4GG6B

Protein complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
186
structure length
163
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSLLVCSVTDFYPAQIKVRWFETTGVVSTPLIRNGDWTFQILVMLETCHVEHPSLQNPIIVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Biased T Cell Receptor Usage Directed against Human Leukocyte Antigen DQ8-Restricted Gliadin Peptides Is Associated with Celiac Disease
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 163
sequence length 186
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gg6B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gg6B01
2EE6A 3HI5H 4JGMA 4F3FB 3CCHB 3QG7H 3WN5C 2B1HL 3PWJA 4HV8B 4WV1C 2JJSA 3FO2A 2YK1L 4ZNCD 4QYOA 3VA6A 3CH1B 3OR6A 3DGGB 4MB4A 4ZODA 4OLUL 5CJOL 2OYPA 4A6YB 5T33L 1WFUA 3F7QA 4U1NB 1Q72L 1N2RB 1FIEA 1SBSL 4F7PB 4HUKB 4KJQC 2VIRB 1REIA 2K7QA 1ZWIB 3UJTL 4H20L 4YGAB 3DSNA 3VXOA 1E28A 3K4ZA 5DEGB 1BBJA 2A77H 4BZ1L 3VXQA 5I1IH 4GRMA 1IAMA 4K8RD 4NRXB 2Z92A 4YX2H 3I2CH 3AMKA 4M6OH 2EYSA 3LQAC 3C6LC 5E5UB 1MJJB 3GMQB 5C0RH 1CGSL 4I3SL 5J6HA 4JJ5A 1BJ1H 2EDBA 5TDNB 3IJSA 4MAUH 3GB7A 4XXDB 4Z7NF 1PEWA 4APQB 4M6ML 1JGLL 4QRUB 4MA1B 4PJGE 2ZSWB 4X7SH 1KYOJ 4TUKL 5I2IA 2YWYA 5BZWA 1ZAGA 4NKQB 1CD1A 5IGXH 4H1LB 4XCCL 3WO3B 1MFBH 4N0UE 4ZFOA 5IJKA 2IMMA 1JGVL 2LU7A 1P4IH 2R56L 4BH7B 2X4RA 3IS1X 1YNTB 2XWTB 3JV4B 2J8UA 5DC4B 4HKXB 4I18B 3P2TA 4M62H 1CDJA 1J0KA 3S5LA 5DJDB 4AENA 5IMOA 5DZLA 1RZFL 1R3LA 2LVEA 1QZ1A 5FOBA 4AIZB 1FP5A 4U7MA 4Q9RH 1WVZA 2R0KH 7FABL 4PJ7F 5FYJH 3RDTA 5E2WH 4HGWA 3UTTA 3RPIB 2RCSH 3DMMC 3VI3F 2D03L 4G8GB 2HN7A 1SJEA 1KNOA 3S3SA 4XNZC 4LFHD 4Y4FC 1VFAB 2RR3A 1I3VA 3ULUH 1FJ1B 4HS6B 4APQD 4WU5A 5JIIA 1E4XI 4GRWH 5FO8B 3T3ME 5TF0A 3P9MB 4NWTH 1FFNB 1UENA 4TN9A 3VFUB 3PWUB 2MNUA 3BVNB 3L5XL 2DAVA 4YNYA 1DE4A 2R1YA 2R8SH 2GUOA 1TVDA 3BW9B 1B4JH 1NH6A 3H9ZA 4NN5C 3LRSA 5JXEA 1XF2A 1IGYB 2J6EL 2E8ZA 4PJCF 3HZYB 2AJVL 1IBGL 4U6HA 1MCJA 5F7YC 3U6RA 4LHUA 4CW1B 4QHKI 5I74B 5DUBB 3SJVA 1WZMA 1FVDA 1DZBA 4KU1A 2HH0L 4FFVC 4LBEB 5L2JB 5ESVA 3AY4A 2FIRT 3CDGB 4N8CL 1JI1A 5MEPA 1RHHB 1IM3A 5IM7A 3QIUB 1P7HL 1CGXA 4F15C 2EIZA 3IFPA 5GS2D 3T0EC 4LLDB 2Q7YB 3TA3A 2E6JA 3RIFK 4XBGA 5J11C 1JTPA 4G8GE 2UWEF 3RHWF 5I1DA 5FYKH 5TFSH 2BOBB 1ZXQA 5T5NG 4BH8B 5I6XB 3T0BA 1G7QA 4XGZA 1XZ0A 3IDMB 2VLME 2FZ3B 5DJZA 5C0JA 3I50L 1X7QB 3D0LB 1Y6NR 2VLMD 2ZNXA 3EYUH 2HKFH 1T0MA 1VADB 1B0RA 3HRZA 4F33A 3VI4F 4Y19B 4GKZB 5BV7H 1YA5A 4MZ3A 4W6WB 4EN3A 2ZCLH 2BVYA 4XHJC 3SOBL 1BIIB 2H32H 1YMMA 1CFTA 1DBMH 2F19H 1AIFB 2YUWA 1JE6A 2FX7L 1MREL 3U0WL 2PTTB 5MP6H 1ZANH 3MA9H 2VXVL 4RGNC 4CKVX 4ZPVA 5E56A 2V7NA 4I2XE 1G84A 5D1XA 1KCLA 3QIUD 4X9FA 1A1NA 1WTLA 4DVRL 3TNNB 3VRLE 1JWMB 3BP7A 3MLVL 3OMZA 4U1JA 5IR1B 1U3HD 3RA7L 3LRGA 4KK6D 1C7SA 3KJ4B 2SEBB 5CHNB 1KN4L 2R0WL 2G60H 2C3GA 3OG6B 3MLZL 4UQ3B 1VESA 2FRGP 4WEUD 2R23A 1IAOA 5DD1L 1Q9LB 4N0RA 3HUJB 1H5BC 3B8YA 5C09B 4Y19E 4BZ2L 4OGYL 2XKNA 3MACL 5JA9A 3CLEH 3MLWL 4Y19D 5KVMC 2XXMB 3RWCA 3C08H 1MCKA 4PJEF 1X5JA 3RNQA 3L3HB 4X5XB 1EUTA 2IFFH 3QUXA 4I9WE 4U1MB 4J1UB 4NZUL 3BP5B 5I18L 5IHUH 5DDHA 3C8KA 3NZ8B 5F9OH 2X7LB 4PRPB 4QRRB 1C5BH 4R8WL 1S7VA 3U30C 2EDFA 1QFWI 4WFFD 3H7BB 2CO6B 3NIFF 3FB5A 3PDOA 3P4MB 4PRHA 1JPST 5ANMB 2DI8A 3V6ZA 1WQVT 1AP2B 4G6KL 4LSRL 3REVB 4LSDA 1MNUL 4P2OA 1DN2A 2WV3A 1UB6A 4KHTL 2LTQC 1XIWC 3ULVH 3ARQA 4HIHB 3KYOA 1JN6A 1G0XA 3NFNB 4KQ3L 3LQZB 2AQ1A 5DUPH 1I1AC 1JPFB 4I4WA 5IOPA 4O58H 4JFOB 4O2CA 1BPVA 3LMJH 1NKOA 1WC7A 3QEHA 5D6CA 1R3KB 1S7SA 1IGCL 2LVCA 1TQCC 1GXEA 3DI3B 1ROWA 5HHNB 4GBXD 2VC2H 4UZGA 5C09D 4R4BA 4ISVB 3T04D 2Q6WB 4OGXH 1C5DA 2J88H 5DMIL 2X1PA 1BJMA 2HFGH 3QQ3B 1HHGB 3VMOA 2DIBA 1IAKB 3KLAA 3KPLA 3MRRA 1AFVH 4XB8A 4XNUH 4NHCL 3GIVA 5IVNA 4NFBA 3L3GB 2IQ9H 1P7QB 4JHZA 1IGTB 3PGDA 3NCMA 4PRPE 3GJEB 4QRRE 2H26A 2B39A 1QFWM 1PX4A 3EOAB 1J0YA 4KDTC 4QRRD 4XX1G 4XP5L 5D7LB 5ANME 1J1PH 2EKSB 5D7JB 1Z0NA 1HDMB 2DQHL 5F7DB 3HNSL 5C07A 3MFFB 1KB5L 1JZ6A 2ADGB 3QXTA 4JHAL 4Q6IA 2VL5A 1FSKB 4AIOA 3BRGC 3TEUA 5IBTL 4Z7WF 1OF2A 5IQ7H 2AK4A 4JRXA 2DKMA 5IEHB 3BSZL 3GK8H 2Q8AH 4KKCC 1RZIA 1INQA 4FNLL 3O8XD 3R8QA 3QNXA 4JEGB 4BQCA 4UQ2A 2WLYA 2P5WD 3TBYB 2DL9A 3QPQD 4KKAC 1F4XH 2FLRT 2XTJE 3NIGE 4D9QE 1JPTL 3AS0A 5ITFA 3LH2L 4Z7OE 3VG9C 3WCYA 3KPRB 2Z35B 5E8NA 4BM7A 3PGCB 5IHLB 3FQNB 1K6QL 3IXAA 4FQLH 2I07B 4JKPH 2P5EB 5BXFA 1P7QD 4U1LB 3HE7A 5C2UB 1NBVL 4MJ6B 1LGVA 5D7LE 1KCRH 3VWJA 4JE4B 3OKOA 2HFTA 3GI9H 3HC3H 4NN6B 4K3DL 3SCMC 3BH9B 1A0QL 5D7LD 1KEGH 3GBLA 2BCKB 5KOMC 3S98A 2FBJL 4XP9H 5D7JD 2P8MB 1A7RH 2NY5L 4XP6H 3A6CL 2HT2D 4Z7VF 4G43A 2A1WH 1EJOL 3FT2A 3VXPA 2XZCL 1WZ1H 3JZ7A 4JVWA 3VXRB 3U1SH 1PG7X 2I25N 1SJVA 5CBEB 2DYPA 3UPRA 1B2WL 4YO0B 4LPCA 1UJ3B 3CSYB 3MNWA 2IH1A 2CDGB 4KGLA 3UPAA 4XNYH 2VDNH 2DWEB 3CVHL 4WW2F 5HY9B 3HR5B 2VXUL 4MCZB 4BK5A 3CDYA 2DQDL 4MJIA 1BEYH 1NMCC 3KPRE 5JR1L 4XXCA 5BW7A 4OCWL 2VZTA 4N0YH 3P73B 1CF8L 2VWEC 1IZJA 2P5EE 3KPRD 3MV11 3S37X 1J88A 3ZT6A 2ZG2A 4PJXA 2VR9A 2P5ED 1QYGH 4LASH 4LDLB 4ZYKB 5GGVY 1IKNC 5EBMB 2I26N 3VDAA 4P3WA 4DGVH 4JPKL 3DUHA 4PV9B 