2F53B

Directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPCIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen
publication title Directed evolution of human T cell receptor CDR2 residues by phage display dramatically enhances affinity for cognate peptide-MHC without increasing apparent cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53B00
4ELMA 3NCFB 1U8KA 4J8RA 3TA3C 4OFVA 4PTTA 4WHTA 4OZFB 1BQUA 4ODBD 5KW9H 1MCOH 4L4VD 5F97E 3SGEI 5JOFB 1T5XB 2BC4B 4PLKD 5IW3A 1RIVL 2JJTA 3WNOA 5BV7C 1LGVA 1FL5A 3MODL 3RHWK 3F7VA 5BVPL 4GAGL 4CADA 4YHZL 4U6VL 1G7HA 1B0RB 4YHPB 4H5SA 1P9MA 4DN4L 1FAKT 1F58H 3MUGB 4PJ9C 2LFGA 4TOYH 4JB9L 3WE6A 5IVNA 3SE3C 4JM2B 4ZOEA 4OKVB 1KT2A 4NBZB 3MV9B 2F53E 1A64A 3T4AB 3GSQB 1KELL 5M94B 2Q76B 2X41A 3CDYA 3OB0K 5CMAA 5HDBF 5DYOB 4OZHB 3K81A 4QRPA 1KLGB 2DYPD 4U1SA 3PQYA 1HKLL 4NFBA 4TNWF 3TGXA 4NKOB 2UYLB 1X5JA 1CZ8L 1K8IA 2ADJB 3LSOB 5BS0D 4KTDL 1AO7D 3GSXB 1TITA 2Q7NA 1RU9H 1W72L 5I19H 1VACB 2APFA 2FR4A 3K2UH 4X9FA 4PRDA 1JPST 1A7NL 2ATKB 1FYHB 3GI8H 1QFUL 2E7HA 1WUNT 4QXUL 1RZJL 4ZS6C 1J1OH 3QDMB 4GXVH 4LRIC 3PXHA 3OKDA 2YSSA 3RWHB 3D39D 1CK0H 3PP3H 5C0RL 1RZ8A 3MV8D 1JHLL 5DS8A 3MSPA 2CO6B 5DR5L 1G9NH 3GMMB 3GHBL 3C5ZB 5EU7C 1ZLUK 3RFZC 5T3ZH 1QSVA 1W0VB 4HX1B 4OFYA 2VNCA 4FQXA 2HLAA 1F3DH 3L3KB 3T0EC 3X11A 1J0HA 3KYNA 3HB3D 5HD8D 4I0CC 1RUML 3PWVB 3ZL4H 1KLUA 2XZAL 3EOTH 1S7SB 4JPWH 4FP8H 3BZFB 2ESVB 4LLMB 1OB1A 2DBLH 2X4PA 3CSYA 2NXYC 4MQSB 1Q9KB 4JPVL 4XCYA 4KVCH 1U8IB 1K9TA 4U1NA 4Y4KC 4P4KC 5KVFH 5I76B 4DGVH 1RFDH 2PXYD 1A1MB 1H9VA 4LCUA 4KKLD 2E9BA 5C8JB 2NQCA 4KROD 1EVUA 1FVDA 2R2CA 5F44A 2VZUA 4FQ1L 3BO8B 4LHUB 3UTOA 3VE0A 3VGEA 2GK0B 4AEFA 1I7RA 1E4XH 1ORSB 3MLRL 3KPSA 1JIBA 2DWDA 4MQXC 5IB1A 2NY5L 3C60B 3MRIA 3C8DA 1I3UA 5F6HI 3EO0B 5F7DB 1GJIA 4XNZC 1ZLVK 1FZOA 3SGEH 4DGIH 3CFEA 3HI5H 1A6PA 5HHPA 5DC0A 4HFWB 4Y2DC 2NCMA 1IEAB 1MRDL 4G9FE 1ONQB 1NCBL 3ARFA 3NCBB 5LWYH 2Z35A 4RAUA 1MFDL 2HH0L 1B0WA 3JUZA 2IJ0C 1OW0A 3S3SA 4UINL 1NMCC 4X6BA 4C59B 5E5MA 3ARBA 3WUWB 3OKEA 3WKML 1AY1H 3T8XA 4LAQH 2FATL 3ZKSD 5T5FH 3TBTA 2R0KL 1HCFX 2QBWA 2C3HA 5D1QB 4FZ8L 4N5UA 4BKLA 1AGBB 5IBUG 4XB8A 4Y5VB 4N0RA 4PJFA 1S9YA 1SEQH 1X4ZA 5I15L 3DXAE 2Q20A 4NC1E 1NLBH 2DIBA 3AU1A 1G7PB 4NQXB 4YBHA 1HH9A 3IFLH 2GUOA 1NDMB 4YDKL 1MLBA 5IM7B 4Y8DC 3OX8A 3GBLA 2CLZA 3GSRB 1UM6L 2IFFL 3D3VE 3C8HA 1U3YA 4D3CH 5C7XH 1RJYA 2A73B 4P23D 1D5BB 3IJYB 4YDJB 5E8NA 4YHYC 4JJ5B 1A2YB 3UEZA 4HS3A 1KC5L 3EO9H 3UJTH 2E6PA 2XKNB 1G0XA 4LEXH 4I4WA 1GIGL 4P3DB 2EH8H 4AG4L 4UB0H 5I8CB 1T22B 5HXMA 1EXUB 3NFNB 1AD0A 1LO5A 3LB6C 3ZLQC 3C6LC 1A8JH 5DJ6B 1E4WH 3BN9D 3W9DB 4YX2L 1CXIA 3BPCB 4S1DD 1F4HA 2J5LB 1M1SA 1B90A 3ALPA 2OI9B 5F88A 1WTLA 4HHAA 5LGKA 3CFKB 4X8JB 3UDWC 1NGWB 3BKMH 1F13A 3C08H 4U6TA 4ZTOL 4M43H 4M4RA 3RI5K 3G5VB 3G5YB 5D4QA 5ALCH 1WBXB 1YEIH 3B6SB 3SOBL 4ZMAT 3UTPE 3EFDH 1YNLL 2YWYA 1V3JA 3WFBH 2XI9A 4BM7A 3FQTA 3MYZA 4BSVB 4BSWA 4PG2C 5EO0B 1A14H 3GSVA 5T5NF 3AREC 3N50A 4V1DA 3QR2A 1EAPB 3DVFA 4K7PL 4Y5YA 2QJDA 2P46B 4U3CA 2EIZA 3THMH 5C0EB 1RUQL 4QRPE 2AJVL 3TH3T 3PQYE 5IEHA 4P2QA 3QQ9D 3QRGH 3T3ME 3ZO0A 1NFDF 5BJTB 4S1RH 4MD0B 3MRLA 1RZJC 1PLGL 4M8QA 4NHCH 4ETQB 3HPLA 4LLUB 1J8KA 5HDQL 2D4DA 4KHTL 3PG2A 1RZIA 4D0DA 4F80A 2DD8H 3IDMB 4BH8A 3HRPA 4M1DL 4G6KH 1YC8A 2IPKA 1FYTB 3NPZB 4PRPE 1Y6NR 2HFEA 1OPGL 3I3EA 3WDJA 3UC0L 5AYUH 1DFBH 1OLLA 2JELH 4V2CB 4YHOH 4RAHA 5FYJU 1T1ZA 3ARGC 3T2QA 2LE9A 2UY6A 1A7QH 4R7NB 1T1XB 5D96C 4Z6AT 5DVKA 5F6IB 4LHQB 1A6ZB 2A9MH 5KZCB 2BNUA 1NBYA 4L8DA 3W82A 5IMKB 4JFYB 2KL6A 3E2HB 3WHE0 3AC0A 3VWKC 2AJUL 3RBSA 1TZGH 2BFVH 1QR1B 5SWZD 1UZ6E 3HA0A 4QRUA 5DUBB 3ZDYF 3TN0D 1WT5A 5FYKD 3SKJL 1SQ2N 4GRWB 1UB6A 4OD2B 4DEPC 4YNYB 4G7YL 3V4VH 1EFQA 1CG9B 4JM2F 3UZQA 4K9EH 1JRHI 2VLRD 1XF3A 4L8SB 3QIUD 5ESAA 3VFSB 3QP3A 2JJTC 1E27A 2GJ6B 1I8KA 2DQTH 3B43A 5ETUB 4ODWB 1CF8H 1H3GA 5CKAA 1ROWA 5T1DL 3Q48A 3LKPA 5ICZB 4P5MB 4NOFA 1IGMH 3M8OH 2PNDA 1H5BA 1RK1B 1XGYL 3MGTB 4PRHD 1GZPA 2IEPA 3VMPA 1DTUA 3G04A 2NY5C 4JFPA 4R3SA 1SY6A 5TQ2L 1UYWL 3MLZL 4LLYB 3QSKB 1KNOA 5E8OB 4OGAC 1H8SA 3TCLA 3O0RL 4FQCH 4RGOL 1P5VA 4L3EA 1T1YA 5GGVY 4JQXC 4JO2H 1DE4A 1TVHB 4NCDA 3EDKA 3B5HA 4LMQE 1C08B 3PWLB 3G9AB 1KIRB 4K3DL 3CH8A 3V5DA 1YZZA 2DQFB 3QUMB 4S0SD 2SEBA 1EFXB 3ZKNC 5E2JA 2DM2A 3VGHA 5I9QC 5MEOB 4WUUD 3FL7A 4LVHB 4YXKH 4DFIA 1D5ZA 4Z0XA 2P8LA 3WS3A 3GNML 2XICA 3MFFB 2JCCA 1AXSB 3H42L 3ILQC 4RRPG 2YXMA 4XCEB 1JGEA 4U6YA 4UDUA 2B1HH 3BGAA 2UZIL 5FYLL 5JOPE 2J88L 4ZNEA 3PL6B 4X5WA 1JFQL 1KJ2B 2D4FA 4OCWH 3MNZB 1P4BH 4PJCE 3FQNB 2OJZL 2R23B 3SDCD 1BWMA 4Y19D 1CE6A 1MREL 4MJIA 4WI4A 1U8NA 4P2RB 4FXGB 3LS4L 2FIKA 3IFNH 4R26H 5GGRB 3NFPB 3R8BB 4XCNB 1INEL 2WUBL 3MBEB 5K9QG 2JJSA 3RY6A 4ZO9A 3LS5L 3OXSB 1RUAL 3ZMRA 5EFIA 3ZDZF 4HIHA 4ZTPL 3W2DL 4YXLL 9CGTA 1RV6X 1MQKL 3KJ4B 4Z7QF 4Z77B 2NTFB 3FO2A 3IVKA 1ZT7A 3ETBF 5CZXC 4HIJA 1OSZA 4J4PC 4GW4B 5D70H 4OT1L 3I6GB 1R3HA 2NY1D 2FJHB 4QWWD 3O2WH 3P0VL 5DJDA 3CXDH 2P45B 5FUCE 2QR0A 5F9JA 1TQCC 5GISH 4G5ZL 2ZG2A 5CP3H 1MCKA 5EC2A 