4GUQA

Structure of muts139f p73 dna binding domain complexed with 20bp dna response element
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
200
Chain Sequence
EFIPSNTDYPGPHHFEVTFQQSSTAKFATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transactivation specificity is conserved among p53 family proteins and depends on a response element sequence code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*GP*AP*AP*CP*AP*TP*GP*TP*TP*C)-3')
total genus 36
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4guqA00
4MZRA 4AGMA 3KZ8A 2J6WA 4LOFA 5BUAA 3IGKA 2IOMA 4HJEA 2RMNA 5A7BA 4L18A 2VUKA 1KZYA 4IBZA 4AGOA 3EXJA 3WU1A 2J1YA 2IOIA 3D06A 5AOMA 2J1ZA 3VD0A 5KBDA 4IJTA 5LGYA 2BINA 3US0A 1LJMA 4G83A 1EAOA 2J1XA 1CMOA 2BIQA 4XR8C 3VD2A 4AGNA 5ABAA 3QYNA 4IBTA 3D08A 4LOEA 4G82A 1T4WA 1IO4C 5G4OA 3D09A 2PCXA 2MEJB 1GZHA 3VD1A 1GZHC 3D07A 3KMDA 2AC0A 3WTVA 2GEQA 5AOJA 3TS8A 3QYMA 2J20A 3D05A 4KVPA 3WTTA 1H9DA 5G4MA 3WTXA 3EXLA 1EAQA 3WTSA 2OCJA 5AOIA 2IOOA 2AHIA 2X0WA 4GUQA 2ADYA 1E50A 3WTWA 2FEJA 1HJCA 4A63A 2BIPA 3ZMEA 1UOLA 3Q01A 4IBYA 1TUPA 2X0VA 4AGQA 4IBSA 5G4NA 3Q05A 4AGLA 2WGXA 2ATAA 2XWCA 1CO1A 2X0UA 2BIMA 1HJBC 5AOLA 4L0ZA 1HU8A 2J1WA 4GUOA 5LAPA 4AGPA 2P52A 3IGLA 3Q06A 4MZIA 1YCSA 4L0YA 3D0AA 4IBVA 1EANA 2H1LM 4IBUA 5AB9A 4QO1B 5ECGA 2J21A 2BIOA 2XWRA 1TSRA 3WTYA 3US1A 4LO9A 4IBQA 5AOKA 4IBWA 2YBGA 3WTUA
chains in the Genus database with same CATH superfamily
2X7LA 2AI0L 4HIQA 2NR6C 3O3BA 3W39B 2O5ZH 5E4EC 3ZDYF 2ZCLL 4DETA 1MHEB 5EIIG 3DURA 2IPTH 3GMRB 3TPUB 2J1KA 1OGAE 2H3NA 3DX0A 4E36A 4TNVF 2VAAB 4LSQH 2G2RA 3GMQB 1GOFA 2ERJC 5FDYA 3W82A 3DOSA 2HUEA 1BBJB 3V5KB 3QSKB 4P9HL 3K6IA 4Y16B 2IWGA 1TQUA 1M6UA 2W0PA 3DPBB 4OZIE 2Q2LA 4UINL 4YO0B 4DJMA 2AQNA 3TLRA 2YGQA 5LGJA 2XTJE 2LW3A 4M1CD 4DSYA 1SVZA 1JAEA 3ARYA 4BSVA 4ZW6A 2NPLX 5J3HD 4S0HA 2OMTB 2CJUH 4B3EA 4LVNC 1JHTB 2ZWSA 4KI5E 1WFTA 5J11C 1EAJA 4ZI8A 5E5MB 2VLKB 4W4NA 1AZNA 1T5XA 2Y2TA 4XCYA 2DKMA 3QJHA 1K6QL 3KR3L 5JHBA 1GC1C 1VFMA 3BESR 5HPMA 1VFOA 2ZOWA 3A24A 5KSUA 5AEAA 1S9YB 3OAUL 1QA9B 1OB1B 1KWGA 1IRAY 1KCLA 4JN2A 3V6OE 4M8QA 1JN6B 3SPJA 1FNFA 2AJYL 3UTTE 4QHMB 1BBDH 3H0TA 3G6AA 4D0DA 3WN5C 2I5YH 1MIMH 5D4JA 4I48B 4KKRA 1F13A 2H0FA 2WWKT 1H6EA 2DJMA 4F7KA 3MRLA 1OW0A 1R24A 3K5RA 2IH1B 1WT5A 1PYWB 2BJMH 4X80H 4AJVA 1HJCA 3L7FA 2BIPA 1DFBH 3BX7C 4BZ1A 4U7MA 1TQSA 1U8PB 3CSTA 5AAMC 4NNXB 5D71H 1BREA 2GJPA 3CZEA 3HZYA 3S5LA 5BMFH 5DHMC 3RFZC 3RZCB 3IFOA 2DEYX 2PYED 2WBJB 5T3ZE 3E6FB 2Z8WC 3HB3D 4WRLA 1WFIA 1A1NB 2WWMC 4Y5VA 3SE3A 5I1LB 3CDFA 4PJ7A 1OGSA 2QPUA 1AQDA 3L3IA 4IRZA 3UTTA 4M03A 1SYVB 4ACPA 3L5XH 3NCBB 2LR4A 1CICB 3QG6A 4NLHA 2HB0A 3F6IA 4FLRA 3T3ME 1PZCA 3OKNA 1GGCH 3NSCA 4KH9A 1KEML 2GSGB 1TZGH 4YUEL 5DD5H 1G1CA 4MJIA 3KZ8A 3GIVB 4IMLB 4HFWA 3FUHA 1OF2A 4NENB 2C26A 2XPYA 5DSCA 1VZHA 5JIMA 1KB5H 3P3RA 1OSYA 5B38G 3TGXA 2IBZY 1HI6A 3CLFL 4L5FE 2QADC 3QJZA 2WC7A 2PETA 3KBHE 2YEZB 1CS6A 4OIFA 2YA1A 4P5MA 1OM3L 3IFOB 5F7KC 2EIMB 4IS6A 3KGRA 1UVQA 1K72A 2ARJB 1DL7H 1IVLA 4TUKH 1MPAL 2WLZA 5B4MC 5F6HJ 3D08A 3ZKNC 3V8OA 5KWYC 4ZODA 5E00A 1K4DA 1IQWH 3LHPL 3Q48A 3U4BH 2BP0A 4OLZH 2WYZA 3HG4A 1YJDL 1ZEAH 2QKIC 1KB9J 1QFPA 3QIUA 4OLWH 1RD6A 2CUIA 3MRLB 2ZYRA 2MHAB 2V9QA 1D6EA 1E3XA 4Y19D 7PAZA 3VSQA 1A5FH 3V4VH 3TH4T 4Q6IB 1TQCC 2HKAA 5IBUB 3SE6A 3WDHA 3MRMB 4PAZA 1I9IH 4M8QB 1GGBL 4B9JA 2Q1EA 5A6MA 5FM8A 4PWIA 2WBJC 1LO3L 4N2CA 3P4MA 4L23A 3G5VA 5E2UH 2E59A 1DJIA 2BWQA 4Z3FA 5EEZA 4LLMB 5HPMB 4HMCA 4BFEA 1NIBA 1FVCB 3JT2A 1HNFA 4M4PA 1OP5H 1IX2A 3X13B 4RZCB 1T0NA 2DLHA 2F53B 3QDJA 1I53A 1QPXA 1SLUA 4A7SA 1MN4A 2OMWB 5IHHA 1A22B 5SWSD 1MFAH 4JHBA 2VR4A 1A3QA 1QD0A 4FQLH 1LEKA 2F1BA 4Q9RH 2NCMA 4HSAC 4TSAH 5I15H 3TVMB 3WNMA 1WZAA 2VDQH 2CR6A 2B5IB 4HU8A 2J4WH 2ARJQ 1KN2H 4WO4D 5FO7A 4XAWL 1EEUA 1B0GB 2FLBT 4XBGA 5IJDC 5DHDA 4OKVB 4F9PA 3VFPB 3GKWH 5EEYA 1TO5A 1J9SA 3GMNB 5K69A 3F05A 1IARB 2JK5A 3OMZA 5FO8B 4Y5XA 1UUSA 5BQ7A 2I9TB 4QRRA 5IG7A 3VFNA 3U4KA 5DQDL 1YAIA 1YYMH 3ILPB 1E9QA 5ABZA 3NJKA 4BH8A 3FT2A 2GBVA 3E9TA 2B39A 2XWTA 3FUMA 3L4UA 4IOSA 2H32H 1ZAGA 2AZAA 2XZCL 3FT3A 3TN0D 1DQKA 2CD0A 1UWGL 2ZYHA 3EJTA 5DC9B 1SHMA 5JDSB 1ZY9A 2M1KA 2DYSB 4E9XA 5C07B 3HC0A 3ASNB 2Z31C 1BQUA 1HYSC 1FA4A 2M26A 3OLIA 5GGRB 4ZOAA 2E9GA 2FZ3A 1MAKA 3KW7A 4J8QA 4NNYB 4ONGH 4G6JL 1G7QA 4PRHD 1OLLA 2ADFL 4YOKA 1HNYA 1R47A 4L1SA 3LVEA 4V1DB 4Q14A 5K93A 2A6IB 3D8MA 1B2WH 2FGWH 1I9EA 5I75B 4DO4A 4G42B 1KG0A 4NRYA 5DVLA 3OHXB 1UGKA 3T0AA 2X4UB 2Q86B 3I50L 4PJEF 2H6OA 4J3OG 3CVBA 1NEPA 2EZ0C 4XOAA 2GEQA 4KHTH 1IAMA 3GLDA 3PCYA 5K1VA 5BJTA 3FH8A 3W9DB 4Q52A 4MKTA 2VMEA 2FATL 4PGCB 2FO4B 4LCWD 5IM7A 1ZCRA 2BMKB 2WXJA 3IDNB 3FT0A 2X1PA 2MFNA 3HNTL 4GT0A 4FMFA 3GLEA 2WO3B 4Y9CA 5T5NF 2H41A 3WOVA 1E4HA 3UROR 3WTSA 2O72A 4GI8A 2Q76A 3N43B 4OM0L 1AO7A 3QIWC 4YHOH 3SYOA 4LLWA 1BZDA 1WBXA 3HPLB 4JM2F 2VIRA 2E7BA 4AEHH 2PPFA 4IBYA 3S35H 1QW8A 1TPXC 3UACA 3FSZA 5DR5H 4ZQKB 1COBA 4PWEA 4QRPE 5IVNA 3I3BA 2PWGA 1JL8A 4CMHB 1XGQB 4G1EA 4KH2A 1R4XA 4I2XB 3ZZLA 1MHPH 5HHOE 3S2CA 4X7SL 3VA2C 2BZ7A 