3BUTA 1T1WA 2Z0BA 3FQUA 5DHVA 1T80A 1NC2A 3STZA 5I1EL 3L9RB 1BAFL 3VXRE 4UTAL 1RAMA 3QH3B 4LEOA 3OKNB 1Z3GL 1F11B 4O51B 5D5MB 2CPCA 2ILLA 4NC0B 2VLLA 3VXRD 4FQQB 4M5YL 3T65A 3RVWC 5FAAA 1RZ8B 2PCPA 1A7OH 1FORL 4OF0A 5ALBH 1CGTA 3HCVB 1YECL 4L8SA 4PRID 2NXZB 2ID5A 1FZMA 2FB4H 4OZFH 3ARGA 1JV5A 2A9MH 1L7TL 3RGVA 1YN6A 2CLVA 1I9IL 1H8OA 1N5AB 5C71A 2VLJA 3CFDB 1FPTL 1IL1A 2LU4A 3BT2H 3MBXL 4MA8L 1H3VA 2XFXA 1PLGH 32C2B 3SKJH 2FEDC 2CR3A 3TT1L 2X4OB 1R24B 3O3EA 1OT1A 2RAMA 1H3WM 1JNLL 1NGYA 2J4WL 1FBIL 2NMSA 5DK0B 3GSRA 4QHNB 4URTB 3ARBA 3WNKA 1TTUA 4MX7B 5GZND 4HKJB 3HZVA 4KJPC 1SM3H 2V2XA 1MIEH 1I9JH 2A0LC 3WN5B 1BQHB 1TCRA 5AG9A 4QTHB 2J8HA 3CVIL 4RAVA 1FN4A 4XC1H 2FR4B 3BMVA 5D5ME 2AI0H 4TRPL 2JCCB 3VRIA 1AC6A 1OOAA 1CXIA 2VN7A 2X44D 1KXVC 3NCJH 3PHQA 1BBDL 3NAAL 2X2YA 1D9KA 1BJ8A 3ILQD 2RJMA 1NQBA 4DN4L 5IBLD 3MRQA 1ADQH 4JFYA 2NXZD 5C0CA 3UPCA 3BMWA 1MAKA 1S7UB 3M8OH 4M8VA 2HAZA 4JRWA 4YHOH 1B9ZA 5DJ6A 5DFVD 3H42L 2Z8SA 2VDLH 1GAFH 1L4IA 4OZGA 5C0EB 4XP4H 4OCSL 4JB9H 3C6LB 4M6NL 4IDJL 2PN5A 3K0WA 4G8FA 3CSBA 1NBYA 3NH7H 3QQNA 2D0HA 5IHZA 2ICCA 3SDAC 5E8EB 4R3SA 1G6RH 3WFCL 2YWZA 5GHWL 1NDGB 2DD8H 1BX2B 1MHHA 2KBGA 5EO9A 4AH2B 1A6WL 4PREA 4UB0L 3V6OA 2WINB 2R0ZH 4LPYA 1RUPH 2CXKA 4NKIL 3CAFA 1I1YB 2JCCE 3MCLL 4MCYB 3RWJA 4QCIA 1NLDL 1YEKL 1E4WH 3NABL 3IU3A 1W0VA 2J6EA 5INDB 1BQUA 1YEFH 1MVUB 4C56A 1PZ5A 8FABA 4KJQD 3DRQA 5K9QI 2W9DH 1VERA 4HBQA 2Z31A 2CIKA 4R4FH 3K1DA 4X6DB 2DLGA 2YD8A 3NZHH 4HKZA 4NZTH 5I0DA 1H3PH 4LCUB 2HFEB 1T1XB 4PP2B 3TYGL 3A6BL 4JDZA 1BGXL 1NANI 3GSNB 1T4KA 2OCFD 1G7HA 3ROOB 3DUUA 1U93B 3IB4A 2VDKL 3QJHB 4HIJA 5CGMA 3C6LD 1QO3A 1ZVSA 2H2PC 3DMMB 3QWRD 1GPOL 1IC5L 5JNYA 3R06A 3CPLB 5IVZB 4UIKL 4XNZB 4Y4FB 1TNMA 5J57B 1H0DA 4JFEA 1NCDH 4EUPB 5A3IC 5K9JL 3HZMB 5B38G 1FNFA 1RUAL 1KPRA 3GJFA 2P43B 3DUSB 3MOAH 1BFVL 1D6EA 1FYTB 2YSSA 3EDDA 3LQAH 4OJFH 2NW2A 3GSWA 1EAJA 1G0YR 5KS9F 3MJGX 4NN5B 1HHJB 1CFQB 4TYUA 1AGBA 5CEZE 4UI2A 4C59B 2PW1B 5MHSE 2IG2L 5CEZD 4X6DE 5ADPH 2ICWI 2MCG1 1T21B 1S7RB 2Z93A 3WIFB 4K7PH 4WI5A 2VAJA 4NUJA 2QQNH 1FIGH 4LDEB 3T0EB 1A9EA 1EK3A 4EI5A 4PJHF 1IM9A 1MIML 3S35L 5J11B 4WTXA 4GO6B 1ONQB 4YBLC 5EUOF 3ZHLA 5F1NA 1MFCL 3DMMD 4PG9A 5DZOA 4IRJB 5T1DL 5F9AC 5I1HH 2CRMA 1T0NA 4Y4FD 4U1HB 5FA3B 1GGBL 5JOFA 1H3XA 2W9EH 1FYTE 3OKEB 5CIPA 3PNWA 3GBNH 1TITA 5F7EL 3WJLC 2JB6A 2X40A 2CKBB 2G75A 5DD6B 2BRRL 3OAZH 2GY5A 5IB5A 3MV7B 4L3EB 4X5WA 4M1CC 4YHKH 4G7YH 1YEEL 3ZDXE 3O6MH 3L3DB 3EJYC 2DM2A 4Y4HA 4UNUA 3Q1SH 1BD2A 1O5DT 3BYYA 5E8PB 1HSBB 1RV6X 3MRBB 3MRLB 1RZGB 2YN5A 1ZHLB 4L8BB 3VDBA 4NP4L 2B2XL 2OM5A 1ZHBA 5FA4A 1FNEA 4FQ1H 1DVFB 4YBHA 5C70A 4JFZL 2IPTL 4FFVD 3T0EE 3FQTB 4Q7DA 1YYML 3ARPA 5GIRB 3T0ED 1KXQE 1OAQH 3PGFL 2HA1A 3T0DA 2YPLB 1N7ML 4PV8B 4N9GB 1G7MA 3VH8B 3OZ9L 1UH2A 1MRCH 3HI5L 4B5EA 1ERNA 1WAAF 3QG7L 4JRYA 3BPCB 4TPRH 1H5BB 3U7AA 4PJ5D 4OLYH 3LS5L 1NCUA 2C4FT 5FO9A 4XBEH 3MV7E 1Y6MR 2NW3B 4YZFF 2DF3A 3QEQB 3O11A 5HDLA 4AT6B 1IMHC 4W81A 1G9MC 3MV7D 4L3ED 4XHJD 2BRQA 4JANA 4JPIA 3VFNA 4MNHA 2XTLA 5HI4C 4NRZA 3RL1B 1AGCA 1OPGH 3VCLB 1M71A 1S3KH 4OZ4A 3LN4A 3DECA 3FB8B 5EU3A 3U30B 5DD3H 3U46B 2Z4QB 5DEFB 4M8QA 1DVFD 4RGND 3VFVB 1S5HA 2X4UB 3I2CL 2QR0B 3KG5A 3HPLB 3MRHB 4M6OL 2C3VA 1KB5A 4DEPB 2YPLE 3BUYA 1QR1B 5C0RL 4GMSH 3SE3C 4JFPA 1XIWB 1IEAB 1WWWX 4MAUL 1SY6H 3OAZK 1U8JA 3D3VB 1I1AB 3IETB 3N1GC 4OM1H 5SWSA 3NPSC 4X7SL 2YZ1A 2MOVA 1IEBA 2AXFB 4EQ2A 3FFCD 3HC0B 5FDWA 5DVNA 3H7LA 3O9WC 3QEQE 1WITA 2IBGA 5IGXL 2FGWH 4ZPTB 4K7FA 4PJAB 2VDPH 4TUOA 1QR4A 1MFBL 3GM8A 4ZUSB 2VZOA 3QEQD 1FZOB 3S88H 1P4IL 2AV1B 3FB7A 5D7IA 5F21B 2QADB 1MCRA 3VFPA 3NCYP 3ARFC 4M62L 1XCQA 3ZKXC 2NY4C 2EYTA 3QEUA 4HZLB 3DWTA 1S7XA 3V5KB 1OP9A 4PJIB 4C83A 4S11A 1LEKA 4DVBB 1U8NA 3SGKA 5FYJL 3FZUC 3VGHA 1ORQB 5E2WL 5CMAA 3IJYA 2J12B 4NYLB 2RCSL 3NACH 4G5ZH 3LV3B 3SEPA 3D3VE 1XIWD 4PRDB 5I8EA 5IMLA 2NNAA 4HLJA 4ZFZB 4X6FB 3TZVC 5GGUA 4NQCA 2GKIA 2W9LA 3TWCL 3D3VD 4WJ5A 1I1AD 4YE4H 4IS6B 1QBMH 3U0PA 5DJYA 4XNMA 4NWTL 1EMTL 1IZKA 5JPMB 2FJFB 4PJAE 3F7RA 1FYHB 1VFMA 4P99A 4ZNEE 2R8SL 1ULVA 1UXSA 1B4JL 3DV4B 3VG9B 4BFBD 1E6OH 5KSBB 4MD0B 1DBJH 4YHPA 2Y5EA 3BHBA 1QSVA 4JLRA 4GXUM 3NN8A 2CRYA 1ORSA 4XVSH 2AKRA 2WQ8A 4LFHG 4NBYB 4HW6A 3MJ8A 2HVJB 3O41B 4H8WC 4JFDB 4PJIE 5EZOL 3K1KC 5DQJA 3VXUD 4EDXB 1E27B 5A40E 3TO2A 5E08H 3SCMB 1OQOA 2X10A 3T09A 5MERB 4YFDB 3ZE1F 2F8VA 5FYKL 5TFSL 3FRPA 3L1OH 2C3HA 1C8PA 1KFAH 4MNGA 3T4AB 4WUUD 1M7XA 1NGWB 1ZGLA 5DA4A 2FH8A 3K80A 1PVHA 2ESVB 1U8MB 4KKCD 5AWNH 4FXKB 3EYUL 2HKFL 3GMRB 3O81A 5FIEA 2V9QA 1EHXA 4XWGH 4YHIB 5BV7L 5F3HB 4IM8A 2EC9U 4KKAD 4U6YA 1B6DA 1NMCB 3L5IA 5GRUH 5KSBE 1DBML 2F19L 1GGUA 1HQRA 4UTBH 4PJDF 4HMDA 4QO1A 1WIUA 3QRFM 1JI2A 3V0VA 4JFQB 1QA9A 3DNKA 4QF1B 5J0BA 4UUJA 4CAGA 5MP6L 1ZANL 2L0DA 3MA9L 4JFDE 4OF6A 3CFKA 5DFWH 2ADIB 5KN5A 2W07A 5TJWK 3BWAB 1A2YB 3SCMD 1H3GA 3D9AH 1JF6A 4XMKH 3V7AE 3BYTA 4GW5B 4L4JA 2LAGB 3WL9A 1TPXC 4RX4D 4MS8C 4TNVF 4OB5H 3MGTB 5F89B 3TN0A 4OD3L 4U7KA 3SPVB 4NGHH 1CG9B 1E4KA 2CLRB 2PNDA 2GYSA 3LKPA 2IF7A 2ESVD 4CU8A 4JQIH 3RVTC 