4OZIE 1FORL 2ADFL 1NC2A 1CT8A 3RQ3A 4GBXC 4KAQL 3MMEA 1NGQL 5KOVC 4KY1H 2XWJB 2ICEB 5HSFA 5E08H 1HH6A 1LEKA 3FO1B 1KJMA 5CEZH 2YUZA 1F4AA 3P3YA 4J6RH 3VXRA 1TJIH 4C4KT 4XP9L 3U83A 2DDQH 5HHQA 5HHNB 4Z18A 8FABB 5J6GB 1I7ZA 5GJSH 2Y36H 1OW0C 3GSNB 4R90L 4XC3H 3ARBC 1NGYB 1KGCD 4OUUB 5J1AB 1HYSD 1CN4A 3LN5B 1PFCA 3G9VA 1M4KA 3F8UB 3GO1L 3SJVD 4F7PB 4V1DE 3QBTB 4PJBB 4C58B 4QRRD 2CLRA 4GKZB 3SGJA 3DVNB 3MOBH 3WJLA 4XXCA 3DIFA 1TCRB 3MLUH 4OCXL 1VGEH 3O8XA 3M45A 1WBYB 5FB8A 1KFAL 4O2CA 5H2BB 2BNQE 1LDSA 4M6NH 4PGEA 5GS0L 4GLRI 4NHUB 4TVPH 5IW1A 3DOSA 5CEYA 1DANT 4XC1L 2WWMC 4JZJA 2CPCA 3L95B 5TE7H 1WF5A 4JFQA 1FGVL 2D7MA 1A7BA 1A02N 4LASH 4R4BA 3JTTB 1D9KD 3D69A 1OTTC 4NC0B 4UTBL 4EKXA 4X99A 2R29L 2PYFA 3JV4A 1AC6A 4MXQC 5DJ0B 5KN5B 3PDOB 5DHYB 1HHGB 3D9AH 1WIPA 5FO7A 1QSFE 1CLYL 4Q0XH 2QHRL 5GHWH 5JUEH 2GT9A 5F7EL 3NOIA 5D7JC 1YJDH 1G6RH 1FNLA 3C5JA 3OAYK 3WLWC 1T83C 3SDAC 3BEWB 3DX9A 1AD9B 4UOW1 1RIHH 4MZ2A 5DD6B 3O2DH 5I66A 3FOLA 1I8MA 5JIIA 3QXDB 4XPBL 5JXEA 3VRJB 4WY7L 2XTLA 4IRJA 2V2TA 2NLJA 3VRIB 4HS8H 4BZ1L 2WLZA 2OQJB 5I1CL 2C7UB 1FLRH 4XNXL 3K74B 3VGGA 2VLKB 3ISWA 4NIKB 4XP4H 5C08B 1S3KL 1L4IA 3HMXA 3B9KC 5DRNB 1KB9K 4F15B 3TIDA 1RY7B 2GJZA 2BNRA 3TVMC 5L9DH 1II4E 1YEGH 5DEFA 3BIAX 5F7FA 3MYJB 4L3CA 3QNZA 1MH5A 3MV9D 3T04D 4HDIB 1FVCA 4TSCH 1MJ7H 4KJPD 1FIGL 1EA9C 4G8IA 2VXTL 2C3XA 1PGRB 1BZ9B 3A6BH 5CZVH 4D94A 2HT2D 1FO0L 2PKDA 2NMSA 4I9WD 4WI6A 4GQPH 1CIUA 1K4DB 4QHMA 1XGRB 3BVNA 3EZ8A 5HI5D 3O3AA 2UWEA 2J8UF 5I0ZA 1OSPH 1LQSR 3WO4B 1BVLA 2VLME 1UKSA 3T3PF 1JNHB 4MCZB 4PJAE 3E6FB 4RGNC 2AGJH 1N3NB 1RHHB 3QEUA 4WFFE 2ARJA 4EN3A 2JCCE 1FGNL 4AM0B 1C7SA 3CD4A 4GRWF 1UGNA 5ECJE 3AS0A 3CZFB 4RCAA 1VCAA 3WNNA 4HKJA 4ZNEE 1G0DA 3GSUB 4NJ9L 3C5ZD 2RFXA 3DPBA 3F6IA 1JUFB 1P7KA 3M1BB 4LDEB 4CDHA 4JHAL 2X70A 4ZAKB 1Q0XH 3CU1A 1L7TL 4MJIE 4WW2A 3DV4A 1A6WH 1WT5C 2Z93B 3VXPA 5TE6L 2Q6WB 1NGPL 4GLRH 6CGTA 1OM3L 1I75A 5HPOA 4LNRB 2VXSL 3WIHA 5IOPA 3CH1A 4HUNB 1QO3A 3LRSA 3S6CA 2ESVD 3CDFA 1ZVSA 3QCTL 5C86A 3T2OA 5D1XA 5EBWA 1H5BC 2BVQA 3QDJD 1BQHB 1BJ8A 1NFKA 1ACYL 1B88A 2ADIA 4P5KA 5EUOB 2X05A 3RIAK 2GSGB 1I4FB 1CDJA 3OR6B 2P48B 3HMXL 1ES0B 5E1HB 4OCNC 4JFEB 4LHUD 3GSWB 1R5WB 4NSKA 3PIQB 1W8NA 3MLVH 4NQCE 2FD6L 5I16B 4JO4L 2F54B 4PJEA 3PGDB 2XTJC 4G6AC 3HE6C 5EIVA 3C60D 3ECBB 3F7YB 3CMGA 3LZFL 1RZFL 4OLUH 2H32H 1EHAA 3DGGA 3HC4H 3GHEH 3VXRE 4G6JH 5FF6A 1EHLL 1NGXB 4ERSH 1RURL 1UH3A 1QFWM 4WV1A 3VFGL 2VDPL 1QKZH 4X9BA 5LVEA 2UUDK 4IMLA 1Z3GH 4F9LA 4WTXA 2B20A 4POUB 1ZWIA 1H3UA 5D1QD 3ZTJG 5GGTH 3OV6A 5CD5C 1VERA 5ALBL 4YJZL 5GS0C 4NP4L 2W9DL 1NCAL 1Z9MA 4JPIA 5IB4A 5IQ9B 3VXOB 1GOGA 4OCSH 4ZPVA 3PDDA 2AEPL 5C0GA 5E2UL 4Y16B 2R4SH 1KB5H 5FDWA 5I1JL 1KLFA 3BE1H 5LQBL 3CDGB 2F53B 5D6CA 5EDXA 2A74B 5ACMA 5JR1L 3ULVE 1WK0A 1Q9LA 1IT9L 4NZTL 1ED3B 1KN2L 5FA3A 5B3JF 4XVTH 3SDYH 1M6OA 5KVEH 2QSTA 4ZFZA 3U9UA 3O9WC 1T2QH 4PGDB 5E1AB 5A40E 2V17L 3BQUA 3WIHL 3QRFM 5KSBF 1U2HA 2R1YA 1OAZH 3HG1A 3LOWA 1WIOA 1XIWB 3KYKH 3FN0L 4HS6A 2KH2B 4XPTL 3TZVA 4QTHB 5DMKB 4PGZA 1IAOA 2FJGA 4DVRL 4OCLC 1Q9OB 5K9KA 1ZANL 1DVFB 2GAZB 4ENED 3MRNA 3CCHA 4G80B 2GITB 1NBZA 2M26A 4KPHH 4XRCA 5TDNB 3SBWA 3BP7A 4R4FL 2Y06H 1LNUA 3S4SG 4AEHL 1IAKB 4WCYH 4PJBF 1WSST 1MJ8H 2QLVB 2V2WA 1A3QA 3O3UN 4MAUH 3NFSL 4Y5XA 1LK2A 3VU2A 4I5BB 5C2BL 2V6HA 4MQ7B 1OY3B 2BNRE 1I3RB 1I1AA 1SJHB 3KYOB 3QULB 1DSFL 1CI5A 2HKHL 4PP1C 1T03H 4HUXB 3BD4A 3GMPB 1AGFB 4XGZA 4Z7NE 4GS7B 3E6HA 35C8H 1KJVB 1UWGL 3IXTA 2ZSWB 5CBAA 1JL8A 3WJLC 4BQBA 2L7UA 4RX4D 2IQAA 5CS7A 3S4SA 1XH3A 3WFZA 2C3GA 2R8SH 2HJFA 4D0BA 1XZ0A 3K1KC 5C0BA 4RBPH 1N64L 2GQHA 3O45A 4O51B 1NGZB 2UWEE 2DQDL 3FFDA 4PB0L 2P8MB 3QZWG 1CDIA 3I9GH 4P3CH 1R0AL 1KEGH 1F6LL 3V0WH 4X83A 4TULH 3VFPA 5IVXA 4HIXH 4JAMB 1KSRA 5D7KD 5DHVA 1MCBA 5B39B 4UI2A 3X14A 2LTQC 3IETA 1EGJA 3BIKB 4OCRL 2AI0H 4DAGH 2HJLA 5HYFA 5KZCD 2N7BA 1G7LA 5GPRA 3ZKXB 2PF6A 4OM0H 5D7IA 1MUJA 4Z5RB 3CXHK 5I30L 3MLTB 4EQ2A 3U0TA 4PGBB 4ODHH 2EIDA 4YEEA 3QZWA 2MHAB 2YA1A 3QG6B 4GW1A 4WTZG 1F11A 3P77A 4YE4H 1OP5H 3BX7C 4E0RB 2DQUH 2CIIB 5JXEC 3KHQA 4R2GD 1HHKB 2GJ6D 2VITB 4KI5F 3DXAB 1YN7A 4FQIH 1GZQB 3U4EB 1TCMA 3R0NA 3STZB 5T3ZD 1X6LA 5EB9A 3HAEB 1LP9A 4AENA 3KLHD 4OM1L 3GJFK 1PKQA 5AZEH 1XF2A 1F4WL 3EHBC 2LV4A 3FB7A 1WWAX 5E5UB 5D2LA 3RZCC 1UCBL 5HHXH 5MHSE 3MACH 4RAVB 4EBQL 3RVWD 1S8DA 2DLFL 2FJFA 5TF1H 2V2XB 4UT7H 5JW5A 4YUEL 4UNTA 1BQLL 4PJEE 3I6KB 2VLLB 2WM0A 1P84K 4BSJA 2Y6SD 2DKSA 4HSQA 1N5YL 3JUYA 1QD0A 3SDDA 1T6WA 3LKSB 2D7TL 5GRUL 1YA5A 5INCA 5EU3A 3ES6A 5I8OH 1MHEA 3BHBA 1U8KB 4J8RB 4JFZL 1U95A 4KVNH 4AMKL 1NAMA 1EFXD 4ZPTB 1OP3H 5D9SA 2R39A 5I1LA 1BBDL 1YNTA 1A3LL 1IAIL 2FHCA 4LP4A 4PTTB 3HCVA 4GKNB 4PG9B 1RIUH 2K9UA 3RAJL 2A77H 2BHZA 3RWCB 3I85A 2MKWA 3BZEA 1FL5B 3F7VB 5IFHH 5DHXB 3PL6D 4H5SB 2EH7L 4LPCA 4M61A 1EGJL 5ITBH 2ERJB 2HT4C 3KGRA 2C4FU 4LSVL 5HVHC 5CILH 4YGVA 1NEZG 2RCSL 5IR1B 5J1TC 5E8PB 2AJSH 4P2RD 4AYFA 2VWEC 1FFRA 2NY6C 1NQBA 4NWUH 3MBED 4WJ5A 2IBGA 5EUOF 2YBRA 3PJSB 2OL3A 1GYAA 4PJ5B 1T21B 4QRPB 4C57C 2BDNL 3PQYB 4FTVA 