4GUQA

Structure of muts139f p73 dna binding domain complexed with 20bp dna response element
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
200
Chain Sequence
EFIPSNTDYPGPHHFEVTFQQSSTAKFATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*GP*AP*AP*CP*AP*TP*GP*TP*TP*C)-3')
publication title Transactivation specificity is conserved among p53 family proteins and depends on a response element sequence code.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4guqA00
2J6WA 2XWCA 3D0AA 2J1YA 5AOKA 4AGQA 4MZIA 2BIMA 3D06A 2P52A 2MEJB 4LOEA 1TSRA 2XWRA 4IBQA 1GZHC 2IOOA 2WGXA 2FEJA 3WTYA 1HJBC 1YCSA 3EXLA 5AOJA 3WTVA 2ADYA 1EAQA 2J1XA 2IOIA 3US0A 1H9DA 4AGPA 4AGLA 3D09A 2YBGA 1UOLA 5LGYA 2J20A 3EXJA 2J1WA 2J21A 4HJEA 3WTUA 4XR8C 4IBWA 4G83A 2BIQA 1E50A 3Q01A 4L18A 1IO4C 1T4WA 2BIOA 3D08A 1LJMA 2IOMA 1HU8A 3Q05A 1CMOA 5G4OA 4GUQA 4LOFA 2J1ZA 3IGLA 4IBSA 3WTSA 3QYNA 3VD0A 3TS8A 2OCJA 3D05A 2BIPA 2ATAA 4GUOA 2H1LM 4MZRA 4L0ZA 3QYMA 1GZHA 3WU1A 4IBUA 5AOLA 3D07A 2VUKA 1TUPA 4AGOA 5LAPA 5ECGA 3KZ8A 4A63A 1HJCA 4IBTA 3IGKA 3WTTA 4IBYA 1CO1A 2AHIA 5AB9A 5AOIA 2RMNA 5BUAA 5G4MA 2AC0A 1EANA 1EAOA 5AOMA 4AGNA 5G4NA 4AGMA 2GEQA 5KBDA 4QO1B 2X0WA 4LO9A 3WTXA 2X0UA 4IBVA 4L0YA 4KVPA 3US1A 2BINA 3Q06A 2PCXA 2X0VA 3VD2A 4G82A 3VD1A 4IBZA 5A7BA 3ZMEA 3WTWA 5ABAA 1KZYA 3KMDA 4IJTA
chains in the Genus database with same CATH superfamily
4LSQH 1ONQA 1UOWA 5TE4H 1ILSA 4XP1L 3KWXA 2XC8A 1JE6A 3SDDB 4FC3E 1JHKL 4MBOA 4OD1H 5MHSE 1I1AB 2ZWSA 3RVVC 3X13B 1G4MA 3SPIA 3BP4B 3Q2NA 3OKLA 5E0QA 2E7DA 3VUAA 1KTBA 3EHBC 4UAHA 1QVOA 4TRPH 2Q2EB 4XXCA 3TURA 1JTOA 4YHMH 3ARYA 1XH1A 4BM7A 3THML 2V33A 1OALA 1HL8A 2C7UB 5LGHL 1FVCA 4WHTA 1E67A 4KHXH 5BW7A 1T5XB 1F3JA 4I8DA 4U1MA 2MJWA 1DJIA 4IM8A 4ONFH 3U4KA 2WINB 4P9HL 1ZWIB 1TLKA 1BZ9B 3ETSA 5D8JL 5IBTL 3PPEA 4CGTA 2OMNA 3Q8FA 3C60C 2JQMA 4GXFA 2R9HC 3VFVA 4YZFF 4UT9L 3V0VA 4N5ED 3AXHA 2HP4A 4DGIL 2EUWA 3MJWA 5LG6A 2CR3A 4JO3H 4GRWE 2ENQA 4XBEL 1HL4A 2WCGA 1F86A 1AOZA 5JW5A 4NN7C 3IFOB 4OZHF 5KN5A 1AI1H 1BCIA 1DLHB 1VEMA 2NXYC 2GPZA 3A67H 4LRNH 2I7OA 3FN9A 4MRBA 3IE9A 4XVTL 4POZC 2HFFA 4OLYH 3ZR5A 3A4DA 1LL1A 5KYXB 2DDQL 2WBXA 2JF1A 3FFCB 3HNVH 3ISWA 2ZYIA 1BW8A 3WEOA 4AJWA 4HU8A 1E5CA 3D05A 4PJFF 4TUJB 4HV8A 1KGUA 4AMXA 3N43F 4YDVB 5AWNL 4DKEH 4L1TA 2L0DA 2GHWB 4NQUA 3UZEC 1CLYH 1X9QA 4J3OH 5JOPD 1CFVH 2BH0A 4DEPC 5IHLB 5I5JA 3CSYB 3IN2A 4R26H 3VFRB 1HJCA 4DT2A 2EYTA 5L4JA 2HVJB 1WAEA 1VGEL 3H55A 3WEBA 1U8OA 1NA8A 1MW1A 5I16A 5DUML 1UFGA 2KT6A 3HI1A 3OLDA 1H5BB 3QUKA 2R2BB 3L5IA 1XGRB 1IBGH 1T1XB 3HZMA 4HGKC 5LAXB 5CZXD 5E6IC 4OJEH 3F64A 5IOPB 3PNWA 4ZNCD 1F1DA 3S3BB 3BGMB 5C09B 2WUCL 5BNXD 4OZGF 1BD2D 4O58L 3DPBA 1G7HB 1XAKA 4X6DB 5DFVC 3TJHC 4R5TA 1C12A 4NBXB 5DC0A 2C3VB 3P54A 4I77H 4JZNB 5A7EA 5IQ9A 2B14A 3LH2H 3W0WA 3RWFA 4D9QD 4E42B 2J57A 4QXGH 4TYUA 3MFFA 1IGCH 1DUZA 4RFEB 1EJFA 1I7UA 2YKLL 4MB4A 4ODXB 4IBQA 3QUMH 2G2RA 1I3GL 5K1JA 5EEXA 1FE8L 1NGWA 1DQIA 4N0UE 3I6SA 3BN9D 3TVMC 1Q9KA 1MN4A 4P5MB 3VXOB 2XFGB 1T7WA 3LRHA 4DVRL 4JPVL 4Z7QB 1TQBB 1N19A 4AV5A 4ONGL 1PX4A 4LASL 3TWCH 2ZYSA 4A7GA 3E3QC 1QSZA 5BOPA 2MIZA 5FK9B 3DBXA 4WWKC 4WIQA 5F7BA 1M2VB 2WW8A 2GITA 1PLBA 5E6IA 2FBJH 5AVYB 1AO7B 4P5SA 1MCEA 4R97B 4WU5B 1OCOB 1UH4A 3VFPB 4U1LB 3L3HA 5AKTA 2JCCF 4OZHB 3RWIB 1QPKA 2WXLA 3SE3C 1VFBA 2C1PA 2L4OA 3QAZB 5IJBC 1TPXC 3BLKA 4GKOA 1RJLB 4HUWB 4MNGB 4X7CC 3CVDA 2J2ZB 1F1AA 1IT9L 4AVHA 4B0MB 4OB5L 4NQCB 4XN5A 5EU7E 4ONOA 4PJFB 1DL7H 1WBYB 1VA9A 3IMTA 2BVQA 4QYAA 3N43B 3BWZA 5IQ7H 2CBTA 3EOYG 3NCYP 3HC0B 1QW8A 3MV9A 1ZIAA 3DOSA 3VGFA 4MA3A 3FMGL 2YRPA 5ICXA 4PBVC 3Q48A 4XC1L 3TVMA 2IANB 3Q7JA 3FT3A 2XQ0A 1PLGL 4PJBE 2CA3A 4ZO9A 5HDLA 5I9QC 2YEZA 4FCAA 2DLIA 2DQGL 5ID1A 2BZ7A 3HUJA 3R06A 3QFDB 2EXWD 1Z9MA 3T6VA 1EO5A 2VDQB 3SDCA 4NN6B 3UTOA 4XPBL 2XQBH 4ISVB 1E4WH 4WWKA 4IHOA 1R3JA 1EAPB 3R0MA 2LOEA 2B1OA 1NCJA 4F1SA 2N1KA 5DJYA 3C6LD 4JFEA 1Z9OA 3HZKA 1QRNB 4RAVB 4PB9H 1G9MH 2XTJD 4G43B 4DGVH 3PP3K 4IBZA 1PIFA 3QRBA 5KS9F 2IDSA 1HXMB 3EYUH 2P8MB 4JM4H 1ES0A 4JFTA 1MF2L 3U79A 5DZ9A 4OZGB 4FYQA 3U36A 3VFGH 3BPOB 3UH8A 2WQUA 3RIKA 3GMLB 3WFDL 2OTUA 5IB2B 3OKMB 3UTTB 5JHDB 1FGVH 3STLA 3RU8H 4XHQA 5IEHB 1I1YB 1BIIA 5LGJA 3KVQA 5E8NB 5F89B 4RCAA 1AQMA 3O41B 1XR9B 2ORBH 5JXED 4NRXB 2ZUQB 4P2QB 3BUQA 2M83A 1XVSA 7PCYA 3EIFA 4M1GH 4NZDA 2Y06H 4R8WH 2F8VA 4X4YB 4KKAC 4GAGH 4GINA 4G9FD 2DLGA 1Z5LB 5FYLE 5IMMB 3U83A 1JGVL 1A5FH 2NNAA 4BIKA 4PJDE 4RNRA 2BY1A 2GBUA 4JQXC 4OFPA 1URLA 5EEWA 2IV9A 3GXIA 3SGDH 3A47A 3ATBA 1EXHA 4HIIA 2YRZA 1IJ9A 3ZY7A 1AXSB 5DMKB 1JZJA 3DVGA 5C97A 4XPHL 1X7TA 3D25B 4ZRGA 2K3TA 3IDJA 4HDIB 3H7LA 4YQXL 4QDGA 3CDFA 2FH8A 3O6FB 1CL7H 4WY7H 3P4NB 4Z3TA 4Y4KC 1NGZA 4NCC1 2BFGA 3V2AR 2OL3H 1XH3B 5E70A 2JCCB 3SZ6A 4XB8A 2NYZA 1A9BB 4NN5C 4KQ3H 4Y7MA 3MV01 4IQHA 4PWFA 4MGXA 2E8ZA 4JHWH 4D8OA 2AJSH 2E46A 3RJOA 3RGBA 5E94B 3L1EA 3QXAB 4LCWA 5M95B 4N6RB 1IC1A 1P9MC 2WVVB 3AU1B 4WJG3 4JZJC 4QWWD 4X6EA 1BVNT 1IBZA 1QBLH 1U95A 2AJXL 8CGTA 4CMHC 4CSTA 4PRHB 5CJQH 3BRFA 4LDLB 3QDGB 1M1XB 4DERA 2NMSA 