NA 3JTBA 4FNRA 3JWDL 1VEOA 2VW4A 3GS4A 4U4BA 2VLJB 4OCLC 2NNCA 2VM4A 1OLZA 4P23C 2I24N 4QTIL 1CXLA 3C2SA 1CGYA 1H0DB 1MDAA 4PQXA 2V4LA 4XGZB 2JCWA 2QKIB 1J9SA 1IEBB 3F7VA 3J27A 3TBVA 4B9YA 1AC0A 2V9UA 3AW5A 2Z93B 5FC9A 4FQIL 1CGSH 2WBXA 1RZIA 4HS6A 4Y5YA 2B1HL 4P2QD 2OYKA 4A2EA 2WSKA 3REVA 4S1SH 1ZDQA 3EOAB 4LIQL 8PAZA 3IEAA 5JZ7D 3MMEA 1EK3A 3E6HB 3QIWB 5EBGA 1SEBB 2QSCH 1X7TA 1S46A 3GRBA 3ALWA 3SOBL 2NTFB 1WA0X 1TZIB 5B3SB 2OMVA 3BOVA 4YDIL 5I8KH 3ZTJH 3BH9B 3B9KB 1QD0A 3UDWC 2P7TB 1NMCC 3HAEG 3KPMB 4ZX5A 2GSIA 4L1TA 1DSWA 4IIQC 5D55A 4NO2A 1NGWB 5ESQA 3VFSA 4IHOB 4BQCA 1NDMB 1RZ8A 2A9NL 3FT3A 1NOAA 2Z4TA 1T20A 4KNUA 4N87A 2ITFA 3K2MC 1DL7H 1E5UI 1K2DA 2WUBL 3LIZL 1QSEA 5FAAA 4D9QE 3GJEA 2FK9A 5I6KA 5KSVA 3AGVA 4WUUB 4JMXA 1AZCA 4MFHA 4A7QA 2G60L 3FO1A 3QIBB 4NQVA 4DK3A 5HGBB 3KNBB 3PU7A 4BSWB 5E8DH 2H3NA 1Q38A 5CXPA 1L5GB 4Z5RA 2A0LD 2V2XA 1UXMA 3D69A 1S7RB 2B9AA 3BUPA 4CADB 3PPSA 3VXTB 3WFDH 3GBLA 1BFOA 5GS2H 2KQNA 4WNQA 2HVKA 3R0NA 4X6BB 4JFDB 4UV7L 3QFJE 5C07A 2ZSWB 1E4XL 1K8DB 4FF9A 3RBGA 2IBZX 3MO1A 4LSQL 1FYTA 1JZDC 4M6OH 3BKML 3CVDA 1KLUB 5ICYB 4HIXH 4WI6A 1Z9PA 2XWTA 2VYRE 4NCC1 5DRNB 1J8HE 4KGLA 5EZPA 1XQ4A 4ZFZB 4H0HB 5AYTA 4MHHI 4F1ZA 1UKSA 4FNTA 1N68A 2LHAA 3QZPA 3S34L 5AB2A 2VMJA 4R3SA 3WIAA 3O6MH 3CQPA 4MQSB 1VPOH 1TQCB 3CBKB 2QELA 1YUHA 3C8DA 4HKXB 2Z7YA 3KPLB 1HS6A 1S78C 5JHLL 2FHCA 3O2VL 3EOTL 4XN4A 2YEZB 3ET9F 2H0PA 1G1OA 3LSOA 4M8QA 3L4VA 4BFIB 3FOMA 4PRAA 2BRRH 3K71A 5DRZA 4NKOA 4H25B 4LT7A 5EEXA 5IQ9A 3WIIH 2UZXA 2MOQA 4AV4A 3BGMA 4M61B 1UB5A 2W38A 5L8LB 1YZZA 3RL2A 3LEXA 2CO6B 3HG0A 2X4OA 4OFQA 2M1KA 3WKQA 5GRWA 4OLXH 3CFTA 1KOAA 5JXAL 4X8JB 5DTFB 2LVCA 1EVTC 2Y69B 4RSVA 4L4TD 4PRPD 2OL3B 2QVTA 4PJFB 1X5LA 3FTXA 3CDZB 5AW5B 1EEYB 5AAMA 2EYRB 2WAHA 3ZKQD 5EU7E 5LAPA 2PF6A 4JPSA 4H5SB 4HT1L 3G5XA 2P9RA 4PWIA 3EUDA 4CVXA 2J56A 3GSVA 1VLXA 3V4LA 3DUSB 2XQ0A 4WCYH 1AR1B 1B0RA 5C0BD 1MUJB 2ZF8A 5AUMB 5ECGA 3IETA 3CZFB 1PG7W 1MCWM 1A9EB 2QKIC 4XCNA 1J9TA 5C9KA 3TCTA 1KEML 4QNPE 1RK7A 1P84J 2GY7B 3INOA 2Q87A 4F3FB 3O4LE 4KKCC 1ZANL 1EDHA 2CKNA 2KT6A 1N5YH 2TAAA 3DHPA 2EE0A 4FTVD 4YSUA 2GUOA 2X6AA 1TQSA 3D0LB 4H0IA 4R2GB 4WGWB 4TSCH 4D9LH 4UBDC 5JHLA 1E2VA 2JLPA 4FULA 5DD1H 1SOKA 3LNDA 2N0KA 3RX5A 4WDIA 3C2AH 4XC1L 1C1EL 2JTDA 3ZZQA 2CBOA 1RERA 1E4HA 4A6YB 2FSEA 3BZDA 4IKNA 5FM4A 4R96A 2C1PB 3C60C 5CJBA 3TEXA 1ZWIB 3A6BL 2A6IB 2ERJC 9CGTA 3OHXA 3IDJA 3MLVL 4NZUH 1W9XA 3EYOA 4C4UA 1WIUA 4BQBA 3BUYB 2EDJA 3UADA 3A4AA 5FF6B 5A2FA 3TURA 3EH5B 4M6AA 1A7NH 3WFZA 3MBWB 2JIXB 3ARDB 4NZRH 3SYAA 3RUGE 5IOPB 4ZW6A 1RUMH 3L2MA 3LXAA 3ULVF 4KKCD 4LSSH 1XZ0B 2JKSA 4POYA 4AYFB 5MEPA 4WLCA 3VFOB 4MNQB 4FFYA 4UBDD 1HCYA 4F91B 3KAAA 1QR1B 1L6XA 4MA7H 1GS8A 2F68X 4U05A 3MRDB 4QF1B 1OV8A 5FK9A 3FC8A 3TOPA 3TBWA 5SV3A 3OR7B 4OF0A 3U46B 1GKOA 1CFNA 3LKNA 5D5MB 3C60D 1P4IH 5FUCE 5DHXB 4Z3HA 1TQCC 3WFBH 2DYSB 1IB5A 2NOYA 3IKCA 4WO0A 4TQEH 4Z7OB 3A23A 1M2OA 5F71A 4ZUSA 1L3WA 4DKFH 4XMKL 3CFCL 4UUJA 3FUIA 2F1AA 4H8WC 3J8F7 3I9GH 4XVSH 1T4WA 3A24A 4AYSA 1TZGL 3KL3A 2PYED 3GXTA 4FKEA 1V3MA 3A4EA 5JNYB 5C3LD 2XZQL 4WI9A 1SLWA 5GS0C 2EP6A 2DQEL 1RQ5A 4AT6B 4F7PB 5CBEB 2BERA 4TUJB 4FI8A 4GRMB 5INDA 2OM5A 2WBJB 1AZVA 5ICXB 4JZNB 1FO0H 4YHMH 4HD5A 5H8DA 1IGFH 4JX0A 2RTTA 4BKLA 4X7DC 1ZT7A 2QLVB 1A7QL 4QY8A 1MXGA 5E6IB 2PO6B 3VXME 5MEOA 2VC2B 2QMJA 2XY2A 4FNQA 3LRGA 4PJCB 1DJXA 3P11L 5CIPA 1MHCB 3SQBA 4JQVC 4FP8H 3GEFA 5KSBE 1CL7L 5AVWB 4D3CH 4PS3A 5I30L 1JWSA 1K3IA 3VD4A 1WWCA 5HYQB 2OBGA 2FE0A 2ID5A 4GAFB 3SE3A 4NDMB 3V4VB 4YHKH 5IB5B 1FVDA 2EH7L 5LCVH 1NGPH 3NABL 1R3KB 5I1DB 2GJZA 3VVWA 1YY8B 2V2TB 2DBJA 1OT2A 5D7JC 4MQXC 5JPNA 5C3TA 3MNZB 3AROA 5GS0D 2K0RA 4PJ9A 5JQHC 3BKJL 2B5IC 3THML 3GSNH 3RTQB 3UPAA 4KDWA 4L8BA 4C55A 4XP9L 4NQSB 1H6FA 2X0VA 