4LLDA 5DVLA 5K59E 4JG0H 4PJ8B 3SO3C 5JW3H 1K8IB 1OOAA 4P46C 1BECA 3QEHA 5CGMA 4ORZC 2JJWA 4ONFH 1IC7L 4K2UL 4Z7UA 5D93B 3HI6L 2WANA 3LDBB 2ZCKH 3HG1E 3MXVH 5ADOL 4JFFD 4PRDB 1NEZA 4GSDH 1SMAA 3LN4A 3NZ8A 4FQHA 3DMMA 4F33B 5I1HL 2NXZB 3QWQB 2XG5A 2R0LL 1GGYA 4PRPB 3MLPA 4JZNA 2XKSA 5J3HC 3O6FA 2YSSB 3OKDB 1RZ8B 1GGBH 5DD5L 3MTRA 3X12A 1DUYB 5DS8B 2BZDA 4Y4FC 3R06A 4H26A 3OZ9L 4HJJL 3SO5A 4EQ3A 2W9EL 3VFNB 3W0WE 1ZT1A 1RAMA 2EXYD 1AXIB 4X4ZA 2QSCL 1J88A 1XT5A 5J9PB 4FQXB 2HLAB 1LO2H 2A83A 3T0BA 3H9SA 3DRTA 2DMBA 1UACL 5JW4N 3KPNA 5EBLA 4F7MA 3FFCA 3EJYC 5CCKL 1JGDB 3MRMB 1WC7A 4NWTL 2VDKL 4YR6B 5IV2A 1EO7A 3RNKB 4R4NC 1NAML 3A6OA 2DQIH 3PDGA 4PJIE 5FHBH 3BKJL 2MWCA 2XG4A 3H9YA 2OP4H 3MR9B 2R69L 4XCYB 4AK1A 5KOMC 4OF8A 1NBVL 5I1GL 4TRPH 4TTDD 3BUTA 3LEXA 5C0BE 4LCUB 1T0NA 5GXBB 3OHXB 1QVOB 4R9HA 1WCBB 4YC2C 1QA9A 5LKNA 5HHME 3NACH 4HZLA 1FVDB 3VXUE 2EDTA 3FB6A 5D1ZC 1AKJD 5IVXE 4K94L 4JVUA 1CFVL 4G43A 1KCRL 5C9JB 1AQKL 2NW2A 15C8L 2IAMC 3O3DA 5HHPB 2NYYD 1UXWA 4ODUB 2WWKT 1D5IL 3T0WA 3U0PA 4UILL 4OV6F 3BQUC 2B4CL 2JIXA 3ARFB 3PUCA 2Z35B 4U2YA 5C1MB 5L0QC 1BLNA 5CHNB 4HWBL 1NFIA 3U9PH 3OGCB 4IOFD 4AIZA 3TZVC 5E5MB 3GBNH 3OKEB 5INDA 5E6ZA 1L7IH 4JDTL 3S37X 2X89D 2R56L 2Y4SA 3TBTB 4MD4A 4L4VA 4ZFGL 4A6YB 5EZOH 1U8PA 1FNEB 3VMOA 4BKLB 5FKPA 3UTSA 5IMLA 1H3WM 2BVTA 4MNHA 1S9YB 2G60H 1MRFH 3P0YL 4RISL 4U1JB 2PTVA 2VMFA 4XPGH 2DIAA 4NT6A 2VLKD 4PJCB 4D9RE 3AU1B 4JEGB 4MA1C 5C08D 4Y5XC 5ICYA 4LOUC 1DBBL 2OR8A 3HFMH 4ZUUA 1LP9E 5IP4A 2GUOB 4F7EB 5A2FA 1PKQE 3LN9A 1U93B 1MLBB 3GGWA 4QRTA 1LO0L 1I1AC 1E4XL 2CLZB 1AE6H 2VKXA 2B0SL 4IJ3C 4QT5A 2BRQA 4FFZH 1CLZL 1G7JA 1RJYB 2F58H 3EYQC 2EDQA 3SE8H 1VB9A 4JE4B 1I8IB 2W0LA 2DYPA 3CFJB 1YECH 2FX9H 4HS3B 5CEXA 2FO1A 1IBGH 3LQMA 3HPJB 3GK8L 1T0MA 4I4WB 5BS0A 5JXAL 5CKGA 1AO7A 3KPQB 5HYSG 4LAQL 2QADB 1AGDB 3G6JE 4M62L 1S7QB 3MLSH 4TSBL 4OZIB 4LCCC 3DWTA 1R3IL 2JB5H 1JF5A 3TWCH 5DLML 5JOEA 2KBGA 4XXDA 3V6BR 3D39A 5HYJA 1EVTC 3MV8A 4YBQD 4NRXA 4HHAB 1G84A 4XAWH 2E7MA 5F9WC 5JZ7C 1BFOB 1KBGH 2D31A 4ISVB 5IB2B 4E5XB 2EE6A 4UV4L 1QBLH 5E8DL 3A6CL 5HYSA 1X5YA 1F3JA 5BMFL 1SVZA 2YK1L 3EDEA 4LFHG 4BSWB 1N0LA 4JGJA 1N4XL 4V1DB 4BYHA 3QB7C 1DQLL 2G75B 3P4MA 3FT3A 3BOVA 2EE3A 4E42B 4Y5YB 3V5KA 3WL9A 4ZO6A 2A6JB 1MWAL 4WWID 4XMLL 2GIYA 1HQ4A 4XWGH 3J7HA 4FTVE 5F7KC 4N9GB 4PGCB 3P30H 1MRCH 5F3HB 3ROLA 5B22A 3IAGC 2BNQB 2HYMA 3TYGL 3RGHA 2H41A 3KNBB 4Z7UE 5K9JL 1NCTA 5E5RB 4U4BA 2F5AL 1OD9A 1ZGLA 1J0IA 4BH8B 4TNVK 1OGTA 4K8RL 1MCPL 4JFED 2IPTH 25C8L 5H94A 3H9ZA 4IDJL 1QFHA 3H9HA 1NCWH 1XGUA 4CVUA 1CXEA 3VI4E 4FABL 4OBRA 3WIIL 3T0XA 4XVUD 2WMPA 5HGGS 2QL1A 1QSFB 5EU6E 4N0CC 1BEYH 3VDAA 3VD9A 4KJYA 5DA4A 2HTLC 4ZFOL 3MNWA 1GC1H 1OT2A 1MAJA 3DHJA 4GMTH 3PWNA 4WU7B 4YHLL 3BD3A 4M9PA 4OF3A 1J1PH 1NMBL 3WD5L 3H9SE 3NPSC 4XNQA 1NDGA 3EO1A 4X5XB 3L5IA 1UB6B 3FFCE 2XPGB 5E2VH 5C0JB 5E9DB 3IGAB 1XF3B 1TZIA 3QCUL 3NABH 1FRGL 1A7OL 5MEPA 1TTUA 3QNYA 3P4OA 1I8KB 3R8QA 3CX2A 3C8KA 4P2CG 1LVEA 1KENH 5FKAB 4EUPG 3MA9L 1X5HA 4HMCA 4NKMA 2CRYA 3T3MF 3KYMA 2CKBH 2LU7A 4K94C 4YBLB 2PETA 4Y16D 3UJIH 4QHKJ 3I2CH 1TJHH 3EYVB 3H7LA 5TDOA 4S10A 4DCQA 5AD0B 2F53D 3UYRL 5HI3D 4CDGC 3CGTA 4Z0BL 3RU8L 4HXBH 4P23A 1IGTA 3QHZH 4NZUH 2B4CC 2EE9A 4YXHH 1T1YB 1DLFH 2IH3B 3W9EB 2YEZB 1YC7A 1WISA 2ZUTA 4BQCA 4PY7B 4EUPA 4NNPH 3DSFH 3V5DB 3LPFA 5JO5A 2SEBB 1XIWD 4K23H 4YPJA 3DMMC 4YHIB 2Z8SA 4U7SA 3CNKA 1U8JA 2MJWA 1XCQA 4PBWD 2I07A 3UTQB 4P9ML 1UZ6F 2ORBH 4PJAB 1HWHB 1YNKL 2HKFL 3WS3B 3O6FC 1NCDH 1DVFD 4UDUB 3LV3B 1A9BA 2VN7A 3B2VH 1LEIB 3UTSE 1GGCH 2JF1A 2CJUL 4IIQB 2MNUA 2OZ4L 4O2FA 4X5WB 4JY6B 3MJ9L 3V0AC 4L9LA 4R96A 3OB0H 3K7UA 3FKUS 1ZHBA 1AIFA 1CE6B 4MJIB 4NM4H 3S5LB 2IBBA 1U8NB 5DD0L 3EDDA 2FIKB 2FDBP 5ITFA 5DD3H 3BJ91 1QYGL 1JHKH 4PRNA 5FA4A 1PZUB 4JKPH 5I8EA 5EFIB 1T1WA 3CLFH 5FDYA 4C83A 4PJDE 3PHOB 4HIHB 1DEEA 4XP5H 4LSSH 4M5YH 4YO0B 4I3RL 1WAAA 2YA0A 4CNIB 1ZT7B 3ZSSA 1OSZB 3RY4A 1CBVL 4KTYA 1Y18B 1NUNB 3P9LA 4OB5L 1AO7E 1MLCB 2VERN 2ATPA 3DX8A 1EIBA 2HFFA 5DJDB 4NN5B 3IT8D 5DMIH 2VXQH 3ULUL 3NZHH 2P1YA 1DBKH 1U92A 1HHJB 2OX5A 5EC2B 4MAYA 5J4MA 5MENE 3MBXH 1MHPL 1NMAH 2WK2A 1NC2B 3V6FB 4NQCB 2EDDA 2CKNA 5CLWA 3RIFF 5C0FA 1NLDL 5HYJE 3D0LB 3BP5A 1HH6B 3MV8E 3F7PC 4IOSD 1A6TA 2DTSA 2AV1A 4WUKH 1U6AH 4H25A 3VXRB 4LSTH 1TXKA 1MI5A 2LU4A 1KIPA 1MJJA 1UG9A 5H37H 1UVQA 4RA0C 1A3RL 4PJCF 4L4JA 3TN0A 3V8CA 2NR6C 3HZYB 3P2TA 1MCSA 4NRZA 3QUXB 3JV5A 4HQQL 2VLRA 5F9OL 1S5IL 3QIUA 4U6XA 1S7UA 4ZOCA 4J7RA 4XNYH 5E00B 2PTUA 3BDXA 3REWA 3FHAA 1P5UA 2NX5A 2FEEI 3DXAD 3O8XB 3AAZA 3QH3B 1T0PB 5FB8B 3DYMA 2R0WH 4JCMA 3UTZA 1YEJL 3B2UC 4PRHA 2YD9A 3BEVB 3TEUA 4HAFA 1I9IL 2AXFB 4K8RC 4YHNA 3EOBB 1FPTL 3BH9B 3KPPA 5CEYB 5MI0C 1IE5A 4JZJB 3WLBA 4MNGA 3AMLA 3IDJB 5I1IL 1RJZA 3CX5J 3DVGA 4AL8H 1S7XB 4R4BB 2EDEA 5TFSH 3OAUL 4OZIF 3MLXH 4ZS7H 3LRHA 2PYFB 1L0QA 5KJRH 4WFHD 2CRZA 1AFVL 4X6CB 5F7MC 2PCPA 4IRZL 1E6JL 3C5JB 4JG1H 4HUWA 3U7AA 4TSAL 3RX8A 3WUZA 5DK2A 1JF1A 1N0XL 3HNVL 5L7XL 4WUUA 5I6XC 4CU6A 3BWAB 4UQ2B 1I8MB 3JWOL 4M3JA 3AVEA 