5E1HB 1SYSA 5SWSE 2KQMA 3OR6A 4P0DA 4AIZB 1P2CA 1AZUA 4OF7A 5EEXA 2CO7A 1TYEB 2QGDA 3I75A 3CXHK 4Y2NA 3L45A 2ZNWA 4POYA 2HFGH 4R3SB 4MMXC 4WCYH 1P5UA 2BERA 1HAUA 1MG3C 2YC1A 3MBEA 3MRNB 1BPVA 5FO9B 1TSHA 5DRNB 5F97E 1J1PL 4UTBH 3VWJC 4TOYL 5EU3A 2XFXA 2I07A 3KPPA 4X7FC 3SDYL 1TEYA 2ZAGA 3A6BH 1KJ2A 3D4YA 3SDDC 2IPUG 5DRZB 1JD9A 1SOXA 2JI1A 1TEFA 1DVXA 4Q6YA 4G9FD 4NQCD 1QTPA 1U8KA 1VB9A 1YMMB 2GHWB 2W07A 4FTVB 4OCXH 5ECJE 4I3SL 2CO1A 3MV01 2FCBA 2EDHA 5HJGA 2A6JB 3BKCL 3JUZA 4LHQB 2IG2H 4PRIB 1F1GA 1NSNH 4DEWA 3CZLA 1FGVH 3AREB 3FPYA 4GIAA 4EPSA 1MIEH 5D70L 1CMOA 2K78A 4JQIH 5H35B 3M86A 4MS8C 3ZQWA 4AK1A 3NCWA 1I8LA 3UGXA 1NCWH 3W9EA 1OV8A 4PJ8C 1I1FA 2CMRL 2JI2A 4X6CB 4JO8A 1RIUL 3EGDB 3FO1B 3QUYC 3DSNA 1W72A 5E23A 3ME0A 4A04A 5D4IA 3T3PF 3WKPA 3ULUC 1HSAB 4I18A 5F7EL 2BNUA 3SBWA 3OJDB 4OF5A 3HC2A 1RZGA 2OW7A 5G5DA 1SQ2N 5JXEA 1QO3B 1YEIH 3AXIA 1NBYB 4HUXB 3VXPB 3QIBB 2YKLL 2XN1A 1X5MA 3FQNB 4ZPTA 1FAIL 4OZGB 3LNEA 1F45A 1JK8A 3BEVA 2XPGB 1WA2X 5GS0C 1WIOA 1DCEA 4JPKH 4XPAL 2WBKA 1YAZA 2QJDA 4K3GA 4O9HH 2G75B 4X9IA 5AW8B 1HWWA 2JVUA 3DX1A 4JK0D 1WG3A 1YYLH 3ZDYB 2ADYA 3L17A 2OMXB 3LCYA 2V5SA 4IMKA 4UNIA 2W1NA 3EYQC 3NSYA 3NK4A 4X8XA 4N2FA 1NFDE 4LSTL 4OW6A 1YPZA 5FHBL 1WFUA 1GZPA 2XI9A 4W9IC 2VWEE 1G9MC 3P30H 5GPRA 1V27A 4N90E 2O5YH 3BAKA 1UOWA 2ADGB 2UVFA 3B9KC 5DJAA 5H37A 1KN4H 2GJ6A 5AVZB 1P9MC 4WW1B 2NSXA 4MZIA 1NKOA 2R4RH 3DO4A 4XB7A 3ARSA 3VFVB 1OGTB 3FRPA 3GIZH 3OLEA 4YFLF 1O9WA 3AG3B 4W9CC 4BH7A 1X3DA 2Q7YA 4MHHG 3ZTJG 2A4CA 4QTIH 3BRGC 2FIKA 5AVYB 1JYNA 4KQ3L 1LMIA 2XWJA 3V0WL 1UH4A 1GHFH 3IJ7A 4QTHB 4GEIA 3LS4L 4QF1B 4NYLA 4PSPA 5DHYA 3Q8EA 3QXUA 2H32A 1E6JL 2VDNH 1U8QA 4MCZA 1CFNA 1CO1A 5LDUA 1RZFL 2VITA 2DBJA 2J44A 3MJ9H 3WLWC 5DK0A 1JZ5A 3S8WA 3C60D 2AQPA 1OP3H 1J05A 1CI3M 4IJ3C 2BWDA 4N20A 2FH6A 1TQWA 4RWHA 2GIXA 1HDMB 3K2KA 4QWWD 1JFHA 4XMVA 5FW8A 2VDOH 3ZO0A 3W56A 1QI4A 2J5LC 1S9KC 3QCTH 4ILDA 4N2LA 3GBML 4R90H 4LMQE 3VX1A 5FB8B 5EA0H 1T5WA 4AQ8A 1ZLVH 5DD3L 3TJPA 1FL6A 5CP7B 4FDWA 5GSVA 2VAJA 1T1XA 2IQ9L 4BWWA 5CLWA 4P5TB 5KVFH 1W8NA 4PJEE 5IB3B 2HKFL 3IVKB 1C7SA 4KRPC 4PVNA 2J8HA 2L7QA 2KMWA 3UERA 3EO9L 4ANKA 3HAEB 4FI6A 4BE6A 1LEGB 4UOZA 4ZW7A 1A7RL 5GRVL 4KTDL 3KD4A 4YQXL 3QDMD 3DX2A 5C7XL 2BVOA 1G7HB 2VLLB 3HMXH 1XGTA 1T1ZA 3BKJH 9PCYA 1W8OA 4LPUA 4ZUUB 3WTTA 1PD6A 2AXFA 4V2BA 4FQCH 4P23D 5B21A 2QT6A 4NPJA 2DQDL 4HUVA 1EJOH 3VD5A 1CF8H 2H2SC 1ACZA 3LRSB 1XCQA 2KZKA 2MKWA 2QSTA 4U1KB 2EVGA 1D5XB 2CHDA 4U6XA 5T8IA 1FJ1B 1P7QD 2FAUA 3C5ZA 3PJSA 3MNZA 4S1DC 3ZU8A 2GITB 2E75C 4M6AA 3T4AC 3C6SB 1P6WA 3OMAB 2WGXA 4QRSA 3GINA 1DO6A 5DJ8A 5CBEB 2P5EA 1FQ9C 4X4KA 1WA1X 5IQ9A 3RUGA 5IR1B 4B27A 2R56L 3HN5A 1CTMA 1IGIL 2DQGH 3T2LA 2COVD 1KGWA 1HH6B 4PWGA 1OSZA 3F62A 3U36B 1QSEA 4AW4A 1SBSH 3CCHA 2J8UE 2P8PA 4N4YB 1OSZB 1JPSL 1KF9B 3BDYL 3L4XA 4XMXA 4XOBA 3PHOA 2VXSH 2E6PA 4X7CC 1CBVH 3ARED 3L5JA 5IJBC 5CJBA 1AE6H 4TNWK 1E9PB 4N1HB 2CWRA 1M71B 2BIOA 1MY5A 1ZVSB 4PGEB 1RZ7H 4BFRA 5MEQB 4XN8A 1QATA 2AJZB 4APXA 3HUJB 2XTLA 2CO3A 3MREB 1VZGA 4NQCB 3AQXA 1MFVA 3OV6A 4BA0A 2P7TB 4MJHA 3SHSA 4OCLC 3PQYA 1P9MA 2ZXAA 3NIDB 3EGXB 5A7BA 4FQQB 4G8FB 5FA3A 4HWEL 4JG5A 4LKCA 4QXTB 2Y36H 3L2NA 4PJAE 4XE0A 4LZKA 4LF3B 1NCTA 2FB4H 1ZK5A 4H8WL 1FVEA 2J6EH 4B5ZA 5KVGH 4J3OC 1TXKA 5CCGE 3RZWA 1SRDA 3HHRB 4YZFF 5H4ZA 2YUVA 3Q1SL 1G7LA 4QWWC 4X7DC 5KYNA 2YWYA 1CZ8L 2W8CA 5EO9A 2JSFA 2Z7UA 2YLKA 3BWSA 1I4FB 2Y7SA 2YPLA 5DMIH 4XAKE 4X0NA 1UC6A 4JRXE 4Z78B 1MH5A 3TA3C 4YHZH 5ESVB 4NHUB 4OIAA 3UFIA 3VXSB 1Y18A 1E27A 4AKPA 1KFGA 4YDZA 5CP3H 2BCMA 3OKDB 3SSGA 4HK3N 1P84J 3GT6A 4XBEL 5JZ7D 1QBML 4ZAKA 5DK0B 2AQTA 4UOW1 4GAYB 4I18C 2RCSL 1JHKL 1U8IA 1CFNB 1CCZA 3BHBB 1TO4A 5IB5B 4AC4A 2P47B 1QUNA 1W80A 5IJKA 5DYOA 2J55A 1RPUA 4K3EL 1WWBX 1NWPA 4NQSB 3MNWA 2ENPA 3ZMEA 3FXIC 4ABWA 3B3IB 1NEUA 1KJ2L 2ZX7A 4N5UA 4YFDB 1B4RA 2Q7YB 1BYNA 2VLME 1P4BL 2CXGA 1ZJAA 3KBEA 3C6EA 2A73B 2C1PA 3FS9A 3W0WE 4CKVX 3LH2H 4Q9QH 3CSYB 3SCMB 5IFAL 1F41A 1S5HB 1OP5K 1Q9WA 3TBYB 1YN6A 4QRFA 2ZKHH 1BG1A 3AAZB 1DJSA 1AGCB 2GJ6B 4LCUA 4U4IA 5CCKL 1IGJB 5HI5C 4QHNB 4PJEA 4X8CA 4PRHB 3GXTA 3KEHA 2DWDA 4Y4KA 3U4AA 3KW8A 3CG8A 4LSSH 4L8CA 2YD9A 5C0BB 1DQML 3FF7A 4JY4B 4DCQB 3S3CB 3S7GA 2WTPA 4XO3A 1S7TA 2I27N 5C07D 4WEBH 5F88B 4FG0A 4GMTH 4UV7L 4X80L 5I0XA 3US1A 4F2FA 1JPTH 1DFBL 2NSMA 4UDTB 3ZMNA 1P5UC 1F97A 3ARGB 4ISVB 1YHPA 1Q9WB 3TBYA 2Z31B 2VSKB 3ZT5A 2EIBA 2NNFA 5A2BA 3JTSB 1RUML 4G6FD 4A7UA 2WCSA 2C9XA 3A21A 3NQKA 4U6VH 1HE8A 1MJJA 4WK4B 3NIDF 3QDAA 2DQMA 1Q9LA 2JQZA 3QUYD 4U1IA 4AGOA 4G6KL 3T2PA 5KSAB 1AH1A 2ESVD 2ZZUT 2VW4A 4K07A 5G5DB 3L3KA 4NSKB 4BCYA 2Q8BL 3FTXA 2B0SH 1HT6A 3N41B 3DKHA 4J8RB 2K6YA 4Z7NF 4OFYD 4A7VA 3KLKA 1DQLH 1QYGH 2DLFL 2JKRM 3B7SA 1KIQA 5DHVA 4GLRH 4HKBA 3CDGA 3HS0C 3DHMA 3OM3B 1T7XA 3ORJA 3QIWA 5B8CB 2ZUWA 3PHQA 1KIUA 3NRPA 1YY9D 2HTLC 3K4DA 5PCYA 1U3NA 4KJYB 4KGLA 4PJGA 2FEDC 3GSRA 3T0BA 3QUHA 2CJ3A 3WUWA 3VXSA 5LNEA 4NHUA 4LU5L 3FFCE 1A6AB 4PY7B 5EN2B 2F53D 5I74C 4QJ3B 4MJ6B 1WYJA 1EUUA 4LLVA 1MVYA 5ALBH 1AXTL 4WHCA 1KCSL 4UCFA 2WZPD 4WW2B 