3Q5TA 3HG1E 4GKOA 3AUVA 3B9EA 3CLEL 2I9TB 4N90E 2CUHA 4N1EA 4PJGF 3C08L 4DW2H 3IDYB 2VWEE 2X05A 3RFZC 5EH1A 2IFFL 1UB5B 5IHUL 1BLNA 4PGCB 5GRXG 1YNKH 5F9OL 2HYMA 3V95A 1C5BL 5IB3A 1QFOA 4RFEB 4MXVE 4HX1B 1RK1A 3BDYH 4PLKC 4OZIB 1D5XA 3W0WA 4K55A 4Y8AA 1PGRB 3O6LL 5BMFH 1HKLH 1U3JA 4P9MH 3FT4B 5I19H 4R26H 5IUSA 2WLZA 3QISA 1I7TA 3ULVL 1XGUB 5IT2H 3TBTB 3U0TB 1FNAA 2R69H 4OD1H 3MYJA 5DUPL 3P9WB 1RURH 4O58L 3LMJL 3L6FB 2OK0H 3WFZA 1BP3B 1H3TA 5IHBA 4OLWH 4GXUN 3DO3A 2ATKA 4IMKA 2VC2L 4P9HC 3K3QA 1CFSA 3KYNA 2EDDA 1F97A 2XRAH 4OGXL 2DICA 2UZYB 1RJYB 1VKXB 2HFGL 5JLZA 1T04A 4X6CA 2AEQH 3QZWB 3V5DB 1AFVL 4XNUL 3T3MF 3LOWA 2F8XC 1UM5L 4QTIH 2IQ9L 3ZYJA 4IOIA 1KTKE 4XZUB 3TIDA 3B2UC 4PGBA 4C55A 2FEDD 4BKLA 3SDAB 1T20B 2A83B 5C0DA 5ESAB 4V1DA 4OZIE 3GSVB 3SDDA 1J1OH 1D3CA 1K3IA 4QRPB 4RQQB 1J1PL 2XY1A 4KJPD 4M4PA 3TH3T 3DARA 3GHBH 1K3ZA 5FXCH 3JXAA 1N6UA 1HINH 1VCAA 4LLWA 2YD1A 3ZMRA 4NCDA 3BP4B 3RWDA 1QTYT 4G9DA 1AXTH 5IQ7L 4I8DA 2FO1A 4YHYC 1OARH 4OF3A 3GK8L 3HZKA 4QXUH 4ERSH 2N1KA 3WUWA 3MUJA 4ZDHA 1CIDA 1RIUH 2QKIA 5JW4R 3DHJA 2Q8BH 5DZNA 1F4XL 4JREC 3C5JA 3U4BH 3V4UH 4JM2A 2DQCH 4AG4H 3ILPB 4Y1AB 1KPUA 2IBBA 4JKPL 1EO8H 3HPJA 2G5BA 4DUWA 2AEPH 3GMMA 3ZTNH 1GRWA 1KCRL 3CUPB 4QRPE 3SDAD 4J6RL 4D8PA 3GI9L 4G8IB 3HC3L 2EDHA 1B88A 1I4FB 3WFHB 3HI1B 1KEGL 1I1CA 4XP9L 2VDMH 2HLFC 2OSLA 1A7RL 4MZ2A 1DFBH 4XP6L 2A1WL 1WZ1L 3ULUE 3U1SL 4RWHA 2EDQA 2R1XB 4GRWE 2BNUB 4ONHA 1LK2B 2VLKB 4OBRA 5ELIA 4OBSA 4XNYL 1JUFB 3SY0A 2VDNL 3VXTA 2CDEB 4P23A 5HHMB 5JPNA 1BEYL 2H32B 4CVXB 4U1SB 4LPUA 1WF5A 2A2QT 1T5WB 3GRWH 4N0YL 3P9LA 3O2DH 3GDBA 4X0KA 1RMFH 2X1XR 3DOSA 1EVUA 4Y1AD 1NPUA 3CXHK 3MNVA 3T77B 1NUDA 4YBLB 4JZJB 1EO5A 1QYGL 4LASL 1F02I 2H2PD 4YJZL 4OKVB 4GAJH 5D2LF 1BM3L 3CFCH 5JIPA 4GRLA 4DGVL 4OZHA 2XWJB 1WIOA 5A3ID 1JMXA 1N6QL 1HILB 4HXBH 2GK0B 1TETH 1YEJH 5C0AD 3VFOB 2VLKE 1SHMA 4XNQA 2EXYC 2WAHA 1F3DJ 3C2AH 1IC4H 5ALBL 3RWEA 1P69B 1T3FA 2VLKD 2NXYC 4HQQH 4P3DA 5J1AA 5HHME 2FB4L 5I1KH 2A9ML 3F7PC 1KLGA 3NGBC 1C5CH 3ZT7A 1U8PA 2IALA 1JHLH 3BT2L 2APTA 1PLGL 4KVCH 1T6VN 1DSFH 3SKJL 4M7LT 5IVXA 4AM0A 5AZ2H 1CXKA 1MRDH 2XKSA 5MEQA 1FE8H 1OP5H 3BQUA 1T03H 3RY6A 3OGCB 1QBLH 1SM3L 1MIEL 4MVBC 4NC2B 1A02N 1L6ZA 1DN0A 1I9JL 5F3BA 3SKMA 3U36B 3JTSA 3B2VH 5F96H 3ZTJG 2DBLH 1X5ZA 3MREA 1YJDH 2JLLA 2AI0L 1TMCB 5HGDA 1I75A 4G80B 5CUSL 1C16B 2HFFA 1KV3A 4KTYA 3WNLA 4M1CD 3N9GH 1TJGH 3CCHA 3EJYD 4JZOB 2FCBA 3LHPH 4HV8A 5ICZB 1CT8A 3VRJA 2YD2A 1ADQL 1YEIH 2GCYB 3TJEH 3UYRH 4NKDA 3QQ4B 3CH1A 3M8OL 3TO4A 2NX5B 3W9EB 4DFIA 4YHOL 1EAPA 3RAJH 2OQJB 3QI9A 4A6YA 1GAFL 4PB0H 3O45A 2QSQA 2JJUA 1N2RA 4XP4L 4F7PA 1Y0LA 3Q3GB 3ZT5A 3NIGF 4YDVA 3NH7L 5C9JB 5BOZG 1G6RL 1LNUB 2A74B 5D7SH 2DD8L 4WFEE 5DEGA 4M7JH 5F70A 5CILH 3OAYH 5T5FL 5E6ZA 4RMRA 1KXTB 5H94A 1RIVH 3NPSB 5A2JH 2VABB 5J9PB 3KPQB 2R0ZL 2AK1H 4IBLT 1RUPL 3INUH 5E99H 2EEAA 3O9WB 6FABH 2WNGA 1KTDA 4S1QL 1FZKB 1OD9A 2W65A 1G9NC 1E4WL 1XH3B 3IFOB 5TDNA 1U8KB 4ZO9A 4XXDA 2H9GA 1YEFL 4YWGH 4F9LA 2ATPB 4QRUA 2HG5A 5IMKB 1AR2A 4L3CB 5F9WC 2W9DL 1D5IH 5HI4D 4R4FL 2OZ4L 2NX5E 3ZKXB 1ZSDB 2NY4B 3NZHL 4NZTL 4J3XA 1H3PL 1OP5K 1GC1C 2C1OB 2NX5D 3WSQH 3K81A 1BQHG 1FL6B 5HHVH 4F7EB 5ESQB 3KDMB 3MR9B 3F62A 3O6FC 4IRSA 1YNTA 5JZ7C 1K5NB 3BKMH 3V8CA 4ODUB 4PY7B 3SO3B 2FH6A 2YHGA 4CN1A 1PEZA 5DJDA 1NCDL 5HGBA 1RIHH 3LSOB 2KZ1B 1I8IA 4QY8B 1ZV5A 4AIZA 3MOAL 5T3ZD 4NNXB 5BRZB 1WFTA 3LQAL 4OJFL 2YRZA 5TDPB 3O9WD 3RPIA 1M6OB 2IANA 1FNGB 2ZSVA 3G08B 4EI6A 5EU7E 1OM3H 25C8H 3DJ9A 5LG1A 3CFBB 1VFAA 4G42B 1JNNH 4HS6A 4MDIB 4FQXC 3K2UH 3UTQB 4S0TD 5ADPL 1FLRH 3FTGB 4GFTB 4NWUH 5T3ZH 1GGYA 1EFQA 2G9HA 3ARFD 4K7PL 4I1NB 2NY4D 2V2TB 1OGTB 3OAYK 2QQNL 1FIGL 3PWUA 2BY3A 3BVNA 4ZTPH 3BW9A 3QIBA 1KF9B 1WFNA 2Z8VC 3FONA 2CR6A 3EYQC 1PW3A 3HZYA 4XBPB 3FZUD 2X6MA 4CW1A 5J56B 4MD4B 2AGJH 4Z78B 4AJ0A 1FL5B 1ZA3A 4L29B 4H5SB 3IAQA 5A2KH 5I1HL 2Y7QB 2VOTA 4OLEA 4LLUB 3PL6C 2NR6C 3TZVD 3QIUA 2W9EL 4JFXB 2GW5A 5BRZE 2BERA 4XAKD 5CD5C 3GBNL 3JWNC 1MCIA 5DJAA 4NNYA 1CQYA 5BRZD 1U3HA 3VXME 5D6DA 1ZKAA 5CEXA 3B43A 3SBWC 4YHKL 1EV2E 5DRZB 4G7YL 5D2NC 3O6ML 1A3LH 3Q1SL 4J3OC 2HWZH 5D5MF 3IDMA 2X4PA 5F1IA 5HYQB 3GMOA 3VDCA 3QXAB 4FQ1L 1OTTC 4GKZA 1CBVH 4EUPG 5CBAA 3BPNC 3R8BB 1NUFA 1BIIA 3QCVH 3D6GA 4JKMA 4DTGH 1NAMH 1AIFA 1TFHA 1OAQL 1QBBA 1QLFA 1Q94A 3NA9H 2FWOA 3DX8B 1A4JA 2BHYA 4LNVA 5ETUB 3D69B 2YBRA 4HIIA 5DSCA 1MRCL 2MKLC 1R3HA 3AB0C 5CP3H 1BOGB 4NZJA 4ODTL 4FG6C 3D39A 2F9BT 4I0CC 4TPRL 5TF1H 4YQXH 1N5YH 1FC2D 2P45B 4LVEA 2RBLA 1TENA 4QHMB 4OLYL 4NT6B 5DQ9B 3ME0A 2Z91B 1BECA 2F74B 4G7VH 1OLZA 4PJBA 4XBEL 3TNNA 3WKMH 3ARYA 4H26B 1A4KA 3UXFA 3WXVH 3H2WA 5IR1A 2EDEA 3W5NA 5JHDA 4CBPA 3EHBD 1N3NB 3H9SD 3L95B 3N50A 1MI5B 1X5HA 2JCCF 3CJJA 1F8TH 1Q9LA 3HUJA 2ITDA 5FYLE 1OAYH 1S3KL 4GBXA 1YQ2A 2YZ8A 4NM4H 5C09A 2ZUQC 3C60A 4WY7H 4KJYB 5DD3L 4X99A 4OUUB 5FYLD 1DQMH 2A6JA 1CL7I 1YDPA 3PWNB 4MDJB 1NKRA 1CIUA 4GMSL 2VMFA 3S35X 2VISA 3D0VA 5ERWB 3BGFC 3MRCB 2J5LB 4GOSA 2E3VA 2H6PB 5FM8A 4U1MA 1SY6L 3NZ8A 1WT5A 4ETQB 2X7LA 4QRRA 3RVUC 4MS8D 2A9NH 4OM1L 4P5MA 3MROA 