4P57A 5J8OA 2CK2A 2AERT 3X3FL 2CK0H 4XNUL 4S1SL 4DW2H 3SQOH 4Q6YA 3EJZD 4RNRA 5A16A 4FMFA 3S98A 5JA8B 3B9VA 5DUMH 1HXMB 4J3TA 4Y89A 3SE9H 3FB5A 4L3AA 1JYWA 1UKTA 4H0HB 1SYVA 5DFTA 5E2TL 3SDCA 2GJZB 4Y19A 3ZE1E 4P59L 1CGXA 1I9JL 4PV9A 5FYJE 2DQHH 1EBAA 3H3PH 5DEFB 4G3YH 3MUY1 4DZBB 5I74C 3OR7B 4L3CB 3UXFA 1MH5B 1VPOL 1FVCB 5HD8C 3BZ4A 2ITDA 3B83A 4G8IB 2P5ED 4PJ5D 5FYKL 5L2KB 4NNXA 4QRPD 5DTFA 3BDYH 1A6VH 1OGAD 4ALAL 2B7DT 4WEBL 5F1IB 2VOTA 4PJ8D 1T66D 4QHMB 3CVHB 3BVNB 1HINL 5DUPH 1K85A 4IRSB 4RGNE 4TUKH 2V7NB 1RMFH 2PXYC 4RIRB 1WFOA 4Q6IB 3BN3B 1MFAH 2BOCA 4KKLC 4P2OC 1BVLB 1J9CT 3WFCL 4Q58C 5D71H 4OD3L 5KSUA 2VXVH 4PREA 2NXZD 4KROC 4NUGH 2V5TA 5DI8A 4IOIA 5E95B 1E4KC 3CFCH 4I3GA 4PRPD 5EZLA 4EI5B 1X3DA 2QQNL 4EN3B 3TPKA 3RWJB 5F96L 1TIUA 4XPFH 3BPOB 1HOCA 1QEWB 3EYSH 5C09B 2FECL 2GTWA 3MNVB 5KSAB 3SKOA 1HHIA 2CH8A 5EA0H 4MYWB 1CGSH 1OCWL 3LMJL 2XA8H 5HBBA 2RFXB 4MB5A 1S7TB 4I2XB 1PDKA 1P7KB 4N8CH 1CGVA 2NY4C 1UWXK 4IMKA 3IU3B 1AHWC 4LF3B 1OT1A 5CJOH 4RGMC 2X70B 3GB7B 3RTQD 1FAIH 5BOPA 4FQXD 5T5NG 4WW2B 3DV4B 3UTTA 4CN1A 4M93C 4H1LH 3RBGA 5T3XE 3V0VA 3SJVA 1W8OA 3CH1B 4QRRA 4NUJA 5IWLC 4GG6B 2IANE 3ZTNL 5MERB 2NY3B 1QO3B 2ZUQB 4H8WL 1RIVH 4Z9KB 1WAAE 5DJZA 1A0QL 2GCYA 3QI9B 5D1XB 5EBWB 3MODH 2XWBA 5BVPH 3ULUC 3D18A 4GAGH 4WEMB 4YHZH 4U6VH 1ZTXL 4HPYL 2A6IA 3T77A 4DN4H 2PYEB 4O2EB 4WGWB 4HC1L 1WLHA 4XCCL 2LVCA 5DURB 1TJGL 3MRKB 5I17A 4JB9H 4I0KA 2RIKA 3QUZC 1J1XL 3LVEA 4NSKB 4OZFG 3RDTD 2UZYB 5DDHA 1XR9B 3RRQA 3AGVA 4P23C 4PJEB 1D9KA 3TBWA 2AV7B 5KANG 4PJAF 2P42B 1KELH 4QEGA 2ICWB 1JBJA 4I18C 2JCCF 3WNPA 4ZODA 1X4XA 2AKRA 2DWEA 5CD3A 5JIPA 2G9HA 1CICC 1HKLH 3SGKA 1YEFL 1CGTA 1MI5E 4HWNA 2BCKA 4WV1B 1CZ8H 3QUKB 5BV7B 2DQJL 4KTDH 3TP4A 2DKMA 1FBIL 1LE9B 1R24B 4BK4A 1FV1B 3IDXL 4MJ4A 1W72H 1MIEL 5CZKA 1FH5L 2IBZX 2FCBA 3I75B 3QWOA 1A7NH 3WEXA 3BN9C 3NCMA 1QFUH 1T5XA 1ZWIB 4QXUH 1RZJH 3VFWA 2IFGA 5DJ2A 4TTGA 5BCAA 1Q38A 1JGUL 1VFOA 5C0RH 1JHLH 2NX5E 3RVXC 3K80A 3VD4A 2NZ9D 5EU4B 5IB4B 5DR5H 2JJVA 5C6TL 3MUGA 4XTRD 3GHBH 4XBPB 1UA6L 3QXAB 1ZGLM 4OKVA 1FNHA 3MV9A 2JB6A 5FA3B 3T4AA 3WBDA 2V5YA 1M6OB 2DMKA 2Q76A 1ND0B 5DYOA 4XP1L 4OZHA 3KDMB 1X44A 1KLGA 1RUMH 2XZAH 4NKOA 3RPIB 1G7MB 2VZVA 3QQ9C 3V79C 2ADJA 3LSOA 3C2AL 2R1YB 3HG1B 5DC4B 5E6IB 5IHZB 1TQBB 4JPVH 3GSXA 3EJJX 4ELKA 3T1FB 3NH7L 1KTKE 4MGXA 2QADD 5GGSY 1Z9SA 3PNWB 2ATKA 3L3JB 2YPVL 2FJGB 2Y5TB 4ZFFB 4MS8D 3RWHA 1I85A 4NOBA 3L7FA 3TCXA 4QYOA 4FQ1H 2CSPA 4I0PD 2UZXB 1NBZB 4XRCB 3BP7B 5JPMB 3W0WB 1LNUB 3MLRH 5E4EC 3T0EB 4LVOB 2NY5H 3GMMA 3C5ZA 3JVGA 3MLYL 3FCTA 1LK2B 2FB4L 3BYTA 1W0VA 4HX1A 5F7UA 1H3TA 3IRZA 2VZ3A 1MRDH 4KK5D 4NPYA 1NCBH 1QPXA 2NY2C 3L3KA 3SDYL 4LVNC 1MFDH 2HH0H 1MQ8A 4LHUG 3WKMH 4DVBA 1VEMA 3ULVF 4PJIB 4BZYA 3PWVA 2ZSVB 2FATH 3QIUC 1CXFA 2R0KH 1S7SA 1RQ5A 2D2OA 3BZFA 2ESVA 4FZ8H 4LLMA 1XH3B 2PW1B 1M7IB 3L5WB 1Q9KA 2AK4B 1YMMA 1XZ0B 5C0BB 1G1CA 4UQ3A 3O45B 3QDJA 4R0LC 2BNQD 5I15H 5T33L 3HTLX 2CDGB 2RGSA 5I76A 3VXMD 3RZWA 1HHHA 1IMHC 1A1MA 1QNZL 1PQZB 3VXUB 2VSDA 4HEME 4Z76A 5C8JA 1PG7W 4Y2DB 4PIRF 3WUWG 4DOHE 5IVXB 4LHUA 4YDKH 1UH4A 3VDCA 3X14B 1ORSA 2AJZB 3S88L 3HC0B 1UM6H 5I2IB 1BFTA 2IFFH 2AK1L 3C60A 5F7DA 3EO0A 4W70A 1L9NA 5E2WL 3IXAA 3AB0C 3FT4A 4HMEA 1QSFD 5DVNA 2ZWLT 2I27N 3E8UL 1IEAA 1KC5H 2ZUYA 3ZYIA 2EEAA 1GIGH 4DKEH 2YPKA 4AG4H 1C1EL 2YC1A 2ZUWA 4GW1B 4XWOD 3P77B 3UTTE 5L6YL 4H8WC 1KGCE 3BPNC 2VQTA 5EOTA 4IDLA 1DQML 5E9DD 3SJVE 5HYEA 3IF1B 3LCYA 5D1QA 3CZJA 1AGBA 5DRWB 4Z7NF 3D1MC 4APQC 5I1EL 4Y5VA 3EKCA 4YX2H 4LSPL 4Q74A 1UEMA 5EIQA 5I75C 4LSDA 3VMNA 3SDCC 4ZTOH 5JPNB 1PKQB 1QP1A 4YHYB 4MXWL 2W92A 3DETC 1NDMA 5LCVL 4WO4B 3U30C 2D9QB 5IM7A 4H1LB 2HVKA 2UWEF 3SOBH 1YNLH 3GSRA 1EMTL 1AR2A 3O4OC 3N85L 5J06A 1FZKA 2Q3ZA 4ONOA 2A73A 2VZSA 2EDKA 1N26A 1XR8A 4JJ5A 4XB7A 4MX7A 3TNNA 3OKNA 4K7PH 2QSQA 4JQVC 1JZ7A 4HFUL 1RUQH 2APXA 3V4PL 5INCB 2AJVH 4JN2A 4P3DA 5I8CA 1KTLA 1MHEB 3BHBB 3E3QE 1HSAA 3AY4A 3G6JB 4QWWC 1U95B 4YK4B 5GGRY 3BRDA 1T22A 3NFNA 4JJHA 2VLJE 4KK9D 2EYSB 5IJKA 1PLGH 2PUQT 1YNTB 4MJ2A 5HDQH 4X0KA 4MDIA 1OAXL 2DM4A 4KHTH 5FXCH 3VFTB 4WW2F 4M1DH 3I6LE 4DKAA 1YEEL 1OPGH 4FQQA 3UC0H 2CRMA 4TVSa 2BMKB 4HUMB 3GRWA 4X8JA 4CMMB 5ID0B 4FQJL 2F15A 2A6KB 4JFDA 2Q8AL 3G5VA 5I71C 2BERA 1WBXA 2H9GA 3IS1X 3PP4L 2AJUH 3B6SA 2XQYG 4MJID 2CR6A 1W0WB 1W72B 4GXUM 3RL1A 5IBLD 3BIBX 3FB8B 3U46B 3X13A 4QXGL 5TF1L 3SDXE 4BSVA 1EK3A 3ILPA 5J11C 2OL3B 3SKJH 1EAPA 4FG6C 4G7YH 4ODVL 5C0EA 4WEUD 4XH2A 4NJAH 3ARVA 4PJEF 4I9WE 5BJTA 5T1DH 3P9MB 1SJVA 2E8ZA 3IU4L 3ARGB 4LLUA 3KR3L 1XGYH 3CSBA 3GI9L 3RVUC 5CGYD 3RJQB 3TO2B 3WSQL 2HP4A 1VGKA 2FX7L 3IDMA 2O5YL 4JRXB 1J7VR 1IJ9A 4NQCD 4YDIL 5TQ2H 1UYWH 3MLZH 3R06B 4R7NA 5EU5B 5EU6B 4HIIB 1ZT1B 3O0RH 1YPZA 3NAAL 4OI9A 4RGOH 5CAYB 2MCG1 5IMKA 3VXRD 3PGFL 2WBJC 4ACPA 3DO3A 5ADPL 4H88L 2A83B 3H9SB 4K3DH 3KPNB 5EBLB 4F7MB 3FFCB 5DUBA 4HAGA 4OD2A 1RUKL 5D6DA 1CG9A 3QUXD 1WFUA 4L8SA 1QLRA 5JW3L 3VFSA 3EYOA 4KRPB 2GJ6A 3GNMH 3H42H 2RAMA 5ETUA 3L3IB 3B9AA 3MRRA 3O8XD 2Y9RT 5IUSA 4CW1B 1I8LA 2UZIH 1S9XA 2BY1A 2ZOLA 