1F4YH 3FPXA 3L5IA 3NZHL 1XIWA 4FTVA 1YC8A 3HI1A 1GIGL 1BJ1H 4P3DB 1A7QH 1WBYA 4TUKL 3T8XB 4JJ5A 4CADB 2FX8H 3F7RA 1GKEA 3O3EA 1QABA 2VZ3A 4L5FL 5BO1L 2P24B 1IQWL 2E0PA 1DBKH 4M3HA 4K94C 2DH3A 4AMKL 1YY8B 2VRKA 5AWNL 1FZMA 2R51A 4RDQF 5HDQH 1N64L 1O7SA 3T71A 5SV3A 3WS6C 2G0KA 4JY6B 3EGXA 3DTXA 1CD1B 4JANB 3ARGC 1CFQB 2WINA 3GJEB 2CO7B 3P9LB 4M9PA 1BM7A 2F1AA 4KRNA 1FNAA 2J1WA 2X41A 4TS6A 2C3VB 2ZP0T 1RK1B 1DEEB 1BZQK 1AIFA 2K7QA 2R2HA 3FFCD 1HHHA 3A0OA 5DK3A 3EJPA 4JJOA 3M6DA 3VM5A 1GOGA 4TUOA 4WSKA 1L0PA 2VDML 4DQAA 3RRQA 4LEXL 3G04B 5C09A 3H6AA 4JFFA 2CH8A 3GMLA 5D1XA 3JZYA 3MODL 2BLFA 3ZJAA 1IT9H 2APWA 5TFSH 3UIYA 4KI5F 4MD4A 3UJJL 3MCKA 2AXWA 1JDCA 1B0RA 2ILLA 5E8NB 5B8CC 3F8UB 1A4KB 4FQLL 3ARFA 4YIQB 4KTYA 7CGTA 3CH1B 3U7AA 4Z7VA 5GIRA 1FG2A 2WZPA 3IDNA 4BUHA 4RRPG 3C6SA 2EACA 2ZKXA 3UPRA 2J73A 3A6OA 1CICD 4EOWL 1KBBA 1TTFA 2QVKA 3PJSB 1PSKL 3C5ZB 2R69L 3BLBA 5EBMA 2NZ1A 5KBKA 3L95B 4U1GB 4BZ1L 2FR4A 5HY9A 4HLZH 4YSOA 2QVTA 3VFUA 2JTDA 4O2FB 4WW2C 35C8H 1XAUA 4CMMA 1CVRA 2QPDB 5D1ZI 1RPQA 2AS5M 3OHXA 1IE4A 5E95B 3LQAL 2HRHA 4QIRA 4ZUUA 4PJXA 1LDSA 1OF0A 5CCHE 4AQ1B 2BCKA 2BNRE 1G7HA 2VLLA 2MNUA 4PJ7F 2YOCA 1JVLA 3GM8A 4TNWF 3ENEA 2ICWI 3RX5A 4ELMB 2D4FA 3FFCA 1YNLL 4MMYB 1LEGA 3KVPA 4KKPA 5KSBA 3H9SD 4WTZA 4N2BA 4PJDA 3S3PA 4GINA 4WUKH 1Z9PA 1EERB 4P2CG 1J11A 5FDWB 1V7MH 5IKCB 5F3BB 2GYSA 1JUFA 2WMPB 3E3QE 5G4MA 4OGQC 1LO0H 5IIEA 1OGAA 4G6JH 1YPZE 5FB8A 1YQ2A 4XO4A 5FGRA 2YQGA 5C92A 3GHBH 3K91A 1H6TA 5IV2A 5L7XL 2CNYA 3VRIA 4KZDH 4FXGB 1L0XA 2FGWL 2PMZA 4K0OA 2PN5A 4LDOB 4TVSa 1YEKH 5F7YC 2H8PA 3VDBA 2XWCA 4APQC 5I5MA 1NANH 3PWNA 5B1BB 5I1EL 3RGBA 4KHTL 3OLDA 4HIHA 4EI0A 1AZRA 3HS8A 1KJMB 1X9RA 3B2VL 1R17A 5JYLA 3CVCA 1ED3B 4AXWA 3T1FB 2I9LB 4MQTB 2DAVA 4P2OA 5J6HB 1VAHA 2H1LM 4JKNA 2ZP9A 4CNIB 4KXAA 2E76C 1GW6A 3GZKA 4LDLB 3V4PL 4HIIA 4N90D 5D7JB 4RZCA 3QXAB 1QLEL 4N68A 4Y5VC 1BEYL 5J1AB 2CKBA 4FJ6A 4CGUB 4JG1H 1SXZA 4FXKC 2B59B 1MHPL 4IRZH 5DS8A 3JZ7A 3X11B 5FV1L 3Q9PA 1UXWA 4Z7UA 3AB0B 1XGUA 2OX5A 2VDNB 2RGSA 4HC1A 1C1EH 4XTRD 5B4MD 5GGVH 3CD4A 1JTTA 4OZ4B 5I9QB 3L4TA 4GAGL 3SGDI 2DPKA 2WLNA 2X53A 3TBSB 3L9RA 3TYGL 1FORL 3MRKA 4NPYB 4LBAA 5A2KH 5HI5D 1B90A 3B7UX 4JFZH 3BW9A 4UILH 3SO3B 4DKEH 3AS2A 1NC4D 2ICWB 4ZXBD 3LS5L 2QADD 4CILA 1LTXA 3CFCL 4P2YA 4TNEA 3IN0A 2ICCA 1AXIB 1FFOB 2VCOA 2GUYA 1OT2A 3EFDL 4BKTC 1NBYA 1SEQH 4RGND 4L05A 4GW4A 1TYRA 1EWHA 2UXFA 4AYFA 4KTEL 3QUGA 3PNRB 4G8EA 3WAJA 3TWCL 3GSNH 4CU8A 4OF0A 3TH3T 5I1JL 1I85C 2JJSA 1I1FB 2XVKA 1E90A 3G5XA 2AJSH 4WUUA 3LRKA 2ISDA 2GTWA 1G0YR 4JQIL 4GAJL 1HIMH 1OF2B 3JWDL 1QEWB 3CK0H 3LZNA 3P3TA 3VXUA 1U8HA 1PAZA 3A67H 4PRAB 1SY6L 4XNUL 4HXAH 4HFUL 2BSDA 2CMRH 4YL9A 3QZOA 1A6ZB 4YPJA 1NCGA 1E50A 3BVNA 2E8ZA 3FOLA 4MTMA 2PCPB 3ZTCC 1LXMA 2CK0L 5ICYB 1QVOB 1LP9F 2PF6A 1FYTD 3EZJB 4JFDA 2Z92A 2YBRA 1AQDB 1DJGA 1EHKB 1EBAA 4PRNA 5D93C 1MXGA 4AT6B 3DVFA 3BAXA 3GI9H 4OLYH 2UZXB 3NUKA 3D0LA 1IM9D 2Y72A 2QELA 1B0WA 3IJYB 1G6RL 2UWEA 2DM3A 4PWHA 2I07B 3KPPB 4ZO6A 2PXYD 3ALWA 4ONFH 1RUKH 3LIZL 1WZMA 3PJLA 4NAQA 2QMKA 5D9SB 5FO9A 5HGAA 2A6KA 1XR8A 4A55A 3EDDA 4TTDD 5JPMB 1CD9B 2EDEA 4U2YA 2KUTA 4LAJH 3VFWA 5FHBH 4P5TD 5HJDA 4C58B 1HQ4A 3MKKA 1FFQA 2BNRA 1D2PA 5T1JA 1MI5A 3IGKA 3D39E 4RCAA 4HLJA 1BF5A 2GCYA 1O6SA 4JVUA 4TPRH 5C6TL 4AKOA 3UBXG 1RLWA 1MREH 3T9WA 5JMOC 2J1ZA 4NQED 2KPNA 1ND0A 1YEGL 4JZJB 5D8JL 3UPAA 1NGXB 4X6DB 3SGEH 2QQNL 1Z5LA 2YXVA 4DN3L 3C60B 4GG8A 3OD3A 5FCSH 3TZVD 4PW9A 5KN5B 5IMKA 4QTIL 1DVFB 5E5MA 5JO5B 4ZTOH 1EHLL 3ABMB 4I8DA 5JHDE 2YXWA 1Y6KR 4KDWA 3F7QA 1LNUB 2GK0A 2EDNA 1RQ5A 5IMLB 4UYQA 1JG9A 3GLAA 3VGBA 2P80D 2APXA 4KI5D 1LE9B 2QV2A 2IBZX 2CK2A 3CFKA 3UXFA 1KEGL 1EMTH 2CIKB 1CXLA 5KBNC 1IKFH 3CMOL 4NJ9H 1QFUL 1X4ZA 5DD0H 3LX9A 1NMAH 4U1NA 5D1XE 4YDLB 4K94H 4KNQA 5EIQA 5KAQF 2VZTA 1MOEA 2DQFA 3Q5OA 4H44C 5DFWH 3NIGE 1OAUH 1S7RB 4JGJA 3NEXA 4N25A 5CEZH 1WCBA 3NA9L 4KX8A 2WP3T 5M7QA 1KJVA 4CW1A 2A6IA 4L48A 1T7WA 2P9RA 5EPMA 2ATPB 3PDDA 1MW3A 3QUMA 2AHIA 4ODXB 2ZKMX 4JRXD 4NNYA 3DECA 3BN9C 4QGTA 2BNRD 1IAOA 3KPQB 1DDHB 3BVXA 1U6AL 3LOWA 4ZOBA 4A63A 5MENA 4L4VE 4YJZL 2HLEB 3QW9A 4L2YA 4YL4A 2O4EA 5BV7C 1CFSB 1NIAA 3H55A 3MRFA 1Q90A 4XPBH 4JAMA 4BZ2A 4L3CB 4MB5A 4NZ8A 4BDVB 1JBJA 4KRPD 4RGMB 4YQXH 4KK8C 2O61A 3UC2A 3SBPA 5ISZE 3GBNH 3EBHA 1BLIA 3IF1A 4R5XA 2VN3A 2YD5A 3MV8E 1QP1A 4JNXA 4ZO7A 1NWOA 1S8DA 3F6JA 4IMKC 4BH8B 2ZWYA 3FSAA 1FFNB 3JV4A 4HISA 3NT0A 4FQCL 3CHOA 1TZIA 2DWSA 2DTML 4L37B 3C9NB 1D6VL 5GGVY 2WZ6A 4Y1SA 2AMGA 2APVA 2OMNA 3O6FB 4XVSL 4Y4FD 4Y5XB 1TU2A 5INCA 3ZXAC 4N9OB 5I1IH 1KYAA 2P80A 2YR3A 3C60C 4PH8A 2E7LC 2X5PA 2NY6B 3K8LA 2AI0H 3NIFE 4K5MA 2AK4E 2N0KA 1WFJA 3QUKB 4NO2A 5L2KB 4YHPA 1KBWA 2CIKA 4MWFB 4XCNB 2A0LD 4B60A 1KIPA 3IMRA 4L9LB 1RHHB 3TJHD 5KSAC 5E1QA 1F8TL 1WCQA 2JMRA 1AP2A 2VZ1A 4AENB 1RJZA 4E9TA 2IDTA 4F24A 1BAGA 4HS3B 1JGLL 4N0UE 3PNWA 4CGTA 2J1YA 3CHXA 2CO6A 1JPSH 1LYQA 3BDYH 1G7IB 5CSBA 1KXVC 1MJ7L 4FHKA 4BCXA 5CR1A 2IANA 1Z5HA 2P45B 4X6DF 1ES0A 4I87A 4U1MA 1PU0A 4C59B 1TCMA 1LO4H 1T89A 1I3GH 4RBPK 4X99A 3TVMC 3ZE0E 3W5NA 