4DPBX

The 1.00 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 8.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Plastocyanin A, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dpbX00
1AAJA 4Q8BA 1J9QA 5A7EA 2HLEB 3MBWB 1GW0A 2BP0A 4KO9A 2VM3A 3FSWA 3TASA 1KGYE 1TU2A 4A2FA 1KDIA 1CYXA 2P80D 2J57A 1JZHA 3WKPA 1BYPA 5I6PA 3T6ZA 3ASNB 1NTDA 1NWPA 1ZIBA 4E9XA 3QJQB 4GXFA 1WA2X 2WSDA 2IDTA 3QJSB 1A4BA 4E9TA 3G5WA 1R1CA 1AG6A 4QLWA 1CC3A 3AG1B 1SFDA 2IWFA 3GDCA 3NJLA 4AKQA 3JT2A 5B3SB 3OQRA 2CAKA 1HAUA 4YSUA 2PPCA 2J56A 1AZRA 3UGEA 4BWWA 4GP5B 2GBAA 3ABGA 2UXVA 3T6XA 4BXSV 3IBOA 4QKTA 2EIJB 2XXFA 2JKWA 4CSZA 4DP1X 2BW4A 4E9RA 3PCYA 2HZHA 1JZFA 1NIFA 5D4HA 2BW5A 2XV3A 3EH4B 2OCCB 1HFUA 4YL4A 4YSAA 4DP4X 4YSCA 1IBZA 4X4KA 3AG3B 4UF7C 2ZXWB 2ZWNA 7PAZA 2Y1AA 1EZLA 2W88A 1E67A 2UXTA 4FAAB 1KYAA 2YQBA 2GSMB 2YAHA 1ZDSA 1OCCB 1IKOP 1MG2C 1T5KA 4DPAX 3PAZA 4A2GA 5PAZA 4M3HA 5I6OA 1FA4A 1NIEA 4ENZA 2IH9A 4KNTA 4GP8B 4GP4B 3UAAA 1WS8A 4BDVB 1J5CA 2I85A 5B1AB 1ET5A 3FU9A 3ASOB 1V54B 5F7AA 4BK5C 1WA0X 1CURA 5LDUA 3ABMB 3C75A 1BEXA 3RYMA 1PY0A 1RZPA 2VW6A 3FU8A 1NPNA 3DIVA 3WIAA 2XVBA 2IWKA 1SNRA 2OV0A 4G7RB 5D4IA 4DPCX 3UADA 1VLXA 2EINB 1ETJA 2DYSB 1PCSA 1L9OA 3EHBB 1GY2A 3AG2B 5TK2A 1FWXA 1SDDB 4RH4A 2PPAA 1A8ZA 2XWZA 4JHVA 4E9WA 1J5DA 2DWTA 2GHZA 2AFNA 3WNJA 2H47C 3KW7A 3AG4B 3FSZA 4AI7A 1V55B 4CSPA 2DY2A 4DP7X 2PCFA 3T9WA 1IBYA 1WA1X 2YARA 4HALA 2FNWA 1OE3A 3FYEB 2BZ7A 2YXWA 1NWOA 1PZCA 1AOZA 5AFAA 1JZIA 3ZBMA 4G72B 3TBCA 1OOWA 2IDFA 1MG3C 1GSKA 3NSDA 1AS8A 1L9SA 2FT6A 3NT0A 1PMYA 3OM3B 4YSDA 3OD3A 4KNUA 4YSRA 3X1EA 4DP9X 3WNIA 1BQ5A 1KBVA 2A3TA 1XMEB 3NSFA 2AZAA 4DPBX 5I6LA 3NJFA 5AKRA 4YVNA 3FU7A 5I26A 3FPXA 2FJSA 4KO7A 4TXVB 3SQRA 2ZONA 2IAAC 3EH3B 1XB6A 3S3DB 1AACA 1BXVA 3QPKA 3NYKA 2J5WA 1ZDQA 2HX9A 2PPEA 1E30A 3FS9A 4HHWA 3U25A 4YSSA 1NDTA 1KCBA 3ABKB 3X1BA 2PPFA 2DV6A 2GC4C 1ET7A 1ASPA 1ILUA 3ZDWA 1JVOA 2CCWA 3NJIA 4AKOA 4E9YA 5I6MA 4KO5A 2VSKB 4PAZA 2FQFA 3X1FA 1BAWA 4HAKA 4FA7B 2HXAA 1NICA 1ZPUA 3S3CB 1IUZA 1WS7A 3FYIB 2ZOOA 1TKWA 1A3ZA 3L45A 3JTBA 1F56A 2XYBA 1NIDA 1UATA 2AANA 4F2FA 4DP8X 2Q9OA 1M56B 4HZ1A 5PCYA 1KCWA 1PNCA 4E9VA 2DYRB 1AS6A 1SF3A 3CG8A 1RZQA 1AQ8A 2YAQA 2BWIA 1A65A 1B3IA 2EIKB 4YSEA 1AZCA 2MTAA 4G7SB 1ZV2A 2FTAA 3NSCA 4DP2X 3NJJA 1X9RA 3MX0B 1XB8A 3H56A 4HIPA 4KO6A 5I5MA 1KV7A 4UAHA 1OCZB 3CZUB 4E9QA 2XXGA 2QT6A 1PZBA 5I28A 1KBWA 3ZIYA 1AANA 2OJ1A 4JKNA 1J9SA 5B1KA 3D12B 1A4AA 2H5UA 1GS8A 2EILB 1PLAA 3UABA 2R7EB 9PCYA 3EF4A 2GB2A 3TA4D 3UAEA 3H4FA 2YAMA 3CVCA 3OMNB 5B7FA 3NJNA 3S8FB 4BDVA 2EIMB 3IN2A 1CYWA 3FQ2A 4NB7A 4UANA 1L9TA 3FT0A 3X1NA 3NJMA 1NZRA 5AZUA 2CJ3A 1FFTB 2HX8A 3ZX1A 2IDQA 1M57B 3T6WA 3IE9A 4JHUA 1GS7A 4E9SA 2YXVA 3KW8A 1NIAA 2I7SA 2NRDA 3DKHA 3WKQA 5F7BA 1JERA 2DWSA 3ERXA 1A4CA 1DYZA 1E65A 1OE1A 1ASQA 3FSAA 2BP8B 3PPSA 1AZBA 2FQDA 1N70A 3NJKA 3X2QB 1SDDA 2UX6A 2PCYA 3H4HA 1JXFA 1PF3A 3QJTB 2X87A 1L9QA 3NJHA 3V9CA 1L9PA 4P5SA 2JXMA 4N8UA 1E5YA 2YAOA 3WI9A 2BWDA 2HRGA 2HX7A 3AZUA 3S8GB 4YSPA 1AS7A 2YAEA 2YAPA 1MZYA 4G7QB 4WKXA 3CDZB 2Y69B 3UACA 3QJRB 2WO2B 3CVDA 2UX7A 2HRHA 2XX1A 1IC0A 2BP0B 1ILSA 3IN0A 2RACA 1GY1A 1SJMA 1V10A 2W8CA 4AZUA 3EH5B 4WTQA 2QPEB 1AZUA 4HCFA 3N55A 3HEIB 1AZNA 1JZEA 2GIMA 3TBBA 6PCYA 2AZUA 2PPDA 4AKPA 3ABLB 1YLBB 1PAZA 5B7MA 1JXGA 5TK4A 3SBRA 5B1BB 2FQEA 2TSBA 4KOCA 5I6NA 3N2JA 3SBPA 2IH8A 1QHQA 4A2HA 3GYRA 1MDAA 1BYOA 2CALA 1OCOB 4K9JA 7PCYA 4NERA 1KDJA 1PLBA 2IDUA 4W1TA 3OMIB 4W9ZA 4G71B 1NIBA 4A67A 1TEFA 2PP8A 1ADWA 5E9NA 2FT7A 1WAEA 4F2EA 5ANHA 3S3BB 4DP5X 2CUAA 1OE2A 2LLNA 1M9WA 3QQXA 1ET8A 2QDWA 3BVDB 3CVBA 2Q5BA 3AW5A 3NP3A 3QJVB 2N0MA 5I5JA 3T6VA 2XV0A 2YAFA 4DP6X 1PNDA 2XV2A 2VW7A 3NJGA 4YSQA 3QJUB 4DP0X 2IWEA 4HHGA 2MRYA 1PLCA 1SFHA 1NINA 1X9UA 3IEAA 1N68A 2TSAA 5B1JA 8PAZA 3HB3B 1BXAA 1J9RA 4A2EA 1BQKA 4L0PB 3T71A 3GXUB 3V9EA 4GY4A 1JVLA 1EHKB 1TEGA 4KOBA 2QDVA 1GR7A 5I6KA 2JFCA 4HCIA 1ASOA 2AVFA 2X88A 2XLLA 1JXDA 1E5ZA 2UXGA 2XU9A 1I53A 4G70B 2GC7C 4HCGA 1OV8A 3BQVA 2BZCA 1J9TA 5B1JC 2R7EA 2VSMB 1BQRA 4BWUA 4P5RA 1GS6X 1AR1B 1CUOA 1W6LA 2PLTA 3FQYA 1JOIA 4Q89A 3FPYA 3WG7B 2I7OA 2XX0A 3AY2A 2WO3B 4BXVA 3DTUB 3PAVA 1URIA 1XB3A 2PP7A 2VM4A 3PAUA 2P80A 2VMJA 1W6WA 1SF5A 2H3XC 5D4JA 2CBPA 2FQGA 3X1GA 1PZAA 3OMAB 1RKRA 2QPDB 4YSTA 3NSYA 4YSOA 1L9RA 2VW4A 1ZIAA 1SHXA 1QLEB 1MZZA 4EF3A 4AX3A 2UXFA 4A66A 1AG0A 1JZGA 5I5IA 1ID2A 3TU6A 2E86A 4KNSA 5B7EA 4YVUA 1SHWA 1W8EA 4A2DA 2GI0A 2BP8A 1NPJA 2FT8A 6PAZA 4BWTA 1QNIA 1OF0A 3FSVA 1RCYA 2B3IA 2IDSA 5EHFA 1BXUA 1OCRB 2PP9A 1AIZA 4GYBA 4MFHA 4N4YB 2FWLB 2BO0A 4F7KA 4A68A 4ZK8A 2B08A 1GYCA 2BHFA 1DZ0A 3PXLA 4PCYA 1HAWA 2VN3A 5IY5B 3CDZA 2XUWA 3PLYA 4M4RB 4NAJA 5FC9A 3SBQA 3NP4A 3FU7B 3FQ1A 2J55A 1JZJA
chains in the Genus database with same CATH superfamily