1A5FH 1HH9B 1R5VB 5DURB 3CXDL 4RA3A 3QIWC 3BZEB 3A0OA 3P4MA 1I8LC 4HUUB 1VSCA 1A6AB 5KAQF 3VJ6B 1YPZA 3VU2A 4LCCC 1AP2A 2FGWL 3LKOA 4P57B 3REVA 3RVTD 2QLVB 2VDPL 1I7UA 2YRPA 4WNQB 1JYWA 1FNSH 5EU4B 3S88L 2H41A 1MI5E 1NGZB 2WIMA 3IJHA 1XR8A 3PV7A 4H25A 1KULA 5IEKB 43C9A 3O8XA 5KSAA 2GAZA 3ARVA 3K7UA 3BX7C 4GLRH 4R96B 4B7LA 2P5WA 5I8CB 1EEZA 1R3KA 2D31B 3VGGA 1T2QH 3VH8G 1M4KA 4WU7B 3WIHA 3WKNA 2YUZA 3HLAB 4Z5RB 5IESH 3MBEC 4YR6B 5ISZB 4PLKD 4R7DA 4ZOCA 1HHGA 3SDCB 3HNVH 3MRPB 4QHKJ 3GSQB 4HWUA 3L3GA 3B5TA 1F3JB 1Q9WB 3WNMA 1EHLH 2Z8RA 3NACL 1P7QA 3S8WA 3QDJB 2BVQA 3GJEA 4I0PA 3BGMA 4YHYB 1PSKL 1QBAA 3WHE0 1GGIH 4YE4L 1QBML 5F7KC 2EKSA 5D7JA 1HDMA 5DURD 4D0CA 5F7DA 4WW2C 3OAUH 2NLJA 3CMOH 4K9EC 9CGTA 5FGBA 1JF1B 5LCVH 4YAQB 4X6BB 1EBAA 3BE1H 4JN2B 1AGDB 4WHTB 1E6OL 2X4QB 1P4BH 3VFMB 3V79C 1DBJL 3OHXA 5IEHA 3RX5A 4XVSL 3CZJA 2XXCB 2I27N 3RNKA 3ZDXF 3B2UD 3TC9A 5IKCA 5K9QG 3JTTB 2IPUG 5BZDB 5E08L 4Y5YB 1ND0B 3MRGB 1I8KA 5L9DH 3IDGB 4X6EB 4BZYA 4W4OC 3KPRA 5ISZD 4LRIA 3REWB 4CVUA 3PGCA 3K8MA 4WO4A 5DHYB 3QDJE 4G6JH 2BMKA 2I07A 2P5EA 1HH6B 3L1OL 3LN5B 1EERB 1K9TA 4HH9A 5ACLA 1KFAL 3DTXB 3HS0B 3NIDE 4WVRA 4U1LA 3QDJD 2CRIA 4HKBA 4F57H 1TVHA 5IW6B 1ZTXH 3MRIB 1RI8A 3RVXC 5EDXA 3BH9A 3H8NA 3BXNA 4LRNH 4OZFA 2NZ9C 4XWGL 2UYLB 3RWIB 4DJMA 5FM5M 4GG6B 2P8MA 1A1OB 4DCQA 2WUCH 5GRUL 3VXRA 5EFIB 3QDGB 5GGSB 5CBEA 4M61A 4UTBL 3N1PC 3QCTH 1S7QB 4YO0A 4XMLH 1AHWA 1KIQB 2OJEB 3OKMB 2BC4A 4MYWB 4PRIA 1MY5A 3BEVB 2X4TB 2IGFH 2RIKA 2EDKA 3HR5A 1R3JB 4DUXA 1D5MB 2ITCB 1KYOK 2BOCA 3F8UB 1S9YB 5B3NA 2OLDA 4KJWC 3KPNA 5JW5A 2R4SH 1XMWA 4HIEB 4L4TA 3D9AL 5FO7A 2KZWA 4XMKL 3VD3A 2NZIA 3MCKA 4BQ6A 2HLFD 1YNLH 3VWKC 3WDIA 5KOVC 5DMKB 1JWUB 3C6SA 3OV6A 3ZKNC 3BRDA 4OB5L 1RZKC 1I3RB 1GZQB 5EBMA 4NGHL 1P1ZB 3KPSA 2NXYB 4GG6E 1ADQA 4LAJH 4JQIL 1GOHA 1YMHA 1QFUH 1V7MH 2IAMA 3GSOA 4AQOA 5DMGC 4YHMH 1I7ZB 2R9HC 3QDGE 5JORB 3OKNA 4ODWA 1HZHH 1F11A 4O51A 4QT5B 1DQTA 4DW2L 3W9DB 1ZLSH 4KV5E 3QDGD 5T1KD 2BNRB 5GPRA 1RZ8A 3AAZB 3NCBB 4JG1H 3V7AG 4M00A 4Z77B 4Y4KB 1G6RA 1YNKL 2BVTA 1PYWA 5E9DB 3BDYL 1Q9KB 4L9LC 2L7UA 3CSPA 1NC4B 1I8MB 5BMFL 1HKLL 3GMPA 3I6GA 5DWUH 4JPWH 4P9ML 4R26L 4P5TC 4YGVB 4WGWB 1YEHH 5IT2L 1U8QB 2R69L 4OD1L 4QHNA 1RURL 1SYVA 3MRFB 4JN1H 2A6IA 2YD7A 3RZCB 2OK0L 4AEIH 3MO1B 2EXYD 3B6SB 4OLWL 4Z76A 1BQHA 5DHXB 3H0TB 4WV1A 2OZ4A 1RULH 2NXYD 5D1QC 4QTHA 2RQ8A 2DKSA 5HYSB 5GGTH 2DTSA 2XRAL 1BF8A 2FR4A 2ORBH 5GGRB 1RJCA 3EO0B 3ZYIA 2AEQL 5IVOA 2BNRE 4POYA 4LCWA 3QSKB 4QRSB 4PJAF 3WIIL 2O61B 5E9DE 4IIQC 3KLHC 1F4HA 4Z7NE 4K94H 4TTGA 1J1OL 1EEUA 5E9DD 5D9SA 1BVLA 5MEND 5H37H 3BOVA 4MVBD 1X5XA 1VGKB 2VLRB 3ARSA 1KUMA 3OL2A 5HHPB 3VFWA 4CU7A 5DJ2B 1NC4D 4Y16B 4ZXBC 1QOKA 4BQ9A 1HINL 5C0EA 2CH8A 4DGIH 3DV6B 4PJIF 4HK0A 4YXHL 2AV7B 3CC5B 1S9VB 3IDNB 1AXTL 4LEXH 5GS0C 4E42A 5GSVA 1OARL 4QXUL 4ERSL 3WUZA 1BX2A 3UTSA 2QQKH 5LBSH 4PJCB 5CCKH 2XNAA 5B22A 4JFFB 4EXPX 1MY7A 5F9WB 5T3XE 2Q3ZA 2Q8BL 5HHQB 5EZJB 3HE6C 2W59A 1T7XA 3DX7B 1I1YA 2QQQA 5T3XD 3U4BL 3V4UL 5HPMA 2DQCL 2N7AA 5C0GA 1MHCB 4MCYA 3MUGB 3DVGA 1KBGH 1J5OH 1EO8L 1CDYA 4M5ZH 1MVUA 12E8H 1ETZB 2GTWB 4L8DB 2AEPL 2UWEB 2AW2A 5KSBF 3QO1B 4MJ5A 3D5OF 1A9BB 1J8HD 2XN9B 3LEXB 4LCUA 2A73B 2VLRE 1RUMH 2I24N 3TIEB 4ZAKB 1T22A 4OIAA 5EIQA 2VDML 3UTZB 1QSFD 2VLRD 1DFBL 5EBWB 3I85A 4Y2DC 3I6KB 3ROOA 3GHEH 3WS3A 4PY8I 3DMMA 5HHOB 3QZWG 2VITB 2KH2B 4ELMA 1TTFA 4PJCE 3CPLA 5IVZA 4JFFE 1RK0A 5C6WH 5EORH 1AJ7H 1BFOB 1HK6A 1XCTB 3SKNA 1CLCA 1KJ2B 3BPLC 4WI9A 4JFFD 4DKFH 5FEBA 3OJMB 3IF1A 2YUVA 2E7BA 2W0KA 1QFPA 5GGVL 1PJ9A 3MA7B 2GSIB 4FTVA 4P4KC 2GQHA 3QFJB 1S5IH 3GRWL 2Y5TB 4HMCA 4QXGH 2UY6A 5DYOB 4F7TA 1UADC 1RMFL 4NOFA 5LAXB 1HHJA 5CGYC 1CFQA 3K74B 2UWEE 4XVJH 3O6FD 2PW1A 4OFIA 1CLZH 5M7QA 1INDL 5JZ7D 4U1IB 1DEEB 2XN9E 4GAJL 3CFCL 4K3JH 1T21A 4Y5VC 1GIGL 1MAMH 1N59B 3MJ7A 2XN9D 1HNFA 1QKZH 3T0EA 4V2BA 4M3JA 3G6DH 2Y07H 2ZOKA 4LF3B 3DYOA 4P46C 1NJ9A 3F7VA 3W82A 1ONQA 5HHOE 2IPKB 4HXBL 4MGXA 2C9AA 1TETL 4L4VE 1YEJL 5D2NB 5HHOD 4PJEB 3TFKC 4QNPF 3WJJC 3C2AL 1IC4L 2J3SA 4HQQL 4PJ5A 4KRPC 4U1HA 2YKLH 2EIBA 2APBA 5DJ8A 5DGQA 4FQXD 5I1KL 2CLZB 1CGWA 5EWIH 3UBXI 4X7TB 4HUNB 5JOEA 3QFJE 3G5XA 1C5CL 3BPNB 2FO4B 1RZJH 3WLBB 4DN3H 4L3EA 1JHLL 1DQLH 2ICEA 3QFJD 4KVCL 4JY6B 1DSFL 3BO8B 1HHKB 3S34H 5I17A 1HSBA 5AZ2L 2ZJSH 1MRDL 2WP3T 3MRBA 3MRLA 1AO7B 1FE8L 1P2CB 2ZUXA 4L8BA 5F7MC 4Y5XB 1U8OB 1T03L 1LP9B 1QBLL 1F5WA 3AB0B 3UTPE 3ORJA 1ACYH 4CADA 3B2VL 5ICXB 3V9FA 2DBLL 1A6TB 5EC1A 3UTPD 3QHFH 1EHAA 1YJDL 3PL6D 2NR6D 5E7FA 5IQ9A 4OZIF 2B7DT 3DROA 3PWPA 5CD5D 5IMMB 3QUYC 2HJLB 2A6DA 3F12B 4JDTH 4PJEE 5BQ7A 2QHRH 3TVMC 5IVXF 2K7PA 3N9GL 1TJGL 4MXQC 3LHPL 5IFJB 1UACH 1A7NH 2BVOA 3FFCA 4CDGC 1H5BA 3RIFF 3TJEL 1YEIL 3UYRL 5GGQH 2HKHH 5I8OL 2HLAB 2R56H 2XOTA 3T2PA 1BVKA 3NIFE 4NPYB 2HVKA 3RAJL 2BSED 2ZOLB 3FQRB 3QEQA 4AT6A 1OTTD 4PR5B 1NFDA 4PB0L 4OGAC 5HGHB 4LLAA 4L8CB 5DXWA 3T8XB 2BY2A 3BGFB 1NDMA 3DGCR 1LP9E 5D7SL 3VCLA 1DUZA 4M7JL 3IDIA 1AO7D 5CILL 4I48B 5HGAB 7FABH 1UZ6E 2PETA 3RHWK 1RIVL 3ISWA 3U46A 2YUXA 2XQBH 3D18B 1UWGH 3VFVA 3BPOC 