3WKNA 5ITFA 4N2MA 5IVXA 1K8IB 1GSMA 2GJJA 3IDIB 3ULUF 3HZMA 2VE6B 3KPSA 2YGOA 4MA1B 4BZYA 4Q6IA 3MRQB 4RFEB 3OAUH 5C6WH 8FABB 3CSFA 4I0PD 5DC4B 4WHYG 5T5FH 4HWEH 1MCPH 3DVIA 2ZF8A 3ELQA 4KFZC 1BBDL 1YMHA 2PTUA 2WVVB 2XSKA 2NY1C 2B7DT 4HS8L 4RGMC 3C5JA 2I5YL 1AD9A 3HE7C 3BZEB 3SDDA 3FB6A 1NH6A 1QFWL 4ODBD 1M53A 1NDGA 3A22A 5J6GA 2PWHA 3APDA 5D9SA 1W72H 3PDOA 1T83A 4UQAA 1HXYB 4YBQD 2JKWA 5I2IA 1QZNA 4JPQA 5CINH 2WM0A 4EXKA 4M5YH 4POZC 4HP5A 2DQJH 4XN4A 1Y1DA 2H6PA 2F5BH 3HUJE 3FQWA 4PJ5A 1CZ8H 3PAYA 3CXFA 3LXAA 4X6EB 3X3GH 3LHAA 4X4ZA 3FQRA 1HI6B 1KXQA 1M6OA 3PRZA 1KXVA 2BY2A 2XHNA 4K3HA 4ZUSA 5CJOL 3NH7H 1ZLDA 1AXSB 4QAMB 3O11A 3BVNB 1U8LA 4HJTA 2Z9TA 3CFBA 1CGXA 3OHXC 2X9ZA 4LCWB 3FNKA 2P8MA 3ATAA 1U93B 4YFLI 4GKSB 4QRTA 3RE0A 5J8OA 2ZOTA 4EI5A 3BRDA 1VLXA 4RMWA 4KOCA 3ZE2E 3D39A 3ECBB 3GQFA 1B9ZA 2IAMD 1UASA 1CTNA 1OCZB 4MXWH 2XPZA 4KX9A 5GZND 5D7KE 4AVHA 4PBVC 3INUL 4ZNEA 2FRGP 5T1DH 3QWRD 4DUWA 1XGZA 3HZYB 3KWTA 2VXVH 1VFUA 3LRLA 3ARFC 3SDDD 5AD0A 4IU3A 5IFAH 2X6MA 2E3VA 4V1DD 4B41A 1QRNA 3K7UA 3PABB 3OG6B 4FFYA 2EH8L 1EHAA 2XY1A 1XDTT 4N0FA 3V4LA 3L7FB 4U4BA 2HKHL 1NGQH 4LCWA 1YMHB 4JREB 3B8SA 5B7EA 4LLQB 1R24B 2GKIA 5F70A 3US0A 4TL5A 1IGFL 4W6WB 5JHAA 3VRLE 3Q7JA 3RDTA 1TR7A 3S34H 4JQIA 3BP6A 2WSPA 3SDAC 3LNGA 1E30A 2WO4A 4D9QD 1T0MA 2DWYA 2XG4A 3V4PB 1BVKA 3F83A 4WGWB 4TUJA 1O7DE 4X6EA 1RERA 5CU5A 2VDPB 1RUMH 1OAYL 1T2QL 5T3XD 3W0WB 5BOJA 1SBBA 1A3ZA 4U6VL 5J1AA 3QZWA 3AUVA 1NCJA 1MWOA 5FGCB 5BZWA 1QBLH 1OPGL 2NW3B 2RAMA 2C7FA 1HL9A 2XDHA 3CU7A 4TRPH 4BKLA 5IGXL 3QYMA 4HIIB 5F7UA 1UM5H 3L3GA 3WYRA 4KDTA 3WFHA 3SDDB 1CUOA 5AUMB 4EVNA 3T09A 1N19A 2Y5QA 3LPOA 4HYTB 4LPVA 4HOWA 4HKJA 4FKKA 2G3NA 2OAAA 2Q5BA 4N1EA 2Q8BH 3DGGA 1CI5A 1JZFA 2OMVB 2R1WA 4YO0A 1OM9A 1OO2A 2ZG1A 1IFRA 3UBXB 2OTPA 3AZUA 4Y88A 2KZBA 1S9XA 2VTFA 2W9EH 4A7TA 5IEKB 1QSFA 4F58H 3QULB 3IDIA 4EDXA 2WXPA 3CXHJ 3NGBB 3OX8A 2VDQL 1WICA 1KGCE 3ZKQD 4LU5H 1KN2L 4G70B 4Q8BA 5IVXB 1DZBA 3C9NA 4MAZA 4Z9KB 3T08A 1T80A 3A6CH 1I3VA 1CFTB 1PX3A 3TIDB 3DSFL 5D7LE 1NC2B 3TCLA 1VPOL 1EJFA 5SWZA 4R6UA 5CHNB 5ALBL 1OAXL 4KDTC 1TCRB 1VADA 5JA9A 2XWBB 1NFIB 1IKNA 3E8UL 4FP8H 5E2JA 2O61B 4HD9A 3PE9A 4HGKC 2GT9B 3UC0L 5CSGA 3TTSA 1SY6A 5EEUA 1GJWA 4D9LH 3BIKB 4M02A 2GB2A 2WTRB 1L9PA 2WLIB 3D25A 3K4AA 2ZYSA 3NIFF 4HZ1A 3RU8L 3ATFA 3LMJH 3AB0C 4EUPA 2R23B 3VD9A 2QEJA 1AS7A 3ARDB 4L4JA 1CLVA 5CP3A 2CM5A 4XNMA 4BA8A 2JQAA 3L16A 1JJUA 3ZZ1A 5I73B 4HJGA 2QKIA 5E5UB 4ONGL 4AYMC 3FQ4A 1N12A 2ADFH 5DJ0B 1BVNP 3EDFA 3SY0B 3DV4B 2ZQKA 1HWGB 5DMGC 3NJGA 3H2PA 2A9CA 3G08A 3L95A 4EZLA 5TK4A 5JIIA 1LP9A 5EF0A 3GSVA 3MLVL 5DUBB 1E42A 1JSYA 2F0CA 4U1HB 4BZ2H 3MLZL 3S5ZA 3RVUC 4I3RL 3FZUD 3MU3A 3OKOA 5KANI 1LO2H 4S1RH 1ANUA 1MRCH 3S3DB 3QJOA 1R5IB 4XMLH 3STZA 2UZYA 5CR8A 2VDMB 3AVEA 4UQCA 3KS0J 2FATH 1E28B 4JZJA 1NAML 2WUCL 3KH3A 4QKXB 1F58L 1MXDA 3QJVB 1I1YB 3HNTH 3O81A 5FLUA 2AK4D 5F9WB 1JZEA 1EVUA 2HJFA 4OB5L 3J7HA 2ZG3A 2GCYB 3IN2A 3SE4A 5FOBA 2FTAA 1KTLB 2WBJD 1MI5B 2JCCE 3TBCA 3OPZL 1IVTA 4N6RB 3HNVH 3IKKA 5CGMA 1OE2A 3R1GH 3FQUB 3PGCB 5KYYA 4ZMWA 1QSZA 1DUZA 5GHWL 3AFLA 1NPJA 2J12B 4ALAH 5JIPA 4K23H 4X42A 4D8OA 4D3CL 1OY3B 3BH8A 3ZIYA 5EFIA 3LQAC 4JO2H 5JO5A 3GSOA 3BT2L 4B9IA 3M17B 4N8VG 4OIBA 4B9PA 3QEHB 1HJBC 1V8HA 3O6ML 4C4BA 3QEUB 2G9HB 4OIIL 4N86A 4E5XA 4J6RH 1V7ML 5I71C 3D18A 1BOYA 1LDPL 2WHVA 1YECL 4Z7UF 1MLCB 4AQOA 4YHYB 3IJHB 1ORQA 1A14H 5T3XH 1NQBA 3HI1B 1WAPA 1DBAL 1JF6A 1QVOA 4JFDB 4NAJA 3A6BL 4QHUB 4G8IA 4HA1A 4PG9A 1IC5L 4KQ4H 4N2GA 4NKDA 1U91A 4OCMC 4WQOA 5DRWB 5IHUL 2BNRB 4OU3A 3ZTNL 1PNDA 1EAPB 2B1OA 4PJFF 2F58H 4P2OC 4P4RB 3TO4A 2NZIA 4OD3H 4OJDH 3H9SE 4L29A 4X5WA 5EZLB 5HVHB 3FUIA 4AKQA 4WI9A 3KXFA 4JZJC 2GTWB 1C5BL 5AG9A 1XR8B 2VM4A 3G5XB 4WUUB 1ZSHA 5GISL 2NLJA 4CC0A 1U95A 4G3YH 1QQDB 2XVLA 4G7YH 4WI5A 1MIEL 3FTWA 3EOBB 2OI9C 2QHLA 3AT0A 3FB8A 3GI8L 4G8EB 1T7YA 5J9PA 5I8OL 3UTSD 2EYSA 3O8XC 3ILQD 4GW4B 4IGBD 5EWIH 4AT6A 4WI6A 1T03H 2WQWA 4J4PD 3HUJF 5KSAA 1AG0A 4B0MB 1IBZA 2D7OA 4WI0A 5ICYA 3HG1E 3Q13A 4N0YH 2VLJE 3FQYA 4OGYL 4OBRA 5DDHB 3TPKA 1HH9B 2LOEA 2VZSA 1DVFD 5AVQB 5EIIA 3FOLB 5IFJB 3VSVA 5AVTB 3MR9A 2CALA 4Y1AA 3OBAA 5J0BA 2Z7ZA 5I76A 4R7LA 3C09C 5E6YA 6FABL 4FABH 3EYVB 2P5ED 4A66A 1P1ZB 2CDFB 1QUPA 2EP6A 4IRZL 5G55A 3CZJA 2H6UA 1ZGLB 3ELAT 1NCUA 2VDPH 5I0WA 4I5BB 3N6YA 4M7LL 2WXOA 4E41B 2P5WE 2B1AH 4JPKL 4XPAH 4KMLB 2Y1VA 1C1EL 4GFXA 4Y4HD 1MFDH 3I2CH 4LP5A 5GGVL 3I6GB 1CU4L 5GRJL 2ORBH 4ODTL 4FFWC 5DD6A 1A9EA 5T1KB 8PAZA 4GQ9H 2EICA 2CGZA 2Q2EB 4R4ND 3BVWA 1IGJA 4N0RA 4IOFD 2JCCA 1EX0A 4NEHB 3LS5H 4JKWA 3D85B 3NTCL 1NCOA 3MBXH 4KKNA 5E8DH 4AGQA 4JG0H 3IE4A 4HWUA 4XP4L 3B9DA 1VKXA 4P2OB 4AXWB 3FCTB 1CG9A 2R4RL 5EUOE 1PJWA 3ZVVA 3O6FC 4OZ4A 1Q94A 1RIVH 1SJMA 3CAFA 4M56A 5I1JH 4OR1A 3RWIB 4K8RL 5D4HA 3MUZ1 1ZE3H 3ZOAA 3FYIB 2OX5B 1QUNB 3R0NA 5DJ2B 3QXWA 1FYTB 3HR5A 1UXWB 1H0DA 3AT9A 4GAJH 1AKJB 1BD2A 2QR0A 4GQPH 4Z7UB 5F7MC 5IOPB 2VW7A 4WZ9A 3FU3A 1I3RA 2F8XC 2GG1A 4JLRA 4L9LC 2D2CC 3RIFK 2ALWA 3L1GA 3H9YA 2FBJH 3QI9A 4L4VA 5HYQA 3RG1C 2XYCA 1KBGL 1CXHA 