1LO0L 2FCBA 2ZCLH 3JYBA 3MRIA 4JRFA 4HETA 5D1XB 3WN5C 3EYVB 2DZEA 4WEBH 3K6OA 4G80B 1FNAA 3RKPA 4JQXA 3TBVA 5D1ZA 5EU6B 4N24A 4CKQA 1T66C 1WIPA 4N20A 5IUSA 3MA9L 12E8H 4NAQA 5JOFB 4EI6B 1AFVH 4CSPA 3BESR 1IGYB 4IK7A 5FGCB 2P47B 1RCYA 5GZNC 1WS8A 1ZEAH 3SBWC 1OCRB 4W4OA 4BGDA 4LQFL 2I69A 4TLKA 2LTQB 2UYLB 4XAWL 5C0AB 4Y4KA 4NGHL 1IE4A 3W56A 2XN0A 3IFLL 5F7MC 4JRWA 3BUDA 3DIFB 5DVLA 1MLCA 4KBPA 2Y6TE 5I74C 4C54A 2ICCA 4FF9A 1H6UA 1U3HB 5DMIH 2W59A 5KYYB 1LM8V 4ERSL 4DHLA 3T0EC 2GK0A 5D96C 4K3JL 3P2TA 4X98B 4HUXA 2MPVA 1BYPA 5IFJA 3P77B 3C5ZA 3FN0L 4C58B 3KS0H 5GGTA 2QQKL 3DK0A 4KKQA 5SX5H 5G5DB 2XTLA 2AJUH 3E6FB 3H8NA 4ZX4A 1IMHC 3FYEB 2FYYB 4FMKA 2EC9U 4PS8A 3GF8A 5GRUH 4DZBA 3AY2A 1Q1PA 1VEOA 3RVXD 2OAAA 2YAFA 3BOVA 2F6AA 4ZFOB 2WBKA 3GSVB 4NUGL 4B9PA 3MGOA 3K6IA 4OM1H 3T4AB 1J11A 2NT1A 1H19A 3MJ9H 1HKFA 3OWEA 3ZKND 3IRPX 1PZ5A 5HGAB 4HW6A 5GZNA 4FI6A 3SBWA 1R75A 2GABA 3K80A 1YG9A 3GXFA 4X7SL 4DP8X 2IADB 2BVPB 3WIIL 4WWPA 2JKLA 2N3JA 3EO0A 1A4JA 3SKOA 2YXVA 4U4IA 5D7JC 2GK2A 3U0PB 3SPHA 1NMAH 3QYNA 1XL4A 3T0EA 1FYTE 4LEEA 1UKQA 2H1XA 1ACYH 1U8IB 3R4DA 3X12A 5ERWB 1Z3RA 3OSKA 3FT1A 4KJQD 5ALBH 5EF2A 3LMJH 2CGRL 4JR9L 5D9SA 4PLOB 5D2NC 3T0XA 4BYHA 4S0HA 3K6NA 1ZGLM 2F1EA 1ZTXL 3PABB 3FHAA 4BFIA 1ODUA 4GO6B 2A9MH 1EEYA 3Q5TA 4XX1E 1CE1L 3MX0B 3PWVB 3IDXH 3O2DA 5DGRA 5IMOB 2PPFA 2BSED 1KIQB 4FG0A 1QNIA 2IWGA 1K4DB 5E1QA 1C1EL 5HYIA 3MROA 4IDLA 1HI6B 4CJ0A 5JOPE 3BKCH 1U91B 1ZMYA 1AGFB 3RZCC 2VDLH 1DBML 1X5KA 1H8NA 2G3ZA 2QLVB 2IWEA 2W0FB 3HI6H 3QDJD 4I9WD 1HILA 5LBGA 3KCWA 5C08A 3ULVF 5CIPH 1NAMH 4M43H 5DJZB 3WD5H 1XF4B 4MB3A 2UZXA 2V9TA 5F7WC 3JBG7 5FOBB 1EMTL 1JHTA 1M7IA 4N2FA 4PJIE 1KZYA 2CO7A 3FONA 5HVWA 2VL4A 3J8F7 4IOSA 4LAQL 4B96A 1GSMA 3FTGA 3ABKB 3IJYA 3MR9B 4A2DA 3NZSA 3NBNA 3ZPDA 1UD8A 1XXFC 4G6FB 3VQMA 5MEPA 1H0DB 2CR0A 3BWAA 5C9JB 2ADFH 1J88A 1R6VA 1X5MA 2NCMA 5INDB 1BD2E 3E8UL 4MVBC 3VXRB 2OK0L 2IOOA 2QVFB 5D2NA 1SY6H 2IALB 4L3CB 2BNUA 3HKFA 2FUQA 3STZA 1QKZH 3CZKA 1U8MA 5HPMA 3BZ5A 4R5VA 5JHAA 2HRHA 3HE7A 3HG3A 4HJJL 3WFHA 2QQLH 2L7UA 4JLRB 1JWMB 2E47A 2MHAA 4D9QE 2ZXBA 1INDL 2EKJA 4G8GB 2VLJB 1MCBA 2F5BH 2F7PA 3B4NA 3HG4A 1USQA 1RXLA 3BT0A 3UMNA 4DP0X 3UBXI 1M7DB 1YYML 2QADC 1IC0A 1TEGA 3RZCA 3O6LL 2EJ1A 4NPYA 3NIDF 1W16A 4ZUTA 2CJTA 3F7QA 4G1MA 3Q01A 4XMUA 3QPKA 3CDCA 5ADPL 5HJ3A 3DC0A 4IKJA 1OAXH 4FFVD 4JRYD 4KNTA 4ZPVB 4NWUH 1S7UB 1N5YL 4JDVB 2ATPA 4YXKL 2Y1AA 1C5DB 2PW2A 1YN7A 5LXGH 3LOWA 1SQ2N 2Y7NA 5C1MB 5HYSG 5D93C 3RTQC 5IJCC 5DUBB 1QFUL 3DWTA 5IBUB 1BVKA 4N28A 3DTXA 1JP5A 3EYQD 3RY4A 1QYGH 3WS3B 2EE2A 5EPMA 4LXFA 5KVFH 1DBBL 4JM2F 3EGDB 2AITA 4OQTA 4AH2B 3FF7A 2GUYA 3VACA 1UKTA 1JPTL 3T65A 3N9GH 4TUOB 1BAFL 3HI5H 1PCXA 1T83A 5KZCD 1L9TA 4N2EA 3F7KA 5IQLA 1M71B 5FUCC 4KVPA 5DVNA 6PAZA 3ZTEA 4JFFB 3NACL 3MLPA 5FHBL 1QW9A 4AQZA 4QJ5B 2JQAA 1URZA 1DSFL 4FFTA 4NENA 5ES4B 1INEH 4IRZA 5BVJB 4BKTC 2KKQA 2NW2B 3JV4A 3FB5B 4OUUB 5I0XA 3TH4T 2EDWA 2J8UF 4M3JA 1GY2A 3SO3C 4Z7UA 4XVJH 1KCVH 2GFBB 2NLJB 3L3JA 1SEBA 3MV9E 4S0TD 2XZCL 1QLFA 1JFQH 4PJXA 4FNRA 2ESVB 5HVHC 3RTQA 1MIML 2DWEA 3ZHDA 1FO0B 2RCSL 1U8HB 1B0IA 2D7TL 1E8WA 4E9WA 3HUJE 3P0YH 4NFBA 3BKML 1IFHH 2W60B 3VGGA 4BZ1L 4AM0Q 3JWNH 1F13A 1U36A 1HIMH 4NO0D 2YBRA 3IAPA 1OAZH 1XGQA 4JDZB 3QUZB 5KSAD 4CN6A 4JHAH 3OR6B 4KO9A 3U0TA 5EOQL 3BQUD 4KKCD 5IHBA 1E3FA 2GT9B 3GXDA 4UT6H 4BK4A 1G9NC 4JRXA 1U8PB 4YHKH 1D5IL 2YBGA 5GGSB 4UQ2A 1SEQL 5EU4A 4C55A 4KJYB 1OGPA 4ODWA 4NQED 1WFMA 2BJML 2CLZA 2AEQH 2QFPA 4QRRB 3V5KB 1A1NB 1DE4B 2JKIS 4RZKA 5I1LB 3BAIA 25C8H 2BHUA 3BAXA 2QPFA 3MRHB 2R1WB 4F7KA 3WSQH 5ALCH 2Y22A 2HX8A 3UC0H 1UTDA 2EUZA 5HJGA 3F00A 2XN9D 1NCDH 5K9KB 4I0PB 1UURA 3MU3A 1I9JH 3LEXA 3TTSA 4EXKA 2UY6A 4HQQL 4LCIH 1TT6A 3M8OH 4K07A 5L6YH 4LHUB 1YJDC 3ILDA 3KLDA 3QVAA 4EDXB 5C71A 1N70A 4LPYA 2X4PB 3VCLA 2XBTA 1QBMH 3QR2A 3VXMD 4WEEA 5F88B 3T9WA 2RFXA 3NGBB 2FJSA 1L7TH 1OY3B 4PRNA 2KDYA 3KXFD 3KL3A 5AOLA 4JFUA 3QNXA 3KL5A 4XOAA 1TJHH 3MRDB 3Q5YA 4YHNA 2W0PA 2WZPD 4AGOA 4Z6AT 2WWKO 3MRJB 2FR4A 4MFHA 5BXFB 3NEXA 2DTML 1G7QA 3MYJA 4JM2B 2YGPA 1JWSB 4FG4A 1MXDA 3WKMH 3LXBA 4HIXH 2CCVA 4XP6L 4PIRF 2IWFA 4RDQF 4UINH 1KYAA 3ARFC 2UXTA 3V0WL 3VXSA 2ZXAA 4DEWA 4XP1H 1ETZA 4GFXA 2AMUA 3H2QA 4JUSA 4ZS6C 5BZDA 1JHKH 2QMJA 5AZ2H 3IKCB 4FS0A 3B6SA 1XGUA 1S7SB 5TDOA 3FSWA 1FI8C 5DU7A 1AXTL 3T0DA 3VRIA 1J18A 1U8CA 1NC4A 5D70L 3ESOA 3MV8D 1O7DE 3B7YA 1MELA 3EBGA 3THMH 4C59B 2ZX5A 1QX1A 5D7IE 1KJ2L 4K5MA 4KC3B 3QWQB 5LGHH 5LUMA 4KQ0A 4AYFB 4APQD 4M6AA 4QT5A 2J8UB 4DP7X 1GY1A 4PFEA 2ADGB 4EN3C 5ISZA 5CSZA 4Z76A 4P9HH 5D8JH 4CADB 1RURL 1LWHA 1XF1A 5IBTH 5BQDA 1I9IL 1F0LA 3OV6A 4XNZC 4PJHA 5JO5A 1PNCA 3UROR 2WC7A 4UT9H 3NJHA 4U4BA 5EZJA 3QZLA 4MD5B 4DGIH 2JIXA 3LH9A 2PXYB 1M53A 1G7JB 3FULA 1TZAA 1A6ZB 4Y1AA 4B60A 3MJ8A 4NKOB 2ADYA 1DJXA 3BDBA 5B38B 1OL0A 4FQIL 4BZ2A 3PWNB 2J1XA 5E4EC 3VXNB 2YA2A 3LV3A 3A21A 4N2DA 1JK9B 1KCBA 3UCRA 1ZA6B 3OLIA 1A9EA 4KPHL 5IG7A 3LQZA 2W07A 3CXDL 4H8PA 3MCKA 1YAZA 4J6RL 2DDQH 1UXMA 1W0VB 1QZNA 4Y9BA 1QAWA 3G3LA 3PJSB 4K94C 1TTFA 4M61A 2CDEB 