2P7TA 2LTQC 2PCPA 4I18A 2Y1YA 1LK2A 1XIWA 4EXKA 2QSCH 4I4WB 1XHHA 3QEQB 3WFCL 3FB6B 3NCCB 3VG0L 3TASA 1VFAA 3VVVA 4J2QA 2ITEA 4TVPD 5KUKA 1ZT1B 4WSKA 3ESMA 3B9DA 2APBA 3A67H 4G7VL 1DJZA 4PRNA 4TNVK 2J5LC 5KOVC 3FH5A 3MRIA 5I76A 3IMWA 1YEKL 2WLZA 3C8DA 2XIBA 2ZOKA 1OGTB 3DX3A 4E9XA 4WI4A 3FU6A 5C0GA 4BKSC 3H2QA 2A4CA 2K9FB 2ZYIA 2VH5H 4JFUA 1OGPA 4PM1A 2NCMA 3QUYA 2Q86B 4QWWC 5CJOH 2OXGA 5IB5A 1M4KA 4KJQC 4Z18A 2C3GA 3EDKA 2DI7A 2X2UA 1RLWA 3FONA 4GP5B 3VG9B 2VRQA 1S7TA 3CSPA 3IBOA 1SXZA 1GGIL 2K78A 5CLTA 5C07B 2OKMA 1B4TA 3KBFA 3PCYA 4OQTH 1UWEL 1NIFA 4BH8A 2DRUA 5D4HA 1RI8A 1G7JA 4LCCB 1AKJB 4TTGA 3UYOD 1HNYA 1P6AB 2OCCB 1NBVL 1DBJH 3MFFB 1HFUA 3L7FB 4YL4A 4R7XA 5IVNA 3WFDH 4L8DB 2NY3D 4UF7C 5IROD 1RHHB 2QZ5A 1MFAH 5EN3A 2BY0A 3HI1B 1EZLA 1J8HD 1SN2A 1HSBA 2DEWX 3V5HA 4BYHA 1CFNA 3ZZSA 1M6OB 1FH5L 3SODB 3HNSH 2EDBA 2WXPA 1OALA 1NMBL 1NDGB 3L4YA 4U1HA 1NAMB 3ROOB 1FA4A 1LM8V 3HG1B 4FHBD 2G9HB 2ZAHA 4JFDE 3TBSB 4F7EA 5B1AB 4DVBA 4U7MA 1JBJA 1BAFH 3PQYE 4C59B 2JQAA 1R5IA 5F9JB 3C75A 3ULUF 4RA3A 2NW2B 4N6RA 3B8SA 4PHXA 4QTIH 1RZPA 3MA7B 3PWPE 2WIMA 4KRPB 2X40A 4O5LH 1L9NA 4JO3L 3RWHB 5D4IA 1YEJL 1JMXA 5LGYA 3I50H 1EZSA 3VXNA 2BRRL 3CCHB 4N5ED 2I32A 4YWGH 4Z0XB 1PCSA 4HG4K 3O3DB 2CO3A 4NN5B 5AKSA 4IRZL 5L6YH 3CPUA 1OP9A 3MV7D 3HZYA 1J5DA 1MHEA 2VXVL 2Y5EA 4PJXA 5C09D 3FUMA 2IBZY 4NGHL 3FFDB 1ZVNA 2MH4A 3QZMA 5I5RA 2G75B 1UUSA 4W4OC 1UCTA 1VADB 5GS2D 2G9KA 3GRWH 2GBUA 4GOSA 1U3YA 3CU1A 3ZTCC 3U0TA 3DOHA 4ATTA 2DOCA 4JJOA 3NH7H 1NC4A 4M43L 3NQKA 5EOTA 1N64H 1CE6B 3L48A 5JW4M 2OMWA 1P69B 5J13B 3O6LH 3OAYK 2BZ7A 3L3OC 4KMLB 1YEFL 1ZLDA 2L4OA 1Z9LA 4OCSH 5CR8A 1A7PH 3LVEA 2R23A 3DSNA 12E8L 3VRIA 2ZXQA 3RNKB 5GXBB 3QG7H 2IFGA 3BP4A 4HC1H 1WZ1L 3MV9A 2FWOB 5JHAA 3KCWA 4PJHF 2F18A 5HDOA 4J4PA 4Y8AA 3JV5A 2H1PL 4P2OD 5CEXB 1RZIB 2C3VB 4UUJA 3L2MA 4P4RA 4MJ6B 3KLHC 4Y9EA 3EHBC 3DV4A 3UBHA 1IM9A 1ACYH 4OFYD 1J12A 2BXZA 2DWYA 3VXOB 1ZDQA 1JGDB 1YEEH 4NOFA 1AQHA 3Q1SH 3HMWH 4E0RB 1JRHI 3J07A 1R33A 3SQBA 2FYYB 5C9JA 1DDHA 5C0BD 5C8JA 2IMMA 1NUGA 2IH3A 2GUYA 3MRLA 4ZPVB 5KVEL 2BS8A 2X53A 4C57C 1JVOA 3HZVB 3STZA 2EE0A 3CPLB 1CXLA 4S1SL 5CKGA 4M1GL 5FFGA 3B5GA 4ADGA 5I6MA 1X5MA 5DK3A 3ZSTA 3NIGB 4FA7B 5CN2A 4X6DE 3CZSA 3O0RH 1IUZA 2AJXH 5CIPA 2EDOA 2VT0A 3FBKA 4V33A 5FW7A 2Z4QB 4OZGE 3RVXD 4N87A 4QYOB 3DO7B 4UNIA 1NIDA 1E4XL 5MI0B 4L18A 3S5LB 5B21A 2Q9OA 1YVLA 4Q6IB 1UXMA 5TFSL 1NCIA 4XI5D 3U83A 2DYRB 5CS7A 5L2JA 3JTSA 4XXCC 2RAMA 3SCMC 1DQDH 4FTVB 1E8WA 3U1SH 4YSEA 1EA9C 3NSCA 1R6VA 3CMOL 3O4LE 4QRRA 1MWAB 1T22B 4YK4C 1S5HB 3UZQA 2LLLA 3RUGA 3C2AL 4NKMB 2Q6WB 1RFDL 2FJFB 1TDQA 2G4EA 3BP6B 1H3PH 5L7XL 5HGBA 5IB2B 1P9MA 3QRBA 3B6SB 4WHCA 3SZKC 5CZVH 4JDVB 2NZ1A 4ELMB 3A21A 2VC2B 3V55A 5A2FA 2QELA 5HYIA 3AITA 8CGTA 3SDAA 1XF3B 1GS8A 4EBQH 1Q94A 4YXKL 2V5RA 3OL2A 2YGPA 3GSVA 3QJHA 5LCVL 2H45A 2P3YA 4JFEA 3SOTA 3CFMA 1NMCC 2X42A 4NN7B 3V95A 1GJIA 3K8KA 4G6ML 5IGXH 3QORB 1KB9J 1GHFL 4QXUL 1JL8A 4R97C 3KPLB 2QPSA 3QUZD 4JE4B 1TCMA 3MBEC 2WUCL 4K23H 4WY7H 4FXKB 1B0RA 1Q1JH 2Q8AH 5CR1A 5KYWB 1PKQE 1T20A 5HPOA 4MWFA 2AXGA 4WLCA 4NRYB 5BRZA 4DKEL 5G5DB 2LU3A 3B5HA 4PRAA 1J1XH 2EEAA 1PFOA 2V9TA 4J3XA 2FWSA 3DHUA 4OVUA 5KSVB 3FTXA 2D03H 3RWJB 3TL5A 1U91A 2ZUUA 3GI8H 4CA4A 3MXWL 3EYVA 5DCCA 3GM8A 2VDLB 2DMHA 2B1HH 1GGTA 4P2CG 1L7TH 2RB8A 4MXQC 3UDWA 4D9RD 5IK3B 1HI6A 1TQBB 4POUB 3RP1A 5I8OL 4Z3TA 4HS6B 3E6FA 2E7CA 3GF8A 4K3JH 4LSPH 2Y69B 4JDZB 1KYUA 4DO5A 2WLLB 1VCAA 4S0SD 5C0CB 4U1NB 3PWUB 3OXSB 1LMKA 3BKMH 3OAWA 2WXIA 4N2NA 2BP0B 3RWEB 2DDQH 4FF9A 1QQDA 3SYAA 5IHHA 5ITFA 1MRFL 2IOMA 5CJXA 4EUPB 2DW5A 3KWVA 2FAUA 2BSSB 1DVTA 4HCFA 3TJPA 1RPQA 4HEMA 5I17A 2V3EA 2NZ9D 3AGWA 3UJTL 2DBLH 3FRUA 1FQ9C 2G0LA 2PPDA 4NZTH 3AM8A 4AKPA 1DBMH 5B7MA 3U46A 4GQRA 1OIOA 1S9VB 4EN3A 1GGBL 3P3YA 4AYFA 4YLBA 4JRFA 1TYRA 3MRKA 4HWZB 1AO7B 4P5TD 2BP3A 2WLJA 3GYRA 2YR3A 3VSTA 2ZOTA 3PG2A 3WJJC 1FN4B 1HIML 1OCOB 3G04A 1QYGL 3A4DA 4B9JA 1XGQB 3I2CH 5FDWA 1LO2H 5CJ5A 5JXAH 3WJMA 2IADA 3IK2A 5CO1A 3BWSA 2VDOL 4GAGH 2V2XB 3TO4A 1G7LB 2WP3O 1G7QB 5C7XH 4OF8A 3F7KA 5JPNA 3ZUNC 2VQUA 1CGWA 4F9PC 2UY7A 1Q0EA 1L7IH 4GIAA 3HA0A 3VFWB 3B7SA 3GO1H 2H6PB 3QAQA 5LBSH 2CO4A 4Q7DA 5D7IB 4KQ4H 2O4EA 5INDB 5BVJA 1TO4A 3SN6N 2PMZA 1IX2A 4DP6X 3JYCA 1Q9WA 4M61B 4GO6B 1P7BA 2FIKA 5GRJH 3D39E 5HDRA 4PV9B 3V7AE 1PZUB 1I75A 4L3FA 3VXUB 5GZOD 3IEAA 4MMYA 4ZBJA 3ATBA 1FNFA 4BA8A 1BQHA 3PIQB 4A2EA 4AVKA 4WDIA 4HXBH 1YN6A 3TIEB 5F2FA 4OJFH 5CD3B 1F13A 2CNZA 1MPAH 2BHUA 3UEQA 3WKML 1QSFA 2FO4A 2J1ZA 2CJUL 3N1FC 4OKVA 4DK5A 4HOZA 3VDBA 1EAPA 5HDBE 4X9GA 2X4NA 4XNZB 4XMPH 1BQLH 4MJIB 4GUCA 4O2FA 5ALBH 1QPPA 2R2CA 3FU3A 1JGEA 4BE6A 4HPHA 4HDIB 3LKPA 1W16A 1W72L 4G8IB 2HTLC 5MEOB 1U95B 2PWGA 2Y2YA 3EOTH 3WE6B 4QO1B 2DQDH 1HL5A 1JPSH 2FO8A 4Y19A 1J9TA 4QRTA 2NSMA 3NPSB 2E76C 1JK8A 4JCMA 4RETB 4RCAA 1FNGB 4NSKA 5BS0A 4Y9GA 5L8LB 4UINL 3BKYH 2XN1A 4FKHA 2XQ0A 1JFQH 3PAVA 3SKJH 2VZSA 1INQA 3B9KC 1CS6A 2JKJA 2P4AB 1F4WL 3GSUB 3PXHA 4FOMA 4JKMA 4KKLC 1UD6A 4N9GA 2XPGB 3T4YB 5T3ZH 2GABA 3TFKD 5GS0C 4OZIA 1AHWB 5DEGB 2IQAA 5IW6B 3J2PA 5CCKL 2MFNA 4OM1L 5D2NB 3GS4A 3X1GA 5GGRB 4OTXH 3QNYA 3F6LA 4HUUA 2CPCA 3KEHA 3ARDB 2M26A 3EO9H 3S0PA 2NQ3A 4Z7UE 4IKLA 4AX3A 4GI9A 4IJ3C 4TQEL 4FKKA 1D9KC 4KK5C 4EI0A 