1S9VB 1E6JH 2BXYA 2VDNL 2W60A 3RVWC 2PWFA 1BIIA 3MUHL 4V11A 4JQVC 4P3WA 1CURA 4GKZA 3MLPA 3S5LG 2WOBA 5LGHL 3VRIB 5LWYL 1CK0L 3ULVH 4LLYA 3RX8A 2FSEB 3QC6X 3GI9L 3P2TA 1DLHB 1H15B 4Y4HA 1LK2B 1I4FA 1DQJA 1NEZA 2NY4B 4J12A 5MEPB 2LLLA 3T1FA 5GS1B 1NCBL 1E2ZA 1I1RA 1HZHH 4AM0B 1Q1PA 3FUNA 4WFED 1GS6X 2V7HB 1RUKL 4MZ3A 3LIZH 5AVUB 5I1GL 4LVOB 4D0CB 5KZCD 3OF6D 4XR8C 3MRBA 2L7UA 4UDUA 5EHFA 1FFTB 5CEYB 3X12B 3MSPA 3L2MA 2NXYB 1AQMA 1FH5L 4OZIF 1AKPA 2W80C 3Q0HA 3S2AA 4OD1H 1NC4B 1CQYA 3PWJA 3MAWA 3IAPA 3K46A 3N44B 4X5LA 4OZGF 3VG9B 4DERA 4OVUA 3B9KA 1CXEA 1ZOXA 4CAGA 4HUUA 1A7RH 1XD0A 4MLIA 3D09A 3PQYB 4CMMB 1AHWC 3ATEA 3OVUB 4O4YL 4O2FA 4YSSA 2P7TA 1ECZA 2NY3D 2P48B 2UVEA 1K5NB 1WWCA 3BKJL 5E7BA 1FZJA 1OSEA 2VLJD 3KGUA 3SYCA 4OM1L 3QRGL 5AOJA 5EBMB 3UEZA 2DICA 5BVPH 4NIYE 4PTTB 3ZRSA 1HOCA 3GS0A 2X4RA 4G6AD 3C2AH 3FFOA 5KW9L 5DLMH 5F3BA 1U42A 3D05A 1CF8L 3N41F 4X0KA 4BK8A 3OJ2C 4NKOB 1DE4B 4N5ED 4HV8B 3K8MA 3QJRB 1O5DT 2CKBL 3MLUH 3QO1B 2O5XL 6PAZA 4GI6A 5DJXB 3LPPA 2OXGB 4EXPX 4ZT1A 5J13C 4PJGF 4DKTA 1U92A 3M45A 1UENA 2EXSA 2PYFB 2IWEA 3HBZA 3I02B 2F68X 3NK3A 3VE0B 3HBGA 3B9AA 3MV7E 2DQGL 4GBXC 4FQ1L 4YHKH 4WFFD 1A9BB 1DEDA 1QKZL 1ZXQA 3AQZA 2XIDA 1QFUH 4NZRL 4RX4A 3P0VH 3IGUA 5DD0L 1L5GB 3IFLH 4FFZH 3PWPA 4NP4L 4K94L 3DIDA 3FN3A 3NAAH 1ACXA 3V0FA 3WFDL 1GYAA 4P2RA 4MDJA 3WMQA 1S3RA 2JJSC 2WVTA 3RWFB 1OAUL 1WA0X 1ZLUH 3OAZK 2C3VA 4CJ1A 5BRZB 3NA9H 4JR9L 4BWTA 15C8H 1CFQA 3E7JA 4LNRA 3UPRB 4LQFH 4W9KC 1CD1A 2CRZA 2A1WH 4IKKA 3X3FL 5IEHA 5JHDB 4NCC2 3B56A 3FO2B 3QRFM 1ECYA 1OTUD 3VH8A 1NFKA 3EYOA 3VXRA 2AXHA 3QC5X 3D2UD 3EH4B 3MXWH 3VSUA 5L88H 4XNDA 1DQDH 2BFVL 4CSSA 4APQA 3T3MF 1VCAA 4L3EA 2DLTA 4BEIA 1YQVL 4Y4KC 1MZYA 1ET7A 5C08E 4JREC 2G0LA 1YUHB 1P6AB 1NAKH 3GMLB 4XPTL 5D1XB 3UZQB 1FO0B 3ZUCA 1SEBA 3KYAA 1HEJC 1F4AA 3J07A 4YXHH 4LLVB 3LKPA 3FN0L 4MLSA 5EO1A 3RGVB 5MEOA 4LARH 1U3HD 2J8UA 3K1KC 4ZTPL 1E9OA 1HCZA 2DYRB 2ZXCA 4H26A 4BFIB 3K3QA 1AY1L 1WAAF 2HT4D 3IAQA 3VM7A 1ACYH 2ATKB 5GJTH 1MVFA 3K6NA 5I1IL 4JANA 5J1SC 4IOIB 1JTOA 4HSCX 5DMIL 3B7YA 2VLRA 4OZHA 4H7VA 2IV8A 4N8UA 4YBLC 4F2EA 5IBLC 5D96B 3RX7A 2NNXA 2ZUQC 1QG3A 4JM2A 3U1QA 4Z7IA 5KG9A 1P5VB 1E7UA 2PTTB 1MWAB 1I1AB 2VYRE 1DN0B 3HNSL 3ECQA 3QUYA 4X9BA 2VN4A 1F8TH 1X5GA 3O3EB 4G9FE 5D6DA 5I0YA 1I7ZA 4CADA 1Y07A 2XXCB 4CBZA 2BY1A 2ZSVB 2PW1B 2RCSH 1UWFA 3VXMD 2WW8A 1SLWA 4PJ7E 4K7PL 3TA3A 2BX5A 3PREA 3SOTA 2Q8AH 3FU8A 4KROD 5JA8B 1VACB 1RZJL 3OXSB 4AVJA 1BZ9A 1OGTA 1VFAB 3FRPB 1JK9A 4MJ5B 4BUGA 1XO8A 2H2PC 5JW4M 2XQBH 4PJGB 3IDXH 3I9GL 1KT2B 4QOKE 4EI6B 1EIBA 3TC9A 1B4TA 3ILDA 4O5LL 4HIPA 5D5ME 1PLGH 1BF8A 1S7TB 1T66C 1UYWL 3C2SA 3GTNA 2LFEA 4KAQH 2BP3A 4PGJA 4KVNH 3HFML 4IEFA 5D7IA 3BZFA 1XF1A 1AHWA 1EGJA 2FT6A 1DBMH 1YEEH 3D3VB 1AGBA 2ZOUA 2EC9T 5D1XC 3TEYA 3MBEC 1KV3A 1UD4A 4N26A 4NLAA 1KOAA 5DZAA 2YAPA 3ABZA 3VFTA 4LCVA 4FQJL 1W72L 2C3XA 1DSWA 4Z3HA 3OXSA 4QXGL 3SDXB 4OUUA 3D2UB 1SLXA 2ADIB 4JGNA 5B39B 3T0DA 3SQBA 1JPTL 5FECA 4KJQD 4ELKB 4GRWH 4GW1A 3CDZB 5TDPB 4OGZA 3Q8FA 4MXQC 4I88A 3VFTB 1S7XA 2ZSVA 4PGZA 4Z18A 2HVKB 4E9QA 1BZ7B 3FN9A 2WXFA 5I23A 5DYOB 4GMSL 1M7IA 1RZKL 3NZUA 5TDNB 1DBBL 1U8OB 1HSAA 1D5MB 1U8CA 5IB1B 1J48A 3LB6D 1I1AA 5M94B 5D7IB 5EB9A 4AJYV 3ME0B 4L8CB 2J43A 1KZYA 1JWSA 1MCHA 5D1QB 5CLTA 1MLBA 4PRHA 3RWCA 4QHNA 1KT2A 3FL7A 4O00A 1NDTA 4WV1B 5MI0C 2E46A 1VA9A 4NUPA 5EBWA 5HI4D 4B53A 5J12C 1QYGL 3KCPA 5KSBE 4X4MA 2WZ0A 2J1XA 3T0VA 4JRWA 4ODUA 3ZT7A 2A73A 2C1PB 5GGQH 3ZTDC 5IB4A 2A6JA 4NO0A 1N5AA 2R1XB 3DA0A 2DYPD 3J27A 1M2OA 1YRKA 2FHBA 2PW1A 3L2LA 4KKBD 1UACH 2WVUA 3HAEG 1V5JA 4DP2X 3I3EA 4HAFA 4PBXA 2EVJA 3HLAA 4YLQT 5D2NE 3BQUD 4PLOB 4G7SB 1SJVA 4DGIH 3FJTA 4UZGA 3BHBA 1G9EA 2VDQB 3QUYB 3R19A 1EZLA 2NY3B 3TU6A 1FL3B 4JM4L 4Z0BH 1T04B 3V6FA 1TKWB 2XFXB 1RZJC 3RWHB 2DRUA 3BISA 3P11L 4NB7A 3ZE2B 1BM3L 1M7UA 4H1LA 4Z7VE 2OMUA 5CKAA 1E4JA 1M4KA 4MDIB 4AQ8C 4AQAA 5C0NC 1CDCA 3T6XA 4Z78A 2L04A 5E8OB 1RSFA 4RDQG 3T6QC 5KZCB 3AG2B 4P2RB 5I16B 4ONOA 4PGEA 3L7EB 5C3TA 1T6WA 4QO1A 1X5LA 3B43A 1P69B 2YRPA 3CLEH 3WL9B 4YHYC 4YWGL 3IDGB 3CUPA 3NJXA 4RFNC 2DI9A 1GGTA 2PYFA 4WSJA 3WIHL 3GJFB 2P1YA 3Q8AA 2Y5TB 2WD0A 5A6IA 1N3NA 3K2MC 5E9DE 2CLZB 2O5NA 5A2JH 1O7DC 1D7DA 3I84A 1TJIL 3OGOE 4F8PA 5L8KB 4LSRH 3VXTB 1U9KA 3Q6GL 4CA4A 3GRBA 3DYMA 3O9WA 2F19H 1G43A 1RK7A 5J12B 5ECGA 3IPFA 4HSQA 2X4RB 5HD8C 4NXSA 2W9EL 1IC1A 3RURA 4XRCA 4NQCA 4FYRA 5ABDE 4F58L 4YBHA 3B1UA 3J2PA 4EZKA 2HH0H 4HMDA 4JFYA 1L7IL 1NKRA 2RBLA 3LEYL 5FGCE 5I1KH 2DOCA 3WFBL 1ZTMA 1FE8H 4NAMA 4LRIA 4OZHE 1NBVL 2X4UA 4HG4J 1PSKH 1AHMA 1HK6A 1VPOH 5CXPA 2XA8H 2AVGA 4E9RA 2G30A 4BZ1H 3I02A 1C16A 3LNDA 3JV6B 2BVOB 3PWJB 4P8QA 2CLZA 1I8UA 2V4LA 2APSA 2BY3A 1W16A 4JMXA 1ILSA 3VD0A 5KBDA 1WFNA 1QSEB 2IV9A 2NYYD 2XKNA 2Y5TA 1AQHA 2OXGA 4AIEA 1FRGL 2BIQA 2FUTA 5LN8A 1CD8A 1T22B 4G80A 2V5MA 4ZAKC 4MX7B 1LE5B 3IDGA 5GGRA 4JM0A 1OTSD 3KS0H 2J8UF 3EH3B 4I1NB 4X0KB 2FECL 2RB8A 3HC0B 3AWEA 5DZVA 5FFOA 3B34A 1T4WA 3MNZB 1DLHA 1H15A 4Y4HB 4PTTA 3RPKA 1WTGT 5JXED 5DFVC 5E6RB 3ZGIA 3APCA 1RZKC 4MQ7A 1D5XA 3WIAA 1K5NA 