3QIWB 4FG6D 3MRHA 2AK1L 3INUL 2PO6C 5E99L 3OR7B 1AE6H 6FABL 1QR1A 43CAA 4ORGA 1VFBB 4PD4J 1IEAA 3C8HA 1TXKA 4MB3A 5SX5H 2C26A 4POZC 2V6HA 4QRTB 3TF7C 3WFEH 1MCDA 4YWGL 1I1AA 4M7KH 2R2EA 3F7YB 3LIZH 3ULUF 1P6AB 1MLBB 1D5IL 4NQVB 4WWKA 1WWAX 3MLXH 5F7HA 4LMQI 4GRWF 4YEEA 4FQ2H 1IBGH 3OPZH 3WSQL 4JHBA 3MBEB 4HS8H 2ENSA 4RSVA 1U36A 5HHVL 3UZEA 3O3DB 2IADA 1UXWA 3V8OA 2FX9H 3DBXB 3WE6A 3MV8B 2ICWJ 4PRAB 5KSVB 2DIAA 3G6JA 4Z7VB 1JK8B 1WSST 2HT3C 2GHWB 3O4LE 3EBAA 5E4EB 2Q7NA 1PX3A 3BAEH 3VXUA 4HZLA 1RIHL 1RFDH 4KDTA 3FHAA 1G7IB 2I5YH 5DF0A 3GFUA 3RVUD 2UUDH 3V5KA 3WHXB 2JJWA 4JPVH 3FB6B 3QIWD 4X7DC 1XGPB 2LQRA 4PS4H 2I60H 1R5WB 3TA3C 3U7WH 5B8CC 4S0SD 1OM3L 3BIKB 25C8L 4BK4A 4WUUA 4I0KA 1K4DB 4PRDA 4NQED 4F9PA 3D25A 3V6FA 1FVCB 2BSSA 3UMTA 1JNNL 3GKWH 3K2UL 2ICWA 2Q86A 1FLRL 3WYRA 4HAGA 4NWUL 5T3ZL 3CIQA 3AREA 1PY4A 2GSGB 2BJMH 2NY0B 3RL2A 2W92A 5JPMA 5C86A 2EDWA 4U05A 1MHEB 3IDUA 5C8JA 4GG8B 4Y88A 1KIPA 1BFTA 1YY9C 3MBED 4CDHA 4ZTPL 1D5ZA 3MV8E 1EZVX 5D93C 4Z7VE 1F4YL 1T1YA 1AXSA 1HWGB 4TOYH 2AGJL 1S7WB 2DMBA 3QBTB 5C0BD 2CMRH 5SX5K 4AEEA 1X5GA 1OSPH 1TDQA 3D1MC 4NFCA 5ICYA 3BIBX 2IMNA 4XCYB 2FJGB 4J8RB 2OXHA 2MHAA 1A3QA 3TNMB 1MLCB 3U9PH 4BSVA 1QHPA 2M8XA 3S9DB 1A3LL 4Y8DC 3I6LD 1WBYB 2HWZL 1NGWA 2DWDB 3BN3B 3X14A 1AKJB 1HXYB 1XAUA 1QPXA 2ESVA 2WIIB 1U8MA 2LFGA 4DOHB 1KIRA 4UT9H 3EZJB 1CBVL 5F3HA 2V5RA 1QQDA 1J05A 3QCVL 1XF3A 4U6XB 2JJTC 1CDCA 3I3BA 4DTGL 5IJVB 1NAML 2UUDK 5EA0H 1HCVA 3IYLW 3VWKB 5DJ0B 3T0AA 2IH3B 2X4SB 4GW4B 4OCRH 1QRNB 4LSRH 2EH8H 5TF1L 1CI5A 1IKNA 4YQXL 3K8KA 3ECBA 4G7VL 3BWAA 3RVXD 4APQC 3WKML 4KMTH 2NZ9D 1KPVB 1Q0XH 2WQRA 3PWLB 4M3KB 4NQUA 3MODH 3WXVL 1DLHB 2AVGA 1IGCH 4P2OC 3ULVF 1H15B 5HI3C 2GTZB 3MGTA 2N56A 3SPVA 1W72H 5J12C 1F8TL 2GJZA 1AKJD 3JWOH 5I8KH 4NM4L 4EKXA 4S10A 4HJJH 4DOHE 4WY7L 5BVPH 3S4SB 3QR2A 4K7PX 4FQHB 2XIDA 1DQML 4PJBF 3N1QC 2F8OA 5EC2B 4EQ3A 1JZ5A 4P5TB 3QUKA 4DZ8B 4Z7UB 1CICB 3PHOB 3VWKD 1QRNE 2GITB 3H3BC 4PGCA 3WNOA 4OF8A 1NCCH 3ZKND 5B39A 2A9NL 1OAUH 1A5FL 1QRND 5F6IB 4HUWB 2W60B 1DDHB 1CK0H 5IV2A 1IAII 1XGUA 1J0IA 3TBTA 3U0TA 4MAYB 1DR9A 5DMGD 1FNSL 4XC3H 2R9HD 4WDIB 2YRLA 1XGQB 4HJ0C 1PKOA 4Z0BH 3NCFB 1ZT7A 2VKXA 1W8OA 1RZKH 2GK2A 1TVBA 3KPTA 2ZWLT 1T2QL 1FO0B 1WISA 1F45A 1I7RB 3W39A 4FA8A 5IESL 3GUTA 5FKAB 3MRKB 3RWHA 3RKPA 3HNVL 1VACB 4ZXBB 4Z7QF 1EHLL 1YYLH 3CFEB 4Z7UE 4P5TD 3EAKA 4MA3B 4XZUA 4UDUB 3BISA 1JPGB 1SBBA 4YUEH 4AMKH 1CICD 3GSVA 2DL2A 1GGIL 3U2SA 5J4MA 2VAAB 4RQQA 4GUPB 3VWJC 2IQAB 1KLUB 3S7GA 1RY7B 5C6PB 1HCFX 3OAUL 2OL3B 1IAIM 3CMOL 1YUHA 5LCVL 3GGWB 4F7MA 2NY3C 3BZ4A 3BE1L 1WBXB 1SYSB 4OD2A 1P4BL 1JGUH 4JDVB 4XCFH 4QHUB 4CGTA 4TVPH 4PJHB 4XHQA 2YPKA 3VXNB 5A2LH 1P5UA 2YXMA 3I9GH 1UZ8A 4ZUVA 2D3VA 1PKQB 5EOTA 3SQBA 4X4YA 3MTRA 3KLHD 1GVIA 1AI1H 3I3DA 1C7TA 2PKDA 5L9DL 1KCKA 2G2RB 3ABZA 3ILPA 4Y1AA 5K33A 1IC7H 4TSAH 4U6TA 4XXCC 2PYFA 4G6JL 4Y2DB 4ZXBD 5BW7C 2AEWA 2F54D 2R2HB 2DQTH 2WBKA 4JGJA 4UIMB 1M7IB 4X9IA 3AM8C 1G7JB 3PJSB 5EOCH 4F57L 5GS0D 1ZTXL 4LLYA 3PQYD 4LRNL 5I15H 2QL1A 5KANI 3BPLB 2F53A 5I1AB 3QWOA 3VE0A 4NO0B 3LKQB 1L0QA 1J0HA 1MWAH 4Z0XB 1NUGA 1FORH 3ROLA 3CFJB 3GSXB 2DQEL 3HE6D 4ONFH 5C0AA 4XVUC 4AEFA 2R1XA 4P2CG 1MFDL 1J86A 2X42A 3QCTL 5E5RB 2JK5B 4XMLL 3QUMB 2BNUA 1LK2A 3D48R 1GL4B 2WM0A 1PKQE 3AVEA 5LVEA 4MXWH 1AGEB 2IGFL 2F5AH 2C3XA 5K59F 4O02H 2CDEA 2R1WA 3DYPA 4Y5VB 4CVXA 3DXAB 1H9VA 3NMEA 1I9RH 1BOYA 2MQ3A 1T5WA 3MGOA 4YFEA 5CJ8A 1YZZA 3P4NB 1FFPA 2AP2A 4NDMA 3X13B 1A6PA 1FHGA 1KJMB 1MUJB 4P46B 1YNLL 2ARJA 1U3ZA 5AYUH 4D0DB 4P5KB 4Y2DD 2DTMH 3QO0B 3CVIH 2ADJA 4OFDA 1RVFH 4OKVA 5JA8B 1IQWH 3P0GB 2AJZB 5J13C 1UC6A 3HKFA 4KRPB 2H3NA 2BVEA 5F72S 3QA3A 1QFUL 1V7ML 5TE6H 4YHML 3WJLA 1HZHL 4QYOB 3I02A 1ZLSL 3QPQC 1ZT4A 3OR6B 4I5BA 4P2RD 4P4KD 3VFOA 5E94A 2XTJC 4JG1L 4MNQD 5CGYD 3DLQR 3VGAB 2D4FA 1UFUA 3EJZC 5D72H 3PDGA 1J7VR 3DXAE 1D9KC 2QSCH 4E41D 3VXOB 1YC8A 4JKWA 5DWUL 1BBJB 4JPWL 4OCNC 3UJJH 4GRMB 2YXFA 1YEHL 2Z92B 4HFUH 3QUYB 2DLHA 4P46D 3MYZA 5HPOA 4ZUTA 5KJRH 2BVPA 4NKIH 4JN1L 5J6HB 4JJ5B 3G9AB 3C5SB 4AEIL 3IJSB 3WXWH 3TFKD 4R4ND 1JTTA 1RULL 2FSEA 4KRPD 1KT2A 3NCCB 3QDAA 4FABH 5GGTL 4PJFF 3F5WB 5C2BH 2ORBL 2XA8H 3TGXA 4G8EA 2F58H 5BZWB 2HMIC 1JZ3A 2OR9L 4QOKD 4CMHC 1NFIB 3J7HA 4ZFOB 4LLVA 5IIEA 2GT9B 4ZQKB 5ICZA 3L3JA 2X4RB 4K94L 3X11A 1JGEA 4GJTB 1HYRC 3B9KC 1LE9A 2NX5A 3JV6B 5B4MC 1CL7L 5H35B 1CLOH 3S5LB 3BPOB 1PQZB 5IMOB 1GPOH 5TE4H 3GEWB 3LKNA 3RY5A 1R3LB 4DGIL 1GSMA 1PDKA 1W0WB 4PB9H 5FOBB 2GJ6B 3SE3A 1I1RA 5B3JE 3SKUD 2EYRA 4LVNC 5C9JA 3QUYD 1LNUA 4KAQH 1OW0A 4LEXL 4KK5C 1BFVH 3UTTB 3TVMD 1LHZA 2QQKL 1EFXA 1WBZB 5CCKL 5BO1H 1SJEB 1KNOB 2VABA 5J9PA 3KPMA 4MXQD 3NIDF 3D87B 3KPQA 1U95A 3FQXA 1UJ3C 3O9WA 5EU6D 4QWWC 1KBGL 1U8KA 4OTXH 1J5OL 4HBCH 4OGAD 5LGHH 1NL0H 12E8L 5F6HI 5TH2B 2R1YB 2GUOB 4OI9A 3QRGH 2ATPA 1B0WA 3LRSB 2UV3A 4FFWC 2PYEA 2GJJA 4L3CA 5IMKA 3ARFA 2XZAH 5FFLA 1JNJA 3U6RB 4RBPH 3SJVB 1RUML 5EPMB 3I3EA 3EYOA 1I3GH 1FL6A 2EDOA 5MEPB 5HYSG 3MR9A 2GJ6E 5JHLH 1JRHI 2EIZB 2PO6D 3GHEL 3FCTA 3G6AA 1T2JA 1BIHA 3TA3B 4EI5C 3R4DA 5HYEA 