2FO8A 3PWVA 1W0VB 2JJSC 1Y7VA 3QDMD 1J0IA 4LPYA 1KIUB 1KTLA 1NOLA 2OP4L 4FFVC 1SHXA 1A25A 1PU0A 1YPZB 2BOCA 4F8TA 1EHLH 4ZMXA 4KI1A 3T0VA 1XIWA 4ADGA 5FOBB 1B0GA 1JMXA 1BVOA 2OI9C 5DVMA 3C6EA 2JKNA 4HJJH 2Y6SC 3KPNB 5I16A 1ZV2A 4Q0XL 4JG5A 2XV6B 4NZTH 3NAAH 4N6RA 2ZWSA 1MVYA 1ZVSB 2E8ZA 3EZ8A 4RGNC 5B1JC 5F9OH 1Q0YL 4JGNA 4WU7A 1Q8MA 1MFMA 1DVFA 3EHBB 1N8OE 1SJHA 2RGSA 3F3HA 4DO5A 2FJHA 3H7LA 3TJHD 5D7JD 4MQXD 4EKJA 4OBRA 4OD1L 1NFDB 5J4MA 4AE1A 1NANI 2VWEE 5F1OB 1OIOA 2I9LB 1OGAB 1P5UB 1KEGH 1OSYA 3V8OA 4KV5F 4OCXH 4RGOL 5F89B 2VQ4A 3TGXA 2ZQKA 3QFDB 1NM4A 4ADJA 1ODUA 4FABL 1S7XA 1TJHH 4FFVD 1G9MH 5D1ZB 5K1VA 1ZK9A 5DUPL 1JAEA 3T4YA 4PRHD 2V7NA 2IQAB 3KGUA 1UHVA 4PJXA 3CFEA 4QRRE 2OSWA 4GI9A 4A04A 4PS4L 1J86A 2COVD 2EDEA 43CAA 4G1EB 2VDKH 1TF4A 1AZZC 3RIKA 2MTPA 4RGND 4Y4KC 3UBXA 4Y89A 1M9SA 4QRPD 3MDJA 4UM9B 5C08E 2R1XB 1P4LB 2YGPA 4FQLH 2EE2A 2PPAA 1NJ9A 1AJ7H 2W60B 4WI7A 1UD3A 4XP5L 3Q8EA 2AJSL 3D39A 4ANVA 4BD4A 5CO1A 4ZNEE 3T6QC 2UZYA 4U6XA 1L0PA 4IBWA 1MF2H 2IGFL 1KB5H 3VD2A 1MELA 4QO1A 3TEZA 3PWLA 4KMTH 4XBEH 1IU1A 1RZ7H 5DUBB 4AQAB 2RCSH 4JVPA 4XPGL 2WTRA 5E99H 3F7PC 4XCYA 3QDJB 3FJTA 3S9DB 4OLWH 1VEMA 3IDMB 1L9RA 1TTRA 3RAJH 2VLMD 3C6LB 3BO8A 2XWJB 1KFGA 5CU9A 2PLTA 4BUQA 2FIRT 1R3HB 4HUCA 1UFGA 3D51A 3OL2A 1OLLA 3PPEA 5D1QA 4B9PA 3WY1A 3U9PL 4FKKA 5DJ6B 5C0AE 4OZIB 1ADQL 1U8HB 3FFCA 1G7PB 3BFQG 4BCXA 3L95A 2L04A 4DPAX 3QZNA 5K69A 5D2LF 3BWSA 4K55A 3LKQA 4Y4KD 1CYXA 4G70B 1BX2A 3T0XA 4ZMVA 5DR5H 4LVHB 4XNZB 1MRDH 3O3AA 4AUUA 1D2PA 3DMMC 1YEEL 1ND0B 4QR7A 3HZKB 3HI5H 3EKCA 4P4RA 3OZ9L 3K8KA 2IF7A 3LN5B 2Y0SA 2W07A 4LKXB 4JHWL 3VI3E 5GGVH 3NCJL 1NMAL 3PAUA 2IPKB 2JQZA 2JE8A 3MUZ1 2JQAA 3VXUD 4L3CA 3S98A 2NX5A 3AT0A 3IMRA 4KJPC 4L9DA 5D96B 5DA0B 1MG3C 1MQ8A 3PHOB 5EU6E 3R7RA 1HINH 2VM9A 2WXKA 2P49B 3EJZC 3HB3C 5FFGA 3A47A 2EEFA 4F5CE 3WNIA 3S48A 3MRIB 1M1XA 4ZYKA 2AXGB 1JZIA 2VQTA 3DX3A 5GZOD 4UTBH 3MV9B 3MREB 3ABZA 1JCVA 4ODUA 1SMAA 3GZOA 4HSQA 1IZJA 4E41D 4WSKA 2DQDH 5FKPA 3KS0H 3Q43A 3DMMD 2CALA 2WNGA 2EADA 4FGMA 4XMXA 3ARZA 3BT2H 1QNZL 4FL4B 4EF3A 5JA9A 1R34A 2OCFD 1CGXA 1AG6A 5K9JH 4C4BA 4Z8FL 2BSSA 4E9TA 4AL8C 1YECH 4TTDC 1LVEA 1PMYA 3HUJA 4LHUA 4MNGE 5C0JB 3HZVA 4K71C 1L9SA 2NY2B 4HJUA 4HHWA 1SLUA 4H40A 5LBSA 1NCGA 5DEFB 2ADGA 3BP4A 1TFHA 2IC2A 4XO5A 4HJEA 4MMXA 4GG6A 1FLTX 2HX9A 4YJZL 1DQKA 5F1IB 1T6BX 4YSPA 3QNXB 4MX7B 5KVGE 2EEXA 2JB6B 1G7IA 1YNTF 1FYTD 2R0ZH 1ADQA 3C6SA 1TOXA 4FX5A 3WIHA 2GBTA 4JFPB 1CD1A 3EFFA 1DP0A 1NBVH 4FZEL 4L3EA 4NZFA 5CINL 4O2FA 2YUWA 25C8L 5E2TH 1FGVH 1L7IL 1P5VA 4WUKH 5E1HB 5ESVA 2CQVA 3LMJH 2DJMA 4GAJH 2FR4B 2A73A 4PGBA 5JW4R 3SDAB 1UWYA 5HYJE 2BP8A 3DVNA 1P1ZA 4PWGA 4WV1C 2Y23A 4HCFA 2W95A 1RUAH 2OTPA 3ZE1B 4H4NA 3GJFA 4I0PA 4UB0L 3QO1B 5TQ2H 5CWSA 2BVPB 2KZBA 3S3BB 4Y1TA 4C56B 1RUPH 2ITDB 2DQJH 1OSZB 5FUZH 1D5MA 4TTDD 3RA7H 1MIEL 2QL1A 3JBG7 2DLFH 1MNUH 3AS3A 4OJAA 3PJNA 1Y18A 1ZJBA 2J43A 3Q8CA 2HKHL 5IVXE 4HALA 1QWUA 5GGSY 2EO7A 1JJUA 4RZCA 1E5YA 1AACA 3Q44A 4HFWB 3QR0A 1BFSA 3AADB 2ZCHH 2ED9A 1NKOA 4D0BA 2NY7L 3VMPA 2YIHA 1XBDA 2J6EH 3II3A 2OMZB 4QTHB 4XPTH 4I88A 4YSAA 3MUY1 1OGTB 2OMWA 1T7XA 4BFKA 2OA9A 5EA0H 5DK0A 2FVNA 1FYHB 1HT6A 5I6MA 2LLGA 1RZJH 1CF8H 2YN5A 3QJQB 3HAEH 5DJ0A 3ZHKA 4U3SB 3F00A 2V5YA 4PJBA 4AK1A 4OLYH 3BEVB 3R1GH 1UOWA 2MNJB 4GKNA 1ED3A 2VN4A 4X5RA 1QFPA 5JORB 2OMYB 3AWFA 4OZFA 2EVJA 1HZHH 3QJHA 1T5XB 2XWDA 2VXVH 2ZTBA 3E8UL 1KFAL 3JTTA 3JWNE 4N25A 3EJCA 2YQGA 4KTDL 4YIQB 5BV7H 5C0IA 3RGHA 2A9AA 1JVOA 3FMGL 3HLKA 3JV5A 4JKPL 3Q3GA 5MERB 1KCSL 2XI9A 3D09A 4XVJL 3KYMA 3NDZE 1FNLA 2CJUH 3BGFB 3S3PA 2IANB 1X7QB 3HPJA 1KCRH 5IESL 4DP7X 4HK3N 3TV3H 1BVNT 5IMLA 5J6HA 3RZCA 5E2VH 3UZVB 1XGTA 2HVBA 3RWHA 3QG7L 1UOVA 1QLEL 4L8DB 5F7MC 3G6AB 2DIJA 2EDXA 3IRZA 4NXKA 2OSYA 