2W59A 4WUKL 4K71B 1AO7E 1PFCA 5EBLA 4YDJB 5J7CC 4R97B 3ULSB 1QWNA 2V17H 2ZUSA 4EN3C 1LO0L 2TSAA 4P46C 1NOLA 2QV4A 2NY5H 1OE1A 3R7RA 3VTMA 2F8IA 1T1ZB 1MFBL 4EDWL 1NC4A 3W2DL 5FO8A 5IT2L 3BC9A 4EJ1C 4CDHA 3QORB 2NXZB 2KDYA 4FZEL 2ZCHL 3SE4C 5DS1A 2DJSA 3V7MA 1WK0A 1B0GA 4PP2B 1YEKL 2JB5L 4M00A 4ANUA 2W81C 4FFYL 5BRQA 3MJ7B 1RAMA 4GUPA 3PL6B 3VXOB 2PYEE 2XWJB 4S1RL 2R1XA 1A6VL 5KYUB 2OTWB 2VW6A 1LK2A 1P6FA 4DUXA 4HLEA 4K7FA 2XKUA 3NACH 1F0LA 4HJ0C 4PLKD 2DQIL 1KLUB 3WEXB 4WW1A 3POHA 1N6VA 1KCUL 3A4DA 1H5BB 4R26H 3FQTB 3FTZA 3LN5A 4TNFA 1J05B 3FB5A 3FSOA 4Y2DD 3D0AA 1F3RB 4OV5B 3V4PH 2ODIA 1RSYA 1I3RB 3O0LA 3MGOB 3NCCB 3ULVF 4K9JA 3IDYB 1DBJL 2LE9A 5C0DB 4JFDD 2PUQT 4E41A 1EPFA 1IGCL 4JFEA 2F7OA 4K9EH 4MAYD 3A47A 1TNMA 2VLKE 1ZGLA 3COOA 2HVKA 1NDMA 4F7EB 1D6EB 4RMUA 4QKTA 5FF6B 3V9FA 2Y06H 2GQHA 4JO2L 1L9QA 4GSDH 3FCTA 4GW1B 4ELKA 4WNQB 3QJUB 3JVFC 3MA9L 5TPWH 1S7WB 5BVJA 3BO8A 4K3DL 4GAGH 1YECH 3WN5A 5IQLA 5T3ZH 1FORH 2VDRH 1GR7A 2JCCB 4X2UA 5HHOD 4OF3A 5LGYA 3U4EA 3VG9C 4K8RC 5ACMA 4E42A 1QFHA 3OJDA 2HFFA 2ADGA 4PW4A 5J9PB 2BNUB 5T1KA 4LRIC 1FN4B 1ORSB 3NOIA 1BMGA 3BZFB 1JGDA 3CFCH 1BAFH 3T65A 1GZPB 1MCJA 2CU9A 3HI5L 4LP4A 3EFDH 4MNHA 3TTYA 2FLRT 3E2HC 4BXVA 1DO5A 3ZY7A 4NN7B 2RH0A 5I0VA 4JKPL 5B1KA 5DSCB 2X44D 5JNYB 4UQBA 4CN4A 4IMLA 4XN9A 1CDYA 1JK9B 4PHZA 4PVBA 3O9WC 3M1CA 2R2EA 3F58L 3K4ZA 3TO4B 1L9TA 1BZ9B 3EYVA 2WWOA 1UM6H 3KYMA 2CQVA 2EEFA 1LLAA 2NY6C 3BUYB 3D9AL 3H42H 5F7NC 1EAPA 1HHIB 3NJIA 4O2EA 3BP7B 4AI7A 3GI8H 4X6FA 3IAGC 3O4OB 4TULL 3CVHB 3I9AA 1LILA 1ADWA 3II3A 4JY5L 4WDIA 5CZXC 3NA4A 3IGFA 5DRZA 2ZWKA 5JR1H 4DGVL 5DI8B 2NOYA 2EEBA 3SYQA 3ESVF 5CILL 4KK5C 2G9HA 2R0ZL 3EOBA 3OKMA 5HTSA 4JHZA 2JIXA 2EC9U 5C3IA 4FABL 1E6OL 3NG5A 2IPKB 3LEVL 5J5EA 5LNDA 3MCLL 2A9BA 1TVBA 2WLLA 1NCCH 5EDXA 5KYWA 3KXFB 3OR7A 4L29B 4X5WB 2E7DA 1D5IH 3AQDA 3IMSA 5DYFA 2A3TA 2ZXWB 3QO0A 4H26B 3ZMRA 3ARDD 1TDQA 4Q4IA 4AIZA 1EA9C 1FYHB 1MFDL 3I2CL 1D5BA 2HG0A 4RRPM 5KTEL 3JWDC 3C6LD 1DVUA 4RWYL 4PBWD 1J8SA 4W9JC 2ETWA 4G72B 5FOBB 4YN3A 4QHUA 3MRHB 3KWWA 4GQ9L 1EHNA 5LKNA 1SEBB 3LDBC 4FNPA 3V10A 5HHVL 2HJFB 3OG4B 3QH3A 2H7WA 3WY1A 2R0KL 5JW4R 3MGTB 1NAMA 1EZVX 2HPOA 4HKXB 3ZDXB 3FT9A 3T5WA 1SXAA 1WBXB 2CE6A 3JSSA 1R0AL 4NO3A 4MNGB 3DUHA 2HPTA 4W1TA 2FJGB 4Y1AE 5MERB 1JNNH 4TPRL 3BPCA 3GXPA 4P2QD 3KL0A 2BC4A 1H8SA 4GT7A 1JHTA 1BQRA 3G6DH 1YEGH 4PGCA 2YS4A 5D8JH 1KXQE 4YHIB 4DFIA 4K8RH 4DN3H 3AGWA 3SPIA 1P2CB 1GW0A 3HFFA 4X8JA 3V52L 5D96C 5C0AD 1XFPA 4RH4A 4MCYA 5D2LA 1LWHA 3SJVB 1N0LA 3F84A 4EI5C 4ZX3A 3FUEA 3PWPB 1WZ1L 1J88A 5ABAA 4JFFE 2YPLD 3V95A 2FBJL 4WI8A 2MCMA 1A9BA 5IBUG 1KBGH 3OKLB 4XNYH 1KG0B 3LH9A 3DGCR 3MUUA 3O8XA 2GTZA 1KEGH 1LWRA 3DO3A 5FHAL 3L4VA 4JJHA 4DNLA 1U58B 1OIOA 2BNQB 2PCXA 2VIRB 2VJ8A 2NY0C 3LZQA 3S5YA 3T8MA 1MAJA 1ZLWH 2G5BA 4FA6A 1G1KA 2HTKD 4NUGL 3GEFA 4PRID 4UOJA 3D25B 5FYLD 1U36A 1LK3H 1DE4A 3OTTA 4NKOA 4RAUA 4AZUA 5IHZA 2APFA 5I5IA 2DIJA 3WIHA 3F6LA 4A37A 4JDZB 3GFUA 4M6MH 5I1GH 1SF5A 3BFWA 4IQHA 3TNNB 5ESAA 1R3IH 3PPSA 5ANMB 4PWFA 2V3FA 3R06B 5IROD 4ODSH 4PTUA 1FNEA 5C2UB 3U48A 1VADB 2OXHA 3ZSSA 3MLSL 1J8HB 1FZOB 2DQCH 2R4SH 4UNVA 1AR1D 4D7PA 3WUWG 2HRLA 1L4IA 3QR2A 1GKOA 2D7PA 5T3ZD 1HX0A 3WHXB 1YEHL 2R69A 2OL3L 3WAKA 5B7FA 2FBRA 4O02L 4HCFA 4CVZA 5F1OB 4AWJC 3OHMB 4V1DA 5EOTB 2P3YA 5C07E 4EDXB 1JHLH 1QMUA 3CGTA 2ZXEB 2HRGA 4OD2B 1NM4A 5DEGA 1KYOJ 2C7UB 3WO4C 4EUPB 1F2QA 5C0CD 2F1EA 3F7LA 1U8JB 5DLML 1IEAB 4XNXH 5DUPH 2JELL 1GY1A 2WLIA 3N1GC 1MSPA 1T89C 4LDCA 2YAFA 3JWNE 5C07A 3SODB 3TVMA 1KULA 3MLUL 4Q6KA 2X4OA 1NFDA 2VXTH 2COQA 4R7DA 5DJYB 2GTQA 3KLHC 2XWTB 1E5UI 4R7XA 3H3PH 3MV8A 1EZUA 3FT2B 4FQ1H 4MJIE 4YHKL 4MZRA 1SOSA 5HGHB 3GMMB 1TTRA 1YJDC 1JNLH 4Q74A 4U0RC 4XOCA 3EG9A 4QY8B 3MQIA 5AW6B 1MJ7H 2CGRL 1IGMH 2WAHA 4XP1H 3T0EE 2H1XA 4A7QA 3L13A 3S96A 1NFDF 4LNVA 3RWIA 1I3GL 5FO7B 2OK0H 3MRIB 5H2BB 4I9XA 3SE8H 1ZVNA 2Q10A 4DQOL 2XZZA 3WJLA 4NGHH 3GSWB 4XI5D 3QZLA 3ARVA 5C0CB 3UH8A 2Z91B 4N0FB 4IKLA 1DANT 1DYZA 3WFHB 2VJXA 5E00B 1CFMA 2AQSA 3FRUB 5F89A 1IO4C 1ZLWK 2GJRA 2F15A 12E8H 1Q1JL 4FNUA 2IMNA 4NQVB 4M62L 2IWFA 5T5FL 3APMA 4XPTH 2OQJA 1FVCA 4J28A 4L4TD 5IBTL 3CN2A 3HN8A 1HHGA 1KFAL 3CWGA 4QHPA 3RPIA 3CBRA 1A9EB 5CLYA 5BRZE 5AZ2H 1UZ8A 5JMRA 3V4PA 4Z7AA 4PWJA 3W5MA 5F7LB 1DQQA 3R4RA 5C0RH 2BOBA 2E9JA 4WKZB 4ZMZA 5CKGA 1JV5A 1WFOA 2DQJL 3SB3A 3WKMH 4I5BA 4LOUC 2YMOA 1IM3D 4FQHA 2P42B 2N7BA 2UXGA 1TQBB 1WC7A 4F92B 2GUOB 4NQEA 1Z2KA 2N0MA 3X3GL 4Z8FH 4Y89A 2X0WA 2SODB 3L3JA 2BSRB 3CV5A 4RFNB 3CFBB 2FX9L 4NRZB 1WLHA 3DIFB 4JFTA 4JX0A 1A0QH 3RKDD 2K6ZA 2CUAA 3GF8A 3C5XA 2R0LH 1IKNC 4G43B 2BVUA 3LZPA 3S6CA 1BFOA 1HQRB 4WEEA 5L8JB 4FTVE 4KKQA 4MBRA 5E4AA 2B2XH 2VDLB 3N1QC 3GMPB 1UVQB 5DJCA 2YMXH 4GRLB 1ASPA 3MKGA 3QI9C 5E5LA 3T4AA 2C3HA 2YEZA 1X7QB 5I8CB 4RAHA 4L4TE 3FQWB 2LU4A 2QFPA 3MA7B 4UANA 4OCNC 5DJDB 4OFIA 3IU4L 5L2KD 1RZJH 3VD4A 2L7EA 5CO1A 3ROOA 4WHTB 1BAWA 3WDJA 7FABL 4WTXA 4Q9BA 1GL4B 2DJUA 3P0YL 3RVXC 1WTLA 3INUH 3JYCA 4DGWC 3DIFA 5DMKA 3NESA 1QR4A 3O4LA 5AW1B 3RVTD 3SZKC 4Z5RB 2GSGA 2VXVL 1VEOA 5CMAA 