2DH3A 1EQWA 1YJDC 4YVUA 3A4FA 4KJWC 4M6MH 1IEAA 1RJYA 4DEUA 4I1PA 1EMTH 4OLYH 4F3FA 3U6XA 2FT8A 4BWTA 2FYVA 1KXVA 2WZPD 3ARQA 1E6OH 3L5JA 5DJ2A 4LDLB 4LCIH 4LVNC 4YIQB 4NJ9L 4I1RA 1YY8A 4YDMA 3VXME 3N06B 4CBPA 3ISRA 3N0AA 3D7PA 2WXOA 2Y3AA 4B3VA 3G7TA 1SYVB 3BD5A 1BOGA 1I9RL 1VFUA 3KPQA 5HGDA 5JNYB 3PXLA 1TOXA 4LLVA 4KKAC 1HXYB 4HKXA 4MA8L 1ZPLA 3GJFA 3RPIB 4D9LH 4H8VA 4I3GA 1CTNA 2YMXL 3NP4A 4Y4KC 2I25N 4Z7WB 4WJ5B 1QO3B 4XN2A 2XZZA 1A7RL 3O6FC 5HHPB 3RL2A 3RFZB 3U2IA 1KGYE 4WU5A 4J12A 5DUML 5J56B 2WYHA 1MUJA 5IFHL 2P80D 2CIIB 4TSAL 3T8XB 2HLAA 1FFPB 1TMQA 3FAXA 1GYAA 3C6SB 3X3FH 1DSFL 4JFVA 3VFRA 3JV4A 1CO1A 5HYSA 2QKIB 1ZIBA 4QNPE 1C12B 1OK0A 3AS1A 5CJQH 3AY4A 5TJWK 3CFIC 3EIFA 4FRWA 5IB4A 2ARJB 3V4VL 1T2JA 1JZ2A 2IH1B 2Q3XA 1JFHA 4LLYB 1YC8A 4PJ8A 3PRZA 1XL4A 4U3SA 3OJ2C 4ZUSA 2VABB 4RGNB 3D0AA 2CM6A 2K9UA 4FNSA 4YSUA 4Z7QE 3BE1L 3O2DL 2VAJA 5KJRL 1R75A 5JQHC 2HMID 4PGDB 3PHQA 3CLEL 5DQDL 1MIEH 4RVBA 1NEPA 4IEFA 2H26B 4AH2B 2XWTB 1U30A 4GG6E 5I19H 3TF4A 4WFEE 3EH4B 1G9ML 4QHLB 4ZUUB 1PY4A 3VFOB 1A7NL 4JB9H 1ZK5A 3WENA 4ODVH 4M6NH 2JK5B 3WIFB 1DDTA 3A6BH 2ZXWB 1XIWD 4M62L 4NX0A 4ILDA 4PW4A 4Y5XB 5J9PB 3FNKA 5EIIB 3IE4A 4NZRL 4KUCD 2ZCHL 4I88A 2BFVL 1FFNA 2F74A 2EO7A 4NQEB 5AL0A 3DROB 4LASH 2HJLA 4EOWH 4LSDA 1P4UA 2NLJB 4MMXC 5DWUL 2HRPH 2PCXA 3VRLE 1IAIH 3F7YB 3MODL 3ZSSA 4NT6A 1OAYL 4WV1C 4GKSB 5HVGB 1IFRA 1UJ3B 2FVNA 2EDMA 2XV6B 3DX6B 4HJUA 4MVBD 3U6RA 3WELA 5HVHB 4HUWA 4WWKA 1N59B 3VAEA 3HRPA 5DYOB 1JWSA 2DIJA 1AY1L 2RA1A 3V4PA 2R0KH 5KBPA 3OJDB 4HK0A 4ZX5A 1K2DA 5TE4L 3RZCC 3LKOA 3I3BA 2ZD0A 3VI4B 1PY0A 4OY9A 1SVCP 1AYOA 3CHOA 4OLEA 4TVPE 1VRSA 4WI9A 1EERB 2QQQA 2X9WA 4LP5A 4GI6A 4ZD3H 3IJYA 4JX0A 4N1CA 2JJVA 4PJDE 5KVEE 3GZOA 2LW3A 3HE6D 4CNIA 5SWSB 3AUVA 3REWA 1YQVH 5TQ2L 1CDBA 4WO4C 4H1LB 1TNNA 3IMVA 5B4MC 3C8KA 7CGTA 3FUDA 4Q74A 1LDSA 3HR6A 1R3KB 2H2SD 1BQHG 2PCFA 3US1A 4UZSA 4PIRF 1N6QH 2W80C 5T3ZD 3VXQB 4MDIA 2P42B 1M2VA 4YDJA 2BIHA 2EH8L 3F3HA 2VLRD 3BN9C 4S10A 1NWOA 5AFAA 3F5WB 1E28A 3SGDH 5EU3B 2WXNA 1X5GA 4TYUA 2BERA 1JDDA 1I7UB 2QQLL 3QT2A 4XGZB 4JFXB 4AEHL 3ZYOA 4WTXA 2AEWA 3D2TA 1PMYA 1ZANL 3GSOB 3D33A 4G5AA 1Z1WA 1IKNC 1GZHA 4Z3GA 4M7KL 2NW3A 1J8HE 3VVWA 3JWNE 2X4UA 3LN5B 2VDRB 1HC1A 3M7FB 4PJGA 1F5WA 2CO6A 2ADFH 4HVBA 5IFAL 1JYWA 2Q20A 2IQ9H 3FUEA 3NGBB 2GTWA 3NEEA 3CFQA 2IAAC 3VA6A 2B3RA 4X80L 1UOVA 2CNYA 3FS9A 1SVZA 2W9DL 3O6ML 3ZHNA 4JRLA 4P59H 3V4LA 1XF4A 1W15A 4APQC 3KBEA 2R1WB 3V0EA 4ALAL 1Q9OB 1IBFA 1ROWA 1CVRA 1NFIA 5LBGA 1DBAH 3V0FA 1OARL 1FGNL 1RL1A 1TIUA 2A9NL 4HD5A 1U8NA 1E90A 4U3HA 2JCCF 1L9MA 1FYTD 1JPFB 1MFEH 2PW2B 6TAAA 5IJVB 3ILQC 1F90H 1Q0YL 3FYIB 3QEUB 4WFHE 1NGZA 3DVGB 5EU7E 1XBDA 3TJHD 2AKRB 2OL3A 2ZZUT 43CAB 4KMTL 4F8TA 4E68A 4DEPB 3WYRA 5J0BA 3ARFD 1NDMB 4DTGL 4MQ7A 5AD0B 3QDHA 4PJAF 3MV7E 2BWIA 4M6OH 1N10A 2R4RL 4JVPA 3NESA 3V0DA 4FTDA 4GXUN 4YGAB 4P2RB 3QQNA 3LZNA 1U8QA 3V6ZA 4ZSOB 3I6KA 3EYOB 1E9PB 4N2DA 5B38A 4KO6A 3DI3B 4AUUA 5DUBA 1AE6H 3OKNB 5I5MA 3V0GA 3HZMB 5ENWA 1MAJA 2QR0B 4R0LB 5FGCE 2JCCA 3GHBL 3UZEA 2IV9A 1VHPA 4ZMTA 3L9BA 3DIFB 2ATKA 2FE0A 1N0LB 2OR9H 4K3EH 2H5UA 1G7IA 1TNMA 3B3IB 2R7EB 3QIBA 4L3EA 4JFQB 3EF4A 1BWWA 4XN7A 3UABA 1F3JA 2EXTA 3MLXH 3VD9A 1XEDA 3RWIA 2VYRE 3GINA 1LWHA 4DETA 1IZKA 3ZYIA 3R0NA 3QUGA 3FT0A 4ISVA 4HG4J 1NCCL 3TWCL 3N44B 4IMLA 3A5VA 4ZFGH 1JPTL 1WD8A 2J1YA 4UILH 4YHNA 1KLUB 3HNTH 3T6WA 5DR5L 1T1XA 2H9GA 3VFNB 3AU1A 3P4NA 4TQ8A 2F54A 2ZOLB 4L4VB 5F3BB 4DFIA 2VITA 3KW8A 3F12B 5AVVB 3LJ3A 1JD9A 4HFUH 2LTQB 3TWYA 3L3DA 3WKQA 5DJ0B 3BKJL 4YHKH 2V7NA 4M8QA 3GD1C 5C0BE 2R29A 3F01A 3OG4B 1E65A 3VE0B 4F1ZA 1ASQA 1LQSR 1WTGT 1G6RL 1AGDB 3PPSA 4YEEA 3OMZA 2V33A 4N2GA 5JQ6H 4HKJB 5FWRA 5E2UH 5D4QA 2J5LB 5EUOE 1ZSDB 3MCG1 4F7TA 4GFTB 4PJFA 1KWKA 4KC3B 1KB5A 3DRQB 5HI4C 5EEXA 2MKLC 1WIUA 4KZDH 1OSPL 2XDHA 4OLUL 3DARA 2IFFL 4OD2A 5AB1A 4G7QB 2B1OA 5K1JA 1Q72H 5FO7A 5JUEL 3MRGB 4Y4HD 5KYNA 1FC1A 1NEUA 2CKBB 2EE2A 3FZUC 3GMLB 5EEUA 4XT1C 1UWXH 4FZ8L 1IFHL 4X6CB 1DJYA 4JFED 4WTWA 5HP5A 2DQTL 4O9HL 4JO4H 1D7FA 4ANWA 3IDYC 3AAZA 4BCYA 3GRBA 1I82A 3WEXB 5E1GA 4F7CB 2BNQD 2QPEB 3LXAA 4JKPL 2FEJA 2QVMA 3N55A 1AZNA 4PWIA 1ZHNA 1CG9B 2UWEE 2W9EH 4LVOC 1DVZA 3M8OH 1C08B 2ZOWA 5CWSB 1JZ4A 1A6ZB 2X4SB 4Z8FH 5ACZA 4KTDH 1HH6B 1J0ZA 3KLAB 4JDTH 3B56A 4W9CC 4NHUB 1YN7B 3MOBL 2MNJB 3VB8A 3MNZB 1RMFL 3MLTB 2Y72A 4ABWA 2EEXA 4DCQB 4WW2C 5HYQA 3DMMA 3QXUA 4R4NC 2V9QA 1KFAL 4YHOL 3KM1A 5GRVL 3KAAA 3CHRA 4ODTH 4R90L 2XN9D 3SDXB 3TVMC 1ROCA 4PTTA 3IAPA 5F3BA 1L6PA 4WHDA 4MCMA 2EDXA 5JPMC 4LKXA 1OTUC 4RQQB 3K71B 1A1MA 3LVTA 1OSZB 2NY3C 4DP5X 5JW5B 4L3CB 3ARGA 5FF6B 4AENA 5DJZA 5EU4B 1LNUB 4KK9C 4N9OB 4NIKB 3OX8B 3CVBA 4PREB 2J88H 5JZ7D 3PUUA 1OP4A 5CP7A 1G87A 2VXUL 4F58L 1L3WA 3ZTNH 1Q0XH 3FTGA 5FUZL 4QGTA 3X12A 1E8YA 4F15C 4UT7L 2O61B 1NM9A 5IVZB 5EUKB 1T6VN 4GSXA 1TZIA 2HVJB 1QBBA 5T1KA 3ZZ1A 1LD9B 4WF7A 3G9VA 3RPBA 2CR6A 2DLTA 3GMOA 5GGSY 3QQ3A 3T1FA 5HY9A 1JVLA 5F6HI 3MO1A 3QO0B 2GAZB 3HI5H 4HETA 3MX0A 4HOWA 2I9TB 2BRQA 4GUPB 3WMSA 3V6FB 4JRYB 