1TTCA 1OM9A 5I76A 2Q3ZA 4P0DA 5DHDA 5ITFA 3GUFA 4FG4A 1E5BA 5EHFA 4BH8B 4BKTC 4N0RA 2ESVB 4HUUB 4F24A 3CVIL 4DP9X 1R0AL 1VB9A 1FQ9C 3GIVA 3A6CL 8CGTA 2XC8A 2IFFH 4P3CL 4PGEB 3ZW3A 2NW3B 3RX8A 1UH2A 1G6VK 5E94B 3EFDL 4LCUA 3KWWB 3W0WA 3GUTA 1U3HB 2XXCB 3P9MB 2B4CC 3TZVA 4NQEB 3TPUA 4N20A 1Z5YD 2GVYA 1SLVA 4ZMYA 1U0QA 4IGBB 1PLCA 1FIGH 4B9FA 4QKTA 5F1KC 4JW3A 3JZ7A 1EEQA 4U2YA 1Q72L 2CCVA 3V52H 3HN8A 3O2DA 4OM1L 5EBWB 4U1HA 1SN2A 1KULA 1JV5B 3H9SB 3C08L 5KAQF 1YEIL 1BLIA 1SRDA 1EUUA 1BCIA 4Z7NB 4WEUD 3E1F1 2EINB 1BDYA 4AM0Q 4JDVA 5EF1A 3TBCA 3TEYA 3KPPA 4UT6L 1RU9L 3WHXA 5A7EA 3T65A 4D0DB 2HA1A 2JI1A 5JIIA 1FAIL 1JOIA 4TNWF 4AW4A 3VXNA 4OIIH 2W0FA 3ZHNA 2WLMA 3VG9C 2NY5C 1B4LA 3S88H 2OSXA 5EDXA 4KH2A 3D06A 1BVLA 3GM0A 4LARH 4QHNA 4YXKL 3TNMA 4HUWA 3N9GL 4RGMB 4WY7H 5IGXL 3TL5A 3W39B 4GAGL 2ZKWA 5EBMB 2NY4C 4TPRH 1A7OH 5HPMB 1R46A 4JQIL 4QNPF 3RGBA 2G75B 2WXQA 4M29A 5EEZA 2VXQA 4Q6IB 5BS0E 3DK2A 1JPGB 3QA3A 1WS8A 1Y1UA 5B4MC 3HZ3A 4FXLA 1ZHKA 3RL1A 2P80D 5D1ZI 5F72S 4OLZH 1A1NA 1EEZA 1A6VL 1KYAA 5FM5M 1MRCH 1CQKA 4TS6A 1KCVL 2YMXL 4ZTPH 1A64A 1Q1JH 3DX2A 5EOCH 1A14H 4X4ZA 3L5XL 2JQMA 3BZEA 4GRWE 1ZLSL 1ZE3H 4PJ5B 3PF2A 4WVRA 4TM9A 4YEEA 1M71A 2YMOA 3RVVC 3DI2B 3RNKA 3DHMA 2X3BA 4JDEB 4OD3H 3HE7B 1IEAB 5L88H 4HOMA 5J13B 4JY4B 3K6FA 3OKKA 4R26H 5EO9B 4B0MB 1IC4H 1XF5B 2X2JA 2QGEA 4HC1L 2HMIC 1EAOA 2OLDA 5HGAA 2BW4A 1C08A 2AJVH 2WXGA 2NY4D 1QTYT 2A74C 2WV3A 4MZRA 2E27H 2FX7H 5IFHH 4C58B 1V7NH 3RUGF 4LKCB 3JVFC 2EE6A 4IRJD 4R7DB 3UCQA 5HHQB 4AM0B 3N85H 4UT6A 5B4MD 1HXYB 2QV4A 3VD9A 3PYCA 4QOKE 1NSNL 3FQRB 3KE0A 4V1DB 3V7AG 2H9GA 5TGBB 1MSPA 4GW4A 1BAGA 3TT3H 3W5MA 3VW3L 4N0UA 1WK0A 3I6GB 4GKSA 5IW6B 3DOIA 5L4FA 1KN4L 2GT9A 4NN6B 4I2XB 5BO1H 2XXGA 4TQ8A 1J1PL 5MP6H 1XIWD 1UM4L 3TH4T 3C5SA 1RMFL 3ELAT 1HDMA 2L7EA 1FLRL 4M7LT 5I0YA 5IHZB 3QXWA 2GTWA 4JJ5A 5D6CB 3MNMA 1AXTL 2EXYD 1T03L 2QLYA 3TNNB 3FSOA 4GW5A 3OAYK 4K3DH 2KDGA 1VADB 2V5SA 3P0GB 4J3OC 5JHDE 2FEEI 5AKTA 1XF2B 2HH0H 4BZ2L 4KNQA 1BSIA 1KTBA 4HLZG 3D3VB 4DW2L 5JOEA 5KW9H 4PVLA 2XBZA 3OKNA 3OG6B 4NO0B 4HIEA 3N5AA 4J3UA 3F58L 2AJ3A 4EI5C 3DOSB 5E4AA 3MAWA 3OBAA 2C3VB 1KENH 1UD8A 1DEEA 2B59B 4ZUUB 1VFBA 3VJ6A 1MHEA 1VCBC 4WTZA 1JFQL 4BFBD 2J5WA 1BZOA 1L7TH 1VGEH 2JKWA 1U92A 3WIFB 2AJYL 1EAPB 4PAZA 2H1XA 3LY6A 4JFTA 2CKBB 5KYYB 5KSBF 2N01B 1UH4A 1G87A 2HLAA 4X4ME 1PF3A 4ALAC 4HC1A 1E27A 4OM0L 2JCCB 3TO4B 3GIZL 3Q0HA 4PH8A 5KZCB 2D3JA 4HFUL 4IIQA 1M2VB 1DN0A 4NAJA 4BZ1H 1EXHA 4JG1H 5J1AB 5CLTA 4HISA 4P05A 4LHUG 1TYRA 3DGGB 3FQXA 1KG0B 4M1DL 3VU1A 1BREA 4RAVB 5L8JB 1RPUA 3EGSB 3L3HB 3FNKA 4NAQA 1HHIB 5SWQA 3ARGA 1F4XH 4EI5D 3U6RB 2V33A 5IMKA 3NACL 3QI9D 1E9QA 3HE6D 4MJIA 5BQDA 5IFJB 5CZRA 3VG0L 5DEGA 3QCTL 1A4KB 3QDGB 4G6FD 5IBTL 1NC2A 4KVNH 3RU8L 5F7HA 3TWCH 3CLFH 4K9EH 5DXWA 5J6SA 4N90D 5J9PB 1YO4A 5CHNA 3U4BH 4U1MA 1CK0H 1XGYH 4AQZA 2RJMA 5E56A 1U3JA 3BMWA 3VGFA 1ZPLA 3KLAA 3Q2CA 5J7CC 4KVPA 2ZOKB 4YC2C 3KH4A 4PJAE 1T0NB 1JTOA 4HKJB 5IQOA 4DPCX 1FL5B 2X3AA 3IN0A 1HWGB 1IC5H 2WO4A 3QJFA 4BZ2A 2AI0H 1BLNB 4XPHH 3FOLA 2Y36L 3F6JA 5D70H 4F8PA 4EN3B 2CCLA 4YQXH 1U8NA 5DDHB 4ELMA 3ZMEA 4DP6X 2XLLA 4JRYB 1QSFE 3P0VL 1BWMA 1NCJA 1AGDA 2ARJA 2YXWA 3X1FA 1I82A 3RIAK 4UU9A 1E0OB 4X6FB 4NLAA 4Q52A 4XNXL 3RJQB 2HT4C 1PZ5A 4KJQD 4XO4A 3FRPA 1R5VB 3WY3A 4ELKB 1ULVA 1O7SA 3HC4L 3TVMC 4DESA 1JPTL 3QR2A 4JGUA 2AC0A 4G3YH 3BCFA 1QRNE 1YQVH 2AABL 1FORL 1KB9K 4AQ1A 3MLRH 3VDAA 3VSUA 2XNAB 1RURH 5AD0B 4X8GA 4DZ8B 1A5FH 3IS1X 1YJDL 4QRUA 1IBGL 3WSQH 3IF1A 1U8QB 3FQTA 3PP3H 1JZ5A 5F44A 3U6XA 3UACA 2QMKA 1QX1A 4CKVX 4XXWA 4PLKD 4OKDA 3BPNB 2N59A 3F2LA 5D1XD 1PCXA 4JGJA 4OZFG 3L3DA 1DQDH 1JHKL 1C16B 1N19A 2QQLH 4KX9A 5T3XL 4WJKB 2QPSA 4N2OA 1IC1A 1BF5A 4FQCH 5CZKA 4Z77B 5EU5A 4G6AC 5D93C 4HXBL 2VDLH 1YMME 