1K3ZA 4WWID 4KVNL 2KLRA 2OSXA 2R0WH 4G8IB 4PG9B 3LSOB 4BELD 5A1AA 3W57A 1B3IA 1YO4A 3JWNH 5IMMA 1CDHA 1DQQB 1OAQH 4F5CA 2BH0A 4Y5VB 5I1LA 3BGAA 3W37A 2ZCKL 1N4XL 1U33A 5EU5B 1F11B 2JE8A 2ZOLB 3GSXA 5DZNA 5AZEH 5DWUL 5AOMA 3T2OA 4BQ8A 1QZ1A 3MOBH 2H6PB 4KITB 4U1MB 1INDL 4YEFA 4YDIL 4ZD3L 3B5TA 4K73A 3UAFA 4NQVA 2P46B 4FNLH 3BMVA 4QOKB 1XB6A 4M5SA 3RJQB 3SDAA 4HOMA 1L0YA 1R33A 2UZPA 5D2NC 4EQ3A 3B9VA 4NQXA 1WZKA 1RJZB 3QIUC 2DZEA 4NO5B 1G6RA 4OZFH 1OPGH 5JQ6L 1KIPB 4L9LA 1O6TA 3LIZA 4DVRL 3O6KH 4MRCA 4I48A 3JWOH 4RFEA 2PP9A 5CUSL 3RVVC 4XH2B 4PU2A 4B96A 4OQTA 5ELIA 3HZMB 4HF5L 1MCFA 2FYYA 5L9DL 1CGSH 1VGKB 1KPUB 4PD4J 5IVZA 4Y7MA 1GMEA 1XGYH 2EDFA 1KLGB 1F18A 4DP6X 1TZIB 4HJ0D 4PLKC 1TPXB 3WNJA 1ES0B 3DX6A 3MNVA 1FFNA 2R39A 5T3XE 1FWXA 4M6OL 3MLXL 4HQQL 1UD8A 4MQSB 3GSNB 3VFGH 2VLKA 1I85A 2UXTA 3TZVB 2UY6A 3HS0A 3WSQL 5AW5B 4ABQA 5ICZB 2HFTA 2OI9B 3TO4D 2QL1A 4HLZG 2I26N 4XHJD 1SJEB 2NRDA 3IDUA 4M43L 1PZ5A 4HHAB 1T20A 1X9UA 4P9MH 3GM0A 4FA8A 4JAMB 4DGIL 3DYPA 3MBWA 1RHHA 1FC2D 3SQRA 4WFFE 3G08B 4L0ZA 3IMBA 4H25B 2YPVH 3U1SL 4ODWB 5LAPA 4BBWA 3TFKD 3SY0A 3B83A 4QRUB 3VWJB 1XF2A 1EZVY 3ES6A 3QUMB 4MHHI 5K1JA 5FYKU 1BM3H 4JGUA 1OHQA 3ETBJ 3FMGL 2WNXA 3M8OH 5SX5K 3PGFH 4RMTA 4RLDA 3V8CA 4EKXA 3G6JF 4DP0X 1WSST 4AL8H 3D69B 1QAWA 3RU8H 2R23A 2DQFB 3FT4A 5BS0A 1ZGLM 1SUJA 1VJSA 4H25A 5D2NB 5C08A 2PPDA 3NFNB 4FXKA 5I8KL 1ZDQA 3R06A 2XV2A 5C0EA 4F20A 4BDVA 3KEDA 1G6VK 3EOTH 4L18A 2EIDA 4P48A 5AW3B 2P5PA 3NCJH 1NFIA 1UEYA 2Y22A 1MDTA 3BAWA 2EXTA 3P3YA 2MQ0A 3HN3A 4PJ8B 3UG3A 2DWXA 3BPLB 1RCYA 3MLVH 5A16A 4M7LT 2VLKD 4Y2DB 5EIVA 2VQTA 3QG7L 1S7VA 3JWNC 4BZ2L 3EOAB 4Z7QB 1NGXA 4X6DA 4U3HA 4N0UA 5K9QG 5F1IA 3ZYIA 1EGJL 4ORZC 4CW1B 1A8JH 1G9ML 3UCRA 1LO2L 1OE3A 2ZIDA 1VGKA 1MFCH 3TO4C 4HAGA 5DK2A 1J1XH 4OI8A 5IJKC 2NX5A 3EYUH 1O6SB 3ALXA 4G7RB 4RMRA 1L7IH 3LEYH 1W91A 3L4YA 3IM1A 2GAZB 5FPIA 5HD8D 1PKOA 3H7BA 3UBXA 3WFBH 2DEWX 1TVHA 1J0IA 3DX9A 4PSRA 2DQTL 2V9TA 1A3LL 3PL6D 1F02I 2AKRB 2Z8RA 2ZPKH 4KY2A 1SJHB 3BLKA 2X4PB 1G6RB 1ONQB 1X5KA 4P46A 3QFJE 5F7AA 4D8PB 5IMLA 5A6LA 3H4HA 4F93B 2CKNA 3DMMB 3HRZB 4QPEA 4JCWA 3L3GB 2D7TH 5D1ZB 4NM8L 3RFZA 1EEQA 2BC4B 2MPVA 4ZXBB 5BUGA 3IDJA 4ANVA 4A67A 4NWUH 3K6FA 4PJ9D 3IJYA 4D0BA 4MNGA 2WLJA 1RFDH 5CGYC 5I6XC 3AY2A 1YNTA 3UZVA 3L3HA 4ORGA 1BVOA 1PW3A 2OW6A 3CVHH 4TUJB 4BQ9A 1BVKB 3CFMA 5GZOC 4UV4L 4R96A 3QQDB 1OW0C 4JRYA 1NINA 3O6MH 4WTWA 2TAAA 5JOPE 2EJ1A 2JXMB 4MNQA 1KXTB 2YGPA 1IFHH 3QWOB 4XP6L 2HSIA 5C0ND 5DC0A 4HUNB 1IGTA 1L3WA 1QNZL 1A14L 2NY5L 4UNUA 3VFWB 2XN9E 4GO8A 5BCAA 1MFBH 1JF1B 1AQ8A 4DAGH 4K7PY 3CFJA 4KQ4L 4UIMA 3V0JA 1YYCA 4UB0L 3ZTNH 5IHWA 3N9GL 3C87A 1UOKA 3ROOB 1MCDA 1ZHBA 2GSIB 3DJSA 4TQEL 2J8OA 1EUTA 2F58L 3S37H 3MJ8B 4OD3L 2YPKA 3GSUB 5D2LE 4UTAH 3OZKA 5KS9F 1DUYA 1KB9K 1JYXA 3FK3A 4F7PB 1A6VH 5B22A 4PJCA 4HWBH 5FYKD 2G3XA 2W0LA 5DJCB 2ESVE 4G7YL 4JDTH 4LGPB 4MNQE 3LV3A 4HHWA 5KBLA 3WLBB 4PQXA 4AJWA 1S7UA 4LSUL 2VR7A 3VRJB 2PCPA 1NMCB 2DBLL 2E7CA 1WIPA 3EJYC 5KBPA 1FVDA 1OARL 1XH3A 3BP5A 3LYRA 3QI9D 1NIEA 1CD0A 3ULVD 3VQ2C 3BPOC 4HJUA 2AJ3B 1M9SA 1KCRH 4FEIA 2WZAA 3VXNA 4GH7B 4UAOC 4M7KH 3ET9F 1X5XA 1NGWA 3U0WH 2NY0B 1S7SB 5L0QB 5E51A 1I8AA 3EO0A 4JZOA 43C9B 4DKFL 2JKIS 2VDKH 3MYZA 5CIPH 2BS8A 2EE0A 1BJMA 5KYXB 3BVTA 3X11A 4MA3A 3KAAA 5G4OA 3C5SA 3VD1A 1F3DJ 2ZXQA 5D7HA 4BSJA 3DVGA 1FN4A 4N3UA 3MRGA 1E43A 4OJAA 1JZ7A 5FUCC 3IJEB 4LOUD 4YSPA 3WDIA 3MA9H 5TPWL 4P2RD 3DBXA 2GJ6E 4P04A 1XSJA 5GRJH 4MA1C 4HIEA 1OTTC 1CGUA 3RDTC 5A2AA 1UWEL 1AD9B 2AFNA 3C5JB 2BHUA 3S88H 1ZTXH 3U6RB 3ZR5A 3GSWA 5E4OA 5JQIB 4FADA 1AJ7H 1KGUA 1RZQA 2IIJA 1BAFL 3RYMA 2JWYA 4OJCA 3ZHFA 1T4KA 2D2OA 2FJUB 1A6TB 2E7HA 2QGCA 1IZKA 2XWZA 4JG0L 4UMSA 3VI4E 5T5FA 1SQMA 1B6UA 4R2GB 5C0DA 2V37A 5LQBH 1J5CA 2YD7A 2X1WL 4KVCL 1GS8A 2H2PD 3DUUB 3EG9B 4RA3A 1RIVL 4H0IA 6CGTA 2DYPB 2X0UA 4GXUM 4X5RA 5GGTH 3UTQB 2E9IA 3QCUL 1AG6A 4FCHA 3MGAA 1H5BA 4YBLB 2BVQB 4NZUL 1TF4A 3Q6FB 1JYWA 1L6ZA 1V54B 4LVNB 4H8UA 1UM4H 2EAEA 4K2UH 1I1AC 4KC3B 1SFHA 4JY5H 5FS5A 2YWZA 1CR9L 4M8VA 1FV1B 1WVZA 1CQKA 4IBUA 4UQ2A 2CXKA 1ML0A 4Z76A 2ZUXA 1D7BA 5CZVL 4K15A 2G4GA 5LGHH 2Y1AA 4NBYB 5LWYH 2R29L 5I17B 2IXQB 2R0ZH 2RJMA 4KKAC 5B3SB 2F18A 1U8JA 4F2ME 2BRQA 3CZKA 3AU0A 2NW2A 1PCSA 3V4VB 4MMYA 2MPAL 4OLEA 1RUAL 3FFCB 3CFUA 2E8YA 1XR9B 3HI6H 1J1OH 4ZX5A 4TLSA 4YE4L 1FFPA 3EFOB 4ZFFA 3DROB 4Y2OB 1URZA 2YZ8A 2XV0A 3QPQC 4KZEH 2OSYA 2OZ4H 3NCFB 4FL4C 4OQTL 3VUAA 1J8HA 2ENJA 3IJSB 4G83A 5ICXA 4B9GA 3GUTB 1RH8A 2W65A 4EQ2A 3HE7A 5HHVH 3B6SB 3E8VA 2XC8A 4HX1B 3ASWA 3MRJA 1IU1A 2LAGB 3PF2A 3QHFH 3RZCC 1CDBA 3VNZA 3WJLC 3M1BB 2DDQH 2MQ3A 3SBRA 3S36L 3ZYZA 1A1MB 2ADJA 3HRPA 3MLWH 4BYHA 3ARRA 3L8QA 4UQ3A 3QRGH 2GHZA 3A4AA 3D07A 4NZFA 5BVPL 2O6EA 1TIUA 5IROC 3RA7H 4ODXA 4NHCH 3A4EA 5HYJA 5GRVK 2WWKO 2XXGA 1KJVB 2DI7A 2CO4A 1OP3K 1S7RA 2NY2B 2Y1ZA 1MEXL 3WY3A 1WZ1H 4G6MH 3FC8A 2AXJA 2WB1A 4JFSA 4GRLD 2Z7YA 4JVPA 4YZWA 3VFUB 3QK0A 1MCNA 3QAZC 5I24A 4WW2F 2EDOA 3BZ4A 4XNYL 2GFBA 3RWEB 2X2JA 4G8GE 2VABA 2YD1A 4YAQB 3K5SA 3UTSA 4JDVB 1NANI 4LHJB 4GBXD 3SCMC 