1CXEA 1AIFB 5I6KA 4W6XB 3LXBA 4PRBB 4UOZA 3HRZC 1FNEB 3ECBA 3NRFA 4AV0A 4IOIA 5EU7C 2XETA 3SJVD 4PJCA 3VWJC 4JUSA 4XPGH 4JQXA 4R9HA 3P77B 2J6EA 3L3OB 2I27N 2OI9B 3B5TA 4HSCX 3Q7JA 4DAGH 1W6LA 1KN4L 2IAND 2ORBH 3IPFA 2DPKA 4IBTA 5E4EC 5IB1A 2QSTA 4Z7OE 1XGUB 1JZ3A 4PRID 2AAVA 5C0IA 4KRMB 2FZ3B 3GZPA 4LARH 4V1DE 2XWBA 1SXBA 2F6AA 4G9DA 1PZAA 1CFTA 2FX9H 1S7RB 4FQLH 4ERSH 4FULA 5D7EA 4IGBD 3MREB 2XTJB 4NQDB 2UZIH 3QNZA 3CN0A 2W5PA 1SHWA 1LLAA 1FV1B 1AHMA 3BJLA 3EJSA 3HNVL 3SGKC 3BZ5A 2BP8A 4JG0L 3TIDA 3D18B 1SMDA 5FW6A 1AGEB 1H5BA 2I07A 4NZUH 3VGDA 3DDFA 4AVHA 1QMUA 2KL6A 4FGMA 3SPVB 1KBGL 3BSZH 4L1SA 3DETD 4WHYH 3A3YB 3ZE0E 4XRCB 3VDAA 1SY6A 1EDQA 4PLKD 1IM3B 4UCFA 3V52H 3O9WB 4JFYA 4JZOA 5T33H 1JUFB 5E6ID 5FYJU 3W81A 5J7CC 3FMGL 3VRJB 4XBMA 2AHIA 2BJMH 3QDME 3H9HB 4EIUA 4RMWA 1TJIL 2ICWA 1XZ0B 4IIQA 3MBWB 3VGFA 1S3RA 2Q76B 2E9BA 1G5GA 3UIZA 2XT1B 4TVSa 2AJYL 4FMKA 5CLWA 1A3QA 1NBVH 3S37L 1HK6A 2CRYA 5DZAA 4EI5A 3DURA 5J1AB 5J57B 3B7TA 2CE6A 4I48B 3KS0H 3K6SB 2Z31A 3A4EA 2A77L 5F6HJ 3FUJA 2ZX6A 2F53D 4XC3H 5HYJA 2C1PB 2WSDA 5TTRA 1YMMD 4NBYB 2WZ5A 4RFOH 4L0YA 3G5WA 1R1CA 3RVXC 1KLGA 3LNIA 4X42A 3THMH 1X5LA 4DPRA 5I1DA 2HVKA 4QXGL 1YYCA 3AT0A 5ICZB 4APXA 3RKDD 1TKWB 2UZXB 1UWXK 1XCQB 4XI5C 5IJBC 2ZUVA 3IFLL 1F58L 5I0XA 1C8PA 3T0BA 3A6OA 4XMVA 3D48R 5J3HD 4QKTA 4Y9BA 5T5NF 5DK2B 1MFDL 5FGBC 3TBWB 3P30H 4MZ3A 3MRDA 5LGJB 1BFTA 1XZWA 4LEBA 1NMCB 1U8JA 4MAYC 1RK1A 3GGWB 3LS5L 3VM5A 5E1AA 4G1EB 3TJEH 2AXFB 3MBEB 4AUJA 5IW1B 7PAZA 2J71A 1N2RA 4LBEB 1NFDE 2ZP8A 3FQWA 1NH6A 1V27A 1KYAA 1Z9SB 4KKCD 5I82A 3FOMB 4R4BA 3I9PA 2UV3A 5TPWH 4A37A 1J5HA 4ZX4A 4E42B 1MCCA 4ZW3A 4M3HA 1AD9B 1WZLA 3KR3L 5C08E 3ZDYF 4ENZA 5CUSL 2B2XL 5DZLA 3SKMA 3UAAA 5GS1C 3QULB 3DTXA 3MOQA 4JFDB 5ELIA 1QPXA 3HJEA 4WUUE 4JY4B 3QUXC 5HPMA 1N7ML 3QDGA 2BVYA 3SE9H 4CC4A 1Z0NA 1QA9A 2FD6L 3PQYB 1HNFA 5HJBA 3T3PE 4Z7NF 5TGBA 3OAUL 2Y07H 5F7UA 4LE8A 5LHDA 4PW9A 3PL6D 1L0XA 2W38A 3GMNA 3LNFA 4GFXA 3P11L 3MLRH 3EAKA 3PWNA 3U82B 1MFBH 3LSOB 4G59C 4CVUA 4JJHA 1ETJA 1U93A 3GSXA 5JQIB 1F1DA 1D5BB 4QHMA 2E7LC 2AQQA 3RIFK 3NAAL 5I0YA 1XAKA 5CP3A 2OTWA 1VPOL 5CU5A 1Z3GH 1WFIA 3FJTA 4N0CC 2DYPD 5I16B 2VLKA 3DX9B 1DE4B 3WNJA 3QXDB 4NNYA 2VERN 3SO5A 4NBXB 2HTKD 4GKZB 1HKLL 4TSBH 1XL6A 5B3JE 1CXIA 2C9QA 4U7KA 1WA1X 5I1AA 4Y16D 1BFVL 1N18A 3SY0B 2IGFL 3D34A 2WJ7A 1NMAL 1FSKC 4OGAC 4YDLB 3VTAA 1KV3A 1JHKH 4KQ3L 5F0PB 3RI5F 1KT2A 1EFXA 2YD8A 2IDFA 2WWKT 1D5IL 1MG3C 5CHNA 5KOMC 4MD0A 4XCEA 5FKAB 1SGKA 5IIEB 4XO3A 3WUWG 1IGJB 5HSFA 2CRMA 1MSPA 4KRLB 3F64A 4AEEA 4P5TC 3D25A 4LFHG 3TBYA 1A7OH 4Y5VA 3S2AA 2PWDA 4FX5A 2HT2C 3DHMA 3FT3A 3NJFA 1LO5B 5I26A 4BBWA 3OKDA 4ZW8A 2ZPKH 2FX8H 5A16B 1BLIA 4EAEA 2WZ6A 4GQQA 3ZQWA 1SMOA 2PPEA 3EFOB 4K94L 1ZT1A 1Q4NX 1R3IL 2WB7A 5CAYB 4JQIA 5HHQB 3RGBA 2ILLA 4QXTB 3IFNH 2VIRB 4ECNA 4LT7A 2EIBA 1FO0B 5L7XH 3AU0A 1OGTA 3BPCB 3ZR6A 1NCNA 5TE7H 2FGZA 3V0HA 2EVIA 4KAQL 4K5LA 1RZJL 5DJ8B 2WQXA 3ULVH 3QI9D 1NGYB 2OMUB 1XR9B 2PN5A 4HZLA 4ZO8A 1IL1B 4X6DB 1FAIL 2Q86A 4FG6D 5HHNB 3NEXA 1KCRL 2RD0A 1D5MB 3JTBA 1F56A 1L0PA 3NIFE 4XMLL 4OZGB 4AK2A 1BA9A 2W65B 4ODBD 2AANA 1HT6A 2Y1VA 1A6UH 3GSQB 4G6MH 4GRWE 4HSQA 1A6VL 1IEBA 1YG9A 4W68A 4XCFH 5ID1B 5JOEA 1WWCA 2HG0A 4PS3A 5C07A 1QBLL 4DGYL 4Z0BL 1MHPL 4LPVA 2DQUL 4DF9A 1NGQH 1YYML 2CRIA 1WZAA 2FTAA 3VXPB 3KPRB 1P4BH 4L8DA 3D0LB 3S8WA 3B9KB 1X9RA 2WAHA 1IGML 1S5IH 3O4LB 4B97A 4OZFB 3B2UD 1RHHA 4GH7B 3HI1A 2OYLA 2VM9A 5IF0B 2ZNXA 4WEEA 3MKKA 4Y2OB 2VLRE 4G42B 2JKXA 1M6OA 4BZ1H 4K7PH 1KBWA 3A22A 3ZIYA 1AANA 4W9KC 3EH1A 3FQNB 4QT5B 5DGRA 2EILB 3ROOA 2PTTB 3ZOAA 3VGGA 3IXAA 3RY5A 3HG1A 3RJOA 5EOQL 2G9HA 5IEHB 3AB0C 5KVGH 2G60H 3WIIH 2GEEA 3RURA 5JDSA 3TFKC 5E00A 2CO7B 2V7HB 3FU5A 1ODUA 1VAHA 1F4HA 3TBVA 4BCXA 1H8LA 3CLWA 1CT8B 4XWGH 2KUTA 1DQKA 4M48H 2ZJSH 5AZ2L 1Z9OA 3VXRD 1FJ1B 1SVBA 2CBMA 2H4EA 3LQZB 1ICTA 4F7MB 2GFBB 4FQPA 4HP5A 5F9JA 5DQ9B 4F33B 1U3ZA 1ZA6B 2NW2A 3NK3A 3D05A 3MA7A 3O4OC 4HIJB 1KIPB 4Y4KB 1EXGA 5KN5B 3RWHA 2J73A 4QTHB 5K9OB 4R7VA 3O6FB 1MREH 3W11D 1XD1A 4Z0XA 3TOPA 4E41A 2XWRA 3S34H 3STLB 3D69B 1ML0A 1IGFL 3O3DA 3WTXA 4GBXD 3GK8L 3RGVB 5B8CC 15C8H 3H9YA 1JWMA 5H37A 3V9CA 4IRJD 5IB3B 3GPSA 2Z0UA 1BDYA 3FFDA 4G83A 4BQ9A 3VW3L 4S0TD 4Q9RH 2YAEA 2BY1A 3LEXB 3WO4C 1HESA 1OGAD 4MHHI 5DZOA 3A0OA 4F5CA 1CE6A 3D2UA 3MV9E 4K15A 5T5NG 4FNQA 1R3HB 1TJGL 1ZK9A 2X1OA 3MCKA 4D0BB 2XX1A 3MLVL 3MRRA 1MHHB 4H2AA 3W37A 4LQFH 3GUTA 3GFUA 2A4ZA 1BMGA 4X2UA 3V4PL 1WGOA 3KHOA 2FWOA 1YRKA 3NCJH 1EO7A 1NGPH 1U58B 3HAEH 4ALAC 6PCYA 2AZUA 5F1IA 3BZEB 1HS6A 2IAMA 1TZ8A 2DJ4A 1IC4L 5CEXA 4AQ1A 4ZXBC 1RZIA 2C3VA 2F54D 4WGWB 3GUFA 5F7HA 4XPAH 2R4SH 2R56L 3SBPA 4ABUA 4FFWD 2AABL 1KELL 3NSJA 4HUMB 1KN2H 3GMRB 1INDL 3QHFH 2Z7ZA 4ZOAA 3RA7H 1BPLB 3FOLB 5IR1B 3PY9A 3IETA 3VXOA 4C4KT 1JGDA 5IP4A 3ATFA 3N85L 4R8WH 5JHBA 4M9OA 4MMXB 4E0RA 4PRPD 4P23D 5AVYB 3GTNA 2X6UA 4FLHA 2ZXDA 1IQWH 3MSPA 3ZVVA 1OD9A 4ZPVA 4XC1L 1WH0A 3QAZB 2IO5A 4QRPB 1BMWA 3CPLA 3MYJB 5CSGA 1QATA 4I18C 3OF6A 1XIWC 5AYTA 2I69A 4HIEB 