4ZAKA 5EMYA 5FOJA 5IR1A 1CGWA 3FT0A 3WIFA 5CLWA 1SVBA 4XP5L 4JHBA 4PS7A 4Q56A 4FQJL 1AGEB 2EE9A 2WLHA 5B8CB 2ITDA 3CBRA 1UD6A 4ANUA 4EN3A 2WKGA 4L8DA 1IGTB 5C0FA 1M6OB 4LSTL 1KUMA 1VGEH 1YY9D 1OP9A 2H6UA 4JFWA 1HDMA 1XFPA 3PDDA 2APTA 3VI3F 1ZK9A 3V52L 5DUMH 4AIOA 4DSYA 1M9SA 1B2YA 4GRWF 4DIXA 1J9QA 2P80D 1I3UA 2BVTA 3ZE1E 4LSVL 3KNBA 2YGQA 1MSPA 4TSAL 5I23A 5CSBA 5DEFA 1MCRA 3QS2A 1R5IA 4LL9A 3RRQA 4D8PB 2CK2A 1NANI 2O5ZL 3K74B 3CN2A 4HOZA 5CZKA 2YAHA 3RWCB 2FAUA 1OIOA 4O58H 3OX8B 3HC3L 3DV4B 3FF8A 2NY2D 5EBLB 4V11A 2NPLX 3TN0B 2PWDA 3ME0A 2PPDA 3E2HC 3F7PC 4F15B 1ZVSA 4P59L 4CC4C 4YHPA 4M5ZL 2X9WA 2YKLH 2QGCA 1L9NA 3N50A 4IRSC 4L29B 1I3GH 4PVNA 3FFDA 4N22A 4RRPA 3VD5A 1FE8H 5HJDA 1JGIA 1JVOA 1D2PA 3IGAA 4HHAA 4JFHD 3G04B 3QIUA 4PP2A 2VJXA 2MNUA 5JORB 2WBJC 1W8NA 3MODL 4MAYD 4L2YA 3VG9C 2OSYA 4JPVH 2X5PA 2MEJB 4N0YL 4XMLL 1HH9A 2OXHB 3KPPB 4ONGH 4LASH 4OLVH 3LRMA 3KPNA 3NEEA 5FW7A 1AC0A 4BV1A 3ROOA 1C7TA 1JCVA 1N10A 4O2FA 4DPBX 1Z1WA 4JFQA 3OQRA 2H26A 5GS0D 2O30A 5LNGA 3DO7A 5DQJA 2WVUA 1MCHA 5F3FA 4ZSOB 2IF7A 5C08E 5JIDA 4LLUA 1QHPA 2E7BA 3L4YA 3P30L 3FUEA 4J4PC 1TZGL 4U49A 4E41B 3WLBB 1EBAA 4PQXA 4HC1L 3VFSB 3K72A 1MAML 5KBMA 4M9PA 1KPUA 3MOBL 4L1DA 1NCUA 4LKCB 2EDLA 4FXLA 1OTUC 1SJEA 3QZOA 1IT9H 4Z3JA 1B0RB 4OB5H 4PJ7A 1P4BH 4N0CD 1IAMA 4CC4A 3FT4A 5HHOD 2LU7A 5F44A 3WNIA 3KPMB 4HHWA 2A77L 3HKZA 3VGAC 1XGTB 5A43C 2E86A 1ROWA 4FQXB 4RX4A 5D2NE 5FYJE 1C8PA 2WJ5A 4XC1H 2UZIL 1L9OA 4XP4H 5EUOA 4P2OD 1PLGH 2K7QA 2K70A 3UBFA 4IHBA 1T21A 2CA4A 1JPST 2F0CA 2EAEA 2NY3C 1IBBA 2ZCKL 3UG4A 4P46C 2DQGH 4IGBB 1Z3GH 3A22A 5B39G 1IBYA 1T03L 5LJYH 2QKIC 5I8CA 2Q87A 4XPBH 4ABWA 3BIBX 4ATWA 1R24B 2CIKA 4KKPA 4N86A 1KXHA 3EBAA 3QQ9D 3CN1A 1NWPA 4BH8A 3QI9C 2XCMC 4KY1L 5DWUH 2I7SA 5J6GB 4U1NA 3BKJL 4I2XB 4QMEA 5EIIA 2YFNA 4J4PA 4NRZB 1F3DH 3UG3A 1AS7A 3T3MB 5HD8C 1KT2A 5LQBL 1INQA 4R4BA 1JNJA 1HAUA 4QKTA 3WTXA 4GP5B 3TFBA 1W8OA 3NJNA 2FHBA 2NTFB 1LDSA 3WFDH 3D4GA 3L5WA 3VVVA 4Y2DA 4KQ4L 1EO8L 2HKAA 1SVZA 1S5HA 3HRZB 3EF4A 3RNQA 3TO4C 2YMXL 4MSWB 2ZG1A 5DJXA 3KLAB 4MHHI 1D7FA 3P9WB 3QQ3A 3X1GA 3QZWA 1NCHA 3H6AA 1BXVA 3N0PB 5IZ7A 3LSOB 1UADC 1L0XA 3LZRA 3O3DA 4PJBF 1U58B 3AQXA 4XBGB 4F3FB 5IROA 4HZ1A 2P46B 1GYUA 3IBOA 4QY8B 2IV8A 3WYRA 4BFNA 4JKPL 5T5FL 4Z8FL 4F7MA 2DJMA 4P46A 4ETYA 1ZHLB 2VERN 3WLWC 2VCOA 4NWTL 1JGVH 1MI5D 3M7FB 5DJCA 3CX2A 3WUWA 3Q1SH 3VJ6B 3REWA 3UG5A 2QKIA 3L5XL 5EEYA 2ITCA 1ZHNA 3FUKA 2YXMA 2XWXA 1WV7T 3L2LA 3QI9A 4XPHH 2GC7C 3ELQA 3HBGA 5BRZA 1EX0A 1S9VB 3T8XA 2FX8L 4YQXH 1CDHA 3QHZL 1VLXA 1G6RL 4JL1A 3GJFH 5EEUA 1MCCA 4HKBA 5TK4A 3MV7A 2KZKA 1E2VA 4HK0B 2WNGA 5DEGA 4ANKA 3I9IA 1KIPB 2GAZB 1MNNA 1YQ2A 4Z7UE 4MNQD 1N0LB 3RDTC 4GG6E 5I82A 4PJXE 3TO4A 5DJ2B 2ZG3A 2MCAA 1B2WH 4UU9B 2PYEB 3D08A 3AQYA 4PRDA 1VB9A 4YJZL 2XPZA 1E8ZA 5JPMA 1WH0A 5BS0A 4G7SB 4NQEE 2IPKA 4HCGA 2HUEA 2Q8BL 1IM3A 2AJXH 3MUGA 1QR1A 1JHLL 2KLTA 2N7AA 4PJDF 1EPFA 1P53A 2NQ3A 3EDDA 1EGJL 3HA0A 3GKZA 4HWBA 1CPUA 5JQ6L 3KPSD 3NJXA 2Y3AA 4HZLA 1G7MA 4WO4C 2VL5B 3B9KB 3MA9H 1H3WM 1A1MA 2Z35B 4GMSL 5A16B 3BFQG 4PP1C 5CU9A 5KYWB 1KCWA 1BQHG 3LYRA 3O9WB 4JO8A 2IBBA 2XQYK 4YLBA 2AKRB 4JPIA 4LQFH 2V5YA 4LQ1A 1BZOA 4XAWH 2WLZA 4AGMA 1AD9B 1U8JB 4NGHH 4NM8L 2DQFB 3AUVA 3IFLH 3KXFE 3W39B 4JG0L 5EDSA 3OJVC 3SE8L 2W95A 3P4MA 1AR1D 4WGKA 3QIBD 4Q6IA 3RDTA 3GHBL 3L3KA 3PF2A 4K3JH 2CXKA 4H20L 3C2SA 3DGGB 1RSFA 3FN0H 4Z7OB 3MNWA 4NQQA 1BHGA 1DVYA 3WL9A 2QQKH 3EUUA 2YSSA 4ZMZA 1OSZA 2NXZD 4X0KB 4GKLA 4PJBB 2XIBA 4GAYB 2Y9RT 2AK1L 4GW1B 5AYUL 3OMZA 3FCSB 3L4CA 3UTZB 3S9DB 1NFIB 3OKDB 1KN2H 1VZIA 2KQNA 3V9CA 2X1PA 3VDAA 43CAA 2XV0A 4NUGH 4PJ5A 1X5JA 4AI7A 1OD7A 4WO4A 5FGRA 1A9VA 1A6WL 4F7PB 2FECL 4K71B 4JG9A 5EA0L 3VXSE 4ZD3H 2N7SA 5JLZA 2BSSA 3N85H 4F27A 4F7EB 5T1LB 4OLXL 5AZEL 3SKNA 4RGMB 4QHUB 3V5HB 4X7SH 3RHWK 1OLZA 5KAQF 4Y19E 5ESQB 2UXFA 2NT0A 4QHLA 1WZAA 1DUYA 5GSRA 4DP9X 2YQBA 3H9ZA 1A25A 5F0MB 1PL3A 3K8LA 1NJ9A 2R23A 2ICEC 2VITB 3IDGA 3PXHA 4GRLB 4X4MA 1NIEA 5F0LB 1JYXA 3MBXL 3FB8B 4IBWA 2C9QA 4CN4A 1AGCA 1WP6A 3PGCA 2OMUA 5HYQA 5J6HB 2QQNH 4FNQA 4BWTA 5KVEL 3MUJA 4K3HA 1TETL 4M8UA 3DIVA 2CGRH 3KPLA 4JR9H 5CGMA 1IAII 4HT1L 4RQQB 4LF3B 1NZRA 4PJHE 1ZTXH 1BLIA 4RAUA 2O1AA 1UT1A 3QEUA 4K7FA 4Z1PA 1G5AA 1CE1H 3V0GA 4R96A 2XQYA 4TVUA 4Y1AE 4M93C 1JV2A 3MLUL 1I4FB 1PKQA 4PJDB 1C1EH 3G6AB 5DD6A 3F6LA 3KVPA 1TUPA 2YN5A 5I0WA 3PRZA 1MVUA 4A6YB 1I8UA 1ZXQA 4PRIA 1KFAL 1BF2A 1T1WB 5E5RB 3SIKA 4ODUA 4KJPD 2X4TA 1RUKL 1WCBA 2MTAA 1EMTH 4GJTB 1NMCC 2PW1A 1HOCA 3CHQA 3D2TA 1N8ZB 4LAQH 1ZLUH 3B5TA 4Y4FA 3QHTC 3CC5A 2ICEA 5E00B 1OGAE 3CPLA 4WJ5B 2Y1YA 3CCHA 3QFJA 3IS0X 4ZOEA 3FQRB 3MRGB 3HBQA 1G7LB 3UO1L 1BVNP 5DO8A 3HB3C 1TMCB 5DRXB 4L4VD 1BVZA 3LNIA 5EO1B 3SPGA 3F85A 3GSUB 1MW3A 1T1ZA 3E8UH 3L95A 4LLDB 4AC2A 1TLMA 4FLHA 3FKUS 3NZUA 2OK0H 3QC6X 4MA1B 2BXYA 4Z95H 2VM4A 3CLFL 3B2PA 4G70B 3QORC 1UJ3A 1PZBA 4IMKA 4HJJH 2I9LB 1H15A 3CFCL 3GJEA 1UACL 3H2PA 3BO8A 1Z9PA 1Z9NA 4N9OB 2YMTA 1INDH 4Y16D 2DW5A 4ENED 5AB2A 5K93A 4YBQC 1RHFA 5JIQA 4ZFFA 4FG2A 4GUCA 4H26A 1HSAA 4N1EA 4KMTL 1YYMH 