2GJ6D 4ODUA 2QTEA 3UTTE 2BSTB 1S8DA 3LZFH 4PJDB 4POZD 3TZVA 5EORL 1AJ7L 1G7QB 1WJ3A 4QY8A 4PTUB 1R3IH 1XZ0B 3KGRA 4DKFL 2ZUSA 5BRZA 4XPGH 5DJZB 5C0JB 2D0FA 3T3PF 3OGOE 5M94B 1MCPH 1T0MB 2APVA 4HWZA 4M7ZC 1S5IL 4LKCA 4QXGL 3HRZB 4XWOC 4F33B 3U82B 4GG6F 4LARL 4PGEA 3AS3A 4OV6F 2CGRH 3ZE1E 4KK9C 5D93B 2BXZA 4XVJL 5DFVC 5EBLB 1YMMB 1CFTB 1WUNT 7CGTA 1A22B 4ZUWB 1CLZL 1DTUA 3B9AA 3UTQA 4JO4H 1X4YA 2BNQD 4K3JL 2HT3D 2P46B 3SJVE 2YD9A 4L1DA 5INCA 4NQXB 1MAML 3T4YA 4Q6YA 1OGTA 1QKZL 1CXEA 4ZPVB 4ODBD 3G6DL 3UJIL 2VO5A 2V7NB 3D85D 2W0LA 5D1XB 5E2JA 5KBNC 1F90H 4XBPA 1HEZA 2I9LA 5DRXA 1A1NB 4PJGB 3TA3D 4HUXA 4PJDE 5HD8C 3LS5H 4MD4A 3BP7B 3S36X 4R0LC 4Q74A 4U1JB 1DANU 4H5SA 3H9HB 5K9OB 5IW1A 2YKLL 1F2QA 4NJ9L 4OM0H 3U9UA 3WLWC 4WGVB 1BFSA 2E9IA 2R23B 1IAOB 1K8DA 4RMWA 4N0UB 3MV01 3EFFB 5EWIL 4YDLC 2O5XH 1RZJL 4DN3L 5KW9H 4GKSA 1DQLL 3H9SA 4RBPK 2XKNB 2DJSA 1GGCH 2AERT 4HD9A 5L8KB 1YMME 1YY9D 5I75C 4LU5H 3S34L 4LGPB 3RWCB 2ZJSL 2VR4A 3AC0A 5CJXC 1YMMD 5KVDH 3LD8C 3O3BB 3P77B 4WFGE 4B53A 5AAWA 4HULB 4LLQB 3CMGA 1ACYL 5DDHB 3C8KB 4FZ8L 3QHFL 1S7VB 2CK0H 1MCEA 2L4OA 4PGDB 2FJHA 4F37F 2EE3A 3QNYA 4K8RH 4PRHB 5EO0A 4OQTL 5JIKA 1F3DH 3V6ZB 4JDTL 2QHRL 2DB8A 3EDJA 5ETUA 4P2OB 4KRLB 1WV7T 3C8DA 4RMQA 4FQPA 3KPOA 3KYOB 1JN6B 5BCAA 4XPTH 3FO1A 5J12B 1UACL 4IOFC 1A7NL 3E6FA 3HN3A 2WBJC 1E6JH 1JNHB 2KQMA 5GGQL 2HKHL 5IOPB 4O2CB 1WC7B 5D6CB 4ODHH 4WEBL 4H26A 2IWGA 4R4BB 5GZOC 1MH5A 4JZNB 1CQKA 2EIEA 3L7FA 3G5ZB 3KPLB 3MRRB 4BQ8A 2B4CH 3GIVB 4A6YH 4RAUA 1SJHA 2E8YA 3RI5K 1LO5B 3PGDB 3RUGF 2CJUH 2XQBL 1UWGL 3QUZC 2H26B 3PWNA 4LIQE 2C7UA 4OIIH 1AE6L 4PRHE 1DUYA 4UV4H 1NFDF 3TWCH 5ERWA 1ZEAH 3MRCA 4JJHA 2H6PA 1NCTA 2NY5C 4PRHD 1KTLB 1JTOA 1TZHA 3EYFA 1UKSA 1EMTH 2F5BH 3TPKA 4ETQA 3WFEL 4P2OD 4FRWA 4M7KL 4X4XA 3L7EA 1P84K 3LIZL 1KCSH 4NUGH 5HI3D 3V4PH 1HH9A 3VD4A 1IGFH 1OF2B 3WO4B 1M7DA 3BZEA 2AK4B 3MLXL 3IRZA 5FUZH 1RZIB 1INQB 5J6GB 3QNXB 4FQ2L 3OPZL 2P1YA 4P57A 4UQ2B 4OI8A 3G5YA 1F4WH 4HS8L 1UEYA 3DVIA 3Q2CA 2NTSP 5DS8A 1TQBC 4PJ8A 3EYVB 3HTLX 5EU4A 2FX9L 3W11C 1NGZA 1JFQL 5EZOH 3L5WB 1Z9LA 5E8NB 5LGKA 3AMLA 5I8CA 4I2XB 2D31A 4ZOEA 2D7MA 3BAEL 4OT1H 5BXFB 3HLAA 1RFDL 2I5YL 2NTFB 3TCLA 4XCNA 3LRHA 4YR6A 5ISZA 3VWJB 4JPVL 5CFHA 4G8GD 2D7OA 4IRJC 2MPAH 1K4CB 1EVTC 4PS4L 1F3JA 1Q9WA 2I60L 3Q5YA 4C54A 3GSUA 1WCBB 3U7WL 2NY3B 5GS2H 1LO2H 3GMLA 2H1PH 3JBG7 3DETC 4G43B 3VXPB 1N8ZA 2V2WA 4HJ0D 3GKWL 4N5UA 2AEIT 2AK4E 2X70A 2DYPB 3UPRB 4P3CH 1WK0A 1T83A 1ZVHA 3TYFA 3MNWB 2BJML 2RGSA 2AK4D 2IH1B 1KG0A 2YA2A 4K71B 5D2LB 2P47B 4NHUB 1QUNA 1X3DA 4MJIB 4WHTA 1DVFC 3O3AA 4I3GA 5F7UA 2E9BA 3HAEB 1S9KC 1CFBA 4TOYL 4NFDA 2CMRL 2O5YH 5I73B 4PJXB 1OSPL 4NZDA 4TUJA 4GS7C 1EH9A 1ND0A 3SHSA 3LKRB 2MMXA 3VWJD 1JRHH 4OD3H 5DHYA 3FQUB 3U9PL 5DHVB 5HHXH 4UDTB 5JIHA 1HH6A 1NC2B 3STZB 3LN5A 2OI9C 5I30L 3LDBC 3G9VA 3HS0A 3QQ9C 5JUEH 2NY3D 2YC1A 3BI9X 3FN0H 5I76A 4X4MA 4X98A 2VLLB 5IW6A 1K8IA 3BFOA 3T65B 3TN0C 1C12A 2PCPB 5D2LE 5LWYH 4L8SB 2YD3A 4UT9L 3BEWB 1FZMB 4MJIE 3RU8H 5T1KA 5EA0L 3RGVB 4I9WD 1XF4B 1KIQA 3OKMA 3AROA 4BFIA 4DUVA 1VGEH 2VLJB 1IL1B 4KRNA 3O6LH 3KLSA 2XFXB 4ZSOA 4PJXE 3RBSA 4DEPC 5ILTH 4OCRL 1P9MA 5E2UH 1R3JA 3O3EB 2EH8L 1NGYB 4FXGB 3PHSA 3GSRB 1L0YA 5J13B 3SQOH 3QAZC 3G04A 1NGXA 1G1YA 1LP9F 1Y18B 5GGTA 1OY3B 1L9NA 2VUOA 4KMTL 1UZ6F 4Q58C 1Q0XL 3WD5H 5DMKA 3MODL 5JOPE 4RAVB 1JWUA 1MCFA 1FN4B 3T2QA 1ZLWH 3PE9A 1F6FB 2PF6A 1NC2D 3SGJC 5JOPD 4XVUD 2CD0A 3W81A 1I3RA 1W72L 2XTJB 2FL5B 5TPWH 3S96A 4HUVA 5FHBL 1MELA 1CN4A 3JWOL 5I8KL 5GRWA 4HJJL 5F7LB 5BVPL 1Z9SA 2IJ0C 1UM5H 2QADC 1D9KB 2FECL 4IMKC 3BIAX 4JFYB 3UBXG 1AD9A 4U2ZA 5C0CB 1L9MA 4F7CA 1U6AH 3W9DA 1JHTB 3RBGA 5F9JA 4FP8H 4PRPD 3RGVD 2VLJE 5C0IA 1T7VA 2E7MA 3AAZA 2D7QA 4L3AA 4GAGH 3QFDB 1NCCL 4G8FB 4CNIA 5E9DA 1OAUL 3IRPX 5MENA 4UILH 5E1AA 4NO5A 4LSUH 1NC4A 1I8MA 1G0DA 1MHHB 3E1F1 3IFNH 1CK0L 5EO9B 4YHNA 2PXYC 1TTGA 4YGVA 2ADFH 3V2AR 4PREB 5AAMA 4PTTB 5KSUA 1U8QA 4XC3L 3D2UB 5I16B 4Z0BL 4CJ1A 2A6KA 3RWJB 4X7FC 3MRFA 1RZKL 4KK8C 4CMHB 3EOTL 3MO1A 1W0VB 5E8DH 2XTJD 4D9QD 1CE6A 3EUUA 1Q0YH 1BZ9A 5JDJA 4C56B 1F6LL 4XCEB 1PZ5B 8FABB 2X9YA 1UT9A 4TSBH 3DX9A 5HYSA 4ODXB 3B9KB 3EJZD 1KSRA 5C0CE 3NFPA 5GGRA 5I66A 4KVNH 1D9KD 2CIKB 1ES0B 3EO0A 4HKZB 1NEUA 4WI8A 2XZQH 4K3EL 4KROB 5C0CD 4JM2C 5LKNA 3WIHH 1YYLL 4J6RH 4JDZB 4PJ7A 4EEEA 2EH7H 2YOCA 3UC0H 4NSKB 1T4KB 2B1AL 4LVNB 1ZHNB 3DUUB 3KYAA 4YUEL 5FCUH 4HIJB 3ZDZE 4AMKL 3UEZA 1J8HA 1ZLWK 1QO3B 2W0FB 1KJVA 1YY8B 4J2XA 4D0BB 5JNYB 1QSFA 3R06B 2BSRB 1VGKA 2VLRA 1H0DB 3KWWA 4JFEB 4OCYH 5DJ2A 3S4SG 4ODVH 1EGJH 5ID1A 1EA9C 1LO4H 1WWBX 1E4XH 1KPRB 1IT9H 3GJFB 2R29H 4LAQH 1HSAA 4GMTL 2YSSB 2APFA 4JQXC 1JGUL 4XCFL 2NW2B 1CDIA 3GSWB 4TVPL 1F6AB 3D2UD 2HMID 2DQFA 4LP5A 4XI5C 2A38A 4PJCA 3I9GL 4PRBA 4C56E 5DJCB 4OF7A 5F7FA 1JZ7A 4CVZA 5HHQA 5EZJA 1AI1L 3C87A 4R9HA 5BJTB 1ITBB 2YPVH 4LPWA 3B9KD 4P23C 1MHCA 5B4MD 3B9DA 2Z93B 1MJUH 1IFHH 2C1PA 1IC7L 4S1SH 4TSAL 1BM3H 4NUJB 5H8DA 4KROD 2DQTL 4F2MA 3O6FA 2VQTA 1A9EB 4U1KB 1FH5L 4EI5B 2UWEA 4LNRA 5IROC 1P4LA 3U79A 2ENYA 4HWBH 3QO1A 5DRWB 