2YFNA 3RY4A 2IJ0C 3BVNA 3DK0A 1KIPB 3IJYA 4WWKB 4AH2B 4LHUD 4GO6B 3KPRE 3L16A 5T1KD 1EMTL 5CCJA 2BSRA 2DQUH 4JG0H 4YX2L 4R7LA 2VLJA 2ZWNA 1CBVL 1OE1A 1VFAA 5ALBH 2GI7A 3QUMB 1H0DA 1HZLA 4XGZA 1M7XA 1GJIA 2YSSB 2QKIA 1MFCL 1WHPA 3ETBJ 4L4VB 5E5MB 5FYKH 2Z93A 3D4ZA 2AV7B 4L3ED 1MEXL 1Q9KB 3UJTH 5DSCB 1HESA 2P1YA 4MDJB 4XOAA 5I66B 4W9GC 1YEJL 4NI3A 1OALA 3CD4A 3JWDH 3KYKL 1WCBB 5C09D 3F5WB 4M3JA 4XOEA 5FO9B 4RFEB 3QIWA 1MLCA 2VLKE 1FH2A 2VUOA 3SJVB 4QTIH 4PEEA 2I5YL 1H8OA 1TZIA 4X7TA 5HDWA 2HPOA 3BH9A 2CCWA 4QHUA 5ENWA 2P7TA 3TT1L 4I3RL 4P4KD 1X9RA 3OVUB 4YDNA 3KPMA 4FQIH 4NO3B 2Z64C 4S1DC 3UMNA 4UOJA 1NGWA 3AJ7A 4IHOA 1NDMA 3RJOA 2QZ5A 4JRXB 2O6CA 2WQAA 1GSKA 2P8MB 2FWLB 3ZOAA 4PTUB 4LIQH 4GO8A 5E7BA 2CLVA 3QE5A 4A55A 3QIBA 2NT1A 3SOBH 5HGBA 4HJ0D 4BSWA 1OAXL 4YDIH 5AZ2L 2OYMA 1L5GA 1LO5B 3UJIL 4BE6A 1UD5A 4NC1C 1YC7A 3VD5A 4IRSC 3VXTA 4QPEA 4O00A 5AVXB 2A9NH 5CP7B 5KEZA 2HB0A 3VRLE 5AW4B 2YD1A 4X6BA 3N1GC 2VKWA 4JFDA 5MI0B 4IBTA 2WQVA 2BP5M 3RNQB 2GEEA 5DFTA 1K8DA 4F58H 4KO7A 4X7SH 5T5FL 4HWEL 4YHPB 1KLUA 1X5MA 4IRZL 5ICYA 2WZAA 4MHHG 2DLHA 3BZFA 3L9YA 3M86A 5DRNA 4AXWB 1YDPA 4I9WE 4FHJA 1LL1A 4PV8B 4S1DD 1URZA 3T4AB 5J1TC 1WWBX 1GW0A 2WAQA 4JM2C 5F6IC 2B1AL 2J71A 4G59C 1MCOL 4F37F 4UV7H 3VGBA 2ZG1A 3EXJA 3PWPB 4HKXA 1ZLUK 2PXYC 3T0ED 3TTSA 3KPLA 3HG1B 4LSQH 3S37L 1SVZA 2X7LB 3BKMH 2F08A 2FCBA 4N5ED 2YEZA 2DOCA 1OWWA 4BFIA 4ENEC 3EOBB 3Q8AA 3QUZB 4A6YL 4CDGC 3RZCD 1ZGLB 4HZLB 4XAKD 2A83B 5IZ7A 1HOCA 3X12B 2Z34A 4LRIA 4GFXA 1ANUA 4M61A 4J4PA 2H47C 4TNEA 5JXEA 3LKRB 1J1OL 3TA3D 2CO6A 4M43L 5JHLH 3O2VH 1Z7JA 3EOTH 3L6FA 1MVFA 2Z3FA 3O6FD 4N0YH 4NQCD 4KUCD 5J6GB 1EUTA 4J28A 1QBLL 4X8JA 2PPEA 5DTFA 3PP3K 3ES6B 4DTGL 2OL3A 1IQWL 4P49A 3BPNC 1WTGT 3EOYG 4APQC 3CDZA 1U3YA 1EEYA 4L1HA 2EYRA 2PXYD 5IVXF 1PFCA 1FZMB 3VWKD 4YBLB 2B1OA 2ZSVB 5CGTA 4ENED 2WQUA 3GTNA 5JXAH 1DDHA 3DUSA 3KG5A 5KBDA 1YEGL 3CU7A 3NFPB 1TO5A 3HN5A 4MS8C 1SMDA 5IHBA 1MUJA 1C8PA 2H8PA 2ZOUA 5DWUL 1I1AB 5AUMA 5T5FA 4A39A 4NCDA 1PZBA 5AVZB 1HQ4B 5TDOB 4IBQA 1N6VA 2UWEB 2CM5A 1A9EA 4IRZA 5FOJA 4HT1H 2C7UB 3RFZB 2JJSA 2DWXA 4KKLD 4KROC 3ZIMA 3RWJB 4NKIL 3VFTB 4F3FA 1AHWB 4QRAA 4GEIA 4JHAH 3QQ3A 3ZT7A 2FGZA 4JLRB 5IG7B 3AQXA 1MREH 1C5CL 2J8UB 4P07A 1OPOA 1TPXB 4HMEA 4APQD 3D0LA 2DQIL 3IBEA 4LSRL 3T1FB 2Z1PA 5ABZA 1QBBA 3HJ0A 3VFNB 5SX5K 4EDXB 3RILA 4HIJB 3F7RA 5K1JA 4JREB 1KEMH 2W9EL 4A6YA 3VWJC 4M9OA 2F8XC 3LD8C 2XIDA 3TBYA 3VO0A 2VC2L 3UABA 3MLWL 2A6IA 3K6NA 4U1GB 1Y1DA 4MS8D 2X09A 4YDZA 5GGQL 3TLRA 4P2QE 1XR8B 4KXZH 3BUYA 4P5MB 1PIFA 1Q9WB 4BQ9A 4YZFE 3U9UB 3ZDZE 5IROA 5I1LB 3NJVA 5FF6A 5JOFB 4QD2E 2ZUUA 4LESA 3EYVA 5HHMD 2UVFA 4XC1H 4KROD 5FM5O 4A2DA 3MBWA 4TULL 3ARDA 5IOPA 4BDVB 1FNEB 3BAXA 5CIPH 4KKBD 2WCSA 4ZW7A 2ZOLB 2ITEA 3MLVH 4JN1L 5ERWA 3VFOA 4AKOA 1MJ7L 4MNQA 4PLNC 1K3ZA 3KGRA 5I1EL 1QR1A 1EV2E 4DP5X 3MRDA 4ODSL 3DIDA 4QF1A 3O6LH 1BM7A 3UTPD 5A40E 3HZMB 3U46A 3WNKA 3OR7A 4HIPA 1MJUL 3BJLA 3FQYA 4ZFFB 3T4AC 1F02I 5D5MA 5I1GL 3IDXL 3LNFA 2YOCA 2X0UA 2RFXB 5K33A 1JE6A 2BSDA 4NKMB 5LN8A 5KG9B 1ZCRA 3IFNL 4FMFA 5IJVB 3SKNB 5K9QI 5I0WA 3CUPA 4P2RD 4U1NB 4PRIA 2FT7A 3SBQA 2OS7A 3MYZA 4YSQA 3RURA 5HGHB 4WAFA 3RVWC 1PZUB 2EH8L 3AY4C 3B7YA 5JNYA 4Y8DC 4BA0A 5A2IH 4KTGA 4K7FA 4AT6A 4F7PA 5CBEA 2DYPB 2C3HA 4TUJA 4GRMA 1WFIA 3L5WB 3ZHDA 5I75B 1KB9J 1ONQB 4HXAL 5ICXA 2A4EA 1CE6B 4EJ1C 2BOBB 3NPSC 3FCGA 4PJHB 3L17A 1NCHA 2OYLA 3ASWA 2AAVA 5E6IA 3L2NA 1SVBA 2PO6A 4NZ8A 4CSZA 1OCWL 3HS0B 3RGVC 1LHZA 1MHCA 2XZQH 1B2YA 2DQEH 2Y7OA 4YLQT 3FRPG 5BMFH 2QADB 1YEDA 3NCCB 5HYQA 4LBAA 5GISL 1OP3H 4NDMA 3SE6A 3V4VA 5IB5A 2QVKA 3PGCB 2ATAA 1J1XL 1A7QH 4K3EL 3ZL4H 5I1DA 2YPVA 1YY8A 5F1NB 4GRLB 2JF1A 4ZMNA 2V2TA 3P11H 3W9DB 3MNZA 3LS4L 2GYSA 4GRWF 1CLYL 1HNFA 2Y1YA 4ONGL 3RTQA 3VFUB 5I30H 1MH5A 