2VZ1A 4XVUD 4QYOA 3TYFB 3RZCB 4OFQA 4DSYA 4DP0X 5FYLL 1G6VK 1LO3L 3CDFA 1A8JH 3ULVD 3D39B 2X2JA 3S5LA 5KSBF 2ENSA 4RA0C 4QRRE 1E5AA 4OD3L 3NZ8A 1EXUB 3RUGE 4MKTA 3V5DB 4FTVA 2FSDA 3GBLA 3PGDA 5IMKA 3HN5A 3OB0H 3ARBB 3QUYC 4JM2D 4J27A 1T22A 1KIUB 4M6AA 2Q1EA 3C87A 4NKMA 2CRZA 1YY9D 3BP6A 4JJ5B 5L9DH 3T65B 2G3XA 1EGJA 3DLQR 4HCIA 4IU2A 5IB2A 1JXDA 3B6SA 4JFEE 5D55A 5I1CH 2ZG1A 4JDVA 4ELMA 4NQCD 1LO0H 3LDBC 5BO1L 2BZCA 4QDGA 1XF3A 2XIIA 5GGRY 1CF8L 5B1JC 3PJNA 1BQRA 2ADYA 3FQTB 2ADGB 3DX8B 3CHSA 2CA3A 2YD0A 4B60A 4ZQKB 2A83B 1DTUA 3QORA 5T5FA 1FZOB 3O2WH 4LEOA 3KPLA 2DQJL 1AVAA 2OL3L 4FXKA 2H2SC 2A9ML 3PJSA 1BAGA 4PH8A 2CBPA 4NRYA 3K6NA 4RNRB 1FVDB 3QIUB 4OCNC 3K74B 5GHWH 2VW4A 1SHXA 2XN9E 4JHZA 2W91A 4FNPA 2A6JA 2MCPH 5KSVA 3CZGA 3RWJA 3HN8A 3MVSA 1RU9H 1FCCA 4L1BA 5E8OB 4PWHA 3DX7B 4X8CA 4DO4A 1QNIA 1YEGH 4N90D 4BFEA 4QRSB 5MENB 1M1XA 3V4VH 3BD3A 4MFHA 3S48A 3BDBA 3RFRA 3SDCD 1LP9A 3H42H 5IWLA 1P5UA 1HCFX 3VXMB 3BP7B 4S1RH 2PO6B 5DSCB 5L4JA 4HS6A 5HHME 3FU0A 5CJBA 4ZDHB 1K6QL 4JPQA 4M4RB 4HEME 1EHNA 4N8VA 1I1FA 5C0CA 1FNLA 4HH9B 3PWUA 3ZHDA 2HLEB 5F9WC 2BP0A 2GI7A 2AQ3A 2VXQA 1WFMA 4O2EB 4EUPA 2ZWLT 3SDYL 3IJEB 2FHBA 2BSSA 3NA4A 4OCXL 5D1QD 1E27A 4EDWL 5KZCD 1HJBC 1M3JA 1WD9A 5FAAA 2MOGA 5D7IF 2B4CL 3ASNB 1MJ7L 2XWJA 1U8OA 1NTDA 1TQUA 3LZQA 4G1MB 2OMTB 2VXTH 4OB5L 2ZCHH 2J8UA 2HJKB 2DQIL 1AO7A 2R29L 4HWZA 5EG6C 1FZMB 3B9AA 2OMZB 1FN4A 2X2IA 3GDCA 3WBDA 3KBHE 2BH0A 1O7DE 3EJYC 3M17B 3L5HA 1XGQA 2PPCA 1MOEA 3APCA 4J4PC 5ADPL 2O5YH 1KB5L 2V2XA 1G7LA 4PJ5D 2EIJB 2XXFA 2ZP0T 1Y0LB 3L4ZA 3TESA 5HVWA 3KDMA 2PF6A 4Y5YB 1MAML 1J86A 3JWOH 1V7ML 2H6PA 2FX7L 4ODXB 3QZWG 4L37A 4HBCL 4L05A 3KJ6L 5C6TH 4FG0A 4IW4C 3WSQH 4A2MA 4F8PA 2BNUB 5LGHL 4HMCA 1R0AL 5ICYB 4YE4H 4NUJB 3Q06A 4KROB 2W88A 3BKCL 3TYGH 2R8SL 1KFGA 4L8SB 4PV9A 4UNVA 5JIIA 1UM6L 3TGXA 2YQBA 2CM5A 2JKNA 2GCYB 4AUYA 3R4RA 1S7QB 2IWGA 3EDEA 1DBBL 4A7UA 3PIQA 1C5BL 4HJEA 1ACCA 4Q2ZB 3TIEA 5I6OA 5CD3A 1FIEA 2XQYK 3CK0H 1YAZA 1IC7H 2VN6A 3FU9A 3BH9B 4CU8A 3G5XB 1NLBH 3E8UL 3F58H 2APFA 1RSYA 2C26A 3S36X 4HDIA 2D2OA 4P2QD 3ARUA 3ARTA 3K4AA 4G8IA 2VUKA 4AJYV 5MEOA 1U95A 2CR3A 2VTFA 2AP2A 1T7YA 3UG5A 3UG4A 4A04A 3FN9A 3FUIA 4QO1A 5IT2H 2XVBA 4G7RB 1NUDA 5EO0B 4OZIE 1FNGA 4OGYH 3FTWA 3V0IA 1U4EA 1SJHB 2RR3A 1F4YH 4FXLA 2HH0L 1KIQA 1P9MC 4QAMB 4PJDB 1ITBB 4S1DC 3RHWF 4JHVA 3QR0A 4FXTA 3T4YA 2XPGA 3CFUA 1HQRB 4GEJA 1D6EA 2AFNA 4L9LC 1AHWA 1AZZC 3P4OB 3S5LG 4UT6H 4BJLA 3MLZH 5IW6A 3MV8D 4HCRA 4X4YA 5D2NA 3SDAC 1UB6B 4AI7A 4CSPA 2ADIB 3P2TA 1EBAA 3BGMB 3ARDA 1DEEA 2DM3A 2QLYA 3A6CL 3KG5A 1IBYA 4S1QH 4YBQC 4JFFD 1M9SA 1WIOA 3QPXL 1QBAA 3MNDA 4WW2B 3FYEB 3HMXA 1KTDB 5L4FA 2MOVA 3N43B 1JYVA 5FHAH 3DYPA 1FGNH 3S97C 1P7QD 1CYGA 3APDA 3FRPB 2P49B 3QDGD 4WJG3 4YIQA 1LWJA 3SYQA 5JPMB 1OWRM 4YX2L 4FQ2H 2NY3B 1Q0YH 3H3PH 1SYVA 1VB9A 2D7NA 3ZKXC 4DGIH 4RZCB 1QBMH 3ALWA 4Z7VA 5IOKA 5E8EB 4ONFH 4FMVA 5JNYA 3DBXB 2CCVA 3OKEB 1HXYA 1FLTX 4WKZB 4JVWA 1J8HB 5DTFA 1IV8A 4KMTH 3RPIA 2J6EL 3B4NA 4UZGA 1MFVA 3KPMB 4WNQB 5DC2A 3HZKB 4Z7WA 2H2PD 4TXVB 4WJ5A 3ZE1B 3P1VA 1U2HA 4YJZL 4F15B 2OW6A 3QPKA 2NUTB 4MNQD 1Q9KA 1WIPA 5HHPA 4TN9A 5H35B 3UDWC 2Q7NA 3RFZA 1NANH 1TJXA 4HKBA 2N56A 1FZJB 1NDTA 2AI0L 4B50A 1N5YH 1G4MA 2CIIA 5AZEL 5MHSD 5C0FB 3D4ZA 1FFPA 2VLKD 3FB5B 4P07A 4OCLC 3C6SA 5I30L 5C3IA 2Y06L 5F7KC 4ANUA 3BIKB 4TRPL 4KKPA 2QKIA 1C12A 2CCWA 4E9YA 3GHBH 1GOGA 2ARJA 1UB5B 4ZS7L 2IH1A 4PLJD 2D73A 4NENB 4FQJH 3S3CB 2XHNA 1PX4A 5CJXC 2JI1A 3HRZB 2VABA 2VL4A 3KPOB 5DI8B 2CDFB 1NCAL 3QWQB 1MNUH 4PGDA 1IAOB 2Y5TB 3GXNA 3WIHA 3VWJB 3AM8C 2LQRA 4ZOEA 1NJ9B 3K2IA 4HZ1A 1KCWA 2YC1B 1OEZW 4Z7AA 1SY6L 4EN3C 1AQ8A 1DQJA 4HS8L 4AH2A 1UD2A 2H26A 1B3IA 1X5JA 2L8AA 2XWTA 1JDAA 2VR4A 3MV7B 3TWCH 3GXPA 5ICUA 5C09B 1WWWX 3Q9PA 4QHLA 4WGKA 1N12A 3ME0B 3VFOA 4DZ8A 5A2KH 2YRBA 5DR5H 3OZKA 2E7DA 4G43B 3DNKA 4JHWH 3WIFA 3BRDA 1B0WA 4W6YB 1IGCL 1CBVL 4AW7A 2Q7AA 1A5FL 5J9PA 3VI4F 1I4FB 5EIIA 2WOYA 4EUPG 5B22A 3CFKB 3TO4C 2R2BA 3P9LB 4X5RA 5FGCB 1G6RH 1PZBA 3AQDA 3DROA 3FTYA 1O7DC 3H54A 3MGOA 5JPNC 2NLJA 3V7MA 3E9UA 5IM7B 3S96B 3TEXA 1EVTC 1X44A 4F37F 2GB2A 2YAMA 1OXYA 3RY6A 5KW9H 1E4WL 1ED3B 3MZGB 1UJ3A 3DX6A 3MLWL 2EIMB 3JTTB 1BX2A 4R5XA 1SQ2N 5CGBA 1IT9H 4ELKB 2JSFA 1E5BA 5DYOA 5I15L 4P2OB 5DJCB 5GGQH 2B0SH 3NJMA 3AGVA 3OJDA 4FFVD 4XH2B 4F2MA 3U4KA 4B9IA 3IMTA 4OCWL 2C1OA 4A6YH 4HLZG 5IEKA 3SE4A 5DFAA 3CDGB 1G94A 3OKMB 1C1EH 1T4KB 1I8LA 2F19L 5CILL 1A6PA 5C0BB 1JD7A 2VDOB 4FN0A 5B39B 5AWNL 4CMHC 3EYSL 4LDOB 1MCNA 1RP9A 2XPZA 1E6JL 2OM5A 2P8MB 3DPBB 2EC9U 2ICCA 4PLKC 2EABA 3ILPB 4YZFE 1MCDA 3T3MB 5I1JL 5I1GL 4BZ2H 1XXDC 2E9GA 1Z9MA 3ZGIA 1UD8A 1N4XL 1PY9A 1R3KA 1NBZB 4LPWA 3SKNB 3C5JA 3BAWA 4H0GA 1GPOL 3VXQA 5FYJH 5FYLE 1BMZA 1V05A 1QFUL 3EJJX 3QZNA 5TDOB 2R2EA 3CVDA 4LOUD 1R17A 3BCDA 2IXQB 1UC6A 1IGTA 5FK9B 2V4LA 5KVDE 2EVJA 2CDGB 2X6MA 4K94C 1MCQA 4RAHA 1TU2B 2UY6A 5EU3A 3ULUH 4YE0A 4PJGE 1COBA 1R46A 2QPUA 4JFXA 3U7YL 4HOMA 2WXJA 4ODHH 3LHPH 4HT1L 5AYUH 3IJSB 1YLBB 2UWEB 4GKLA 5FUZH 4K8RL 1DO6A 4YDZA 