4J12A 3N42F 3RFZC 2FEJA 3O6LH 4LKXB 4JFHE 3VFNA 1FH5L 5I6NA 1XF2A 4M4RB 1P84J 1EERB 4PJIF 3HR5B 1TTGA 2ENPA 5ADPH 2AQSA 2XZAL 3EG9B 2L7EA 2CIIA 3RX5A 1DQJB 1HWGB 3GSNB 1N5YH 4HWZB 1PBYA 4N87A 5E2UL 2YPKA 4XR8C 4PCYA 3NJMA 2HT4D 2QL1A 4FA6A 3FJTA 2H5UA 1L3NA 2NY5C 4HUCA 2YSTA 5T1MB 4YSRA 4QTIL 1QFUH 3CPUA 5J7CC 4GB9A 4ZFGL 5D4HA 2XA8L 2Y36L 35C8L 3NSDA 1T20B 5DRNB 1DBBH 3CN3A 4I1NB 2X4RA 2D0HA 1HVXA 1PFOA 4HF5L 2H1PH 3V9EA 1JRHI 1YEKL 1X6NA 3GZKA 4AQOA 1JPTH 3DJRA 3RVWD 3TOPA 2ATAA 1BAFH 1ZSDA 2HT3D 3ARGD 2OMTB 4MLSA 1JZ3A 3IVKA 1WTGT 3G6JA 3P9LA 5B3NA 3RFZA 1LO3L 2Z7YA 1W72B 5HYJA 1ONQB 2X6UA 5SWZA 4YAQA 3T0AA 2FVNA 3HJ0A 1LDPH 3NACH 5FHBH 2P7TA 1FIGL 2CNYA 4G6AD 4Z7IA 5I5IA 2C8NA 1JZFA 3KM1A 1ZS2A 3OKLB 1K3ZA 1P6AB 5DA4A 1QVOB 2DY2A 1NC2D 3CZNA 4H7VA 1XXDC 3ABZA 3PE9A 1JUFA 1MQ8A 4HJ0D 2ICWA 4LVNC 3UACA 2FX7L 3O4LA 4PGEA 3F58L 1CXIA 1FVCB 3EJZD 3HNTL 2XZCH 2YHGA 2YPLA 4WHTB 4A39A 1WYJA 4HUVA 1FYTB 5EUOE 4G71B 2DM2A 1MIMH 1BAWA 2Y2YA 3APMA 2RCSH 2QBWA 3CFJA 2D7TH 3BSZL 4XPAL 3I6GA 3BKMH 3LEVL 4DF9A 4HWEL 3QJTB 5TDPA 3J27A 3P2BA 3V0VB 3VFVB 1MCFA 2X4OA 5CILL 3GEWB 3KWVA 3ZTJG 3ARBD 3T2QA 2QTVA 3D69A 3LRKA 1R33A 2O61A 1EH9A 2FWUA 5EOQH 2R29L 4X80L 3D06A 3LXUX 4WHYG 5JW5B 2DD8L 1SXNA 2VB5A 4MJHA 1D5IH 2A5UA 4XVSH 1SEQH 4RGND 1J0IA 3LCYA 3CXHJ 3Q2LA 4RMRA 2BJMH 4BHUI 1XB3A 5EOCH 3FUDA 3N42B 2ICES 2OZ4A 3D1MC 1ZD6A 4P5TC 4Q4IA 2L7JA 3OWRA 4Q0XL 1DQVA 2WNWA 4E9SA 3DA0A 2AW2A 3EHBB 4Z7NB 4HV8B 3FQ4A 1T6BX 3EGSA 4WENB 1WO2A 3EOTL 3F3HA 5SX4I 3QWRD 3JV6B 5D7LA 1HZHL 1XIWA 3KLKA 3NIGE 5HXMA 4HQQH 1F90L 4JPWL 4OZFH 2DQ6A 1KLFB 2G5BA 1TNNA 2OBGA 1T0PB 4A7QA 4YHIB 3FQ2A 3HUJF 3QJUB 1SUJA 4ODTL 5I16B 4I4WA 2CPCA 2RJMA 3QUKB 1K2DA 3N1PC 4BK5C 1GMIA 1DQQA 2H0EA 3ARED 4MYPA 5I75C 4JK0D 3P11H 3QW9A 2YAMA 1AMXA 4U6HA 4UAOB 1RZKC 4A7VA 1Z32X 4XAKD 3C60D 3NCBB 1GGIH 3CZGA 3HZMB 3TPKA 4ODSL 2XWEA 4Z78A 1VKXA 3PXLA 4DQAA 3N44B 4BCYA 1A4CA 2LVCA 3PNWB 5BRZE 4GBXA 1NCBH 1RU9L 3GSRB 4BBWA 3V0WH 2NXYB 3POCA 1UGKA 3DPBB 2DN7A 3GPEA 3PL6A 3OAYK 2FT7A 3MV7E 5C07A 5SV4A 3A5VA 4P5TA 1C12B 5FCUH 3OHMB 3WMSA 3VGHA 5EN2A 3W0WB 1L9SA 1CGXA 1OSEA 3RWFB 1FVDA 1OAUL 3MFFB 2LFEA 1JGDA 2H8PB 1I7UB 3KPSE 5DHMC 5F6IC 4B50A 1KJ2H 2G2RB 3O6ML 3MJ9A 4HWNA 2IO5A 1B0WA 4TXVB 4DEPB 4X4XB 1FH2A 1NGWB 3S98A 3SBPA 3IMBA 2Y1ZA 4UQ3A 4PRBA 1MJ7L 5I30L 1RPKA 5A1AA 1L3WA 3IM1A 2XN2A 4NS0A 1WAPA 1Q9KB 2EDBA 1LYQA 1SMAA 4UQ9A 1RURH 3ZKMC 5D5MA 1R4XA 4ZMWA 4KOBA 1BZ7A 1SXZA 2FNWA 3II3A 2Z9TA 1AGDA 4LCVA 1Q38A 2VZVA 3UC2A 4NKQB 3DBXB 4BA0A 4DWHA 5HYSB 3IEAA 4OT1L 1ZKAA 2OSXA 2GITB 4YSAA 4QXVA 5E6IB 1BPLB 5I0ZA 2WCSA 3DO4A 2KLSA 4FQIH 4KXZI 5DWPA 2CKBA 2K4WA 2QV4A 2X6MA 2B1AL 3QEQA 3CXDH 4IKNA 3Q43A 3ECQA 3P9MA 1FNGA 2NUTA 3Q2VA 4J6RH 5A2LH 3AWEA 2XZQH 3MMEA 3EADA 5IWLC 4JKNA 5B1BB 1VFBB 2C1PB 2UX6A 3WNNA 3CHSA 3ZL2A 2M8XA 3L1OH 4ZMNA 4N26A 3WS6A 4QRPA 3TJHD 3MJ6A 5JNYA 1T7XA 3II1A 1EVTC 2BMKA 5D7IF 3VXQA 1A7BA 4BSVA 2R4SL 4LSRL 3RIFF 3D09A 4KXDA 2BRRL 4XP5H 3KG5A 4WI6A 4FQJH 1RZ7L 3MV9B 1RUPL 5E4AA 3DOSB 4MA3B 3AS3A 1NAMA 1GHFL 3TVMB 4LSTH 4ABVA 3FT3B 1V3JA 1BIHA 3RKDD 4RFOH 3V52H 2BC4A 2XY1A 2YEZB 5DURD 1ANUA 4QD2E 1AQ8A 3RAJL 1EDQA 3V10A 5ID1B 4N9GB 3HUJB 3R06B 1A7QL 4BD4A 2RR3A 5BZXA 3SDCB 3KHOA 3P3TA 2Z1KA 3DDFA 1UENA 4WWKB 4IHOB 1JPGB 1R3JB 4LSVH 3VTAA 5CCKL 2XY2A 3WNKA 5DJYB 2WOBA 4JFEB 2R69L 3HZKB 2WQWA 1BAGA 1MFCL 3V4PH 5EO9A 1B4TA 4DP4X 1KJ3L 3VSVA 2VXTL 1U8QA 1RKRA 3HC3H 3I3DA 4TV3A 1TXKA 2CD0A 4H8WL 1ES0B 2UWEA 4M7JH 3NVQA 2NSQA 4PGCA 5DK2A 2X6BA 4AY0A 5L4FA 1GW0A 4UV4L 3U36B 2VM9A 4MCMA 4X4ME 2OTUB 1TPXB 5CKGA 3FSAA 1FWXA 2H41A 3STLB 2FUTA 4JFYA 3BUIA 4P59H 4UYQA 4P23D 4X2UA 1AY1L 1BIIB 5FF6A 5JR1L 2WYHA 3UTSA 4Y89A 4J5VA 1JD9A 4TUKL 3D7PA 1G7IA 3E38A 1HWHB 2C1OA 4X7DC 2VMDA 4HS6A 4FZ8L 2ZOWA 5C0NC 4B7LA 3MODH 3OKNB 4UM9D 2FQFA 5I9QB 4M6ML 4N0YH 5EBMA 4XMLH 3D3VA 3WJJC 2CO6A 2NNAB 3ZE1F 3NK3A 4FI7A 3BVNA 1FZJB 3MKGA 4RNRB 3KPTA 2CG9X 4HVBA 4W9CC 5FHAH 3P2DA 3SN6N 4DK3A 2HKFH 3FU9A 2AQ2A 3PHAA 1UEMA 5I71B 3DVGB 3QRLA 4KITB 2X4SA 4OBRA 3P0VL 3O3EB 4G42A 4OJYA 2FHCA 1IILE 3IDJB 3P30H 4PRIE 1IVTA 1Q9WA 3GMQA 1H3GA 1IGML 4W9DC 2AQTA 2AMGA 4HC1H 2PO6C 4MJJA 3RY5A 4L3FA 3MOBH 4EI5C 1J8KA 2GBVA 3R0NA 4Y9EA 1E90A 3CAFA 3C5SA 3VVWA 3QFJE 3A6BL 1EJ8A 1HT6A 4ES9A 5FWRA 2A77H 1A3QA 3Q3GA 5CUSL 2FL5A 5JHBA 2FLMA 1MCIA 5HI5C 3PXJA 3MACL 2WXNA 4LCWD 5KBNC 4KTEL 2UZIH 4ZO6A 1U95B 1N2RA 1B4RA 4PWEA 4GSDL 2FQEA 3A6OA 5IREA 2WM0A 3RVTC 3BE1L 2ZCKH 4JQVA 3VD4A 4R7NA 3WXWL 4GP4B 1KJMB 1T03H 4S1RL 3TBVB 1UM6L 5LDSA 4OI9A 1KCRH 5D1ZB 3NP3A 4P2RD 5GRVK 4GLRI 3OKEA 1MJ8H 4FQ2L 4B7IA 4ZUWB 1O9VA 1OKEA 2ERJC 5F96L 1N67A 1F4XL 3NK4A 3BKJH 3S96A 4BH7B 4MNHB 5AAWC 4M7KL 4UI2A 2PO6A 1PAZA 3D5OF 4QCIA 3L17A 4XN9A 4M1CC 4KK6C 5CN2A 1MLCB 2EEBA 3QUYC 5ADOH 4IOFC 2V6HA 3BPLC 3KPRA 2OCFD 4MX7A 1QA9A 1WA1X 1EO8H 2ZAIA 3NCWA 4KQ4H 4NSKA 4XCEB 3TBBA 4JJ5A 1A1OA 1EAOA 2GK0B 1YNLH 4LCCC 3WKNA 2QV2A 1U6AL 2Y6SC 4HUXB 4PJGE 5SV3A 4U7KA 4PJ8D 4N2HA 3K5RA 4OF8A 5IFJB 3O81A 3C5ZB 4R7DB 2WANA 4NKIL 4H1LH 5C2UB 