1QPPA 1HSBB 4RQQB 3WJMB 4EZMA 4PN6A 2WANA 4NQSA 4PHXA 4Z3JA 4OGYL 1EZVX 2FJSA 4PRPE 4GUPB 1PX3A 5J57B 3P2TA 3T3PE 1E43A 3X1NA 3RFZC 1W0VA 2R9HC 1JGVL 1F6FB 1GOHA 1KIUA 4M7ZB 1IBHA 5ID1B 2B15A 1FWXA 3KBPA 1MPAL 3X14A 5F6HI 5HYEA 1HL8A 5EBLB 1YPZA 3PQYB 3DX8B 1QFUL 5FOBA 2Z7UA 3BKJH 3V9EA 3THMH 3VXPB 3ARGD 3KPNA 4XP1H 2OZNA 3SGJC 2NNFA 4XP9H 2O93L 2PWDA 1BMGA 3D33A 3VSTA 1ZVSA 5C0BE 2BFGA 3QUGA 4YHYB 4JB9H 1NC4A 4DO6A 4JREC 2YQ3A 2WLHA 2OP4H 1RIUH 3QG6B 4PRBB 3V0GA 1NC2D 3HI1B 5ISZD 1PQZA 2K4AA 4R4ND 3F7QA 2JJUA 3GMPB 1CE1H 4IJ3C 3L54A 1YHPA 2FJFB 2I9LA 1OGAA 4KZEL 1RK0B 4Q0XH 1P5UA 3NSFA 5EG6C 4H8VA 3G7TA 3I50L 4FTVE 2E7CA 5JYMA 2B08A 5CCHE 4BZYA 5D7LD 5LN4A 4HUVA 2WXFA 5I1KL 3BHBB 4QJ4B 1Q0YH 3CMGA 3DTXB 3QFDA 4DGUA 2X10A 2JVUA 3F01A 5D1ZA 2Z31B 1WO2A 1JDAA 3EDKA 1GZQA 1LNUB 1WFUA 2E0PA 5KTEH 4HWZB 4I18B 1IL1A 1EO7A 4J3XA 1SHSA 4G1EA 4F7MB 1FG9C 4G71B 3SDCC 3L9RB 4UINL 4JE4B 4M93B 4RGOH 5F0MB 2YD8A 3VGDA 5KYWB 3CH1B 4UM9A 3ZL2A 2R1XA 3AB0C 4FABH 1P4LA 4HLZH 5AW1B 5EUOE 3N06B 5DUPH 2R2EB 5DK3A 4Y4HB 1I7ZB 2GCYB 5ES4B 5L4JA 1RSFA 2WQRA 3QW9A 4PS4H 2VDMB 1C5BL 4Q14A 5JO5B 3MGOB 2X12A 4PP2B 1LK2A 4LCCB 5FW7A 2XV3A 3H2WA 3BC9A 3BYTA 2V2WA 1BJMA 3QDJA 3D85B 5KBPA 4QTFA 2DD8L 1CICB 2XWJA 3CAFA 1N7ML 1R3HA 3AQYA 4GSRA 4XP5H 2AJSH 3RY6A 1AO7B 3U0WL 3FQUB 4ZUTB 4ZDHB 5DJ6A 4RETB 4OCNC 3VFGL 4OZIA 4ZFGL 2IGFH 5D7IE 4K94L 1G7PA 3GSRB 3OM3B 4DAGL 3MSPA 4GIAA 3VGHA 4A66A 1VZIA 4N68A 1W72B 4OQ1A 5CLWA 1Q0XL 1LEKB 4XPGH 3T5WA 2HFFB 3HS0C 4L1DA 4F8OA 1QWNA 5AKRA 3MA9L 3UAJC 2H5UA 4QIRA 2CPCA 1ND0A 2N1KA 2PYEE 4XMPL 4CW1B 4KKPA 2PWHA 4AIZA 1IEHA 3U9PH 4BFNA 2OZ4L 1M7DB 1ADQH 3KHOA 5D2NB 4LKXA 3EUUA 4JZOB 3WIHH 2E6PA 3OR6B 4K7PL 4JKWA 3GI8L 5DUML 4PJAF 2ZUXA 2IPKA 2PUQT 4KRPC 3RDTC 1AKJB 3AUVA 1WPCA 3DVFA 3VAEA 3N2JA 3QIWD 4IIZA 3QCUL 1YEEH 3RWGA 3PHOA 1FNSH 1YN7B 3ISYA 4G8GA 3PL6B 4QJ5B 3D08A 4OV6F 3B9KD 4DOHB 2IOMA 2P26A 3OZ9H 1BEYL 4JHWH 2VE6B 4LLMA 3NCJH 5AVTB 2F7PA 1ROWA 3MREA 3CDCA 3AS2A 2Z8WC 2BNRD 3CU1A 1JZEA 3P3RA 2NXYB 5CAYB 1TLKA 1X7SA 4WUUD 1ZK5A 2APBA 2NTSP 3BSGA 3QIBD 3GZQA 4X5WB 3U36A 5FW8A 2GJ6D 4PR5B 2R27A 1TNNA 2FL5B 3UTTE 2PCYA 1B3JA 1NUFA 5A16B 3KPTA 5MEND 4YHYC 4TMPA 2VL5A 5C0JA 1FFPB 3MLSL 4M6ML 3OJMB 1F1AA 2KLTA 2AQ1A 2VRAA 1V3LA 4ZRGA 5DEFA 2FECI 4PJ8C 2HJKB 4TRPL 4KRPD 3RDTD 3GMRB 3QDME 5F1IA 3V5KB 2OXGB 3QNXA 4R90L 5T3XD 4D8OA 2JB6A 4P2OB 4RRPA 1IRAY 4S0SD 1QNZH 2W0PA 3EO0B 2X6UA 2WKGA 1S3KL 1E8XA 3BGAA 4Z23A 1J8SA 4KBPA 4Z8FH 1EPFA 5FPIA 4PJEE 1F97A 2OTUB 3FTGB 3WOVA 5D8JL 4NB7A 4OZFH 3T8MA 3LV3B 4OF5A 3DBXB 5J89A 3IGLA 2FR4A 4Y2NA 2O6PA 3SDAA 3S4SB 1IX2A 5KVDL 5BO0D 5BOPA 2OZ4A 3UX9B 4PJDA 3EJRA 3IJHB 3OKLB 3QO1A 2BVPA 2CJTA 4KDTC 1G7MB 1BOGB 3B37A 4YK4C 5DRWB 5TQ0L 4M93C 2ITDA 3NJKA 5HDQL 1OSZA 5CINH 5ABDE 4RMUA 25C8H 1QFWI 5DC2A 1L7IH 3K8LA 2OQJB 2XWEA 3MLZL 3CQQA 3S8FB 4N2EA 5SWZD 1VACA 5JXED 2E86A 5GZNC 3GS0A 2H2SC 2C9AA 4OZ4B 3SKJL 2BNQB 5CMAB 4UB0H 3D4CA 3QJVB 3NGBB 4N24A 3GI9L 4PRHE 2Y5EA 5DZOA 2VLRD 1KCUL 1S9WB 1MIEH 4X4YA 1ET5A 4D2NA 1Q9LB 4QTHA 4MAZA 3GBML 1OGTA 5I6XB 5CEXB 1WISA 4JKMA 5HTSA 2WWMC 4NQDB 2ZG3A 3ULVC 1XT5A 4M8VA 4RGNE 2RIKA 1FFNB 2HKHH 1Y07A 4TSBH 2Y72A 4JFEB 4QRPE 2EUZA 1AR2A 1SDYA 4Z7QB 4G5AA 4U3SA 2PR9A 4PI2A 3BEVA 1A8ZA 3LIUA 2NY7H 2NUPB 2YD7A 5JORA 4M1CC 2ICEC 3DXAB 2VMCA 3CSPA 4FQ1L 4IMLA 1T5XA 2R2CA 3VRLF 3QPQD 4PJGB 1QBAA 4GBXC 3U6XS 5A6LA 5I5MA 3ILEA 4HEME 3ZKXB 5MERA 2IMNA 5GZND 2G5BB 5C0CB 1IIKA 2H2SD 3WFEL 3C8KB 2VLME 1GGBL 1X7QA 1D5IH 1JWUB 2IDFA 4ZS6C 5F96L 1KPUA 1NCWL 3SBWC 1KXVC 4U0RB 1ACYH 1GOFA 1TO4A 4A7GF 3E8UH 1KFAH 4KKNA 3HFFA 2WWMD 4L8DA 4PSPA 4BFEA 3G6AA 4KTDH 4R2GD 4ZNCD 2YBGA 2E8YA 4LPWA 2L4OA 4NQQA 3FMGH 3FULA 1BF8A 1KTDB 1G7LB 1KCSH 4XVJH 1CT8A 4DUVA 3LNEA 4NJ9L 5IQNA 