3BUIA 1QKZH 1UD3A 3FCBA 1XEDA 4NZRH 4PR5B 4UM9B 5I18L 2ZG2A 3UBXI 5J56B 3NAAL 3NSDA 3SBQA 2GY5A 3LD8C 3VI4A 5L4JA 4NUGH 4X5QA 4YEEA 5C0IB 5B3JE 4JFVA 5GIRB 1DVFA 4OLVL 3QDGE 1T83C 2A4EA 1CFVH 1DSFL 3C60A 1EJ8A 2ZX8A 1OL0A 2FJGA 4GG8B 5MERA 2E7LA 2RFXB 3TT3H 2A74A 2PWDA 2XACC 3O4LE 5CJQH 1CXFA 4A2FA 3SJVE 1WT5C 2AERT 4HJIA 3VW3H 3VACA 4G6AC 3VWKD 1ZGLP 1OVZA 2MQCA 2N56A 3MXWL 3LRHA 4NQUA 5DRXB 4LAQL 1UD2A 4JUTA 5IJCC 4DN4H 4FN0A 5IZ7A 3TURA 4TUOB 4QO1B 2NT0A 3BWUF 4RSYA 2DQCL 2R4SL 4X6CE 2VQ4A 4XZUB 2Y23A 3GGWB 1HHHB 3INOA 2CCLA 4CC4C 1GJIA 3TWYA 4HCRA 4HWZA 3DXAB 4DVBA 1YEHH 4UTAA 2CDGB 3BDXA 3SGKC 4M48L 3TONA 5FW7A 1GYWA 3WEBA 2UUDH 3MO1B 2JB6A 5D5MF 2GJ6D 3UP1A 5JXAH 5IF0B 5KS9E 4MMXA 5DEFA 3LEXA 1IEBB 3VFSB 3FN0H 1C5CH 1TVBB 2WLLB 3V6BR 4F8OA 4XN2A 7TAAA 4LARL 3ZN6A 3B5GA 1KIUB 4IBZA 3QNXB 5A43C 1KIQB 2CDEB 2UWEB 5GJTL 4Z3GA 1RJLB 1YDPB 3GDCA 2CRYA 5ISZD 5B1AB 2H9GA 4H4NA 4LSVH 3GRGA 2ZX5A 1J8HE 4KDVA 1V7NL 3CVHA 1F6AA 1JXJA 3JV0A 3QEQB 3PP3K 4QHKI 5FX3A 4XCEB 1N5AB 3QAZB 2CBPA 4LGSB 1SN0A 3PFQA 3O3AB 3VMOA 5BZDB 5ACZB 1RZ8B 3ZKXB 2VJ0A 3GO1L 4ODUB 1A6AA 2OR8A 3F7YB 3WUWB 3K72B 1RLBA 2UYLA 4CKQA 1NZRA 4WV1A 4Z3JA 3ZYOA 2EUVA 2IPUK 4ZMLA 1HXKA 2FJFB 5D1QA 2E4TA 1V55B 2ZKYA 5FXCH 3TBTB 2J25A 5EUKA 3EXLA 5TQ0H 5EF1A 1K8DB 4DW2H 4GG6F 2WLYA 2QQKL 3BIAX 3T65B 5KSBF 4JPIA 3HTLX 4TNGA 3VD3A 2D31B 1G0XA 3W1ZA 4J8RA 1IBHA 5F9OH 1XIWD 1N0XL 3WE6B 1EFXB 2YUXA 3P9MB 4QDGA 5ENWB 1NJ9A 1Q72L 2EH7L 3KJ4C 3OF6A 1FFOA 2XX1A 4HUCA 4EKJA 5KJ7E 3LNIA 1CGVA 3PUCA 2YRZA 1DBML 1DVQA 1NLDL 2JNZA 4MD5B 3BE1H 2OYMA 2F54A 2IDUA 3KNBA 4GNKB 1MJJB 3OJVC 4HC1H 4PWKA 2MNWA 3V7AE 3KJ6H 4WNQA 2EXWD 2FO1A 4MD5A 1TTUA 3LRMA 3MNWB 4HKZA 5K5YA 5AVWB 4FQJH 4TL4A 5FF6A 1R1CA 2B4CH 1L9MA 4MA8L 4FLSA 3AS1A 4UDTA 2WBXA 2NXYD 5ENWA 4Y4HC 3EUDA 3T04D 4IDJH 4JFEB 3EO1B 5JUEH 4PJHB 2XZAL 4FLOA 3ZTEA 4NBXB 4C8XA 5DVOA 2XNAB 3AS3A 3FONB 2HFEB 4YXKH 1PLCA 3TBTA 3QYCA 4ZS7L 4Q2ZA 5E99H 2FX9H 4UIKL 1RZKH 4PIBA 2NY4D 4EI6A 2AABH 4PP1D 4AYSA 1TJGH 3T1WA 3OKDA 4M5ZL 3PV6A 3QNYA 4MJ5A 3QXAA 1FCCA 5LUMA 3OQ3B 2AK1L 4Z3EA 1FL5B 3S4SG 2WXMA 4IYKA 1RY7B 2B2XL 3C5ZC 3IKCB 2OLDA 5LXGL 4PFEA 3NQIA 5DT1L 1VACA 4PBDA 4OTXH 2QPEB 1FNLA 5DURB 4JRFA 1R3KB 4U1LB 1GCFA 4F1SA 2WYTA 2FWSA 5HVHC 4RDBA 2Q3ZA 1GAFL 4WI4A 2WUBL 4HIHB 4DK6A 1YEFL 1V3KA 4HETA 2OL3A 1K5WA 2W9LA 1P7QB 4I77H 4CMHC 1UT9A 1PG7X 1BHGA 2Y9RT 1QPPA 1MVUB 2NTFB 2X1XR 3ZDWA 2OFQA 1A1OB 2VMFA 3MHZA 3QNXA 1BVZA 2C34A 5DZLA 5I6PA 4P23B 2Z4QB 4Z0XB 4RISH 1NGPL 3CN0A 3MRDB 4G8FA 2CAKA 2C9AA 4JO1L 5MENE 4P2OD 2VMDA 1DVYA 4F7TB 2H1PL 1CGYA 4X5XB 1UH3A 3QUMH 4A6YB 1HL5A 4MMXB 4FXGA 4Z7NE 5IF0A 3QDMB 5FW6A 5ESVA 4LCYA 3IDYC 1QTYT 1JZ4A 1TT6A 3NFSL 2RIKA 3RGVA 5MEOB 3ARQA 3WJMA 1I9JH 2WMPA 2WKLA 5DEJA 2OYPA 1EFQA 3MOBL 3KPNA 1CL7I 5JDJA 4WWOA 4XX1G 3X17A 4GUCA 1PIGA 2NNCA 1YEWA 3X14A 2QPSA 1T1YB 1RL1A 1H8NA 5AKSA 3SOBL 2FNWA 1AZVA 2IADB 2Y6SD 1ETB1 1DLFL 1LEIA 4OBSA 1PZAA 1WIUA 4OLUH 1T6BX 3A5VA 4S1QL 1F4XH 3GXDA 2P5EB 5FKAA 5IR1A 4O2CA 3CSBA 4DVRH 1M1SA 3VQMA 3SIKA 2AJXH 3AXLA 2BWIA 4E0RA 2Y2YA 3NDZE 2V2TA 2NYYC 4KUZH 1UXSB 4XMWA 1OAKH 4ANXA 2CBTA 4LSRL 1QFOA 1UD6A 3MV9B 3IGLA 4XRCB 4QNPE 2AMUA 2AEQL 4OUOA 43CAB 1UXSA 4I1PA 1ZVSA 1I8LC 4U7KA 3ZL4L 2A9DA 1XSIA 4U6TA 3WFEL 1S78C 4NQQA 1SGKA 2FQFA 4LOVA 4M6OH 5FKAB 2X9WA 3WV0A 1JMZA 4AY0A 5EU7C 4WUUD 3MCKB 4BSWA 5ILTL 3MV7D 3NABL 4RBPH 1HH6A 3VXUD 1XF4A 2C9VA 4PS4H 5C70A 4WFEE 3QO1A 3WMPA 5DO8A 1N2RA 3BPOB 4NJAH 3QHTC 3PV7A 5IB3A 5HYSB 2AZUA 1HHKA 3KPNB 3NIGB 2CRMA 2CNZA 1A7NH 5I16A 43CAA 3MRJB 4KX7A 3RWGB 3SO3C 1JPGA 1AIFB 2OSLA 1RK1A 3NCXA 1FZJB 4TNVK 5AAMA 2UY7B 4ZMAT 5BPPA 3HMWH 1Z0NA 3DI2B 3LRSA 3P9LA 4WFGD 4ZMNA 3U2JA 2OMYB 4U1JB 2BVEA 4AL8L 2ZX9A 4H8QA 2JI3A 3EZ8A 4UM8B 3DTXB 1JF5A 1S2EA 3BCDA 1WGVA 4R8WL 3UO8B 2E86A 2A9AA 4AQZA 2Z4QA 3VNYA 2GC7C 3ZZSA 3V6FB 1OHZA 4Y19A 5HHQB 1A1OA 1MVUA 2DMKA 2MEJB 4MCZB 2AV1A 2AQRA 3D2TA 2P24A 2B1HH 5EOCJ 4G8GA 4AV5A 2JLPA 3I85A 1WBYB 3T8XA 3VXUE 5F6IC 4BIKA 1ZLEA 5EZOL 3BWAB 4N2OA 5I17A 5GSRA 2Y4SA 4WW2A 3ARZA 3P40A 4WU5B 2FLMA 3IFNH 1XZWA 1DQJB 1MI5D 4D9RD 5MEPA 3T6WA 5IB4B 3QG7H 1SHWA 4ZMVA 5KVEL 3OKKA 1GGIH 3DETC 4R2GC 5C09D 3U9WA 4KK9D 2H26A 2AK4B 4GJTB 3U0PB 2VRQA 4KKBC 3AADB 2BVQA 4UQ9A 5DZ9A 1J1XL 4CU6A 4QLWA 3BFQG 3T2NL 3CIAA 3UTQA 1JERA 3NACL 3Q5YA 3K1DA 3LKQB 2IALA 2QHRL 1E5YA 5AKVA 2VB5A 4NNPL 4Y9BA 3DHJA 3MPCA 2QR0B 2HVJA 1AKJA 1BD2B 3ESOA 4FTVD 1YMMD 1M7IB 1GA2A 2E6QA 3N44F 3QORD 4X98A 5GQBA 5TDNA 1PAMA 3BYTA 5EUOF 4OT1L 4N9GB 3FBQA 1PD1A 2W9DL 2XBTA 1KV7A 4QYOB 1DBJH 2VISB 1R3KA 4PP1C 4U1LA 1X4YA 3SQBB 5ITBL 4AE1A 1A47A 1HSBB 5FO2A 4OUUB 3U6RA 3ZE1E 4BWUA 3H3BC 1ZIBA 3TN0A 3BUTA 4YNYB 3U9UB 1MCRA 1X5HA 3CVHL 5BXFA 3ARGA 4ISVA 1DQIA 3V5DA 3QNYB 3DBXB 4IIQA 1PX4A 5AL0A 2EE6A 5HHXH 3IBEA 3WS6A 3UTPE 1FSKC 4NXKA 4R9HA 1A3RH 4MCNA 4NM4H 4K3DH 1KBPA 4XGZB 4U33A 4X6CA 4J3BA 5E6ZA 1G1OA 4DO6A 1SM3L 2DWDB 4Y4KB 5GJSH 2QMJA 1ILUA 3EYFB 2J2ZB 4QMEA 1UHVA 2XFGB 5E4EB 2WVSA 1RI8A 2UYLB 1BX2A 2E27H 4H8WC 3F7PC 3K72A 2GJZA 2IBGA 4N0CD 1PVHA 4UB0H