4HCRA 5ICZA 3HE7C 5FYLH 5K59F 1FFQA 2J88H 3LEXB 1YMME 1RK1A 4P5TB 1JFQH 3QDJE 2FWOA 4W4NA 2ZZUT 3PGCB 5FO9A 4JM2C 2OJZH 3ULVD 1MREH 4AY0A 3PE9A 4IEFB 1M7XA 3FB6B 1ZVYA 3LS4H 4NQUA 4LLYA 1TMCB 5E8OA 4G43B 5EO1A 1INEH 2WUBH 2QTEA 2NW2B 3LS5H 5K9QI 2P5WA 3CMOL 1RUAH 1UXWB 2VDQL 3U0PB 1TVHA 4OLVL 3QAZB 4XHJC 4ZTPH 4YXLH 3W2DH 1C08A 1A7PL 1MQKH 3PWLA 4KKNA 1NJ9B 1MEXL 4A2LA 5HI5C 1KIRA 3MJ8B 4LEOB 7FABL 3QDAA 4M7LL 3ZDXE 5EC1B 1EFXA 1BAFL 1C5CL 4LLAA 5E94A 4YPGB 3KPOB 2K1MA 3ARQA 3P0VH 4N8VB 5FIEA 3S36L 3MJ7A 3MFFA 1HI6B 4G5ZH 5KBNC 5FKPB 4XCEA 3UTSB 5IFJA 1FORH 2ADFH 3LEYL 4MNHB 1Q1JL 5DQ9A 4KAQH 4P2YA 1NGQH 5DMGD 3QDHA 4X5LA 4PJIF 5H35B 4NT6B 1KJ2A 3C5ZC 2B8OT 1ZSDB 3MNZA 5ICYB 2P44B 1P2CB 1TNNA 2R23A 4XP9H 3B8SA 3GGWB 4QRTB 1TNMA 4MMZC 4P2RA 2DMCA 4Q9CA 5GGRA 1BIHA 4XCNA 1JTOA 3MBEA 2ZG3A 4R90H 3DJ9A 4PJDB 5TE4L 4KRMB 2HJKB 2E5EA 5IVXF 1OHQA 2VJXA 3GO1H 5L2KD 5CEXB 3RA7L 1U42A 4U1LB 4OZGA 4GBXB 4OCXH 4GW4A 4X98B 3LPWA 4GRLD 4IRSD 1KFAH 3TT1L 4QHNA 2VSCA 4JFFA 5D7IF 4DTGL 5EZJB 1T3FB 5KVGL 4HCRL 5MENB 1P69B 5GS0H 4UV7L 4XXDB 4DZ8A 4XC1H 5HYJB 4EI5D 3RI5F 4RBPK 1FGVH 4NRXB 2ICEA 3C60C 3FO1A 2Z31C 5C09D 4L4TD 3H0TB 1ZHLB 5KSAD 4UTBH 2HLFD 1Y6MR 1P6AB 2R29H 4N0YL 1P4LA 5F89A 1WVZA 2HG5B 4OIAA 1FG2B 4JFDE 1UXSB 5HHNA 8FABA 1CLYH 3RNQB 2QHRH 3F58L 1F3JB 4FFZL 5F7EH 4KC3B 2I5YL 4ONGL 1A4KA 1LP9F 1NGYA 1IAMA 1OD7A 4OUUA 4NZDA 3LN5A 3T4YB 3JV6A 2WINA 4HMDA 3QUML 4F7PA 3L1OL 3V5KB 3WL9B 5A43C 3O6ML 1XF1A 5D1QC 2I60L 1BX2B 4GKZA 4NQTA 3TM6A 3DVNA 3AFLA 4Y5VC 1HQ4B 4XPBH 1JWUA 1WFTA 2NY3D 2HN7B 1TCRA 3FT2A 1K4CA 2JTDA 4WY7H 3LKRB 1WBYA 4BZ1H 3QI9D 3CPLB 5I1CH 1OP5K 5IBUB 4XNXH 1CR9L 1UC6A 1FZJA 1S3KH 3ZHLA 2VDNL 2PYED 4NHUA 5D7LA 1KJ2L 1ZGLB 3V6OC 5MHSD 3MRDB 1EPFA 3G6JF 1AKJA 1T89A 1UM5L 3L95A 3LPGA 3OBAA 4X7FC 5H94B 1B2WL 2BSRB 2YD5A 3H9HB 3SCMA 4AEEA 3DYOA 3SDAB 4PPTA 5HVGB 4I3SL 4UU9A 1M71B 2XA3A 5B38B 1FIGH 4L9DA 1YPZE 5ICXA 2VXTH 2X4NB 3PDOA 1HHGA 5DHYA 3TJEL 2F74B 2Z8RA 4LKCB 1VADB 3AY4C 4HIEB 1NL0L 2AABL 4PLJD 5IJKC 4U2ZA 1NDGB 3BEWA 3EO1B 5I1AB 1I7TA 5F7LB 3ORJA 5DD6A 4MJ5B 1TTGA 2UVFA 2OJEB 1WZMA 2OTWB 1PVHA 4OAWB 3D85B 4ZUTA 3QXDA 4M03A 5FGSA 3TVMB 5MEPB 1U91B 2YRZA 1B4RA 2OM5A 4ZUVB 3C8KB 3VRIA 1I9RL 2GJ6E 1FGNH 2OQJA 1YEKL 2C7UA 2VLKA 5GRXG 5C08A 5GS2D 4JKLA 5T3ZE 5BQ7A 1IARB 3LHPL 4NKMB 5DRNA 4NJ9H 2AQ3A 3F65A 3DURA 4Z7UF 3MREB 4UIKL 3MYJA 4JHAH 4Z7WA 2NY0B 3E1F1 1L7TH 3ZE2E 3MC0A 4HDIA 3VG0L 4K7PX 1JVKA 4R6UA 5TE6H 1ZS8B 1NGPH 4K07A 4FA8A 5EOCL 1M05B 3GSNL 1OM3H 4L29B 3KXFA 3O11A 2VXSH 2DM3A 4N9OB 1TETH 2P5WE 4JZOB 3DTXB 1FCCA 4ODXA 4ZS6D 3GMRB 2O5XL 1K4DA 4RGNB 3EDJA 1SJEB 5IBTL 1XGRA 4KKCD 3QCTH 5JO5B 5E6ID 3T2NL 2IGFL 1AP2B 3QPXL 1ZV5A 2BOBB 2CRIA 4URTB 3M07A 2OR9L 1XCQB 2I07B 2XNAB 1ACYH 3BGFB 3W5NA 1JNHA 1CDHA 4MCZA 3HMXH 5C0ND 2E3VA 1N3NA 3WN5A 1A9BB 1FFPB 4AM0A 2DLEA 4FN0A 4M48L 5F6IC 3W0WD 3CZFA 2FD6H 1PD6A 4JO4H 3T0ED 4M1CD 4L9LB 3E2HC 3LZFH 1RZFH 1WQVT 4LGRB 1UFUA 4U0QB 1AIFB 1BQHG 3M1BA 5AYQA 1EHLH 1V3LA 3FMGL 3GFUA 1RURH 2Q1EA 2Z93A 3N9GL 3VFGH 1IAIM 2VDPH 5GS3A 5FA4B 2Q6WA 5DFVD 2MPAL 3FO0L 1NBQA 3VRLE 1T1WB 2IANB 4C83B 3SPVA 1AGEB 4L8SC 4H20L 1DEEB 2IALA 1CDCA 1O0VA 1N6QL 3CVIL 5ALBH 4OZGE 2AK4D 2R9HD 4NP4H 1EUTA 2W9DH 1BQHA 3DX8B 1IL1A 1JPSL 1NCAH 3GKWL 1DUZA 1T04A 4JFFE 3VXUD 1U92B 2AEPH 1I4FA 1SBBA 2GSGA 3OR6A 4MAYB 4Y2DD 1LO3L 1ES0A 3ARDC 5E2UH 3S8WA 4JLRB 3OSKA 5AAMA 5I1JH 4JFEA 5LQBH 3GSWA 3AXLB 1R5WA 1JHTA 5JR1H 3RPKA 3S34L 3BP5B 3VH8B 3L5JA 3O4LA 3CUPA 3PGDA 4NZTH 1IT9H 1KN2H 3ECBA 1G7QB 3OKLB 3SKNA 4KWUA 2H2PD 1Q94B 3NCJL 1JNNL 1FNSL 1MI5B 1OAYL 1KIPB 2X4TA 5BXFA 1NGXA 3ALXA 2V17H 4O5LL 5DRXB 3WIHH 4L1HA 2YZ1A 5T1KD 3TN0B 5HVFB 4D9QE 1A4JA 3FN0H 1ORQA 4XPTH 2VDRL 5I0DA 2HAZA 4LVHC 3UBXB 4O02L 2M2DA 3QPQC 4DVRH 4U6XB 1QUNA 1ZANH 3BPLB 3UX9B 1ACZA 2NX5B 1BD2D 1JTTA 1PSKL 3T1WA 4PJDF 3PL6C 4D9RD 4R4FH 5F72S 3VWJC 2YN5A 3IJSA 4AEHH 3VXOA 5IHUL 1FL3B 1WICA 1P7QA 4XVJL 1CCZA 4HH9A 4RZCA 3NFSH 4B5EA 4LIQL 4PP2A 1IAII 3L3GB 5D7LE 4WO4D 3ABZA 3WLBB 5C2BH 2F53A 4YHKL 2CUMA 1RJZB 2ZJSL 3V52L 2D7PA 1X5ZA 4KJQC 4HLZG 1DSFH 1U8MB 2HKHH 3FRPA 4OLZL 3DUUB 1NUDA 1UWGH 3LB6D 4TPRL 4X4YB 3KJ4C 4PGDA 4MQTB 2PCPB 1EBPA 3CAFA 4HUWB 4RMRA 5JMOC 1VKXA 1XIWA 5DK2B 1N64H 5DMKA 4OIIL 4IS6B 4GAFB 2GY5A 3SKMB 2DQDH 4JO3L 2ZUSA 2VZTA 2GAZA 1R0AH 1HIML 3WS6A 1INQA 4G80A 4GW5A 3INUL 1UJ3B 3P73B 2EXYC 5CSGA 1IAKA 4OCRH 3BW9B 3MRCA 1FO0B 2WQ8A 4PV9B 5F71A 3ZTJH 5I30H 3PHQB 1SJHA 1VESA 3KYOA 4UOW0 3QULA 3P4NA 2IH1A 3GJFB 3DI2B 4Z7WE 3GMPA 1AGFA 2XN9D 2VRAA 5B39G 2ED8A 2ZSWA 5HGAA 2MCPL 3PWUA 4HF5L 3KXFE 4N0UE 1FNFA 2ENSA 1WWCA 1FJ1B 3LD8B 4TTDC 1J05A 2LTQB 2UY7A 2X7LB 5BVJB 2FYYB 2NY1B 1JRHL 3IDNA 4O51A 1NGZA 2YD3A 3K8MA 3ARGD 4XAKE 2BOCB 1JZ8A 4X6DE 2P8MA 4OQTL 1UKQA 4HJ0D 3DUSB 4OM1H 4PREB 4DOHB 5CJQL 4F9PA 2X44D 2XFXB 1F4WH 5FAAA 1JTPA 1BIIB 1HN1A 1NEUA 3TBVB 1G6VK 4JRXD 1UCBH 2DQEL 1NCUA 5B39A 3VDBA 1JCKA 4EBQH 3DROA 1HOCB 4KUZL 3RWEA 1MFEL 3BIKA 2DLFH 4BH7B 3SKOB 1HHIB 2NYYC 5EU6D 4YUEH 1BQLH 4WTWA 1JN6B 