3BD4A 2YD1A 4I1NB 3ZE2E 4OD1L 4XX5A 3L2NA 1AXTL 1IC5L 2IEPA 1DANT 1QHQA 4H25B 3WFEH 2IALA 3HPJB 3K1KC 3W56A 1KXVC 3Q6GH 1JI2A 1UXWB 3NDYE 3N50A 1TT6A 1T7VA 2KZKA 4NZFA 5FGSA 1RULH 4K0OA 4YXLH 2O5XH 2EEBA 3WEBA 4N8CH 4HPOH 4HEPA 1QUPA 2PP8A 2YZ1A 2R1WA 1RJLB 3O11A 3NBNA 5C9KA 3HFMH 3QUZB 1DHKA 3VXRE 4AIXA 2Z34A 1N19A 1S7SB 3D2UD 1YECH 5AVUB 5LN4A 4U1MB 1QW8A 5IJVA 3QEUA 4KKCC 3DVGA 2OJZL 3VFSB 1IGIH 4J3BA 3R8BB 1DFBH 2AKRA 5TDPB 1YEHH 4LIQL 3S4SB 1DCLA 2MQCA 1B2WL 2BY3A 1KN4H 4XNQB 4YFEA 3PNRB 3KVQA 3B83A 4ODUA 1NDMA 2F8OA 4Y89A 3AT8A 3AY4C 1W0VA 3N9GH 1BQKA 4B5EA 2IAMD 5F1NB 3U0WL 3OGOE 2KH2B 3S7GA 4G82A 3GXUB 4P2RA 2ZUQC 4ZSOA 1Z3RA 1S9WB 3EYOA 1JNHB 1KNOA 4ODWA 3ECWA 2X4OB 3OKNA 1BVLB 1M7DA 1PG7X 2QR0A 1HINH 4R0LA 4PJ7A 4HWNA 4JQIL 3L1OL 4IOFD 2V5MA 3HNVH 1DQMH 2N3JA 3DIFA 4M93C 3HS9A 1N0LA 4CRPA 1E4XI 4XP6H 1AP2B 3B3IA 2R7EA 3MRFB 4JFQA 1KBGH 2CHNA 2FSEB 3HUJF 4OF7A 5I0DA 1X5IA 1WEJH 2OCFD 2NZIA 1Z9PA 2F54E 3VD7A 3VYPA 5EA0H 2BMKB 4UIMA 2X41A 1W6WA 2D7TL 4Z7OB 3QRGL 1HXKA 2C4FU 4WUKH 5E8DL 2H3XC 3MZTA 4V1DB 4P5TB 1H6UA 1KLUA 1IVLA 4HMDA 4P9HH 1HWHB 3VFNA 1TZOA 2Z93B 4B6ZA 2ZOLA 2XZAL 4L4VA 3MJ9H 4U1SB 1NUNB 3Q2WA 4H88H 3F12A 1ZIAA 3S37H 5E8NB 1ZHKA 2AQNA 5CZXD 5DJ0A 4M7LT 2XBTA 1OLLA 1CL7H 1UYWH 1XVSA 2WMPB 4PJFE 3VE0A 4WWKC 2GI0A 3H85A 1AGDA 5F72S 2XA8L 5C86A 5ES4B 1I1AA 1OF0A 2NNCA 3GBNH 4HKJA 1KPVB 2WTPA 4RMTA 5EIIG 3BMWA 4NLAA 3FTUA 2BO0A 5SWZD 4F7KA 4D94A 4UWQB 3GS0A 4NFBA 1EDYA 4Y2LA 4R83A 5DS8B 4PCYA 4HJGB 4L9DA 1LK3L 3VGHA 3ULVE 3MRGA 4RGOH 3GMLA 3FU7B 4X6CA 2J55A 1HHHA 3EYQD 3OC8A 1SBSH 1MFDH 4FNRA 4XX1G 1ZXQA 2OS7A 2WLMA 3D4GA 3SDXF 4BQ6A 2OULB 3V79C 3K6IA 4KO9A 2H3KA 2MMXA 4EEEA 2ODIA 4FCAA 5FYJD 3WEXA 3WLWC 3EGSB 4LEXL 3L08A 5ABDE 4MQXC 1BD2D 1C5CH 2RGSA 4DKAA 3GI9H 2Y2WA 1JYXA 1A2YB 1M7UA 4GIOA 4QUOA 5AW2B 1ND0A 3KE0A 1PDKB 3MRBA 3QO1B 1WBXB 4PSPA 4YH6A 1AJ7L 3QZOA 1C08A 2YPVA 3ULUD 2Q8BH 3QI9C 2X4SA 1WA2X 4RGMC 4YS4A 3IBEA 2YGNA 5FO9B 4UV4H 1HH6A 3KLAA 1YDPA 4P49A 1DJIA 4MDJA 3KGUA 1YN7A 2XKSA 5GRVK 1GMIA 3O2VH 3B2DC 1MW1A 5C0ND 3MLTA 4BGLA 3UCQA 3F62A 3GNML 3Q6FA 4K5MA 4DCQA 1VGKB 4JS7A 2H3NA 3OQRA 5LO7A 4ZODA 1KYDA 4FLOA 3BPNC 3SDXA 2DQGH 2ZKMX 4BXSV 4LZKA 4H1LG 1SJXA 1RP8A 1TR7A 1GZHC 4KXZI 5CM1A 3SE3A 3QEHA 4RQQA 2JLPA 5ALCH 7TAAA 2VQ4A 3U7WL 3K71A 2EUVA 2NY2D 5JW5A 1HDMB 4AYID 2Y24A 5KVGE 1KEML 1OPGL 4PYGA 1LNUA 3B2UC 5EU4A 5L4MA 4JDEB 3OX8A 2D3VA 4PREA 1UWYA 1FI8C 4H8UA 1NCBH 3CZNA 1KIRA 1MCWM 4L5FL 2NY5L 1W9XA 2O61A 3O4OB 5IVZA 4R6UA 5EUKA 3UTOA 1UENA 3B2VH 4N90E 5DLML 3TPUB 1BVZA 1MG2C 2F0CA 2P5EA 3CXDL 5KSAA 1HU8A 3KJ4C 2AAAA 1LD9A 3RPKA 1A4KB 4EIZC 2NXZD 1ZE3C 4HQQL 4YHPB 4GP4B 5DXWA 4GLRH 5E4AA 5AOLA 2YPLA 4U0RC 3QO0A 2GAZA 4YXHL 4YNYA 4PJCE 4XMUA 2NY7H 1ET5A 4AIEA 4NZDA 1BIHA 4JRYA 3V6FA 1AIFA 2P28B 4MB4A 1U8IA 2DJUA 1BZ8A 4PRBA 2E9JA 2CHXA 3WXVL 4GUQA 1DZBA 1FNEA 2FBOJ 3FB7B 3K2UL 1NUFA 2DN7A 2HFGL 3ILDA 5FCSH 2IOOA 1NOFA 5KS9E 3GTTA 4UTBH 1R34A 5DMYA 3WIAA 1AGCB 1H8SA 1JV5B 1ZVYA 3P77A 3QEGH 3CN1A 1K3ZA 5JO5B 4CSTA 4F24A 5JHMA 1GAFL 5D1QE 3WDHA 1J5OH 2ZX5A 3L3OA 4LAQL 5JIDA 1JGVL 3WO3B 32C2B 1OZUA 1G9HA 4XXWA 3AG2B 4FI8A 3UZEC 2AITA 1ZGLB 1GJWA 1B4LA 3TH2T 5F88B 1XGUA 5K33A 3LHAA 3INOA 3KXFD 3BI9X 2ZP9A 3AG4B 4M8UA 1DJGA 3CBJB 4HIQA 2VL5B 5DUJA 1KJVB 3QIBC 2DY2A 3MROB 1S7RA 5TDNB 3KYKL 4UQ2A 2F5BL 5LNGA 3MJ7B 4NQDA 4WFGD 1GJUA 1NBYA 4O2CB 4M5TA 1MWAL 1FIGL 4PJ5E 3KLLA 2A9CA 4J8RB 1JPEA 4N0RA 2V2TA 3KL0A 3JUZA 3UCRA 3BAEH 3D18A 3P40A 4XHJD 5M94B 1AGEA 2XJLA 2FWUA 1EGJL 1PU0A 2Y25A 3SPVA 5FHBH 3ZDZE 2B4CC 1EO5A 3F6IA 4FYQA 3SHSA 2G5BB 2FT6A 5F21B 2CJTA 3H6JA 4BHUI 1PSKL 5DEFB 1CFVL 4I18B 1LK2B 1XIWB 3O9WA 3UEZA 1BQ5A 2A3TA 3WNIA 2V3DA 3T0VA 1CU4L 1JUFA 3IT8D 3ZQXA 3S88L 1CK0L 2AK1L 5FFLA 1VFAB 3VRJA 2WCPA 2VZUA 4UOW0 3TT1H 1TETH 3H9HA 1UZ6E 1TTFA 1JCVA 5T5FL 1XZ0A 4PRNB 3MBWA 3S3DB 1AACA 2Q76A 3O3BA 1IQDA 3WNKA 5HYJE 4FNUA 2FGWH 3VD2A 4YHMH 5FV2A 1F3DH 4XXCA 5IOPB 3OZLA 4ZO7A 2OTUB 4P5MB 2D3NA 5J1AA 1JGLH 1HOCB 4I48A 5D70L 3KEDA 2GC4C 3LZLA 3N1QC 1ASPA 2QGDA 5C0AD 1QACA 3T0WA 4H7VA 3W9EA 2OXGB 1A14H 4P2QE 1FNHA 1BAWA 4XVUC 5KYXB 4HLJA 4PR5A 1S7TB 4LSVL 5ICZA 3D87B 4H8WH 3REVB 1MCOL 1TKWA 1JYNA 2VSCA 1CGXA 2VDLL 1Z32X 4OZHE 4JCWA 3G6DH 3NIFB 3ORJA 4YDKL 4BH8B 1G1OA 3VFPB 1MHCB 1G7JB 1NLDH 4LO9A 1G9NH 1GXEA 4MA3B 1FE8L 5DJAA 1TPXC 4BK5A 3BFWA 4GRWB 3I3DA 4O58H 5J12B 3CG8A 3TBWA 3L9EA 5LGJA 1ZT4B 4NNPH 4HJJL 3HE6B 3S36H 2CLRB 1G7PA 2DZEA 3DBSA 3BDXA 5HI5C 2E6QA 2ZUTA 2YUXA 1ZS2A 3MUHL 5EOCL 4GNKB 2PABA 2AXFA 3DMMC 3MBEA 3CXHK 4HIPA 3L3GB 5F96L 2VXQL 5I74C 5IW1A 1KV7A 4C8XA 4LBEA 1Z5HA 2RMNA 1EEUA 4R26H 5K5YA 1Z9SA 5KAQF 4PJBB 1VFBB 2VZ3A 1UCBL 3FOMA 2VLRB 4KK8D 3DRTA 1BGXH 1J5IA 5FIEA 2X1XR 3ARGC 2GK0B 4YR6B 4DVBB 9PCYA 1AD9A 3QDGE 2WP3T 3CSGA 3ZPDA 3BESR 2AJSL 4FFYA 3B2XA 5B7FA 1A3RL 3LH8A 2ZE0A 5EWIL 4JFDA 3PREA 4JY4A 3NZSA 5EC1A 5I0VA 3UPCA 1L4IA 1CD1B 4XN5A 1MJJA 2AEPH 3GBMH 1BREA 3W2DL 1FUNA 3AWGA 3DDGA 1F8TL 3MLVH 4OCRL 1RZFH 2N7BA 4B9PA 4MNQE 3IE9A 1MCSA 