4N0CC 5EOCL 3SE8H 1N6QH 2AXGA 4KK5D 2A73A 1YEDA 3TIEA 4JFEE 4PG9B 5I15L 5JW3H 4GRLC 2P42B 1IARB 1T0NB 2BK8A 4UNTA 3BDBA 1MWAL 1FGVH 2BDNH 5IW3A 5JOFB 1KACB 1NGPH 4ONFL 5CIPB 2OP4H 1G7PA 5AYQA 4M7ZB 2R2BA 1T66C 5HHOA 4QWWD 2JB6B 1WGOA 1MOEA 1J1XH 2VITA 3OF6D 3HNTH 1O0VA 4YXLH 1W0YT 5IB5B 2VDRH 5BS0A 5A1AA 3P4OA 4MXWL 4FQXA 2EC9T 3KAAA 1BFOA 2F5AL 3IDYC 3QDMA 1BD2B 4UV7L 4O02L 4U6VH 4YIQA 2ZUTA 4FFWD 3C5ZA 3P4LA 1UVQA 1I9RL 1YEGH 3QFJA 1ZHBB 5FA4B 1FNEB 2NYYC 1IGMH 5IF0A 3ZTJH 5DYOA 1ZOXA 3L3OB 2D9CA 1LVEA 4OQTA 5AYUL 4YEFA 5DRNA 1E0OB 3DRTA 2DTML 4XRCA 1FGNH 4LSSH 4EI5D 4U1IA 4Q2ZA 1RVFL 1IQWL 3FRUA 4R0LB 4RA0C 1N59A 1G7MB 1N0LA 3PL6A 5FHAH 5CUSH 5ENWA 1OGAA 4JRYB 1WICA 5TE6L 5C92A 5CINH 4U3CA 3GO1H 4YDLB 4YXKH 3ESUF 3RQ3A 3QHTC 5F8QC 1HQ4A 2XY2A 3SBWA 5FO9B 1GH7A 2FATH 2V17H 5D2NA 4XWOD 1BF2A 3O11B 5I75B 2FEEL 2NPLX 2H45A 1BD2E 4KK9D 4JANB 4JAMB 4JPIB 4NC1C 3LD8B 5D72L 3VFNB 2NCMA 1BD2D 5A16A 2QSCL 1AGCB 3KPPA 1F3RB 1M71B 5EUKA 3WLBA 1IJ9A 1NCBL 5EU3B 3UJJL 1QFWH 4M8QB 5T5FH 5AG8A 4HFUL 2XQYG 2C3VB 1KB5B 1AO7A 1P2CA 2Q76A 5KJRL 4JFPB 3QNZB 4PUBH 5HD8D 4KI5E 3WXWL 4Z7UF 4S1QH 5EULV 5ICXA 3ULUC 4JRYE 1A6TA 1FVEB 2WBJB 1HIMH 4PFEA 4FABL 3MUZ1 3WLWD 3WNPA 5HYJA 2YR3A 3V6BR 2FX8H 5C2BL 1D5BB 4OF5A 1IEBB 2XA8L 5IMMA 4JM4H 3SE4C 2HJLA 2F58L 3F12A 5FDWB 4PYGA 5L0QC 2YEZB 5HTSA 1QD0A 2OZ4H 4U2YA 3JWDC 4TUOB 1NBZB 1FFRA 4OSUH 5D7IB 4YDJB 3OSKA 5C08B 5H2BA 2HLAA 3GBMH 2VH5H 3ESVF 1CLOL 1XCQB 1TCMA 3FQRA 3QUZB 2EYTB 1X5AA 5TE4L 3K46A 1JL8A 1B90A 1PD6A 5HGHA 1VB9A 4PB9L 4C83B 4L8CA 3TV3H 1LEKB 1U8NB 1XFPA 3MXWH 4KAQL 1JVKA 5CAYB 4IRSC 3IJYB 5HYFA 3ALWA 5HGAA 4Z7WA 4J12A 5BO1L 1XGTB 4Y2OA 5I8EB 3D18A 5IMLB 2NNAB 5SWSE 4GH7B 1XT5A 5CJQH 2VDQH 4NQCB 1I8LA 5GGUB 4IOFD 4PY8J 1S9WA 2WBJD 3OR7A 3U0PB 5DJYB 4LCCA 3CVHB 4HJGA 4U33A 4LSVH 5BV7C 4NQEA 5K9KA 1LQSR 4CUCA 2M1KA 2EDNA 1TQBB 3L3KA 5CWSB 4OTXL 4RZCB 1J0ZA 5MHSD 4HBCL 5LGHL 1I85A 3SGEI 5GZOD 4J3SA 1NL0L 1KC5L 3QRGL 1UXSB 5D7IE 3JUYA 1FV1B 5C08E 1MLBA 4FFYH 4MD5A 4NQVA 2XZAL 4MA7H 4XPHH 4A2LA 2OX5A 4JLRB 3NN8B 1ORSB 5FGRA 2AKRB 5C08D 1JGDB 3I75B 3KVQA 4JZJC 3MBEA 3MJ8B 5CEZH 1I3GL 4S1DC 3QUZD 2P8PA 2V9TA 3G5VB 5DQJB 5JHLL 4EBQH 2MWCA 5J8OA 4HC1A 2E27H 4D94A 3N1FC 3QIBC 5E2VH 4Z7VA 3KYKH 3OXRB 5C0BA 2VQ1A 3BESR 4FS0A 2UY7A 3LZFL 5ACMA 3TCXA 5I1LA 3QXWA 1FYTD 3X12A 3OKDA 1L7IH 4MNGB 2ARJQ 4NQCE 1VA9A 5JW4M 1AQDA 1R3IL 2M26A 3P30H 1ZGLB 3FB6A 4XPGL 1QVOA 1SEBA 1FCGA 4WW2A 5CP7A 3BN9C 3BP6A 4TULH 5DK2A 5FYJU 5TQ2H 2YD5A 4WI3A 4EDWL 1FL3B 2X4NB 1HI6A 1MCPL 3S5LG 5IFHH 4EUPH 2GEEA 3BIKA 4WW1A 5D6DC 4DZBB 2CGRL 3TM6A 3W11D 2BXYA 1HQRB 1D6VH 4JO4L 2APWA 3IKKA 2GSGA 1QA9B 15C8H 3KJ6L 5TDOB 2CUMA 1XGYH 4GS7B 3S3PA 3CFKB 3AXLA 3B3IA 2MJWA 5L2KB 4C4KT 3HRPA 5KN5B 4N0FA 2FIKB 4ODTH 1F90L 4IRJD 5DTFB 3DURA 5IFAH 1T1ZA 2OI9B 3ULVC 3LDBB 4LKXA 1W72A 1BQSA 4MNGE 3I84A 3DETD 2W91A 4HEPG 4OM0L 4XAWH 3ULSA 2QV2A 4HHAA 3UBXA 1ZK9A 3TN0B 1QHOA 4RMSA 3UZQA 2FJGA 3PXJA 1U3YA 2XT1B 5KANG 2O5XL 3LKPB 4FQJH 2BP3A 4ALAH 5KW9L 2EDTA 2X1QA 4I13B 5FYKU 4L1HA 3IDJA 1GGCL 1N4XH 4WHCA 1HOCB 1RZ7H 2JB5H 3P11H 4LU5L 4NO2B 4HS3A 3MRDA 3TH2T 5KVDL 3WFBH 1U8IB 4S2SA 3GIZH 1BVZA 3MOBH 2VTFA 3MLRH 1BLNB 4A2MA 2DDQH 3C60C 2YPLD 2CK0L 4U6XA 3QAZB 5L2KE 1KJ3H 1RK1B 1D5XB 2GFBB 5IJVA 3W0WB 4O00A 1V7NH 4K8RL 5L2KD 4Q97A 3VWKA 2ED8A 5DJ0A 3CXDH 1WTGT 5E8OA 5JMRA 1DLFL 3W5MA 2X9XA 2IH3A 3LAFA 1MCNA 2X4SA 3FQWA 4BJLA 1S9XA 3QQ9D 4XPTL 5FM4A 5B3JF 3FFDA 5HVHC 3SGDI 1E6JL 5IB4A 5EU7C 3VD5A 3TN0D 1IC1A 3ZKQD 3QYCA 4ODHL 3VFRA 4UU9A 3QG6B 2DKUA 1CFSB 3KYNB 3DI2B 1G1CA 1U2CA 4QRQA 4NZRH 5JLZB 1T04B 1ED3A 3V4VH 4X80H 3TPUA 4YC2C 2B4CL 4X8JB 3NPZB 1CDUA 5CGTA 4A6YL 5KSAC 4IOIB 4P2QA 2CJUL 3VFSB 2Y72A 4PGBB 2ZPKH 4BKLB 3IVKB 1LE5B 2P8LA 4L9LA 4PYHA 1H8SA 4OIIL 3SO3C 3W0WE 5F1KC 4JCLA 5A43C 2J8UF 5JW4N 5EC2A 4YDKL 4MSWB 4UV4L 1CZ8H 2PXYB 1PSKH 1NCAH 2E7LC 1ZEAL 3W0WD 5EOCJ 1IILE 1FAKT 3CSGA 2F5BL 2BVUA 4LLWB 5KG9A 5AUMA 1KEMH 5IB1B 4NUGL 1KCSL 3RWDB 3V4PL 3IAPA 1IGFL 4G9DB 1PAMA 2W60A 4O2FA 1CGUA 2XPGB 4DFHA 3HZKB 5FUZL 3WUWB 5D1QA 3RGHA 4WUKH 1EZVY 1O7SA 1F4WL 2QKIB 1ZMYA 5D70H 2QADD 4ELKA 4WDIA 1LEGB 3C5JB 5FGBC 4JM2B 4RIRB 3MLSH 4NN7B 5I0ZA 2WBWB 3DIFB 1NANH 1FCCA 1A6ZB 4QGYA 1FO0A 3QWQB 4IIQA 4R97B 1GZPA 4OT1L 3HPJB 1I7RA 4H1LG 3GMMB 4JO3H 1IVLA 5DI8B 5FKAA 1UKQA 4DQOH 4X9HA 4UINH 5FF6A 2MPAL 1MWAA 4ZXBA 2F54A 1RJZA 1YN7A 3CFEA 2MCPH 2PXYD 5MEOB 2OSLB 4WO4C 2KQNA 1LO2L 2PW2B 2H1PL 5KS9A 1NGQH 1C08A 3LPGA 2RB8A 3KNBB 2APXA 3HG1B 5E95B 5CSZB 3RX7A 3EHBC 1NEZB 4LPVA 4P3CL 3PQYA 2VAAA 4ONHB 4KK8D 4GUPA 1KLUA 3BZFA 4U1GB 2OL3A 2IC2A 3SY0B 3HE6A 4EOWL 1DJSA 3SDXA 1JZ8A 3GGWA 3VXTB 2VUYA 4P23B 4H0HB 5D1ZC 4HZAA 1SYSA 1F13A 3V52H 4JDVA 5C0FB 3SE9H 4PJHA 1FRGH 4JM2D 1UYWL 4JFDD 1RJLA 5FUOH 4X0KB 3CNKA 2G5RA 1AHWC 3FHQA 5EUOA 1JYVA 3KHQA 2O5YL 4UBDC 3MNVB 5LGJA 1T89A 1NSNH 4HH8A 4P4RA 3VGDA 4N8VB 1ZA6B 4U7SA 4WI2A 1UWXK 4GRLB 5CLTA 1AGFA 1JRHL 3ZKMC 4OZHB 4P59H 3EDKA 1V8HA 3LPFA 5HHXL 4Y2DA 1IEHA 3M17B 2VL4A 1M7IA 1UKTA 3IU4H 5JUEL 5SV3A 2IPUK 4KQ4H 1CD8A 