5IB3A 1FHGA 2BINA 3Q06A 3MBEA 1EEZA 2XXCB 5DJAA 1HH6A 4JKPH 5T5FH 4Z8FH 4LRIC 4DZBB 1ETJA 3MUY1 1CUOA 5H35A 4OF3A 3L5XH 2YD8A 1FFRA 4XZUA 3MGOB 4IJTA 1IAOA 3AACA 1BXXA 1R0AL 1U8KA 3G6JE 3ZE1B 4FKKA 1DJZA 3DX3A 4QGTA 5HYJE 5SWZE 4A2GA 1PZ5B 3WNLA 3B2DC 3V5DA 2XT1B 2FX8H 2QMKA 2VDQL 3QHZH 3AS0A 4KKLC 1XV8A 4DW2H 4AL8L 4TOYH 4OZIA 2KS0A 5AB1A 5JW4R 1SJMA 1E5UI 3C87A 3MRRA 3EO0B 3L4WA 3OXRB 4PWKA 3FC8A 1A4JB 3SKOB 4FQCL 2GVYA 1JWUA 4MASA 4YK4B 1PZAA 2A38A 2X4UA 3RNKA 1OM3L 1BOGA 5LKNA 3F62A 1D9KA 1I7TA 4XGZA 2DAVA 1HTYA 2C9AA 4UM8A 4LCCA 1BG1A 4WW2F 5TDNA 4RESB 2ED7A 4WQOA 5DD0H 3X12B 1FJ1A 1KXVC 1CQYA 3C8KB 3LB6C 5FW6A 2BOLA 1G84A 5D9SB 4GH7B 1S7TA 2P5WA 3J2PA 4GAJL 5DHVH 2B9AA 5TQ0L 2Q8BH 3GRWL 1JN6A 2WTPA 2MQGA 4HISA 4BFIB 3ILEA 3ZLQC 4LRIA 1EEYB 5FW8A 4BELD 1A7RL 4RA3A 5T5NG 5LB1A 1EGJH 3EJTA 1DEEA 5E51A 1R3IL 3S8GB 5JQ6H 3W57A 1T2QL 1FL6A 4HLJA 2IGTA 5F9DC 4F8LA 4WI9A 1I8KA 4JAMB 4GMSH 3DHMA 3I74A 3SGEI 5C08B 1HILB 3V95A 5ANHA 3NMEA 2VH5L 3QUXA 3W38A 5C0DA 4NPKA 2G4EA 3IU3A 4LARL 1XZ0A 4NM8H 4WO0A 2QJDA 2A9NH 2J5LB 2UZXB 5H37A 4XBPA 1JHTB 1M7IB 4PRPA 3SE8H 1ETB1 5I1DA 3FONB 1M05A 3ARQA 1MDTA 4GG6F 5D7LE 4UT7L 3FTGB 3IJYB 4MMXC 4M29A 3GHBH 5DK0A 3D12B 1PJWA 1R5VA 4U31A 4ADJA 5D7JD 5MEPB 5GRWA 1RPQA 3BWAB 1E9QA 5GISL 1HQ4A 1TTBA 2IH8A 1KXVA 5ICZB 3LKPA 3PFUA 2OULB 3D4ZA 4OFYD 4NJAL 1EFQA 1S7QA 5EORL 5D2NB 3DHJA 2BNUB 2NX5D 3TV3L 4NO5A 1PY0A 1ZPUA 5CO1A 3CDYA 3STZB 1U8MB 2AK1H 5LCVL 4XWGL 2V9UA 3BQVA 4O00A 3HE7B 4ODBD 3WFHB 4EI0A 4FG6D 4G5ZL 4JO2L 3IJ7A 3U1QA 2FNBA 3UJJL 2MHAB 2VO5A 5GS1A 1HKLL 3ZDZB 5I2IA 3S35X 4X4KA 5IFHL 1EVUA 1V5JA 4H0HB 5EA0H 4QRFA 4DQOL 1ZPLA 2VZ1A 4K0OA 4BRVA 2Z31C 2Y23A 4LSUH 2J88L 4OLXH 5AZEH 2JI2A 4NPYB 1PZSA 4PIBA 1IGJA 5HDRA 4ZUTB 2EVHA 1MKFA 4G1MB 3FUHA 4W9LC 5JW4Q 3DSFL 3ZRCC 4HP5A 1WDAA 4FXGB 1PGRB 1ZE3H 4PYHA 4ZS7L 4GSUA 5HJ3B 5KANG 1Z5HA 2QSVA 1QBAA 4K7PY 1UG9A 4HFUL 1IC7L 1CBJA 1MRFL 4MMXA 4KKNA 1I75A 1RK0A 4BK8A 2ATPB 2G0KA 4XX5A 2PW2B 3K71B 1YN7B 5IM7A 3L81A 4R7LA 4M7ZC 1ZLSH 3IAGC 3SOTA 4N3UA 4HULB 5KVEH 4PHXA 1UWXH 3QULA 4OCWL 4DOHB 1TETH 3V6OC 4YMPA 1Q4NX 1RP9A 4HT1H 5D5ME 5AVZB 2QSQA 3EW3B 2HAZA 1BVKB 2D31A 3DTXB 4YWGH 3EXJA 1WG3A 1WC7A 3TXAA 4MVBD 3LQAL 5EPMB 1OP3H 1E30A 5CJ8A 5F1IB 4GRMA 4OM0L 1CT8A 1OE1A 3U2IA 2B08A 1AYRA 3CZLA 3U4BL 4OJDH 3MLUH 3SE6A 4FTVA 3RY6A 3BGFB 2YC1A 3LIZL 3G08A 3IPFA 3OAZK 4HPOH 4PYGA 3FPXA 4WZ9A 3CFQA 1ZLDA 2FE0A 2DJUA 3WJMA 3FS9A 3FUIA 3DGDA 4HMCA 1M3JA 5CINH 1AQKL 2QADD 4ZFOL 3WO4C 3ULUL 2YRBA 1YY8A 3CU1A 2DKSA 1RUKH 4ALAL 2DQCL 2Y2TA 5AQ0A 2J7LA 4NENB 1BQRA 2LVEA 4LPWA 2Z8RA 3JV4B 1JI1A 4CNIA 1MAKA 4P3CL 4W81A 3D51A 4P2AA 2HFGL 4HIPA 2P5EA 4Z7UB 1VHPA 4J28A 3L3JB 4JQIL 2WCPA 1SEBB 4K55A 4LOUC 3B5GA 1QLFB 2XYCA 2JQZA 4PJXB 4ZMYA 4JGNA 2QVKA 2FLBT 3KGTA 4X0NA 3LDBB 3RTQB 5F7FA 5IT2L 4QXUL 3V6OA 4PJHF 2DWEB 5FM5O 3QDHA 4N2KA 1AKJD 3B9DA 3HAEA 3AFLA 4MD0A 2B4CC 3CLFH 4OR1A 1NWOA 4QRTA 3GD1C 1ZXKA 4PN6A 3CFCH 5IGXL 1UACH 4FLOA 4GXUN 2YBRB 1XGQB 2OJZH 3BZ4A 4IDJH 5H94A 3OLEA 4KUZL 2A9CA 2VLKD 4QRQA 4KUCD 2A74A 2ZUSA 1OE2A 4KI5E 3DMMA 4KMTH 1Z66A 1RZPA 1NQBA 4JRXB 4WTQA 1QI3A 2P5PA 1FRGL 3KDMA 4UQ2B 5EU4B 5F9AC 1FH5H 2VDOH 4ODWB 2EVIA 4FEMA 3OVUB 2UWEE 2CLZB 5AOKA 5EWIL 2H0FA 4L4TA 3AU0A 5F7AA 4JHVA 2F7RA 4ZDHA 1I85A 3S4SA 2XZAH 3GXNA 3GBEA 2FDBP 1KXQA 3QFGA 4Z7WE 1EEUA 5ETUA 1J9CT 5JMOC 3FOMA 3LEXB 2UY6B 3Q6GL 2UVEA 4KK8C 1DQLH 4YR6A 1HHGA 5DMGC 3BP7A 4M5TA 1NEZG 5AEAA 1J9SA 3NN8A 3VCLB 4BUHA 1YEGL 3DPDA 3E8VA 1UHVA 2IFFL 2JLLA 4QTIH 3UTPD 1X5HA 2I25N 4YDNA 4ZFGH 2XA8H 2JNZA 1MAJA 2Y36H 35C8H 1MG2C 4R90L 3RP1A 3P3UA 3QS3A 4PRNB 2MH4A 3QNXB 3IGUA 4K9EL 1UM5L 3LS5L 3FOLB 4K15A 2DIJA 4YHNB 4HUKB 4BQBA 4HF5H 5I6LA 2K6WA 2VRAA 3K91A 3OAUL 1LILA 4D0DA 3MYJB 1N64L 4W9KC 2FGZA 4XO9A 3PNRB 1LO3H 2FH6A 1G1YA 1L9MA 3VXSB 1ETZB 3QYCA 1WA2X 5I1IL 3KVDD 5BZDB 1OGSA 3O0LA 5KVFE 1FIGH 5FO2A 4FNSA 3HG5A 3V7MA 5TDOB 5I1KH 5AVVB 4Y19B 3VRIB 3ABGA 1U8CB 3BCFA 1NC4B 4M48L 3L3IA 2BFVL 5DT1L 1ICTA 5BV7H 1OT4A 3GKWL 1EUUA 3F83A 2AABL 3F58H 6TAAA 5DF0A 3HNTH 4GAAA 1P69B 4HAFA 4OIBA 4PLNC 4QT5B 4XNAA 1PW3A 2J25A 5I8EB 3UZQB 5EC2A 5CSZB 2ATKA 3K8MA 4EIGB 4Z76B 1KMGA 4R2GD 3C2AL 5ISZD 3BSZH 4XPAH 4UTAA 3F7RA 1OOAA 3LEVH 3MV11 2VERA 3FPYA 4PJHB 5JO5B 4HWEH 1DBAH 1CS6A 1PQZA 4P8QA 5CILH 5EZJB 1ADQL 2IDTA 1JXJA 1XGRA 2Y69B 3PUUA 1B4LA 4PWIA 4W9IC 4XMZA 1JIBA 3DLQR 3DX1A 3MA7A 5I28A 3T6QC 4Y1AB 1YZZA 3JWNG 3MJ8B 4X80H 2W0LA 1GSKA 3DUSA 3EAKA 5LAXA 2DD8H 5DS1A 2VMCA 2YIHA 1H3PH 3LV3B 1JTPA 5FKAA 5IG7B 4R97C 1A9EB 3QP3A 5JYMA 3BGMA 4HPYL 1I3VA 1R46A 5KUMA 2A83A 5J9PA 1DQML 4YFDB 4UOW1 3ARFD 1KULA 3JWNE 4XMPL 2NRDA 4Q0XH 3QISA 4KRLB 4BSWA 4TVPL 4LNRA 1CDJA 4JVWA 2A9AA 4ZAKB 3T71A 1QSFA 4DEUA 4WV1A 3EOTH 4QHPA 4DESA 1SM3H 2D3JA 4YXLH 5IR1B 1HZHH 5ECJE 3ZT5A 1OGAB 5EUOF 4PVMA 4PMEA 3EFDL 3VM7A 5TFSL 4CVZB 1W91A 2ITDB 1I3RA 3ZX1A 1YA5A 2IPTH 2DM4A 3CN4A 4EN3B 3MBWA 4IK6A 5EBGA 5C0FB 4TSCL 5HPOA 1HDMB 4JFZL 4MCYA 4TQ8A 3JUYA 1KTRL 3S3SA 1A47A 1D5MA 2QPSA 3FUMA 1IEAA 3TA3C 3TLRA 3FB7A 3L48A 4ZUSA 