3D3VD 2E27L 5F71A 2DI8A 1REIA 2X1PA 2C7UB 5MHSE 1TTGA 1JZDC 2VLKE 5F9WB 1B9KA 3HC0B 5E2VL 5IBUB 5J6SA 4AM0Q 2XQBL 5AAPA 5LKNA 5DT1H 1P1ZB 1OE1A 1D5BA 1K9TA 2DQHL 3F00A 3TN0A 2PCYA 3N5AA 2X87A 4PBXA 3BZ4B 3TS8A 3L3IB 3N41B 5I16A 3DX9A 1KELH 4WRLA 1VEPA 1AC0A 3T0EA 4ORZC 3QXDA 3SBWA 5CBAB 5I8KH 4KI1A 3PV7A 1FYTB 4JQXC 1SOSA 5KBNC 1NAKH 1XH2A 1KTLA 4GKZA 4I5BB 4GW1A 2CLZB 4HIIB 4JKWA 5JW4R 1KJ2H 2WO4A 2R23B 3D52A 5HI3D 3VRIB 4LIQE 1E3ZA 1ZTXH 5EORH 3SY0A 3BP4B 4XC1H 3FQRB 2VDKL 3ARFB 5BMFH 2WJ5A 1W2KT 1AQMA 1XF2B 2WKLA 3G5VB 4LLQA 1AZUA 4UUJB 5IIEA 4PJ9D 3WFZA 2BXYA 4W9EC 3DV4B 3LH2H 3RIAK 3VFGL 4X6DF 3T2NH 2RHEA 5B1BB 4WGVB 4W9HC 2DWEB 1ZGLM 5DD6A 2WXFA 4NDMB 2YRZA 4CN4A 5BRQA 2DF3A 1LO5A 5I66B 3K2MC 2AXHA 1H5BC 2LAGB 5A16A 3ECQA 5C9JB 1DDHB 1EPFA 5C8JB 3DTDA 2IH3B 2I9LA 5GJTH 1BWMA 3EFOA 4LLAA 5FM5O 1JN6A 25C8H 1AXSB 4W1TA 5HHQA 5CNHA 3PYCA 4HCRL 2VIRA 1YNTF 4KTYA 5DZVA 5GRWA 4Z76B 5IBTH 1FO0A 4GSDL 2NUPA 5ANHA 5D1ZD 2O1AA 3KYOB 5T1MB 4N2LA 4X0NA 4URKA 1X4YA 3BVDB 4IIQC 5DJ8A 3VD3A 1NGYA 1XR9A 3HMXL 3R06B 1IL1A 3Q2VA 5C07E 2OZNA 5HHNA 2BHZA 4EI5C 1OAUL 3JTSB 3L16A 5L2JB 4OZGA 2ADJB 5E5UB 2AS5M 1HE7A 3VFVA 1UOWA 2BVPB 2MRYA 2ARWA 3GSQA 2ZCLL 5ILTL 3GJFK 3KGTA 2Z31C 3BRGC 1FGVL 4B9KC 1D5XA 3ZL4L 1BXAA 4DWHA 1FLRL 3RUGB 2ZG3A 3HI6H 3RX5A 1SXCA 2WNGA 1QFWH 3V9EA 3MLYH 3VXPA 3KPRA 3MNVB 4ODSL 5BRPA 4K9EH 2NQDA 3D0LA 5TQ0L 1FL5B 3V8CA 3CVIL 4L9LB 1E4JA 4QEGA 4Y1AD 3UBFA 3PHAA 3CXFA 2AVFA 5I8EA 1Q94B 4Y2OA 3MRMA 3IDXL 4DESA 2WTOA 3QJHB 5DURD 2A9AA 2BSED 3NACL 4JFEB 3KLKA 2JB5L 4QT5A 3VGEA 2H0EA 5L0QC 2QSQA 4RWHA 2PTTA 4Q9BA 1TYJA 3ZR5A 3FQYA 5LUMA 1B0RB 3NJXA 4FJZA 4Q89A 2AXGB 2I7OA 1EAOA 2K0RA 5IHUL 4FZEH 1URIA 3AT9A 4MHHG 1K6QH 3PAUA 4N2CA 3IMRA 2XWDA 3U4BH 3WIHL 3ZKXB 1FJ1A 3LQZA 4F7MA 4CC1A 4FABL 1T66C 4F33A 5DQ9A 4E41E 3VB9A 4BRVA 1ZA6A 3I3EA 1VFMA 4PRHD 1UZ8A 2QPDB 1FBIL 4UV7H 1L9RA 1KIPA 4Y4KA 3SDYH 5CCJA 3WTUA 2VB5A 5AL8A 1OB1B 3B3BA 3ZKND 2FBJL 1EHXA 4QRQB 4GMSL 5K9OA 1MW2A 2XN9B 4YLCA 3MPCA 3ZQ9A 3STLA 3VD1A 5FX3A 3RGVA 1KTRL 1C5DB 1D6VH 3SGEI 3WKYA 2LE9A 5IB3A 4KFZC 1HSAB 4F5CE 5DLLA 3PV6B 5GGTH 2P45B 4FNTA 4P2YA 3LEXA 5D9SB 5CD5D 1CLYL 4YFDB 3G6JE 4OJEH 5ADPH 5BVPL 4D0BA 1R3HA 1NCTA 3EGDB 2Z0BA 4XBGA 4UMGA 1XCXA 5D8JL 2P24A 2B5IB 4AL8H 3I75A 1FP5A 5D72L 1IKFH 1DBKL 2J57A 4AYFB 1E9QA 4LRNH 3MRKB 4PFEA 4EZMA 1H9DA 2AXWA 3BZEA 1L3NA 3T6ZA 5DZNA 2KLRA 3JZYA 3HW7A 3ARRA 2DQFB 3QJQB 3G04B 3K3QA 3C09C 5KAQG 2VJXA 3HS0B 5CJ8A 1A4BA 2DM2A 5AW0B 1TYEB 2O30A 2PYFB 3WJMB 2IADB 3WXWL 3BUIA 3SJVB 5I71C 5AKTA 3FOLA 3HE7D 3NJLA 1CI3M 4R5VA 1F1AA 5IR1A 4JFSA 4YMPA 2CAKA 5JLZB 5JPNB 3UAJD 1D7BA 3T8MA 1R3LA 1RIHL 2GBAA 2CMRL 3KL5A 1T1ZB 2BVQB 2WWMD 3E2HC 4NWTH 4PSRA 5BVJB 2XICA 1PG7H 5DMGC 4QRPA 4FL4B 4S11A 3R1GH 2XV3A 3APNA 3MYJA 4KVCH 5HDBF 2FIKB 1JF1A 3B9EA 3G08A 4TLSA 4XMXA 1UZGA 4PGCB 3EFDL 3UROR 4QPEA 4Z77A 4MMYB 4X6EA 4HIEA 2QV4A 2EO1A 4I0KA 1LE9B 4M7JL 3UZVB 4LNRB 2JTDA 1SYSA 1CLZL 3D39A 3IU3B 4D8PA 1U8PB 4XBEH 3A24A 2JQMA 4XNUL 1EXUA 5GS3A 1AQKL 4V2BA 4OKVB 4Z1PA 3UTTA 4KY1L 4DPAX 4OV6F 3V5DA 5LN8A 2IJ0C 2VDRL 5T3XD 4IDJL 4O2FB 1MI5D 1S4IA 3ARBA 1QSED 2PUQT 4CMHB 3W38A 2HKFL 1H8OA 4ELME 7FABL 3LKPB 4UAOC 3T0DA 4JJ5A 1IAIM 4ZTOH 1OZTG 1WA0X 2MHAB 1XGRB 2V5TA 3G6AA 3SIKA 4QRTB 2VXSL 5E6IB 3UIYA 4A7QA 5I24A 4Z7UF 1F2QA 1MLCB 2WWKO 3FTVA 5AAWA 5FYJE 4YC2B 3TNNB 1KY6A 2IWKA 2WXLA 2YOCA 4P5KA 2WVVB 3FQTA 3DUHA 4PI0A 3DX8A 2KKQA 1BFOA 1ADQL 1FHGA 2DYSB 2QJDA 1VZIA 4TM9A 1L9OA 4LRIA 3ULUE 4HWBH 2F53B 3BYTA 1VF5C 4HUUB 5E1HB 2DWTA 3NRPA 1YMMB 2Y6SD 4HF5L 4MNGE 3QYNA 4UQAA 3FT2B 3PDOB 4F93B 2WYIA 4RNRA 1FVDA 3QIUA 2CK0H 2JIXA 4F3FB 1OQOA 5KSAD 1BQSA 3FQ4A 1I9JH 4X7CC 5DJ2B 1LP9E 1MF2L 3P4MA 1G1KA 2YPLD 5BOJA 4DN4L 3DX7A 4OZFG 1KCUH 1WQVT 3VI3E 5AB2A 5MENA 3KPQB 1BOGB 3VTTA 2WHVA 4C56A 3FQUA 4ZS7H 4TF4A 5CEZH 3L17A 5EZLB 1RZKL 2GBTA 2GJZB 1AS8A 2HJFB 1QLFA 3PP3H 4JO8A 4QNPF 2EDFA 1NCGA 5F7WC 4KRPC 3MN8A 3OM3B 5C0CE 3VXMA 5HBBA 2PO6A 5DSCA 1JHTA 2A4EA 1KCVH 2TRHA 4RX4A 4PUBH 4ZDHA 3DOIA 3NSFA 1WLHA 4M4RA 1EZUA 3LPFA 4WU5B 4KGJA 1BF8A 3HKZA 2OMYB 1OM9A 1S2EA 4HH9A 4J3OC 4Z7QF 5HDQL 3VYNA 4H8QA 2MIZA 2APSA 2IDCA 4HSAC 3INUL 4HGMA 3NYKA 3JV4B 3VFRB 5DJXA 2HX9A 4NN6B 4MAUL 4O2EA 2D7PA 4OJDH 1GYVA 4AOFA 3IJEA 2CSPA 5HYSB 4OIIL 4JFZH 2J8UE 4GW4A 4KHXH 4GG6F 3BMVA 5J89A 4WI8A 3B7YA 3ZMNA 2PPFA 4XN4A 2LHAA 2FUQA 2FB4H 3HC3H 3SD5A 3H1ZA 1ILUA 4G1MA 3TZVD 4X7SL 2OMTA 3CFBB 4WI5A 4PAZA 5FUCE 3X1FA 3G5YA 1AGBB 1FZMA 1XQ4A 1NICA 1P7HL 4CDGC 2OMZA 4DGVH 3O8XA 2NY5C 4LSTH 4TUKH 4ZUWB 4I3SL 3M17A 4G7YL 4PWKA 4M93B 3OKYA 5DRZB 2WAQA 3C2SA 4AG4L 2A73B 1V3MA 2IAMC 4U2YA 3V10A 4Z6AT 2DMCA 3ZO9A 4FYRA 1LYQA 1SF3A 1WHOA 4AQ1C 5DJYB 1Y0LA 1P4IL 5DFWH 5BQ7B 4Y5YA 5I1EH 4PG9A 4AGQA 1D7CA 1ZV2A 2CKBL 2DYPB 4RBPK 5HHXL 5HJ3B 4QJ5B 3PGFL 4JAMA 1CE1L 2BNUA 1SLUA 1SUHA 2W95A 5GRXG 3VGAB 4AK1A 1INEH 2JQZA 5ICYA 4ZQTA 2HJLB 2GY7B 4KVNL 4OM0H 2VLJD 4WFGE 1JMZA 4L8SA 4HUVB 4G6AC 1N8OE 2MPAH 2J8OA 3ZTJG 2FECL 4NQVB 4Y16B 5AW7B 4BK4A 4ORGA 