3Q5OA 2R1WB 4OFKA 3SKUD 3QFDB 4Z5RA 1N5YH 3MLTA 5GZOD 1ZEAL 3HAEG 4IOFC 1R5IB 1F2XK 3U6RB 1JGVL 2J3SA 1S78D 2D7TH 5GRUH 1YY8B 2A9NL 3UTTB 3QG6A 3ZE1F 4JFZH 4LU5L 2DI7A 4AMKH 1H3XA 3KHOA 3SJVB 1BBDH 1A6VL 1A3LH 1IAIH 2ARWA 4K3GA 4NBYB 4DJMA 1HHKA 4P99A 4KRPD 3RZCB 2B2XL 3DXAA 5DJZB 1L0YA 1GZQA 3G6DL 2XWBB 3D18B 3U4EA 1JYNA 1RJLB 1QHOA 5DHVH 3TFKC 5FCUL 3L9RA 1A6AA 2AP2A 4HGWB 3T77B 4P5TD 4F15C 2EH7H 1MSPA 1EGJH 1IC5L 4G8GE 3SGDI 5FGBA 1CTOA 5I17B 4EZMA 4LSVH 3DV6A 1R3KA 1REIA 4XPFL 2RCSH 4RAVA 4X7DC 5F1KC 5HDLA 3I50L 2H2SC 4KI5C 1YY9D 2IPUK 1D9KB 5J89A 3TBWB 2V2XA 4Z95L 3WFDL 2EDOA 1KULA 4NO5A 5ISZD 3ZKND 2X1XR 3A67L 3O4LE 2VLLA 5AAWA 2DWEB 5CD3B 5TGBB 1LWRA 2BDNH 2G9HB 1MPAL 2P24A 5DZLA 1EEZB 4RQQA 2AJXL 3LKSA 2BCKB 5EPMB 5B3NA 3VGFA 2VLJB 3Q5YA 1IC7H 4K2UH 5TF0A 3EW3B 4NYLB 3HI6H 1E4XI 4ZPTA 1CDBA 4WU5A 5ADOH 4GKNA 5I1HH 3QWOB 3WEXB 4PG9A 3RWCA 1MCHA 3RVVD 2R0LH 3VFWB 4MNQE 5HVHB 2LU3A 5DJ2B 4YBQC 3BP6A 3UTSD 1KJ3L 5IFAL 1NPUA 2H32A 5CEZE 3FO9A 1DN0A 5DD5H 5ERWB 5JA9A 1WITA 3OZ9H 1E28A 4HJJH 2W9EH 2AW2A 4FQLL 4S1QL 1WAAF 3MOAL 5EN2B 2D7QA 2QSCH 1WZ1L 3AROA 1J86A 4XX1E 4ZAKC 4HZAA 5DJXA 3SDXB 3SO3B 5IR1A 5E8PA 1LMKA 2ITCA 4P46B 4RA3A 4YH6A 5CZXD 1UACH 3UMTA 4J4PD 2JB6B 1AQDB 3RKPA 5CCKH 5HY9B 2R4RL 3PJSA 5GGTA 4Q9RL 2P5EA 2VDKH 4NWTH 4PJ5A 1T21A 4UZGA 4WI5A 1OGAA 3LRGA 2WBWB 3OGOE 1NAMH 2BRRL 4PJ8A 1NCCL 4P48A 5DMJB 2ZNXA 4YEFA 3BKJH 4GBXD 2FO4A 2R69H 4ELKB 4JRYE 1NBVH 5I1GH 4TVPE 4GAJL 3EYUL 4F33A 3AS2A 2YD6A 1KCVL 5CSBA 1QRNA 2EDHA 5MEND 1MVFA 5CJXA 1FLTX 4PRPA 1CFNB 1IM3B 2YD8A 5HYJD 3L7FB 4QYOB 3MRJB 1C12A 2W0PA 4BELD 1DUYA 2EO9A 4K94H 2X4OB 3VFNA 1CFVH 3NCCB 1KCRH 3OJ2C 1AQKH 15C8H 3FCTB 1T5WA 2F19L 3VXQA 4B41A 1D5IH 5J9PA 4UILH 2DJUA 3RTQA 1IQDA 4NPYB 2B4CH 2D0HA 3STBA 1ADQL 4D2NA 4HWBH 1P7HL 4JY5L 5LAXB 1JGDA 4NCC1 2YD2A 3U1SL 3MRMA 4YR6A 1SEBA 3SGDH 2DL9A 3BKYL 4DVBB 3BH8A 3RNKA 1IQWL 4F3FA 4JDTH 2L7JA 2R56H 4ZFGH 2BY3A 1UT9A 2DS4A 3QQ4A 2WWMD 1AXTL 3MR9A 2YR3A 1YMMB 4RISH 3P0YH 1ULVA 1MELA 3QDJB 4UQ3B 1VEOA 1HHHB 1NC4A 4MB3A 1OTTD 4YFLI 1MF2L 2DJ4A 3OHXA 1QVOA 1WCBA 4HWEL 4Z76B 4Y16C 1DBBH 4NKDB 2E9JA 1LDPL 4MXQD 1AH1A 3TESA 3RDTA 1LO0H 2HRLA 4X4MA 5L0QB 5D2NC 4EOWL 5D7JD 2B0SH 3WLWD 3QDGE 2APWA 1CLZH 2YUXA 1DQDL 5C9JA 2ZG1A 5EZIL 3SDAD 2X1QA 2AAVA 5EH1A 3IXAB 3FT4B 4ODUA 3S37L 3GMLA 3GK8H 4XPHL 2W65B 5CHNA 1CVRA 5JXAH 1XIWC 3OGCA 2YPKB 4HULB 3V4UL 2YC1B 4KI1A 4NZRL 3QUYC 3P40A 4ZOAA 5EOTB 1F4XL 4M62H 4QXTA 3H7BA 1DVFC 4TSBH 4A6YA 1FNEA 3D85D 1R3IH 3LAFA 3WS6C 2DBJA 5EULV 5DLMH 3TVMD 3UJJL 3MLWL 5HDOA 4U1JA 1MCFA 3GM0A 4JR9L 4PJCA 3TJHC 2HMID 3HUJB 4HD9A 4RFNB 5FYJD 2DAVA 4KMTL 4UV4H 4F7EA 1U93A 5CIPH 3A6CH 5E8DH 5F21B 2HVKB 3IFOA 1DQQB 2NY0D 1FZKB 4F8TA 5BMFH 2YK1H 4GS7C 1KIUA 1N4XH 5B8CB 1DQLH 1XR8B 1I8IA 3CFJA 4MX7B 3TNNB 3V8OA 3OKNB 2XOTA 2AJ3B 3GDBA 4WFHE 3HPJA 5EWIL 5FYLD 1MWAH 4XMLH 4R7DB 4JN2B 4X7EC 1N6UA 4DKEL 4RGND 1KTLB 4HGKC 1HSAB 1GAFL 3G5ZA 3O41B 1CDYA 2K7QA 3HZVA 3KPQA 1P6FA 4A2MA 5CUSL 5FV1L 3TYGH 1AGDA 3V5HA 2NW3B 5K9JH 1S7QA 1IM9B 4X0KB 3K46A 4MDIB 4F9PC 4OZIA 2F5AH 2IMMA 4ZUSB 3H2WA 4NQSA 4RMVA 1U58B 1JPFA 4LLWB 3V7MA 4DQOL 3VGAB 4I0PA 3ZKQD 4K8RH 1MCPH 2ENYA 5KVDL 25C8H 4FQQB 4OF5A 4IDJH 1SM3L 1URLA 4FABH 3WIIH 3U7WL 1BFOA 4HH8A 2VIRB 3ZKXC 5IB2A 4ISVA 4E5XA 3DBXB 4JFDB 3FJTA 4OLWL 2H9GB 1S5HB 4ZUWB 1IGFL 4KK8D 4LSRH 3RL1B 2Y1VA 5HTSA 4AT6A 3X13B 4N1EA 3ILPB 4YHLH 5T3XD 5FM4A 1NMBH 5HPMB 3WD5H 5GGSB 2G75A 4LSUL 5KS9A 4NM8L 4GXUN 2IAND 4E42A 2P5EE 3GMOB 1I1CA 2A6JA 4PJ5E 4XH2B 1OGAE 1BOYA 3QCUH 1FRGH 1A7OH 1GOFA 1NUFA 4NC1C 4O4YL 4N9GA 4PGCA 4A6YL 2XT1B 2EICA 4LPYA 3KJ6L 5F3HA 2H6PB 4DN3L 2BNQA 3S3JA 3KNBA 1OTUC 3VXMA 2XY1A 3HE6D 3K4DA 2EO1A 3MA9H 3QXVA 4QHUA 5F93C 2PO6B 2XZCL 3BP4B 3FQRA 4M1GL 1QQDB 3KG5A 1VGKB 2OTPA 1T2JA 4MAYD 1QRNE 1UWXH 3FQWB 3EFFB 3RGVB 4PBVC 1QBAA 1BM3L 2KDGA 3UYRH 4PJHA 4X80L 1U8OB 5JHDA 4Z0BH 3RU8H 3EGSA 3NPSB 5FUOL 4ZXBC 1YPZB 4I13B 4WHCA 3U4BL 1QSFA 2EYRB 5EORL 1EH9A 1MI5D 5DK3A 1ZA3B 3MRPB 3AM8A 5CD5D 4WU7A 5ACLA 1EEQA 5GS0D 2WLYA 4X5XA 2VQ1B 5E7FA 2XPGA 5C0JA 2EECA 1U3HB 3BSZL 5E9DA 3IGAA 4P9MH 1QLRB 4LL9A 4R2GB 4NJAL 1YNKH 2HKFH 3WXVL 1ITCA 3EYOB 4KKBC 1KCKA 3VA6A 2NX5D 5IROA 5I1KL 3MRRB 3RL2A 1S9XB 2ZOLB 4OZHF 2CJUH 1P9MC 4TQEL 1I7UB 1FCGA 3S96A 5FKAA 2OZ4H 1MY5A 2VUYA 3FAXA 3MJ9H 2FWOB 32C2A 2YMXL 3O9WD 5FO9B 4PV8B 4HXAL 3NIFF 1T7VA 5CGTA 4K3JL 3EYVA 5AD0A 4FXLA 3B9EA 5DD0H 1VSCA 2CR3A 5IF0A 1QYGH 1QFWL 5EO1B 4X4ME 1J0ZA 1X5LA 2P5WB 4FFWD 2IH3A 1KCUL 3OAZH 4LCYA 4PJ8C 4YDLB 4YQXL 3W9EA 3HZMA 2NTSP 2YEZA 2FH6A 1Z6JT 3CDCA 4I3RH 4PY7A 1QR4A 5D93C 4B7LA 1CBVH 3LDBC 4L8BB 4NO0B 1JP5A 4HW6A 2C9AA 3S35L 3SHSA 5E94B 3S5LG 2X4UA 4OB5H 1WTGT 1GHFL 5KVMC 4YHIA 2IBZY 3UTQA 1N2RA 4CKVX 4PJAA 3ULUH 2OXGA 1ZLSL 3MJ7B 1CGUA 4WENB 5IFJB 1AJ7L 2FBJL 5CINL 1KPVB 2VISB 4MSWA 1MHPH 3LV3A 5DQ9B 3BRGC 1LEIA 4HUUB 4LSQL 1NLDH 3C5SA 4IIQA 2DKUA 2VDMH 4JY6A 5M7QA 4GFTB 4W4OA 1D6VL 2FZ3B 3KLAA 3VXSE 1IFHL 4FQXC 3S5LA 5GS1B 1FG9C 2AVGA 3HI1A 3NTCL 3O3BA 3QJHB 4JFXB 1A3RH 