3M17A 4YS4A 4ODSH 4DKFL 1PDKA 1PF3A 2YA1A 4HCRA 4NN6C 4EN2A 1GYAA 5C0CD 1FO0L 4G3YH 1K8IA 1M2VA 4H44C 1FAKT 1OSPH 2XA3A 3MGTA 3MUZ1 1B3JA 2E3VA 1R5IB 3DECA 1RU9H 5DEFB 2CUAA 3ATEA 5E4EB 1CK0L 3UYPA 2GJ6A 2K7PA 2VDRB 1B9ZA 1AO7A 4M7LL 5IHHA 3ZDXE 4OZIE 3IJ9A 4UTBA 2JKNA 4TF4A 5CFAA 3IJHA 4HXAL 2AJYL 4TL5A 3GIVA 3IMVA 2RGSA 2ZUXA 4JY5L 2J5WA 4BDVA 4QOKE 3BPOC 3Q2CA 1OAUH 3ME0B 1A14L 3DV6A 3VSUA 1ZVSB 4HUWA 1RJLA 3NIGF 4URTB 4LU5L 2BO0A 2HFTA 4YHPB 5EC1A 5HHMD 1OP5K 1OAJA 3DTDA 3O6MH 1J10A 1HYRC 2BLFA 3FFDB 4E9XA 2NYYC 4N4YB 4JM0A 2Y7LA 2XBDA 4PJFA 5E6UB 3IGAB 1QLEL 1MJ7H 2UUDH 3C75A 3DO3A 3QIUB 2P5WE 4HHAB 4NQVA 3NCYS 4PP2B 5B7MA 4RMWA 1AHWC 4S1DC 3TCTA 3D30A 1OF0A 1HL5A 3RIAF 1N7MH 3NIFE 3BUTA 3ZTDC 4IEFA 1CXFA 1HH9B 3CQPA 3GDCA 3V0JA 1XEUA 1B9KA 3KPNB 1IGIH 5IIEA 3TA3A 3ROOB 2FQGA 1C5CL 4WTXA 4O2FB 4OT1H 2F53D 2WQAA 3CHPA 1IC5L 3PCYA 4OKDA 5C3IA 4JFQB 2HWZL 2H26B 3DO7B 5DQJB 3SDXE 4GSRA 4LLUB 3P4OB 1PG7X 3RUGA 4DPAX 1UH3A 5K1VA 3KS0J 2B1AH 2WLLA 1NBVH 5F6HJ 1UA3A 3O6FC 1LO5A 2NX5E 3CFBA 3K72B 4H13C 1GW6A 4UDUA 1KPUB 3FYIB 2NY4D 5AAPA 2EYRA 4OZGA 3WNJA 4PJ7B 5EUKA 4JS7A 5AENA 2R4SH 3FT4B 4LAJH 1MHEA 4LSRH 1QHOA 2BRRH 1QACA 2H3NB 1QFWM 3T77A 4H8QA 3NJKA 1RJCA 2C26A 1P7BA 3SB3A 3TH3T 4IRSD 1OANA 2XWJB 5E8NA 4AJ0A 3GM8A 4AK2A 1OO2A 1IVLA 4X9BA 3WEXA 1X9RA 3AXIA 2YFOA 5EUOB 1AHWA 3O11A 5JDSA 5BRPA 4FFZL 4DGYH 2E9GA 4Z0XA 1T21B 2JSFA 1ZHKB 2PP9A 2ZP9A 2BPBA 3RAJH 2WBJD 2IJ0C 1A7QH 1BM3L 3UBXA 5DA0B 5F72S 5I8CB 3ASNB 2J20A 5CCKH 2CIKB 4MKTA 4QEGA 2Y3NA 5BMFL 2SEBB 5T3XE 4L3ED 4EQ2A 5F93C 5IEKB 1FBIL 1E9PA 4BH8B 3TO2A 5C0EA 2R69H 3M45A 5DMKA 1HL9A 4F7TA 4L3AA 4U1NB 3D25A 5EIIB 1KJ3H 2PWHA 3SPCA 4HDIA 1KT2B 3HZYA 1INQB 4FAAB 1CMOA 1QEWA 2LT9A 1ESOA 3O6FA 4H8WH 5J89A 3S5ZA 3P4NA 2LTQC 2EDNA 5PCYA 4Q89A 3DX2A 2JCCA 3L5WB 4HFWA 3BLBA 3ARDC 4FX5A 3P02A 4Y2DB 5C6PB 5D2LA 1U3HC 3QPQC 1S5HB 4H8UA 3RNQB 1AY1H 5JR1H 1XCWA 5TE7L 2LE9A 4JL2A 3QQ3B 3QZWB 1HINL 4TUKH 2NY0B 3LQAC 3NIGB 3O3DB 1J1OL 3AU1A 1PYWA 4H0IA 4J6IA 3D87B 1BFTA 4IBTA 3WHE0 3UIYA 4NDMA 1KDIA 5FM8A 1KV3A 3MUHL 1MFEL 1PSKL 3IF1A 2NY3B 3CMOL 4M6MH 5E2JA 4F7MB 4J3OF 4P46B 3BP5A 2WLYA 3WUWB 5DJCB 3TZVA 2GEQA 5KBDA 3REWB 1QO3A 2QKIB 4HBCL 4FTVE 4NQXA 2ITCB 2V17L 1BBJB 1ZHNB 3EYVA 3JT0A 1S2EA 3S35H 3EYOB 4FN0A 2DYPA 5FAAA 4GT0A 4F9LC 3MZGB 3T4AC 1WFNA 2WXOA 4ALAC 3PWJA 1KIRA 3P0VH 3VRJA 5BRZB 5C6TL 3K81A 3PREA 3T8XB 1XT5A 1ASOA 1LK2A 3MRBA 3QI9D 4F24A 4KROB 1QPPA 3DUUA 1LTXA 2CALA 2N56A 1V27A 4HKBB 3MV7B 5CN3A 3BZEB 4DN4H 4YHZL 2BVOA 5DEGB 5KS9A 1KTDB 4B3VA 2P5EE 2Y2WA 3ARDA 2R56L 5AW9B 1YC7A 3A6BH 3HMXL 4PY8J 1B88A 2ZOTA 3WDJA 3KPSB 5CU5A 1IE5A 5CUSH 1E5AA 2QZQA 2EVFA 3V6OE 3TO4D 2O6FA 2VZ3A 3MACH 1WIUA 5FECB 3UIZA 4ICXA 4V1DA 5JPMB 4KTEH 2NY1D 3R18A 5BS0B 1J8HA 4QAMB 2PTUA 4OF7A 3ZR6A 2IPKB 3MUGB 2DMHA 1IM3B 1JPEA 3NEOA 4G8FB 5TF1L 3OKOB 1L6ZA 4GSDH 2ZWNA 1CGSL 3BE1H 3FCGA 3FH8A 3FQNA 5AW5B 3PP4H 5BJTA 4E9LA 3ZMNA 3WXWH 3VWKA 4S1RH 4AQ8C 4RRPM 2CXGA 4Y0GA 3WLWD 4OGXL 1TQTA 1DCEA 2G60L 3M46A 4G8AC 4HZLB 4AG4L 1G7MB 2WN2A 4GQQA 4FQ2H 1FLTX 1A1MB 5F96H 2ROYA 1QTPA 5I8OL 3P3YA 3OHXA 1MCDA 4JMNA 1F4XH 4WNQA 1XZWA 4QIRA 3HW7A 3BEWA 1OHQA 4L4TE 4M7KH 4EAEA 2VR6A 1FSKB 1MCKA 4UBDC 5F7LB 1J9RA 2BVPA 2EILB 4ZXBC 1H3UA 1KXQE 5HGHA 4J8RA 3P4MB 3CX5J 5KOVC 1TTAA 3G5XA 4JO1L 4Q6IB 3RDTB 3B7TA 3L3KB 1OT1A 3U0PA 4LIQL 1U6AH 4AQAA 2YKKA 3C8DA 3QYMA 3MNWB 2XIIA 1U8IA 2D3VA 3WL9B 4D0CA 4NKIH 3VMNA 5ERWA 3F7LA 3QXVA 4FL4B 2YSSB 4TSBH 3U4EA 1OSZB 1OF2B 4FABL 5FFOA 3LZNA 3W5NA 1CFNA 2X6AA 4L05A 4Q6KA 4U3SB 5I76B 4ZTPL 5L0QC 4A37A 4XO3A 2L04A 5D6DC 4AQ8A 2ZJSL 43CAB 1Y1DA 1Q9OA 2DF3A 4LT7A 4HUUB 4PJ5B 4HHGA 1CGYA 1PVHA 1KIQA 4WO4B 1R0AH 4OZFA 4NFCA 3JWOL 3QCTL 2YD0A 4POYA 1IQWL 3OPZH 1BJ8A 2BSSB 5JLZB 3MRMB 3DOIA 1JZEA 4U1JA 4UYPA 1PZUB 2VDQH 4ODHL 3SKNB 2W0FA 4AL8H 5DQDL 1KNOA 2R7EA 3RZWA 4PP1D 1L9QA 4K8RC 2XPYA 5D7HA 4QHLB 2BVUA 4PY7A 1DUYB 5CLYA 5GSRB 4ZXBA 1YEHL 4FOMA 4FQCH 5GSVA 2OYKA 3B1TA 1B4JL 1G4RA 1NJ9B 2K6YA 2R23B 1V8HA 3IDGB 1OM3H 2AAAA 4PJGF 4WI0A 5JQHC 1AXIB 1N12A 1AGCB 1FNHA 2ZX7A 1X3DA 3PGCB 2OMUB 5J13B 5HYQB 3EH3B 3MHZA 4HJUA 4LL4A 3TGXA 5HI4C 1NGQL 2JJWA 1YQVL 4MB5A 1JZ4A 1QMUA 4ELKA 5JW4M 2AERT 2XJKA 4PG9A 5SWSA 3GRWH 5JUEL 3RI5F 2B16A 1J0JA 1BMWA 2FZ3A 4RAUB 2ZKYA 3QEUB 4K7FB 2VNCA 5E1HB 3U7AA 1WJ3A 1QSEE 3S3PA 5L8LB 1A7RH 2X12A 1PZ2A 1E3ZA 4NYLA 2JLPA 5D6DA 5C2BL 1R3IH 5KBLA 3ECVA 1JV2B 2GTZB 3G6JF 3QUMB 1PKQB 3W37A 1IM9A 4XCYA 5DD6B 4B5ZA 4G8GA 1JNNH 3DI2B 4WUUD 5CSGA 1SXSA 3GI9H 3EYSH 4C4KT 2XUWA 4R84A 3FTWA 1SOSA 1QBBA 1MVUB 4G7RB 1MCOL 4NXSA 2G4GA 3I2CL 4R5XA 4XOEA 2WXJA 4PRIB 2ITFA 4Y88A 4ODUB 3ALWA 3CWGA 4P4KD 2CK0L 3CSPA 1CFBA 1WCBB 2XV3A 4KZDL 1QSFE 2PW1B 4OGYH 1HOCB 3ULVC 5E23A 3UAAA 1QLRA 4Y4FB 3MO1A 4UT7H 3CC5B 2BZDA 3ECWA 3L45A 3RTLA 3CPLB 4NKDA 3LRLA 3CCHB 5C0CE 3ILQC 3QFJB 3D85A 2CJUL 3X3FL 2YO3A 3LIUA 1O9WA 5I0YA 1XCTA 4X6CE 3RGVD 5J8OA 5KSBE 1T1ZB 2BIIA 3BXNA 3L95B 4NJAH 2V9RA 5EORH 1A8ZA 2YAQA 3TV3H 5HYEA 3QHFL 1OPOA 3FRPG 4XWGH 1UJ3B 2WSKA 5LCVH 1GJIA 1HCFX 1TMQA 