1AH1A 5JHDD 2AC0A 1FH2A 4X7FC 5GZNA 3AVEA 1MWOA 5T3XL 5LWYH 5DVMA 2YPVL 4Q2ZA 1S7UA 2LFEA 2JJSA 4NUGL 2E0PA 3DUUA 3QISA 1JWSB 1JWUA 2WINB 1H8NA 1BW8A 4NP4L 2WANA 2NR6A 4DQOH 1A3LL 4LLDB 3LIZL 5CGMA 3LKRB 1E50A 4X7DC 2A74A 3Q48A 1K2DB 4HK0B 5JIPA 1JRHH 4KX7A 1CR9H 3BH9A 4UANA 1M2OA 3G5XA 5J6GB 5MI0C 5F8RC 1I1CA 1B4JH 4CW1A 1L9TA 5B3NA 2BNRD 1RSFA 2KC0A 5KBKA 4YZWA 2AJUL 3UO1H 1FFTB 5H2BA 4IKNA 3LNDA 3ZRSA 1S9XB 1MQKL 4MGXA 3VA2C 4WW2F 2HUHA 1UVQB 1SHSA 2F1BA 2D8KA 1NIAA 3T4AB 3N43F 3KWTA 1EUTA 5J06A 5EO0A 5L88L 1TVHB 4N0YH 1DJSA 3O81A 4U33A 1DLFL 1F11A 2JH2A 2ISDA 5CN3A 5TF1L 1SJHA 2EEDA 5D2NE 5G4NA 1UURA 4K8RH 3D6GA 1U9KA 4PJDA 3O6KH 4U6VH 2PCFB 2PWFA 3QIWD 4N8UA 1HQRA 2R0ZH 3BP5A 3P4OA 5KYUB 3V7AG 1M2VB 1OHZA 3BVNB 3QI9B 1IAKB 1UB6A 1JG9A 3C9NB 3F8UB 4M7LL 4PEEA 3D4YA 1X9QA 5I9QB 2EUWA 3CDZB 2QADD 1E28B 3QORC 1WBZB 2ZT9C 3GSRB 2HRHA 4WW2A 3FF8A 4TV3A 4XN1A 1IC0A 1KTDA 1YEDB 5BV7H 1OL0A 3BPNB 3BXNB 2ZSVB 4Z7VE 4FXKC 3H8NA 1UH2A 5IW3A 3P02A 3TV3L 1U6AL 5DFVC 3BPOC 2ENYA 5JPMA 1KCSL 1RZ8A 1WGVA 1ECZA 3MXVH 5A3ID 4PJGB 4XWOC 4Z7WE 5INCB 3TBBA 1KOAA 4OFDA 3BDYL 5IROA 1K4DB 5E8EA 2VDNH 1LGVA 4AXWB 5CEZD 3OKEA 3CJJA 4GLRI 3QUMH 4WKZA 3VCLA 1ITCA 1J8HA 4BKLB 2IH8A 3KPMA 2ZX9A 4LL1A 4WNQA 3ZE2B 3HZKA 2YKLH 5HD8C 5HHOA 2D0FA 4FA6A 4ONGL 4CJ0A 3TN0D 4M5ZH 4QY8B 4XAWL 5IWLC 1FZJA 4D9QE 1P5UC 1QR1A 1PLBA 5CZKA 5LAPA 4BQCA 4G71B 3FB5A 5C0FA 4G8FB 1RUPL 3KJ4B 1GCFA 3T0ED 2KYIA 4DW2H 3BIKA 1WAEA 4F2EA 4JY5L 4RGNE 5DUPL 2P9RA 4KZEH 3GHPA 3GLEA 2NYYD 4YQXL 1UB5A 4XP1H 4ZMAT 1NEZB 2OZ4A 3IGFA 4YHZL 3VXRB 2GTQA 4H8HA 4NENA 4Y4FD 4XZ4A 2E56A 3MRNB 3HRZA 4NXSA 1BEYH 3VXTB 3KPOA 4L8BB 2E9WA 2VLLB 2CDFA 4MYWB 1ZJAA 1WAAE 4IS6A 4Q58C 1IAOA 4FS0A 2HT4D 3U30C 1NJ9A 4HIHB 4ZTPL 3U79A 2TSAA 1CTMA 2YC1A 4FE9A 5D71L 3W57A 3I6KB 3C12A 2VZOA 1J9RA 4JN2B 4GBXB 3U4EA 5FLUA 3D9AH 1HZKA 1QP1A 2AV7A 5DUBB 1HJCA 4IRJB 5C09A 3ME0A 5ENWB 4U1IA 9CGTA 5KYYB 1FORH 4D8OA 3SPCA 3NEOA 4B9ZA 5E24E 2ATKB 3JWDL 3M6DA 1I4FA 3F04A 5FUCC 1OGAB 1T21A 1UACH 4BUGA 4L4TD 3K4DA 4AEIL 2R1YB 3P9LA 3LKQA 2B59B 4M8RA 1F3JB 2CHWA 5I6XC 5FDYA 2VJ8A 1J0KA 2X1WL 1O7VA 3S96A 4IKKA 2X12A 1SN5A 5ESAB 3ZUCA 4N2AA 2DD8H 3K2KA 3QNFA 3T0AA 4NFDA 3MACL 1HNGA 4F2ME 3JTTA 5DDHB 4WTZA 3D5OF 5EUOF 1LK3H 1NAMH 1RHFA 2G3ZA 3BVUA 1T1XB 3U2JA 3SQOL 2FRGP 1WO2A 4P2OA 4ELKA 3P4NB 2F54B 3TX4A 4FFTA 4RMQA 5JXED 1UKTA 4WW1B 3HB3D 1KB9K 1QWUA 3L3DB 4FQXD 3ATDA 1T0PB 2ZCKL 2V7NB 4M8QB 1KTBA 1NQBA 4MA7L 4GT7A 2A1WH 4OFYA 4R7LA 4BE5A 4W9GC 4OBRA 4HWEH 2P46B 4JQVA 2GBVA 3MUUA 1XTLA 3CDGA 1UEYA 3OKMA 1JZGA 3WN5B 1T4KA 4OKDA 4PRPB 4GXVL 1VGEL 4P23B 3HS8A 1W8EA 4XNZC 3SYPA 2AJ3A 2P5PA 4PJFB 2H32H 1XT5A 2UWEF 4JKKA 2P8MA 3DPBA 1KJ3H 3EBIA 3PP4H 2RFXB 5ADOH 1UA7A 4WSGA 4A68A 1UD4A 3GNMH 3D08A 3LEYH 4ZAKD 2BHFA 3GXIA 1DVFD 1NBZA 2J8HA 5IHZB 2GJ6A 3SKNA 3D50A 2K4AA 4M1CD 3OZ9L 3UL4A 4WK2B 1RVFL 5TDOA 4FFYL 4GSQA 3CX5J 4J8QA 4U4BA 2IXQA 1MW0A 1AAJA 4Q8BA 1J9QA 1ZJBA 5K9KA 5ACMA 2CDGA 1EEYB 1AHWC 1JNNH 1W0WB 3GT6A 1TU2A 1TPXB 3H7BB 1YNKH 4BFNA 3CZLA 5D2NC 1CYXA 4RDQF 1CZ8L 3T2QA 4JM2B 3ARDC 1TQVA 3WJLA 3I6GB 1K8IB 4RESB 4OQTA 3IJSA 2UWEA 5F7FA 1THCA 1WRFA 4N2IA 1GVIA 2V17L 3K6DA 4CVXB 4F57L 4QLWA 3BWUC 5GRUL 2DWDB 4H25A 5I74B 5JR1H 3HPJA 1QRND 4NM8H 1NCHA 2CXKA 2EIZB 3AXLB 2FL5B 1R4XA 3KPNB 4R4FL 4YBLC 2BDNL 4AGLA 2UXVA 2QEJA 3QDJA 5DJZB 2VE6B 5DVPA 1BIIB 1N0XH 2JKWA 4DT2A 2ZKHH 2OK0H 3WXVH 1RJLA 5KVFL 2CQVA 4RISH 4HPYH 4P46D 3QUZA 1PQZB 1F3DJ 1WFTA 3FTGB 2KI6A 1ZA3B 4DP4X 4I2XE 1S7SA 4HXAL 4M9PA 3T77A 5K9JL 4U1MA 3SPHA 5FECB 3RFZC 4TMPA 3MMEA 4XPHH 3VFSA 4MKMA 5F6IB 4KK8C 3ZKSD 1E67A 4C54A 4FAAB 3S4SA 3FRPG 4P2RE 4TULL 4UQDA 4L29B 1I9EA 3GMOB 2EVFA 3QQ3B 4UOQA 2QKIC 3T1FB 2OTPA 3MO1B 2J20A 1N6VA 1BECA 3QWRD 3HG3A 5PAZA 1TFHA 5LXGH 3I6LD 3JWNG 1JGUL 4KNTA 2YD2A 2NY6C 4PJ7E 5CBEB 1E43A 1XF5B 2WQAA 4XXDB 1S9WA 3SDCB 4RGNC 4Z7OF 1JNHA 3AQXA 4ZMWA 3CLFL 1TTUA 2X4OA 1BVLA 5FLVA 3KVDD 5EZOH 1Y07A 3W1ZA 3GLZA 1FDLL 3GRWA 5DHDA 3ZLQC 1X9LA 5KS9B 1AKJD 4HJSA 5JW3L 1FO0L 2G3MA 3UBXB 2X70B 3FDWA 4J3UA 2FSEA 2R83A 4A38A 4TSCL 1WZMA 3Q8FA 4XMZA 1OAQL 5CU9A 3O3EB 5D1QB 2VC2H 5KZCB 2P8PA 4PLNC 4H0LC 2EKSB 1SDDB 1GGCL 1QI4A 4L4VE 2BMKA 3ZE0F 1EEZB 4X7EC 2JXMB 4HC1A 4MB5A 5DS2A 1E8XA 2Z8WC 4OLWH 3RDTD 5C2UB 2OAAA 1NOAA 3QNZB 4G3YL 5A2AA 3LNEA 5LQBH 2Z93A 3RAJL 4U1SA 1MCHA 1DUZA 3RY6C 5DD3H 4O51B 5E8NA 1UJ3C 4DVRL 2I07B 5HVHC 2WMPA 4BFIA 3P69A 4XOEA 2W94A 3AXIA 3IB4A 4PJ5B 4Z23A 1OTTD 1I7RB 3QCUH 5J11B 4PS4H 4J3TA 1KPVA 1RZ7L 4J7RA 2PYED 4AQAA 1CXFA 3TFBA 3NG5A 4MLIA 2ZIDA 3QHZL 1WVZA 4X6CE 3ZDZB 1QTSA 3LB6C 4FFZH 1MCOH 5F0JB 3SE4C 3SE6A 4WI0B 2DQEL 1EEQA 3EBAA 4QIRA 4POZC 3X1EA 4DP9X 2XRAL 4HJGA 4IIQB 1YJDL 4I77H 4JM4H 1QLEH 3CFJB 5I6LA 1JGIA 1OM3H 4DNLA 3FU7A 3FPXA 5GZOA 1VACB 3DURB 4LL4A 3UJIL 3DWTA 2Y36H 4HJJH 5F7NC 5T3XE 2WUBH 3EGSA 1MI5E 2W60B 2JKSA 1TCRA 3I9GL 2H8PB 4YN3A 1KEGL 2WKOF 1XBRA 3FXIC 5AQ0A 2YHGA 1KLGB 2APTA 4M5YL 4XNAA 3QO1A 1WBXA 4UNUA 5DD0L 4ETQB 1BZ9B 4BQ8A 5FYKL 4GMTL 4ZFZB 2W0LA 2JIXD