3B7UX 3MJWA 4JE0A 5EB9A 4BH8A 3KPSA 3H3BC 5D2LB 5E6UB 3ZZSA 2ESVA 4HUUA 5AOKA 5IESH 5J12B 2X2IA 3RWCA 2Q5BA 4M1CD 5G4MA 5I1CL 4PGEA 2NW3A 4LEBA 1ZLVH 4B9CA 1QLEH 2QPDB 5E94A 2COQA 3KWWA 1D7FA 3HC0B 1DQMH 4FYQA 3VXUE 1U3HA 2IPUK 3K72B 1L4IA 5CJQL 5IROD 2O61A 4NQEA 1ZA3A 1WZ1H 3ASNB 4IGBA 2K7PA 3PDGA 4M9PA 3OAZH 2VISB 2JIXD 2ZT9C 1A4JA 1UJ3C 3CVIH 3BMVA 5J3HC 5KVFL 4P46B 2AZUA 3A6CH 4R97B 2EIJB 5EBWA 3QUXC 4NZJA 4WK0B 1H3XA 1MFVA 1X5IA 1JV5A 1PJWA 3QRGL 4P3CH 2ZUWA 2W80C 1I8KB 1OXYA 4HUKB 3EFDH 3W11C 2YUZA 5T3ZL 1L9NA 5D6DA 5AVVB 4E41E 1S6NA 4D0DA 3KWUA 2V0AA 4Y5XB 1KWGA 2V5TA 2IH1B 1EO8L 2ZYHA 3DJZA 3CX5K 1ORQB 3DTUB 4D8PB 1Q72H 3VDBA 1P7BA 1MCRA 4OM1H 2W1NA 2VXUL 3ARTA 3C08H 1K4CB 1JGDB 1FCCA 2HZHA 4IOSD 5KWYC 2RH0A 4UT6H 5T33L 2WB7A 1RU9H 3V0EA 4HCGA 4V2BA 5FYJD 2VDNB 3AG2B 3IAGC 3L81A 5AG8A 1FAIH 1G1KA 2OMNA 5EBMA 2R29L 3CSTA 3SE4C 5HPMA 2O30A 3CDGB 5J3HD 5KVEL 4ZW5A 2YGNA 3RPIB 3B9VA 2G75A 2X4NA 3EJYC 4FERA 4Q6IA 1JPGA 1U8CB 5CEYA 1I9EA 3T8VA 3VYOA 2WBJD 3SPHA 4WI5A 4YXKH 5K93A 2A6DA 1T89A 3T0BA 2OJEB 3F7LA 3N9GH 5IGXH 1KPRA 4XN5A 3FUEA 2H32B 1GGTA 1D9KB 4FG0A 2Q2EB 1SQMA 2X6CA 1B88A 4M02A 4PJ5A 1OM3L 1X5YA 4R4FL 4KI5C 3FHAA 4JDEA 3HE7A 3LNGA 4JY4A 5EO9A 4YZFF 1XF5A 1JZHA 43C9A 3ZDZF 1KCVH 2YMXH 3R0MA 3DRTB 1B2WL 2ZX7A 2C8NA 3L5XH 3DROB 4BFRA 1ZLSH 5DURB 4L37A 1WLHA 4LKCA 3TVMA 4B97A 3RTQD 3KLLA 5DVLA 4AM0A 4PGDB 4WU5B 1HXYA 3CFDA 5T1LB 5LAXB 4V1DA 3R8QA 2WYTA 4G43B 3QXAB 4HC1H 3MX0B 2BO0A 2K45A 5I17B 4A63A 2YGOA 2LFGA 3I6GA 4LF3B 1ET8A 3IDIB 2BCKB 2XTSA 3C5ZB 4UM8B 4B9GA 2D03L 2P5PA 4FXKC 3ETBF 1H9VA 2EO1A 4I2XA 1HH9B 3G6JF 1CLZL 1F90L 5J11C 3S8GB 4HH9B 3H8NA 1QWHA 3R4DA 5IEHB 4JEGB 4CVWA 2ICWB 1NKGA 1T2QH 3OKYA 4OGQC 4KI5D 2AXFA 3MA7B 1OSEA 3V0WL 1RZQA 4AC4A 1MW0A 5IHZA 5H94B 1NSNH 4Y16B 1F3RB 2FB4L 5D6CA 5TF1L 1SEQL 3VW3H 4AJVA 1EHXA 3IYLW 4PMEA 3WHE0 1O9VA 3EHBD 1VADA 1KN4H 3MCKB 4XNMB 3U30C 1XF2A 4ZUWB 2WLKA 3P73B 4XMUA 2GABA 3KYAA 3ILQC 1J1PH 1FSKB 5DUJA 3R18A 2VQ1B 1LK3H 1UM4H 4HJTA 1RMFH 4NO0A 3QFJB 4OCYL 5IUSA 1AYRA 3DOSA 1FLRH 2I7OA 2C3VA 1J0ZA 1UYWL 2VERA 4JO5A 2B59A 1WQVT 4ZUUA 1AXTH 1T03H 3PWNA 5F7LB 3D12B 1QZNA 3PUUA 4O58L 1J8HB 1DJGA 1I75A 2F5BL 2OR9L 3OAZK 4K73A 3UO1H 2UUDK 2YK1H 3WIFA 4XCCL 4BZ2H 2QSVA 1MFNA 2MEJB 3BLPX 2R7EB 4ZQKA 1HC1A 1UOKA 2CKBA 5E2JA 2KUTA 3D30A 4DW2H 5KYYA 2V3EA 4HHGA 3F58H 4NN7C 4YO0A 3STZA 3BZ5A 2JCCA 2Z8RA 3TO4A 3I9PA 3KHQA 3W1ZA 2E9WA 1M3JA 2HT3C 2X9YA 3MRKB 3KW8A 5J1AA 1JFQH 1IAKB 4LLUB 6TAAA 3WO4B 4ORGA 4PRDB 1LO4L 3DGGA 1KG0A 1XL4A 2Y2WA 3ILQD 4K5MA 1IT9L 2Y1ZA 4RAVA 3EGSA 3L3HA 4HIHB 3PABB 1OQOA 1T5WB 3LQZB 3DO3A 2NLJA 4YZWA 3MRMB 1CLOL 3U6RA 1EZUA 5IHUL 4OM0H 2ZE0A 1BHGA 4RRPG 2DMBA 3GIZH 4HFUH 5IFJA 1TZOA 4FFZL 2MQ3A 4LL9A 3T3PF 3OKOB 1KGYE 4YL4A 3QHFL 4P9HL 4FEMA 3WLWC 3AREB 1A4KA 3QDGA 4ANWA 1UVQB 3C6LD 2IADB 4M1DH 3TN0C 3S37X 5J9PA 4M7LL 4JKLA 4UNIA 2UZIL 4N8UA 3C09B 3QUML 1YAIA 3TTYA 2UX6A 2Y4SA 2WBWB 4AZUA 2ZOKA 3NACH 1SJEB 1HL4A 1FV1A 1T0NA 3L3JA 5DZAA 3JUZA 4HKJA 3DI3B 1FL5A 2HT3D 3BVVA 5DHVA 2V3FA 3VG0H 3U0PB 1TTFA 4JM2A 1BLNA 2FLMA 3I84A 1ZS8B 3RU8H 1NPJA 3GTTA 3UBFA 4P3DB 2NXZB 3N42F 4QHLA 5ALCL 3CLEL 4FQ2H 4WFFD 4LSUL 4AEIL 4JRYA 4PHZA 4WF7A 2FH8A 3II1A 3LZRA 1IV8A 4K2UL 1EFXD 2ZOWA 4M7KL 32C2A 4X6FA 4WWID 4LO9A 3GXPA 4ABVA 1A6ZA 3FTWA 3WLWD 1R5VA 4ELKA 2Y36H 3DJTA 3O4LB 1N18A 1T1XB 2YN3A 1T83C 3FH7A 5HHOB 1U8LB 1Y0LB 2CHDA 2XNAA 4MMZB 5AD0A 3CZUB 2MH4A 3MV9D 1U8QA 1BFVL 4GKOA 3NZHL 1N6QL 4XNXH 2NNAB 5AENA 1FNAA 1P6WA 1XF1A 4XVUD 1T6WA 4NOBA 3HC4H 5EUOF 1JPTH 4XP4L 2AEQL 1RUQH 2PABA 1C16A 2AABH 3P9LB 3KH3A 4ZOBA 1FORH 4O4YL 4U1KB 3KBEA 1UGNA 3QAQA 2G30A 4Y16C 3V6ZB 4CU6A 1YJDH 1KIPA 4WWKA 4YHLL 3PHQB 4O5LL 5CSGA 2GTZB 2ZWLT 4HAKA 3VFMA 3ZE0E 1N6UA 2R2BB 4CRPA 3L1OL 