3WS3A 3GJEB 3BO8B 2BZCA 3UJJH 3RPIA 2AC0A 4FHJA 4M93B 2IAMC 4LPTA 4AEIL 1NCWH 5C3TA 5AB0A 2UZYA 5IFHH 4E5XG 3QUZC 2W94A 3HFMH 2AANA 1UCTA 4H26B 4ZFFB 1HSAB 2GJ6E 2J3SA 3ESPA 1FZOA 3KL0A 1VACA 5CR8A 5ACZA 4DQOH 3U30C 1N68A 1II4E 3VFNB 4X8GA 5T1JA 4KKBC 4AW7A 1XF2B 3TX4A 2ZUUA 4KJWC 4ADGA 3RWHA 2H2SC 5CEYA 3FTYA 2ZOOA 2DWDA 5LNEA 3RWGA 2F08A 3V0FA 3LPPA 1XAUA 4WTZG 2B5IB 2AXHA 4X42A 1SF5A 4WI3A 4ZW6A 1HYSC 2CIIB 3AB0B 4C83A 1IC7H 4DUWA 5L4MA 4IU2A 3EO1A 2YPVL 3K4ZA 1DLFH 2YPKB 4HJTA 3FH7A 4I0PC 4E9YA 5CJBA 3CZSA 2RTTA 1SRDA 1CICD 1JNLL 3V4PA 4OCWH 3K2KA 2W9LA 4KH2A 2HH0H 2IC2A 3HB3D 1AZUA 2LV4A 3MDJA 2F54A 4NHUA 3QG7L 4HALA 3LQAH 4EUPA 4OM0H 2ODIA 2X4RB 3ZT7A 4E68A 2W60A 3PDOA 4N2IA 2HJKA 3QORD 5F9JA 4PGBA 3U4BH 1Y6KR 4WTWA 2IAMA 2KZ1B 2OYLA 3LIZH 5GZOD 1ZSDB 3IVKB 4Y2LA 2FO4A 3QUZA 4MXWL 3RUGE 4JM2C 1N8OE 3G6JB 3P9LB 2HLFD 2OCCB 1OSYA 1SQMA 5HYJB 1ZCRA 1ZTXE 3AZUA 5SWZB 4AE0A 4YAQB 1Y0LA 4LEBA 1AQKH 4OAWA 4N1CA 4UQDA 5HDQL 3ULUH 2P7TB 1TF4A 3WIHH 2VMFA 5GPRA 5MENA 1S7WA 3KWWB 1ZDSA 1MWAA 2CQVA 3MXVL 3US9A 4D9LL 1GPOL 2QPDB 2XV6B 1DE4A 2JJUA 3PQYD 4M9OA 4WWNA 2N59A 2BWDA 1WPCA 4O51A 3WHXA 1I8MA 4P3CH 3U7WL 1KN4L 2V5SA 1JUFB 2HFGH 2XG4A 2ICWB 4HEME 3K1KC 4PGEB 4JQIH 4HUVB 2YPLB 1WD8A 1CVSC 2EZ0C 1GC1C 1ZK5A 2WHVA 4V33A 3KE0A 4C56A 3O4LD 3SQRA 4LHUA 5D5MF 1QPXA 1ROCA 1IFRA 4QXUH 5IT2H 5GGVY 1AR2A 1ND0B 2X4PA 3U2SA 1U3NA 2DQJL 4ZT1A 4XN2A 5ITBL 3CFJB 5DRWB 3I6GB 2BNQD 3U82B 3ZTNL 2J12B 2X4OB 4XNUL 3VMOA 5IGXH 5J1AA 5CJOL 1KCSL 3D69B 1NLDL 2Z91A 1KV7A 4AGNA 3N6YA 2PXYC 3KLSA 1JXFA 1GGBL 2EIBA 1GOFA 1L9RA 3N1MC 1V3MA 1FDLH 2IDQA 2AVFA 1MQKH 3PG2A 4LO9A 1WFUA 2OQJA 1FRGH 3F05A 3NABL 4JW3A 3SQBB 4ACTA 2XDHA 2C7FA 2ZOUA 3CFIC 1WHOA 2HMIC 1KBVA 4F5CA 1N6UA 3VDBA 4H4NA 3MFGB 5IJKC 1XMEB 2DH3A 2QZ5A 5DJDA 5C0JA 5I8KH 4G82A 2GJZA 3H9HA 5JTWA 5LBSA 1S7SA 3F04A 5D2LE 2APSA 3CBJB 2J4WL 4FCHA 1E5BA 4A6YL 4ECNA 2ED9A 4X8JA 5IVZA 3VXUD 5D7LB 1XIWB 1IKNC 5B1AB 1LEIA 2WXHA 5L2KE 1NGPL 1HE7A 2EIZA 4H88L 2G5BB 4KFZC 4OY9A 3QZMA 2XTSA 4M6OL 1YEGH 1CB4A 2X2JA 2IFFH 4ELDA 1ETA1 3E9UA 3F65A 3WN6A 5CCJA 4I4WB 1FFOA 2NSMA 1K2DB 2NR6C 4PJ9C 4TNEA 1DQQB 4DFIA 2V8MA 2R83A 4K9EH 1UM5H 3PV6A 3LS5H 3O2VL 4U6HB 1OW0C 2AEWA 2OLDA 3RA7L 1HCYA 1UVQA 3LRGA 4Z78B 4KI5F 1VKXB 3OAUH 4GUPA 4Q9CA 4NAJA 2PXYA 1AGBA 2Z7UA 4XE5B 1N64H 1A6ZA 3KYKL 4GBXB 4FA7B 3RVUC 4H1LA 1NICA 2UWEF 2IH9A 4DH2A 2W0KA 4D3CH 3PL6B 5C07B 4P5TB 2FSDA 5IJKA 1EFXA 3QZNA 3PWUA 5EF3A 5EN2B 4JGJA 2AK4D 4M48H 1W0VA 3VFTA 4Z7WF 1FVDB 3W11C 2J56A 2BFVH 4KHTL 4NNYA 5DT1H 3TN0C 2HCZX 3GKWH 1IKNA 3AW5A 3H3PL 2AABH 5TE6H 4XMTA 4FLRA 3B2XA 1J5DA 3FTVA 2D7OA 2GJRA 4O4YH 1EXUA 4UQ3B 4V1DE 1KPVA 3D2UB 1J8HE 2E59A 2P44B 2E7HA 3EDEA 3AY4C 3G5ZA 1AGEA 4PVLA 2GBAA 3T2PA 4NQDE 2OYPA 3WV0A 1SDAB 3C2AH 3GSNL 4GP8B 2E8YA 4IOIB 4N2BA 5D5MB 1HC1A 4WUKL 4X5RA 4XI5C 3H9SD 2WOYA 2NR6A 1BZ7B 3BGAA 3D6GA 4PJ9A 2NSXA 3P40A 3BIKA 3BH8A 3ZN6A 1AGDB 1ADQH 3DXAD 4XMWA 1OW0A 2P3YA 3NPSB 2BHFA 3UAJD 3T8VA 2V3EA 2CKNA 2DIEA 5GGRY 5AOIA 2J8OA 1L0YA 2FIKA 1AVAA 2H32H 2CKBB 3HG1D 1HNFA 1I53A 3QEQB 5DHVA 4D8PA 4HPYH 1E2ZA 1XL6A 4TQPA 2NUTB 3P9MB 1FNGB 4O2EA 3RWCA 3MMEB 4XMPH 3MSPA 5JZ7D 1VFUA 4YBHA 4DAGL 4R7XA 4TVPH 1NCGA 3A4FA 1RK7A 1S78C 5JNYB 2X9ZA 5DURB 2BMKB 4OJFL 1QEXA 3VD9A 3GXPA 3TN0A 1F4AA 3VXQB 2HKHL 3HVNA 4RSYA 4BSVB 3FO9A 1VESA 3T6ZA 4J39A 4FULA 4QHMA 4Q9QL 5I5MA 4OGAD 4OI7A 2BSCA 5TFSH 3BVWA 5BOJA 2NW3A 3SJVA 3NYKA 1NAMB 3AY4A 3QDMD 4TSCH 1DDHA 4JFZH 3BHBA 2W38A 3JZYA 3FDWA 3CFEA 3BAKA 1L9PA 1SYSA 2EDEA 2ZE0A 5T1DL 2GSIB 1WRFA 5L88H 1CXEA 3KPPA 3L3GB 3WCYA 4DKFH 3L5HA 4N8VA 5EHFA 5TD4A 5DC9B 1FO0H 4JMXA 4LP4A 4Z3FA 2J55A 3QZPA 4AMWA 4YSEA 3OBAA 4DVBA 2E27H 3EJPA 1CK0H 4EEEA 5EU3B 1GS7A 3CH1A 2ZOKA 5EO9B 4Z18A 1UZGA 1YEEH 4FMFA 3SCMA 3LN9A 1OCZB 4RGOL 3R4RA 2ZKWA 4HXAH 3WLBA 2UWEB 5DK2B 4PGCB 4EZKA 4JY5H 4P4RA 2BP0A 5C6WH 1GH7A 4O02A 1E50A 1A14H 4WRLA 4JFYB 5JOEA 1BGXL 2BIOA 2Z7ZA 4NQSA 3L08A 1B0RA 1DBJL 1GYWA 5FF6B 4RMVA 3UTSB 1GS6X 4MRCA 3HRZC 3TIEA 3NSFA 3BYYA 3QXDA 1G7IB 1QLEH 1VSCA 1IJNA 1S7VA 2C1OB 4PREA 4W9FC 4AUUA 4Z7VA 4HS6B 3SGDI 4X9YA 3V4LA 2BS71 1F58L 2EDTA 2OMXA 2WXPA 3V8OA 4PD4J 4GUOA 5EBMB 3U1PA 5GRZA 3D3VB 4YUEL 3SQOL 2CO6B 4AYGA 5IB5A 3BVNB 5AW2B 1C5CH 2DQUL 4Q97A 2E6PA 4I7ZC 3VI3A 1IC5H 4YDJA 2HWZH 3SGJC 3GGWA 3U7YL 3MRKA 4OZIF 2O6DA 3ZDXF 2V7NA 2X4SB 3N0AA 4G42B 4IRJC 3MRPA 4JO4H 1CDYA 1EXGA 1DJGA 1Q9WB 3QQDA 4YL4A 4ZODA 3ZIYA 1FCCA 3DVFA 5JYLA 2H7WA 2XFXA 4NHCH 2YD1A 1QZ1A 4L8BA 3C5SB 4FE9A 1TQVA 3KAAA 4A2FA 4EF3A 2AJ3B 1T6VN 5FLVA 3KEDA 1U0QA 4XMKL 2FL5B 1MHPL 1EZLA 1DVFD 1ET5A 4RAHA 4X8XA 5E08L 1OWRM 3FH5A 5CJXC 1D5XA 3HLAB 4TM9A 3NSYA 3ZK0A 3LVEA 4OCRL 7FABL 1M6UA 2YD5A 3NIFF 3ARXA 4G7YL 8FABB 3GMNA 5AKRA 4M03A 4QY8A 5C0ND 4PJ6A 4AZ8A 3B7UX 4R7NB 4FXKA 2HXAA 1WEJL 1BM3H 3JTTA 5FM4A 5HHNA 1YDPA 4UNTA 3H3BC 3SDXF 5BMFH 3ARPA 2EIDA 3OKEB 3SGJA 1TJGL 4IRJA 2W9DL 4H0LC 2W9EL 4NP4L 3RURA 3CIAA 2XPGA 5TF0A 1KELL 1XEDA 3KGSA 4ZUUA 4A2EA 4XODA 3LN5A 3APDA 2PO6B 4POUB 3T6XA 2D4DA 2I60L 3SKUD 5GGRB 3MLRL 