3FN0L 3PJSA 1EXUB 5JO5A 4AY0A 4G9FB 4HGKC 3OXSA 5CZXC 4DKAA 3PABA 3HG1D 4XI5D 5DQDH 2V5SA 5FKPB 4ZFGH 5LWYL 1XGRB 3O2VH 5I1AA 4N90D 1T3FB 3LKQA 4P3DB 5FV2A 4GW1B 4Z0XA 1BHGA 3GSXA 4ETYA 4KRMB 4P2RA 4P4KA 5F7WC 3EO9L 3RU8L 2IAMC 1LD9B 4NIKB 3B5HA 4P23D 1A1MA 1P7KA 1KLGB 4MNQA 4PD4K 1U8PB 1Q8MA 4GSDH 4OFVA 2ZKHH 1VGEL 3Q5OA 4LSQH 4TQEH 5ILTL 5E2UL 4QNPE 5IVXB 1QRKA 3GI8H 4E41A 1CXLA 2J5LC 1HXMA 5MEQB 4N0CD 4Z95L 3SQOL 3BQUB 1EEYA 1WAAA 3CU7A 4WIQA 2VE6A 4OZHE 5F3BB 3SKMB 2WK2A 4GRLD 3KXFB 2AJSH 1MUJA 3WD5L 3MREB 3IT8D 4MWFB 1HN1A 2AJ3B 1CGYA 2VXSH 4P5KA 3M1BA 5GGSY 4CMMA 1A3RL 5ID0A 3EFDH 3BJ91 3NVQA 1PY9A 4G9FE 4QEGA 1T66D 3CZFA 1EDQA 2OXGA 3V5HA 5HGDB 5TPWL 3MLTA 3HAEG 4G9FD 4HCRH 2EDYA 4AYFA 2P24B 4QHLB 5L8JB 6CGTA 5EN2B 4IHOA 5E7BA 1CT8B 3VRJB 4MQ7B 3WIIH 4PJ9A 4RMVA 4NKDB 1OB1A 1U6AL 5B38A 1XR9B 3TO4B 5DJXB 3UYPA 3MOQA 3F58H 4QOKA 3ZE0E 4FP8L 1EAPB 1HHHA 5F1SA 2NYYD 3QI9B 1EUUA 3O45B 4H0IA 4RDQF 4GAGL 5IVXE 3SDCC 1Y0LB 3QJFA 3TH4T 4YDVB 3OKLB 4U49A 4U0RC 4UILL 4QGTA 4YXHH 4LSUL 4ZUUA 3QXVA 1A8JH 3BQUD 3IFNL 5H94B 3KXFE 5F1OB 3FT3B 2ADFL 3QULA 4GRWB 1TZGH 5HDOA 1U8LB 3OJVC 4OGZA 3KXFD 3QUYA 1HHIA 4KDVA 5L0QB 1AD0B 1KTDB 3TVMA 3TP4A 3EYSH 2W65B 4M02A 2VZVA 3SGDH 3C5SA 2XACC 5E8DL 4NC1E 2H9GB 1Q0YL 5HVWA 4TSBL 5EU6A 1FFOA 2HG5B 4ZO8A 3ALPA 1R5IA 3F5WA 3RWFB 1G7LB 1T6WA 3CH8A 4KVNL 1DQQB 2XZQL 2K9UA 5T1LA 3WIHL 4Z9KB 3TO4D 1MFEH 5FYJE 5HJ3A 1NFIA 3UDWC 2EH7L 4Y5YC 3RY4A 3UC0L 3QI9D 4QRPD 1TZIA 3C9NA 2GT9A 4ZQKA 5FCUL 5FYJD 4IRSB 3H9YA 4D9LH 4B41A 1ZS8A 4HLZG 3JV6A 4O5LH 5H35A 1PQZA 4LCYB 4OCYL 4CJ0A 5HGBB 3ULUD 4ODVL 3T08A 5CKAA 2PO6A 1EGJL 2QJDA 2OJZH 1I8IB 3DO7A 3P0YH 5FB8B 1LO4L 5GGRY 1E4XL 1W0WA 1IT9L 2CXGA 2GJ6A 2R29L 4LAQL 2D4DA 4HDIA 3LEYH 5BV7B 2DQUH 2D2OA 5HDQL 3EW3B 2IANB 2ZSVB 5GGVH 3WMSA 4EI6B 2Q1EA 1WBZA 3H3KA 4O9HH 3TBWB 3FOLA 1JPSH 3T2NH 5E00B 3VXSA 4WI6A 2YPVL 1U91B 1P84J 2G9HB 1XF5B 3C09C 1INDH 1MJUL 1IFHL 4QXTA 4S1SL 1OT2A 5GS3A 1GIGH 2Y36H 5EU5A 5TH2A 3JWDH 1QLEH 3QIBB 3MFGB 5FYKE 3FONB 2BNQA 4WTZG 4HWBL 3C2SA 3SE8L 1M05A 5FYKD 4IRSD 5EO1A 4WFHE 5IK3B 1OP3H 5JW3L 2OTPA 1ZA3B 1PFCA 2LE9A 4HXAH 5EPMA 3D85A 4E5XA 4PJXF 4WFHD 4BA8A 2BDNL 1FGVL 5TQ0H 3B5GA 3WHE1 1NGPL 4J4PC 2OP4L 5DJAB 4NNYB 2IANE 2HRLA 1J1XL 5B8CA 1U3HB 1V3KA 5IG7B 3HNTL 2BSTA 4YXLL 5CEXB 5EG6C 2VDRL 4PJDA 5HHMD 3ARUA 2OTWA 2IAND 1GHFH 2HJFB 4PTUA 4J3UA 4U6VL 1C1EH 1DQJB 1S78C 2X4PB 2OTUA 3CK0H 3LS4H 4KZEH 5F1IB 1OLLA 1YEGL 4Y4KC 3GMOB 3FO9B 1IGML 2E7CA 4NKOA 1T7ZA 4OAWA 5CBAB 4S1DD 4KHXH 5EBLA 4F58H 1OAZH 3DX6B 4ZUWA 1FGNL 4LSSL 4OV5B 1KENH 3QIBD 1QLFB 1Q94B 4XP1L 2FWOB 2Z9TA 1P53A 5GRYA 4LLMB 1A4JB 1GCFA 4NQXA 1BZ7A 3V0WL 3TBVA 2YBRB 4TTDC 5FHAL 4HIIB 5DSCB 1AY1H 2ZUUA 1R3HB 3BJLA 3D39B 5CINL 3GO1L 4F3FA 3RZCC 4YXKL 1U9KA 1MHPH 4HUMB 1YQVH 3LEVL 3BN9D 1J12A 4PJBB 4PJGA 2FATL 2V17L 2ZCKH 5I8OH 1A4KB 3OJDB 3DGGA 5JHDB 3H9HA 4YPGB 5FGCB 5K9OA 4U1NA 3QCUH 4MB5A 4MJ4A 4N0UA 3EFFA 2VKWA 1X5YA 2ITDB 3EZ8A 4GBXB 5DK3A 2VIRA 3C60B 1FNLA 1ZWIA 2HTLC 1QFWL 2JJTA 4RAHA 4X99B 1OP3K 1WZKA 2A6JB 2HRPH 1YDPB 2VXQH 4WFED 4NRXA 3ULVE 5SV4A 8CGTA 4Y16C 3O3BA 2VISB 3D0VB 3P77A 4AEHH 4KFZC 4PUBL 3VFGH 1VPOH 3ALXA 1MJJA 2UZIH 3ULVD 3GMQA 4LLQA 1KLFA 3FMGH 4OZGF 2DMKA 4LVHB 4N1CA 4WFFE 5HVHB 1Z6JT 3BGAA 3D39E 4P5MB 3MROB 1HIML 3LB6C 4PGDA 3ZDZF 1WEJH 2F15A 2FX8L 4APQA 3D39D 1NCNA 4JM4L 4UOJA 4PJBE 3BKYH 5ITBH 3UCRA 2XZZA 1YPZB 2ZSWA 5GJSH 3E2HC 3LKOB 4KZDH 5JHDE 3RWGB 1F58H 4N8PA 5FGCE 1I7UB 3B83A 3Q6FB 4H1LA 4YFLI 4OSUL 1JMZA 4YC2B 2P7TB 3IJHB 1RUKH 5JHDD 1XR8B 4CN6A 4H25B 1JNHA 3LPWA 3O8XB 43C9B 5KSAB 2GAZB 1ITCA 1J8KA 3HUJE 3GBML 1G9MH 4BH7A 3H6JA 2D0GA 2P5WB 2VH5L 4WWKC 1EEZB 5C09E 3TLRA 5E70A 2XWTA 3JV4A 3F65A 4HKXA 4I18A 5F6HJ 3C60D 5HSFA 4G6MH 4YDIH 4RFOH 3TV3L 3ZKSD 4R7DB 4JZNA 1T7WA 4ZAKC 3G5ZA 3MXWL 2IBZY 2EKJA 3ZHKA 3OKKB 5E6IC 1EJ6A 1LO5A 1FC1A 5T5NF 2BVQB 2MKWA 4I0PB 3VXMB 4OCMC 4G8GA 4I77H 5CJQL 2VDQL 3BGMB 3KR3H 4JQVC 1UGNA 2WWKT 3UROR 5JQ6H 2NY2C 1FJ1A 3QB7C 1YPZE 4LSVL 4D0CB 4NCC2 3WS6C 3RIAK 1KTLA 2NLJB 5FO8A 4CU6A 4Z7QE 2B20A 3P9MA 5DD0H 5KAQG 5DR5H 1FFNA 4YLQT 4X7CC 4F9PC 3VFUA 4FFYL 3OHXB 4MA7L 2GY7B 4XPHL 1XF1A 2P5WE 4LDOB 1IGYA 5KSAD 5J6GA 3AREC 1F4YH 3RNKB 5CEZL 4TNWF 5DUBA 5EZIH 5IKCB 4L9DA 3EYVA 1CWVA 4EBQL 4LBEA 3WDHA 5L2JA 1I8KB 1WFOA 2E27L 3CDGA 2J1KA 1RHHA 1VDGA 5E2VL 3L5WA 3KYKL 2O26U 4FFZH 4I2XA 4LLDA 4WO4B 2Q7YA 4HWEL 2BMKB 3GSNL 3T0VA 5DLMH 2O93L 4HH9B 1L7IL 4KI1A 2NTFA 2DMCA 4X7EC 4CN4A 2BOBA 1J10A 4JKKA 1DBBH 4BH8A 3P30L 4HKBB 4I0PD 3VXMD 4GT7A 1TVHB 2DLEA 4TULL 2V7HB 2VSDA 1K4CA 1Z9MA 4MJ2A 5TQ2L 2FZ3A 3PUCA 3BXNB 4UOW1 3KS0J 4OZFB 1CE1H 4FMKA 5IFHL 1HYSC 1WCBA 3HMWH 5JDSB 1X7QA 5D1ZB 2AABH 3D0LA 4DCQB 5FK9B 1IKFH 1VADA 2WSKA 4Y19A 2EE2A 5IBUB 1N6VA 1VHPA 1SEQH 4M61B 2EECA 1S7TB 1D6VL 1AHWB 2BC4B 2BY1A 4HSQA 4M9OA 4PRIB 15C8L 4KUCD 2ZG3A 5D2LA 4Z18A 3HB3C 1XGYL 4RGOH 4EIZC 4NHUA 4JY4B 4HWNA 4EZMA 4Y5XC 2PTTA 4U3HA 2AAVA 4BUGA 2BOCB 1ZE3C 3FN3A 1ZVYA 3VMPA 3KPNB 5JW5B 4H8WH 5IFAL 4L4TB 3HAEA 5FO7B 1A6UH 4ACPA 3MCKB 3AM8A 5FECB