1CFQB 1NANI 2VZOA 4WGVB 4EUPH 3PHOA 4DK3A 1SMOA 2FECI 4HQQH 2V9TA 5F9OH 5BRZB 1S5IH 5F7YC 5FK9B 4YO0A 5C92A 4CNIA 3KLSA 4N90E 4OZGB 1X5XA 4HKZA 1Y18A 1F90L 1MLCA 2HTKC 3VXTB 4QHNB 4JFFB 5CIPB 1YEJH 2J12B 3OKKB 3KPLA 3F5WB 3ZDXF 1CFSB 4W68A 1I9IH 3MRQB 2FSEA 1HHJA 5AUMA 4DZ8B 1FPTH 2HVJB 3V6FA 3CX5K 4NQCA 5IEKA 2EXWC 4M7ZB 5L88L 4YWGL 5I1IH 3VFUB 2DB8A 3D0LA 1SY6L 3OAUH 4ZG1A 4OZ4A 1IC1A 1P4LB 5F89B 3DO7A 4C56A 1OLZA 5GIRA 1AFVH 3ARFC 4FNLL 4QKXB 1OP9A 3EOAB 5FFLA 4IRZH 1E6JH 1A4KB 3PWPB 4TSAH 3HLAB 3HZYA 3UTTD 5DWUL 4QGTA 1N0XH 3HNVH 3JV6B 2WINB 5L7XH 3QUXA 2APBA 1JNJA 4XPAL 5KS9E 3JWOH 2C4XA 2HWZL 3EHBD 4D8PA 3VA2C 5E00A 1JWUB 3X3FH 3FT2B 1K4CB 1MNUL 3MPCA 4HLJA 4S1SH 4XNUH 5SWSA 3RZCD 2YD1A 4CVWA 2X4RA 3QH3A 3VXNA 2NZ9C 4TNVF 2E8YA 3MXWL 3U79A 2Y72A 1CWVA 4KHXL 4PTUB 4XTRC 3BEVA 4J12A 1FZJB 2QSVA 3MCKB 3RWIA 2AXFA 1TENA 3VXME 5C3TA 3EOBA 5D7LB 4RFOL 3DGCR 3BH9A 5E2TH 5JW4R 4P59H 3K0WA 1I9JH 2DQCL 3QO1A 1FZMB 2BSSA 1AKJB 3MCG1 3IDJA 5IHBA 1KN4L 2RJMA 1HZHL 3KVQA 3SCMB 1S7XA 4Z7OE 3UAJC 1Z0NA 1VPOH 5ANMA 4PJHE 4UU9B 5JHDE 1YEDB 4FFVD 2VO5A 5FYKH 5ICXB 1JMXA 4Y4HB 4X6CA 1OARL 4ALAH 4WEBH 5C6WH 4N5EC 1VFAB 4JKKA 3JXAA 3V9FA 2J4WL 4WW1B 2VLJD 4WI9A 2E6QA 1HINH 5FUCC 2QADC 1I7TB 5MEQA 5J12C 5DF0A 1IEBB 3BWAA 4UQ2A 3WFCH 2ZPKL 3RIFK 4OD3H 4MS8C 3CK0L 4ZUTB 2H3NA 5E9DE 3I6LD 5AZ2L 2RR3A 1NANH 2QQNH 1SHMA 5F96H 4CMHB 3ARPA 1HXMA 2NY6D 3F6LA 5HYQB 4K3EL 3D2UD 4NO3B 5BQ7B 1OCWH 3DYPA 3LMJH 2O61B 1EDQA 4KK5C 1DJSA 4TYUA 3ZYJA 3DURB 3QIBB 2N4IA 1FFOB 4DZBA 1YEHL 4KH2A 4Z7WB 3OR7A 2DI9A 4P46D 5DRZA 5EOQL 1Q0YL 1GSMA 5F8RC 3MRGA 4Y5YC 1RVFL 5FO8B 4P2OB 4C55A 5L2KA 3F7QA 3KXFB 3O11B 3RWDA 4N0UB 4J3OC 3HKFA 3QT2A 5F1IA 2P8PA 2VXUL 4ODXB 3MV11 3ZTNH 4H8WH 3CVHA 5J3HD 4GRLA 1YPZF 4IRSA 1A0QH 2CKBA 5GRYA 2V7NA 4X6DB 3ROOA 4RIRA 1INDL 5HGHB 5JW4Q 4Q6IA 5ID1A 4Y4FD 5FGCE 1LD9B 5DEGA 1ZTXH 4HPYH 5BZDB 2VAAB 1VFMA 4HC1H 2CIKB 4LAJH 4XCCH 4YDVB 2A0LC 4EI5A 1TJGH 2W1NA 1AHWB 4JKMA 3ZHKA 5T1LA 3WN5B 4RGMB 1J1XH 3RWJA 5M95B 3ULVL 2BJML 1H15B 1QEWA 5C09A 4DKFL 4L4TA 3EJYD 3MNVA 5KSAA 2EDJA 3TLRA 2W0FB 3EDFA 3RWFB 2FLRT 1S7WA 5KANI 1N7ML 1S7TA 4M7JL 4I2XA 3IU3A 1C5BL 4LF3A 1O7SA 2CO7B 4JKWA 3GB7A 1YEFH 1KEML 1GOHA 4XWOC 3DARA 3W5MA 5MP6L 2DQJH 3LQAL 1FBIH 4LBEA 2IG2L 1FQ9C 2Z9TA 1GCFA 3IDXH 4I8DA 3RUGA 1VA9A 1CTNA 1MIEH 4X7CC 3SPVB 1FH5H 1TETL 2IALB 3ZE2F 3Q3GA 4GG6A 1MCWM 5GSVA 3S97C 5MERA 3QUZB 2DJSA 2L0DA 3JV0A 3QI9A 1JGUH 1IEHA 1YMMD 1UM4L 1N8ZA 5C70A 4D9LL 1IL1B 1MIML 2VR4A 5D5MA 4MJ6B 4G8GB 1DUZB 1T04B 2V5SA 2PYEA 4O2EA 2IAMD 5C6TH 4YBLC 4I18B 4DFHA 5DGRA 1IGCL 3MRKA 3QHFL 3U2SA 1AGCB 1UA6H 1J5OL 5GGVL 3C6SA 1MJUL 1JHTB 2P43B 1XR9A 1ZE3C 3O4LB 3CUPB 4J3SA 2AV7A 4XMKL 1LK3L 2ICWA 1AR1D 3HMWL 3SKNB 1MFCL 1JNLL 1FNAA 4XP1H 1QSZA 4M6AA 4EIGB 3U36B 2X4TB 5BXFB 5H8DA 1R3JB 1U8QB 4C56E 2GKIA 3QUKA 3C2AH 4OTXL 1LE9A 4RMWA 1BVKA 4QLRA 4HPOL 1R24A 1A4JB 1FV1A 2WQRA 4PS4L 1ORQB 3CVHL 1GGTA 3NH7H 3VW3L 1KPUA 3FN3A 3I75A 1HILA 3G5XA 4MNQB 4PJ9A 2YPVH 5IKCA 5F7NC 5D72L 2D0GA 2FGWL 4D0CB 4LDLB 3MUHL 1OTSD 4QF1B 3VRLF 2HT3C 3JSSA 4MD5B 4LQ1A 1MHHA 1CDUA 4IIQC 6FABL 2ICCA 4X7TB 5SWSE 5J7CC 1SBSL 4ODTL 4YHML 2R2HB 3WFHA 3IJSB 4W4OC 5EU4A 1P7QB 3EYQD 4NQDE 4HH9B 4XBPA 3MLYH 4OZGF 4RZCB 3K4ZA 3QNXB 2FB4H 2D7OA 4PP2B 4FXKB 4OF6A 3QXAA 3WNLA 1D6EB 2JJSC 2W38A 3RY6C 1G0YR 4JM4L 5FUZL 5HI4D 1HNFA 1ND0A 3UPRB 1CU4L 1A5FL 2R2EA 4QGYA 1XCTA 3KDMA 4U1MB 5ANME 3UZEA 1ZGLP 5I8KH 1B0GB 2LQRA 1DZBA 5IVOA 3RPIA 5E8EA 1G7MA 5HHVL 4X6CE 4LRIA 1JZ5A 4JRYB 1YN6A 5JMRA 2G2RB 4OZFH 3LIZL 4PJ7E 4R97B 5E6IA 5IHZA 1VKXB 4QOKA 4NNYA 1CXLA 1K3IA 3NMEA 3TNMB 1D5MB 1IKNA 5IB3B 2JE8A 5CJ8A 3T1FA 4XZUA 4NN5C 2EKSA 1CE1L 4OF7A 5T33H 3UCRA 5CGYC 3PNWA 5JZ7D 3L3JA 3TYFB 1IM9D 1QNZH 1EO8L 2Y5TA 4ZFFA 3K2MC 1INQB 2DL2A 4Y1AD 2CLVA 4GW5B 3KWWB 4X7SL 4KKAC 1JGLL 4LQFL 2UVEA 2Y07L 5JPMA 3W0WA 4JDVB 2QQLL 4YIQB 3S88H 5SX5H 3T0EA 2AK1H 3TH2T 3DRQA 3MRCB 3TBYB 1U9KA 1BGXL 1G6RB 5E2WH 4JFDD 3BUYB 4UBDD 3E8UH 2G5RA 1C5DA 1A9EA 1YMHB 4Y2OA 1F3DJ 3P4NB 2IH1B 1M7DA 1C1EH 3ESUF 4R0LB 5BV7L 2XY2A 5L6YH 1T2XA 3UROR 4PJIA 5HGAB 2ZSVA 4HUKB 3SGJC 3R1GL 4XBGB 2YN3A 4I48A 4U05A 1DQMH 3PWUB 4RSVA 4XXCC 5L2KE 12E8L 1G1YA 3HS0B 3O8XC 2PW1A 1M7IA 5I1EH 3L5WA 4UT9L 2AK4A 1J05B 3IRPX 3L6FA 1D5XA 4LSPH 3IDNB 3AUVA 1I3GL 2CDGA 3MCLL 4OI7A 1PQZA 3VXUA 3IYLW 2PO6D 3ULVC 2RB8A 4Y2DA 4MXWH 2ZP0T 4N0CD 4N68A 3L3OB 4JZJC 1OWRM 5LCVH 3QDGB 3GMQB 4NKIL 1EMTH 2AJZA 3RGVD 3DROB 3HC0A 5I2IA 3EZJB 3RWEB 3N85H 1X6NA 5KSVA 5C09E 4L4TE 2Z4QB 3BZDA 5BW7A 2V7HA 4AIOA 3LQAC 3ARUA 1S9KC 4I2XE 1NKRA 4HFUH 1MAML 4ODSL 3V4PH 5T1KA 3RVTC 1U3JA 1N59A 3IDYB 4QCIB 1PZ5A 3CLEL 1U0QA 2KPNA 1B4JL 1OAUL 2BK8A 4ZQKB 4DGYL 1U3HD 4TUJB 3RUGE 1WGOA 1OAXH 3IF1A 4N0FA 4Z7WF 4IRJC 1BPVA 1PKOA 1H3PL 5DRWA 3U30B 4GG6E 1BD2A 5DMGC 2IQ9L 4M7KL 3JBG7 1YEEH 5FOJA 3V6ZB 2F5BL 2M1KA 1WJ3A 3BISA 3L9RB 1A6AB 1H8NA 4FQJH 5JPNA 2VR5A 3OXRA 3ZE0E 4U1IA 1F4YL 5D5ME 4U0RB 2Q8AH 1HCVA 3CSPA 2PYEE 2BSTB 3D25B 2E6JA 3TO4B 3DV6B 4FZEL 4OLYL 4WO4A 1R3KB 