1BIHA 1FC2D 3VXSA 3CDFA 3RUGB 1DZBA 2XICA 3SEPA 1A21A 3UTSD 3S2AA 4OFDA 2EYTA 4RWYH 1PLBA 1JHKH 2YSSA 5T3XH 4G42B 1S5HB 1HHJB 4L4VA 1RPKA 4NRYB 1UTDA 4W6XB 5FYJU 4HXBH 2AV7A 3DIFB 3DARA 1Q9KA 2WLNA 4MLIA 5D7IF 5DSCA 5HXMA 4ETYA 1EMTH 1OAKL 1SUHA 4YOKA 1WCBA 4LDOB 1MFAL 3JT2A 4LCIH 1RHFA 4ZAKC 1UT9A 1WDAA 3F5WA 3EBIA 4J3OG 2BY1A 4PCSA 2D2OA 4RFEA 1WAPA 5FO9A 3SDAD 3SJVA 4IU3A 1CBVH 1RULL 3M45A 4X0KB 2J1XA 4QXUH 3NDYE 1GMEA 1MFCH 1O6VA 2ZPKL 1NCTA 2WM0A 4PLOB 4NO3A 4C56D 1HXMB 4JHBA 4NENB 4J6RL 4WHDA 2Q2LA 1XH0A 1MEXH 5AOLA 3VWJA 4ZJ9A 4AZ8A 3CX5J 2Z35B 3L4XA 1YEJH 2R15A 1MJJB 5F93C 1I3RB 4JRXA 2OCJA 1J5CA 2P8MA 3MOBL 4P2YA 4PTUA 2H2PC 2ZXGA 2XVLA 3FSWA 2I5YH 4G7QB 2AQ2A 4Q58C 5FA4B 1FL6B 3OF6D 3TT1H 5H2BB 1LO5A 4I3RH 4KU1A 5AG9A 3GSWA 1MRFL 5CP7A 4YE4L 2HRHA 4WI4A 4OTXL 2WVVB 4FI6A 4PD4K 2A6KB 3VXMB 5FGBA 4QEGA 3C12A 3RIAF 3CN3A 4XOCA 3G3LA 1Z1WA 5KSBB 4JFVA 2VSKB 5HD8C 4AVIA 1J11A 1OAXH 3BUBA 4LOFA 4YHPA 1IC0A 5AZ2H 4ES9A 3LPFA 3QULB 4G6JL 3UJIH 1JN6A 4J1UB 5EU7C 2Z7ZA 2FECL 3RLSA 4HWBL 4PV8A 4M4RB 3T4AA 4TV3A 1IGTB 4ZXBC 1JXFA 1SOQA 1WZAA 3ULUL 1L9TA 3DECA 3M46A 4MRBA 1Z5LA 4P5TB 3PWPA 2H2PD 4IOIB 3V10A 5CR1A 5KSAC 2XHNA 2BNUB 2X4RB 1L0XA 5T5FH 4HWEH 1M42A 1CD9B 2RALA 4IRZH 2IAND 2TRHA 4G7SB 1CUOA 4LOUC 4N90E 5E8EB 3ZK0A 4A68A 5B1KA 3MC0A 1TITA 3MFFB 4PJEF 3EOBA 1ZGLA 1QKZL 1KYOK 4FLOA 4HZLA 2M83A 2A83A 2DLGA 3X12A 1MCOH 4Z1PA 4H2CA 1CXKA 1F6LL 4PU2A 2IQ9L 3LKRA 4XH2B 3S37H 2VB5A 5HD8D 4MAYC 1QFWL 2J57A 4PBDA 1ADWA 3GXFA 2ESVD 4R0LB 4X6CE 2WO2B 3RGVA 3V0DA 4KJYA 3WNMA 4A6YH 4Z3TA 2X38A 1A6WL 1I1FB 4MA8L 3CZGA 3ZT6A 3MRLA 5CP3H 2EUVA 2VGLM 3UFIA 3D25B 3NFNB 1JUFB 4H26B 3UTQB 3OKEB 1J1OH 3FQWB 4M43H 3T2QA 1LP9E 1YSOA 1CG9B 1JERA 2JXMB 3DC0A 5C0EA 1NCDL 4IGBD 1FZMA 4R84A 2G5UA 1DZ0A 4XX1E 1XZWA 3GPSA 1QFOA 1QBLH 5B22A 5K39B 4DTGH 1G7HB 3NFPA 3P30L 4MXWL 1IQWH 2Q7YB 3MRJB 1CU4L 3H9SD 4ONFL 3BIBX 5CF3A 1I1AA 1RD6A 4GQQA 2PW2B 4I5BB 1Z5HA 1HHKB 1BYPA 5TDOA 1HQ4A 2AK4D 2UWEA 4Z3EA 1EBAA 4QRRB 1EBPA 2C7UA 5GGSA 5D1XE 3RFZA 4MAYD 2ICWI 4HWBA 1U2HA 2OULB 1SJXA 1MHHB 5CD5C 3RG1C 4Q2ZA 5DT1L 2APXA 3VFTA 1AHWA 4YFEA 3RZWA 5BOJA 3HBQA 4F57L 4UQCA 1NIAA 3FUHA 4JLRA 2R39A 5C08B 5IG7A 1TYJA 2J8UA 1O75A 4IK6A 4BH7A 1J0YA 1EHKB 3II2A 5DWUH 1TJXA 4ICWA 3QP3A 1LE9A 3SGJA 3QUYC 3PJLA 2CA4A 4EIGB 1MFEL 1RZIB 1MN4A 4R7NB 1CFTB 3IB4A 4R83A 5IEKB 3VFNA 4EDXA 4HIJA 3DPBB 5TDNB 2WXRA 1SUJA 2JKLA 2IBZY 2WYHA 4NKIH 4LNVA 4AEEA 1JZ3A 5E0FA 4G8IB 3AG4B 1CTOA 1C5CH 3IJ7A 5E8DL 1XR8A 2ZX5A 4LSRH 2DQIH 4P5MA 1Q9WA 3P77B 3LZOA 2HRGA 1ZLEA 3U9UA 5C09E 5TFSL 1D3CA 4NO2B 4RX4D 3VFSB 3CFKA 4NSKB 5AQ0A 3DHUA 2W65B 1GC1L 2FBJL 5C0AB 4WGKA 4PBWD 1HQRB 4JM0A 5CD5D 4JBSA 1ZTXL 1K2DB 1BXAA 1JF6A 1GL4B 3EF4A 4RFNB 4BDVA 3GJEB 2VC2H 5LQBL 3MLWH 4PJ5D 3Q8FA 1RJYA 1S7WB 1B90A 3ZTDC 1FNEA 1WBXA 2CRIA 3AAZA 3FO1B 5EMYA 5HGGS 1DBJL 5JTWA 5I0XA 2ZOLA 5GGQH 2H3NB 2JJTC 1AGFB 5IUCA 1NFIA 1ZIBA 4Z5RB 4WJ5B 3D69B 2LU5A 1KY6A 4JK0D 2A38A 3QUYD 4MMYB 1I85C 5DLML 3SDCA 2XU9A 3I2CL 2EEBA 2J6WA 3V4VH 5H4ZA 2MQCA 2HVKB 2R1WA 3HZMA 3MCYA 2XJKA 3VFRB 4ZFFA 2F54D 4K5LA 3K4DA 3VI3B 2EDYA 2YPVH 3QC5X 4OV5B 2IEPA 3FUKA 3MO1B 4KJWD 3WEXB 2RFXA 4NKMA 5K9QG 5KG9A 4L18A 1W15A 4JN1H 2YA2A 5IJVA 1WRFA 3SKNA 5JHMA 1MJ7H 4U1NA 4XT1C 4Y7MA 1FH5L 2E7LA 4OQTL 4FQXC 4QXGL 5EU6B 4AK2A 4HU8A 5I1EH 3DYMA 4ODSH 5GGRB 2DTSA 3HJEA 4LE8A 5HGHA 1S7QB 3CE1A 1INEH 2N56A 2OMUB 2VKXA 1MJUH 3PE9A 1JYXA 4YDLB 1JF1A 5J06A 4PJIE 5I1GH 3VH8A 3IDXH 2XN1A 2ZOOA 2DYPA 5DMJB 4WQOA 2XQYK 3L5WA 5DO8A 3IFNH 1CE6A 2QPEB 2O5XL 2BOBA 4OLXL 2IDTA 1SJMA 5C0GB 2C4XA 5DRZB 1GKEA 4NKOB 3T0EE 3S8WA 1RZFL 3J07A 3ATFA 3HS0A 2EH8H 2UZXB 1FFOB 1H19A 4MNGB 3EJJX 3Q06A 1UB5B 3UAJA 3PJSB 3D3VD 4Z0BL 4NC1E 5IK3B 4NO0D 4N8CL 4OJCA 2NYKA 3UC2A 4DP1X 4I89A 