3QARA 3AADB 1JVLA 2Y5QA 3C9NB 5F6HI 4FLQA 3EKCA 3KPRB 4MX7B 1QA9B 4EI5D 1YMMD 4EOWH 4YL9A 4NSKB 2KMWA 4JJ5B 1A1OB 1IO4C 5TE7H 4XN8A 4QTHA 3K2UL 5DJ2A 5EU7C 2HVKA 1J1OH 4WFGD 1DYZA 4AVKA 2BHYA 4JFDA 4N0UA 2F54E 3MBEB 4DP1X 2OCJA 1PSKH 2ZCHL 4J2QA 1EEZB 1UD5A 2AP2A 4PEEA 1HH6B 5DJAB 4AOFA 4XPFL 4PU2A 2FEEI 3PQYE 3RVTD 1TU2A 3MLVL 3PFQA 1HQRB 1RULL 2V17H 5KANI 2YGVA 2V2TA 4LNVA 1IAOB 4KK5D 1U8KB 3RG1C 3KZ8A 3DIDA 5D7SL 4ZQKB 3IRCA 2VXUL 5E2TH 1KACB 2VLLA 1WAAA 2Z35A 5C6TH 3BPNB 3V5DB 5AOMA 1SDDA 5KYWA 4CAGA 4OZIB 3ZDXB 5MENE 3UPRA 3CTTA 3MRRB 2BNQE 4YHZH 3OJ2C 4N25A 4WEUD 1RZFL 1XB8A 3BPLB 2DBJA 1JWUB 2X4UB 2YZ1A 3RNKB 4G7QB 4M1CD 4AEHH 3NCFB 1TITA 1BOGB 3HRPA 4KK6D 3QUYD 4QOKB 3HMXH 4PW4A 1D9KB 1I7TB 4IOFD 4UNUA 4XGZB 2APXA 4LCCB 4C56E 1B0GA 3VGDA 5TDNB 3O8XB 1NOAA 4G6ML 1MCWW 4AQ1A 5JHLH 4QNPE 1FJ1B 5CD5D 2OP4L 3DGGA 1GOHA 1IIIA 4AT6A 1S7TB 2P5WB 3QIWD 3B3IA 3D8MA 5TF1H 4F91B 1JN6B 2V3DA 5IV2A 4IJ3B 2YXWA 3NIFB 4Q6YA 2C4XA 5E95B 2QLYA 4RLDA 3PHOB 2A0LC 1MFVA 1DEEB 1CF8L 1FL6B 4OGXH 2DMCA 2G60H 1ZHBA 3SE9L 3VXUE 4AG4H 4B3EA 3KWUA 1TKWA 4D2NA 5LDUA 4BHUA 1E4XI 1F41A 2IEPA 1I8KB 3UGEA 2OTPA 4DP5X 4GKSA 4WDIB 4KH9A 3SDXB 5I8OH 3N2JA 3QUXB 1WVZA 4YHLL 3H54A 3IU3B 4PGDA 4GW5A 1XZ0B 4R3SA 4KKLD 1RERA 1U42A 4MAUH 4WK4B 3TEUA 9CGTA 1ZT1A 4XBPB 2UUDK 2BNRD 2FIRT 5ESQA 5I1DB 2V37A 1M05B 3IETB 2EUVA 3S88L 4PRPD 5IVXA 4JO1H 5D1QE 1XB6A 3H7BB 4NC1C 1R5VB 4LIQH 3HN5A 5JXAL 2WSPA 4HEPG 1E9QB 1GCFA 2WWMC 1HU8A 1C7SA 3SYQA 3Q05A 4PY8I 5I0VA 2VLRA 1S7QB 4FABH 2R1XA 4NO5B 2C3GA 4ZOAA 3NA9L 3LB6D 4LF3A 4ZTPH 4POZD 3SD5A 2B0SH 3O4OB 2V7HA 2VR3A 3KYAA 1N3NA 2ZJSH 2AJZA 2ZYHA 2E7LC 5GS1B 3KW7A 5I2IB 5KJRL 1O5DT 3SZKC 3S3JA 1FVEA 1X4ZA 5K59E 4WI2A 2WY3B 3JWOH 3QCTH 4NERA 3G6AA 3GNML 2VRKA 1W0WA 4LK4A 4DJMA 4ODHH 4PW9A 1JPSL 2H2PC 2NY7L 1FV1A 1IGJB 3AAZA 5DQDH 3VWJC 4FJZA 1J48A 3CVHH 5TJWK 3K3QA 3VDCA 2IH1A 1JGUL 3MQIA 2RA1A 4JO5A 1YEHH 1ITCA 2Y5TA 1CG9A 3ISRA 2CBPA 4RFNB 1B4JH 2H9GA 4BEIA 2VWEE 2ZXQA 4DETA 3IE4A 2X6VA 4MMXB 3ULSA 1RK0B 2CGZA 1R19A 3V0AC 2BSBA 3VG0L 5E00A 4RVBA 5IM7B 5DZAA 1N18A 4ZW3A 1MCWM 4P3DA 2CLRA 1NGQH 1FC1A 2CDFA 1YQVH 4MZ2A 1G7LA 5T1KD 4NZTL 5DR5L 3UJIH 3GUFA 1SN2A 2X6CA 4HAGA 4PJEA 1MHCA 4F2MA 3F01A 1P7KA 1KGYE 2HX7A 2Q76A 2D31B 1CFMA 5JUEH 4PB0L 1WC7B 3WFBL 4GRMB 2J6EL 3L13A 1CT8B 3R7QA 4RSVA 5C2BH 4EZLA 5GGTL 2E7LA 1GGYA 1JZ7A 1JYVA 4MJIA 1M9WA 4FTVB 2YC1B 2PN5A 2IPUG 1ZLVH 3FTSA 5EZLA 3TBSB 4MA7L 3WJMB 3ZU8A 5IB1A 4AIZA 1MCOH 3I2CH 2C3WA 3MRLB 3JWDC 4P2YA 5DLLA 3VWJA 2VQ1A 2HTKC 2Z31D 3GMMA 1XGYL 1YY8B 4DK6A 1JOIA 2CK0H 4Z3EA 3DRQB 4BQCA 2XN1A 1HHHA 2YN3A 5EZIL 1ZLWK 1E6JH 2DWYA 4CNIB 3ZJAA 4UNIA 2MTPA 3EG9A 5JIMA 2MCPL 2NDGA 4X4ZA 5F7EL 2N4IA 2P5EB 1DQJA 4PMFA 1VIWA 1C16A 1ED3B 2CJUH 2GI7A 4HIEB 1JZ5A 3SJVE 3KYMB 3PGDA 4M7ZB 1A0QL 1G0XA 2C9XA 3HN8A 5BW7C 2VXQA 4LVOB 2BWIA 3NA4A 5FUOL 1EZVX 2VDPH 1OCCB 3QHFH 4G6JL 3DVIA 3QRGL 3W1ZA 1X7SA 4QRTB 2QVIA 3WTSA 1N5AA 5CP3A 3LX9A 2K3HA 4KDVA 5IW3A 4M6NL 3K2MC 3TH2T 1PLAA 3NCEB 1MNUL 3BZ4B 1EJOH 3PWPD 4QRQB 2A74B 1YMHA 2CBQA 1Q0YL 3DMMB 2ARWA 4LLMB 4C4BA 1P7QD 1UXSA 1P5VA 3KDMB 2P42B 3HHSA 1KTLA 5E6YA 1W72A 3O2DL 5C0BE 3WO4B 5C8JA 2P4AB 2AJVL 4L37A 4L4TB 3DNKA 1MRCL 4QF1A 1RV6X 1EHLH 4ZDHB 4A2LA 3VYOA 3S4SB 4TUUA 3U9UA 4ZO8A 3SDDD 3LRSA 1MHHA 2R0KL 1I1AD 1CQKA 2JE8A 1W8EA 5ETUB 1U3YA 3WNPA 3GINA 3PIQA 3SKJL 3TV8A 2YPVH 3FOMB 4CDHA 2C5DC 3LN4B 3AITA 4X6CF 4Z7VE 4WSJA 2E75C 1HHGB 4YR6B 5KSBF 3BP7B 3BVVA 3P0GB 4LE8A 4OW6A 4Q14A 5CZXC 3NN8B 1SMOA 3B1UA 4PLJC 2QGEA 4LOUD 3BAEL 1OHZA 3AVEA 4NO2A 1FYTA 3F7YA 15C8H 2J6WA 2CCLA 3QG7H 2TRHA 2Z7WA 3VI3E 4ZG1A 4AGQA 5C86A 4UAOC 1F11B 4M62L 2ZWYA 4N0FA 1FZKA 3DX4A 2YUVA 4D0DB 4HOMA 5CF3A 4MA8H 1UZ8A 5FYJL 1TSRA 4MXWH 3B8YA 1EUTA 3DRTA 4GIAA 1OK8A 4DP6X 5EO0A 1LO2L 2NZ1A 2MNJB 1QG3A 3WE1A 5HDQH 5DMJB 1H3TA 3T0WA 1A3LL 3T4YB 3MXVH 4XNQA 1GPOH 4YPGA 5IHWA 1SBBA 3L3IB 4AGPA 5CEXA 5IQNA 3SDYL 3U7WH 4HGWA 1KN4H 2WV3A 1BQKA 4PJIA 3FFCD 2C34A 3JV6A 3D33A 2ZUVA 1KB9J 2BIQA 4Q7DA 4HS8H 4KK8D 1KLFA 5EC2B 2ATKB 3X3GH 3ZQ9A 2DQJH 4W9GC 3D48R 5ITBH 3JUZA 4YHIA 4A7UA 2LLLA 2MQ3A 3ASOB 1BD2A 3QCVH 3ZTNH 4GUQA 1PQZB 3D34A 4XNUH 4Q74A 4F58L 1YNTA 4WNJA 3U1SL 2OMVA 3WEAA 3WNMA 1QSEB 1N6QL 1ZVYA 1NLDH 1A7NH 3MA7B 3RUGF 3APCA 1GGBH 3DUSB 4OD3L 3S5LG 3I85A 2PTVA 4OCYL 2WK2A 3LKNA 5FKAB 3I6KA 3NABH 1DZBA 2B20A 2VE6B 3GSRA 4OQTL 3OZKA 2A83B 1MUJA 4K3EL 5J9PB 1E7VA 3SYAA 2WLKA 2DKUA 3DX6A 5C09D 4BSWB 4LNRB 3ATAA 3GM0A 5IFAL 3LPWA 2AXWA 3BI9X 4MS8C 2O5NA 4H25A 2EP6A 2ZWKA 1Y18A 3LKOA 4B9GA 3FT2A 1QSFB 3O3BA 5CCHE 2J4WH 4WV1B 4A6YH 1JF5A 5I66A 4Z9KB 1DHKA 5ID0A 4U33A 3VFMA 2H8PA 5LNDA 2JKTM 4Q8BA 2XKNA 4OU3A 2ADJA 5DHDA 1NGPH 5M94B 3V4VA 3TIDA 1MFUA 4H88H 1I3RB 4JFDE 4X4XA 5KSUA 2O26U 3GEFA 3OJMB 2DOCA 3MBWB 3C6LC 4M6OH 1PY9A 2HPOA 1CCZA 3LKSA 4NX0A 1KXTA 5KSBB 3FHQA 4MCYB 2ZXEB 1XTLA 3FQTA 5DUJA 4JFOA 2JJTC 2G30A 4FQQA 1Z7JA 4GY4A 1D5MB 1H3VA 2EDQA 3CSGA 1IEAB 3D39E 4AIEA 3HE6D 3FB7B 4ZUSB 3RA7H 3M17B 3SDCC 3K4DA 1PDKB 2LGNA 4KX7A 3TJEH 5HYSA 4P48A 1TOXA 1K8IB 4XE0A