3PP4H 4H1LA 5D7SL 4Z8FL 3B5TA 3SEPA 4LPUA 4P49A 4QXGH 2DI8A 2QQKL 4ETYA 2BSED 4NO5B 4U6HA 2GFBA 3V7AE 3VFMA 2P5WD 1U3ZA 4BFGA 1ZHKB 4ODVH 4DKDC 2P24B 4PUBL 5GRVL 4RQQB 1NAKL 2DLHA 4IRSC 3MUZ1 2HFGL 3G6JA 4OUOA 5DSCB 4NO0D 3B4NA 4MVBD 2EYSA 3IU4H 4OF0A 2AQ1A 4WU5B 1ZK9A 3UDWA 1J12A 3KR3H 1PY4A 2X4QA 3GI9H 5EOCJ 3VFTA 5I71B 1BJMA 2XQBL 3TBSB 3WSQH 2XZQL 1T7XA 4EN3C 5JHLL 2Q7YB 1ERNA 2FX7H 3BP6B 2O5YH 3JTSA 4UDTB 2H32B 3BPOC 5KAQF 4XBEL 3FO9B 1DN0B 4YDIH 2BMKA 4CMMA 2X42A 3VFOA 5ID0A 5J11B 1E28B 4I77L 3AREA 4PYGA 4LK4A 1FE8L 2EC8A 3NAAH 2A6KA 4JRWA 4EDWL 3U82B 3PGFH 4JN1L 3ZYOA 3IDGA 4KGLA 1RULL 4PRIE 2MSPA 5DJXB 5ADPH 1W0WA 1W72A 2PR4L 4WW2C 1JV5A 4H88H 3FB8A 2ITCB 2OMNA 4PJGA 3U46A 5IQ7L 4J1UA 4GUPB 1YQ2A 3MROB 4K7PY 1I1YA 2XN9A 3GM8A 4QNPE 5CBEA 3DI3B 2P5EB 1RUKH 2OCFD 1OGAB 5HYIA 4L8CB 2NY3C 5BRZD 1J8HB 2ZUQC 2W9LA 5LGJA 1G7IA 2J2ZA 3QI9C 5D1XC 2FO4B 3QG7L 1S9VB 2F8VA 3KPRD 5F6HJ 5C0DA 3STLB 4X9HA 3P9MA 4ORGA 1KB5B 3ARGA 5KG9B 1XFPA 3Q6GL 4QOKE 4JDZB 5BO1L 3QISA 1QRNB 2FEEL 3TO2A 3VWKA 4WDIB 4UMGA 5EU7E 3QHTC 3X17A 4JRXA 1MCEA 1C12B 1A21A 1QPPA 5DO2C 1GGIL 4WI8A 1CGWA 1CFBA 2ADGA 4HUVA 4YGAB 2NR6D 5EU6A 4HIIA 5EU5A 1DLHB 5CSZA 3T0EE 4G9DB 1T5WB 2V5MA 1AC0A 3DNKA 3CMOH 4NQEE 3VXQB 5JQ6L 1F2QA 2VDQH 4KRLB 4OLVH 4KMQA 3RTQB 3FONB 1A7PH 1IQDB 4WV1C 1MEXH 3EBAA 4D9QD 4PLJC 4TN9A 3HZKA 7FABH 2OS7A 4M7LH 1CGYA 2ZCLL 1ZHNB 3PWPD 3HE7B 5B4MD 1BAFH 1C5CH 1SEBB 4F9LC 3MV01 3B2UD 3BH8B 4MDJB 4P9HL 4M00A 4NGHL 4F3FB 4M5ZL 4XMPL 5JDJA 4GMSL 4K8RD 2I25N 5TH2B 1S7RB 2Q8BL 4CN6A 5C07B 4MHHG 3S36H 3QQ4B 4HBCL 4X6FB 3L3IA 3MGAA 2WUCL 2BVPA 3LEYH 1Q1JH 5DK0B 4CW1A 4Z7VE 2VABB 2AK4E 5D2NE 1NC4B 2YRLA 4P5TA 1IC4L 5IT2L 5DXWA 4Q9QL 4JVPA 4YAQA 3MUJA 3PGCA 5D7LD 2LAAA 4JQXA 4UAOB 2BY0A 1JZ6A 5C6PB 3OKMA 3RDTB 2CDEB 4ZOBA 1IZKA 4N8VG 3SCMD 2N1KA 5ISZA 4BQ9A 1FSKB 2W59A 4X6EB 5TE4H 3WFEL 3L3HA 4FQPA 1KCLA 3BWUC 4R8WL 1Y6KR 3GIVA 3QA3B 4Y4HD 2OL3L 4GRWH 4K7FB 3RA7H 3GMLB 1NJ9A 4KKCC 3MJ8A 4LEOA 4U1GB 4KTEL 5E6IC 5IMMA 1TQBC 2HRPL 5EC1A 3G6AB 4KJWD 1IKNC 4OKDA 3L5XH 4BFIB 1J11A 5JDSB 4YPGA 3TT1H 1YDPB 1A1NA 3KPOA 4XI5C 5JW4M 4DTGH 1V7NL 4QXTB 5KVGH 3H7BB 3KPMB 3MV7E 4HCRH 4N8VA 5C0NC 3TT3L 4B53A 1HI6A 4UV7H 1XF5B 3HNTL 3SBWC 1EUUA 1RD6A 1QLEL 1BD2E 1L6XA 1X5IA 4LVOC 4M1CC 4F57L 5H35A 1MHCA 3NA9L 2R2BB 1ZSDA 3VXSB 2XWTA 4MCYA 1P2CA 1VHPA 3MRHA 2Y25A 4NN6B 4HJGA 4N0YH 2CGRL 4EDXA 1ZOXA 4O00A 2ZOKA 3IFOB 3QIBD 4MZ3A 3F58H 1J0YA 3ZSTA 4J4PA 5DFVC 4RMTA 2I5YH 4ONGH 4KUCF 4PJDA 2J6EA 2YKLL 2HJKA 3KAAA 3QUMH 3O81A 4P2OD 1JPTL 3KXFD 3L1OH 4PB9L 5EBMB 4LFHD 3O6MH 2I60H 4U1LA 3UO1L 4LLQB 2W0KA 3OB8A 2R9HC 4GBXA 4WFGE 1N6VA 3G5ZB 2YRPA 4X98A 1IGYA 3HZVB 4XAKD 4BFBD 1WFNA 1LILA 2Z31B 3V5HB 1K5NB 5EZJA 1T3FA 1KUMA 4NFCA 1F45A 5A1AA 1CR9H 5MENA 4NQSB 2VDNH 1RPQA 1JPFB 5F1SA 5J0BA 2KKQA 3HR5A 1KJ2H 2H45A 2NY4D 4I0PB 4CRPA 1UM5H 2CQVA 1B2WH 1X7QB 2X1WL 3H0TA 1ZHLA 4F2MA 4FRWA 4GRMA 1PY9A 2H2PC 4I3SH 2D03L 1SYSA 5BW7C 2HG5A 1FG2A 4YZFE 1UXSA 3TJEH 1K8DB 2I24N 4X8XA 3RNQA 2VR9A 3PHSA 3DX7A 4AT6B 4DK6A 1UQSA 2R1XB 5CWSA 1NL0H 1TZHB 4PJGE 2AABH 3ULUD 2IF7A 5J13B 3T4YA 1EHXA 5KS9B 1IGJA 2XN9E 4XVSL 2VZ1A 2FRGP 2VE6B 1BX2A 3T2PA 1QSEE 5GRVK 4KZEL 2FGZA 2HN7A 3O3EB 1R3LA 1DL7L 1A7RL 5B38G 1FFNA 3MO1B 3QUZD 1R5VB 1TLKA 3D6GA 3LKRA 4G6FB 1I9RH 4UIMB 1YQVL 5I1DB 3CPLA 3L5HA 1YEKH 2QEJA 3VXMB 2C1PB 5C0CE 4Q97A 4G8GD 4QHUB 1FNGA 3FQRB 3LHPH 5DT1L 4WO4C 3MRDA 4LCWE 1CICD 4UIKH 2HFTA 5D7JA 2BSRA 4JRXE 3PF2A 4PJHB 5JHDB 1PG7L 3O4LD 4ELME 1T83A 3EGSB 1U8HA 4HWZB 3SDAA 3VG0H 5FEBA 1M71A 3ARSA 1JK8B 3BGMB 1PX4A 5EOCH 5B38A 3GSNH 1BFVL 3MRFB 4WHYG 2X4NA 4LSRL 2J6EL 3SDDC 3ESVF 2F74A 3SQBA 3FTGB 3GMNA 4LKCA 1VADA 1CXKA 2O5XH 4P9HC 1CD1A 4YK4C 4HIEA 5IBTH 2I9TB 3G08B 1G9EA 4J23A 5L8LB 3NN8B 1QACA 1SVCP 1EEUA 3T2NH 1MCLA 5I1AA 2IGFH 3QIWB 4FS0A 3RVXD 3QPXH 2A38A 4POZC 1K2DA 5SWQA 4MJ5A 1PYWA 3B9KA 2OR9H 2OJEA 3Q0HA 3V2AR 2OTWA 4MNQD 4Z78A 4OAWA 3D85A 2YUVA 1QFPA 3TVMA 4O58L 1U91A 1P53A 4ZUVA 4JPKL 4FFYL 1OF2B 5CEZD 5GRJL 3RL2B 2X9YA 4M48H 3S96B 2ED7A 1P7QD 3VG9C 32C2B 5A2KH 1I1RA 1MFBL 4LGSB 3MRBB 3ZKMC 5C2UB 3MREA 3LKQA 2JK5A 3B3IA 5DZOA 4EXKA 3FMGH 4PGJA 5IF0B 1F6AA 3N9GH 4MA3B 2Z0BA 1ZS8A 3GJEB 2MPAH 3FO0H 1M05A 5ISZE 4L29A 4LCYB 2DTML 4JO1L 4H20H 3HZMB 4JZOA 3DTXA 3BMVA 4MXVE 5HHOD 4KXZI 5EO9B 1WEJL 3GMRA 4AH2B 4E41A 1LE5A 1N6QH 1OWWA 2W60B 1SJEA 4JRYD 1BQSA 3SE4A 3CVIH 5A2JH 5FGCB 4TVPD 5GZND 1AP2A 4NQVB 2X4UB 2BOBA 4XP6L 3IJHA 3S3PA 4HJ0C 2GTZB 3L3DA 3CU7A 2J8UB 1JPSH 3GKWH 5CJBA 4QTIL 1N2RB 2F8OA 2XNAA 5LBSL 4LRNL 3HRZB 1Z5LA 3QYCA 4OJFL 4MSWB 1LO3H 3WDIA 3BYYA 3N1GC 1I9EA 1FFPA 2Z92B 4EVNB 3C5SB 3S34H 2AJYL 2NY2D 1BOGB 2O5ZL 1GPOL 4JQIL 4BJLA 2EC9U 3KLAB 2VDOL 4S11A 4KDVA 5GZOC 2ED9A 2FL5A 3NCJH 1JNNH 2ZUXA 1FNSH 1OAYH 3WIFB 3X3GL 1S78C 1XGQA 4O5LH 3HI1B 5ILTL 3O3BB 4GQ9L 3TPUB 1IVLA 4F37F 2FH8A 2AEIT 4NC2B 2WIIB 4V2BA 2EIEA 2IANA 2VDRH 5DZNA 5FM5O 1AGEA 2COQA 3VH8G 4KRPC 4O02H 3IAPA 2EZ0D 2KQNA 3ARDB 3BKCL 4OLXL 1KIQA 3GSOA 4CVXB 5EUKB 4N1HB 4HKZB 4HG4J 3O6LL