1H8SA 1G7JA 4XAKE 4GG8B 2VWEC 4NM8H 4APXB 2ZG2A 4FQXD 2C9UA 4JRWA 4H8PA 3PGCA 3BN3B 4PCTA 2AGJL 4TTGA 3BZ4B 3CWGA 1LTXA 1OCWH 5F1NA 4OZGE 4XBMA 3W9DA 5DD0L 1XEUA 4YHOL 3DHJA 2DWDB 4NQCE 3VFUA 3WJMA 4RQQA 3SKUD 3G5XB 5FXCH 1S9XB 4JKNA 5E08L 3O6KH 4HPYH 5GISH 3UBHA 5HYJB 3EDJA 4GUPA 2O26U 2VDML 1XH3B 2Z7WA 5KZCD 4KFZC 3GSVB 1J1XH 5FCSH 2ZUQC 5SWSA 3HMXA 3G5ZB 5EWIL 4DUWA 1RZKC 3E38A 1TXKA 5EBLA 1HK6A 1GW6A 3CZLA 2B2XH 1LMKA 1TZAA 1UATA 3DX8A 3LS4H 3QJTB 1E4KC 1CLYH 2I69A 4RDQG 2H0FA 4ONGH 3NK4A 2AVFA 5AB1A 3V0VB 4MSWB 1U42A 3HRZC 1B4TA 1PYWB 5E9NA 5JUEL 5IJDC 5IVXB 1UWXK 4OGYH 4HW6A 1KGUA 4KRNA 1JGVH 4RRPM 4DN4L 4CN4A 3CZKA 1W72L 3QUHA 1PX4A 3NCMA 3UP6A 3QG6A 4PRBA 4Q74A 1MPAH 4XWOD 5CN1A 5ANME 4EE2A 4PJ8A 1A6TA 2G4EA 2ENJA 3NJFA 3I9AA 3WGUB 3I9IA 3U82B 1TLMA 3ECWA 3ESMA 2FJFA 4WEMB 4NFDA 1NIDA 1A7NL 2WOBA 5C9JB 1NCNA 5TDPA 1KBBA 5BRZA 1AZRA 4OSUL 2IWKA 4R96B 4A7UA 2BY3A 4HPHA 5HY9B 5EPMB 1Q9OB 3BHBA 3ARFC 3HW7A 3DTXA 1BVZA 3P9WB 2YD0A 5CN2A 3CFUA 4G9FA 1UQSB 3OHXB 4PD4J 4Y4FB 3EYOB 5GGVY 2NY3B 2Z31A 1PAZA 2FEJA 4EN3D 1CCZA 4GB9A 1DVTA 4CU8A 1H5BC 2TSAA 1EHNA 3APCA 1W2KT 2IAMB 4JRYD 1AXSB 4I18A 4KZEH 4F7MA 4KDTA 5C0FB 4L8CB 3LRSA 3I50H 3L9RA 4P9HC 4KITB 3VI4E 4DGYL 1BMZA 5GPRA 3CH1A 4MXQD 5DS1A 1KN2H 3WFBL 1JCKA 4DGIL 1SYSB 1BYOA 3IJSB 5IB1B 4EXKA 5HHME 4K9JA 2HUHA 4HBCH 5GRXG 1RLWA 1YEWA 3U25A 4Y4HA 1I7ZA 3QIUB 2GCYA 4TVPL 4XVSL 2WQSA 1I8LA 2CWRA 4XODA 2FSDA 4LVNC 5E6RB 4I1RA 2Q0ZX 3MGOA 4UINH 4PP2A 2WWOA 3HHSA 3VM5A 2JKXA 3FN3A 3MRPB 1KBWA 4KDVA 3D85A 3VYPA 1KYOJ 5F2FA 1M05B 1NBYA 1CICA 3UTPE 4X7FC 3F6IA 1OHZA 1AO7A 3L3OC 4APXA 3FQUA 4ZUTA 1O9WA 3ZVVA 2C9XA 3LPWA 3LXCA 1C5BH 3FZUC 4WWKD 1W72A 1NGQL 3LZQA 1LEKA 1P0SE 3GRWA 4FP8L 4P2RE 3H55A 3L7EB 2NNRA 2YXVA 2HTLD 5KYXA 5INDB 4GBXA 4WHTB 1HH6B 2DD8H 1OCCB 1N7MH 1VENA 5E1QA 4BQ6A 4NFCA 3U0WH 1CFVH 5LCVL 2X41A 1GPOL 1KWKA 3VFGH 5EF3A 3JWOC 4ZFGH 3CNKA 3DDFA 4K94H 5D2NA 4CBPA 4JZOA 1H8NA 4DAGH 5MEOB 3OR6A 2EXTA 2A4ZA 3INUL 5D7SH 3SBWA 1KXVA 1N59B 4Z95H 2ENQA 2WLJA 3SD2A 3BSZL 1JWSB 2VCOA 3MA9H 5IQ7L 3KWVA 5F9WB 3WNOA 2WMPB 3KLKA 1I7UB 1FVDB 1YN7A 2BIOA 2GAZA 4XMPH 3PL6A 5BUPA 4A2MA 1QPKA 5GS1C 1IAMA 2WY3B 4I48A 1T2XA 2OZ4H 1G9EA 4GSDL 2WZ0A 1XMEB 3M07A 1ESOA 2VE6A 4PVMA 4U0QB 5DUMH 3GI8H 3QS2A 1AVAA 5FWRA 3TYGL 4JRXD 4AQEB 3CMOL 4E0RB 4HJJL 4L8BB 5ACMA 4E9YA 5LB1A 2CR0A 3LRKA 4GOSA 1CF1A 3QCUH 2TSBA 4N2HA 2YAHA 1I1CA 4PR5A 5BS0B 2YRLA 2FL5A 3NIGF 5FGRA 2XWBB 3T8XB 1KTLB 3TC9A 2JLLA 5A16A 1BEYH 5L2KD 3B7SA 4KNSA 1UZGA 1FFPA 3ABKB 3RB5A 3H1ZA 1WT5A 4JM4L 4CDHA 5BZXA 4X4XB 2HJKA 2MNUA 3U9WA 1OAZL 3GMRA 4GRWB 2WZPD 3V5KA 2OXGA 5FLVA 2DQTL 2ZZUT 4N6RB 4P2OA 3QR1A 5I71C 3EO0A 2VJ0A 4NQXB 3VRIB 4WU7B 4AQOA 3BIKB 5DMIH 1TQUA 3KCWA 2WP3T 1YEKL 2V17H 2JELL 4U31A 1UM5L 2YA1A 2XA8L 4Y2DB 2OTUA 3FTGA 3X13B 3WV0A 4MA3B 2X53A 2KHAA 4M6MH 3FONB 2W81C 5GRVL 2K7QA 4TRPH 3ZE0F 3LV3A 2NY3C 4IKKA 4W81A 1H6EA 1U8JB 3S4SA 2P5WD 2VDPB 5AW9B 4R90H 2J8HA 5LUMA 3HG1D 3NCXA 2CMRL 1NIFA 2N0MA 2Z8SA 4XOBA 3STBA 3IU4L 3IJHA 5ISZE 3OKLA 4I1PA 1CGVA 4ZG1A 1SXCA 5D72H 5DRWA 1U3NA 4QOKB 3LJ3A 2MCPL 4FQLL 4CJ0A 3WYRA 3QUZD 5DD5L 2X05A 2OQJA 4Z6AT 5D8JH 2W92A 3WNPA 3JV6B 4HJGB 1A1OA 4BCYA 5D7LE 4MJHA 5TJWK 3HG3A 3QIUC 4B96A 5KVDH 1XD0A 2FWSA 4OZ4A 5IJCC 3AU1B 2BNQA 2RCSL 5IFAL 1ZGLP 3UBXB 3MRRB 3H3KA 3HHRB 2HN7A 5TQ0H 2DI8A 1T1WB 1S9WA 4B0MM 1NJ9B 4ONHB 3WTUA 3QWOB 4BE5A 3KYOB 4AOFA 5C6WH 1A3RH 1O0VA 4WO4C 5CEXA 2F7QA 3D39B 3BAKA 3MLZH 3BI9X 4TQHA 2BVOA 4XE0A 1FFNA 3B83A 4JFEA 1MCDA 3W81A 3C87A 3T77A 1VGKB 4JFOA 4PWKA 4QO1B 4DKEH 4RMBA 2BC4B 3F04A 1J05B 2WTRB 1S2EA 5LBGA 1BQSA 4L4JA 2NUPA 4QMEA 2FIKB 1KCUH 4F8LA 1MRDL 3DXAA 3BO8B 3SOTA 1IMHC 1XCQB 3GBMH 2BWDA 3PFUA 4N26A 1CR9L 3MV7D 2PWFA 3EJQA 1I1AD 2CO7B 3GLZA 4LNRB