4DPBX

The 1.00 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 8.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
b'IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin A, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dpbX00
4HHWA 3ZDWA 1IC0A 1L9SA 1JXGA 4YVNA 1SFHA 2PLTA 3V9CA 2HRGA 3PAUA 3OMIB 1AZUA 4UANA 1IBYA 2BHFA 3AZUA 1N68A 1OOWA 1NINA 5I6NA 1NPNA 2B3IA 3ABGA 3CDZB 1WA2X 2J5WA 4AKPA 2ZXWB 5AZUA 2ZWNA 2WO3B 3H56A 1JVLA 3OQRA 4GP4B 2QDVA 1OCZB 1JXDA 3OMAB 2P80D 4YSPA 2BP8A 3ASNB 2LLNA 1ASOA 5D4IA 1AS8A 2PPDA 1AS7A 4HZ1A 2FT7A 1PY0A 2JFCA 4X4KA 3S3BB 4K9JA 3FQYA 4GP5B 2VN3A 4A2FA 4WTQA 4DP6X 1L9QA 1OE3A 2VSKB 3FU9A 1NICA 2FNWA 2UXVA 2DV6A 3FSZA 1KYAA 3SBQA 2TSAA 1IKOP 4BDVA 3C75A 1CYXA 5F7AA 5IY5B 2HX8A 2GC7C 1HFUA 3NSYA 2GSMB 2I85A 2PPFA 2X88A 3X1BA 2FJSA 1ADWA 1R1CA 1ZDQA 4DP7X 1A4CA 4ZK8A 3NJFA 2GC4C 2VW6A 2GBAA 2XX0A 1ASQA 1AZBA 3FS9A 3NT0A 4DPCX 1AIZA 1NIBA 1NDTA 1RKRA 2DYSB 2UXGA 1TEFA 2DY2A 3NSCA 4AZUA 1URIA 3UAAA 5I5IA 1RZPA 5I6OA 4F2FA 3G5WA 1BYOA 1NIAA 3IBOA 1XB3A 1JVOA 3DKHA 3S3CB 3NSFA 1JERA 1NZRA 2BP0B 2EINB 1OV8A 3CG8A 3OM3B 2H47C 1NWOA 4E9TA 1OCOB 3PXLA 3FYEB 3ZBMA 3AG4B 1V55B 2BWIA 1HAWA 2OV0A 2YAMA 2XV3A 4A2HA 2XX1A 3IEAA 3OD3A 4DP2X 1NWPA 3IE9A 3NJMA 3QJRB 4KO6A 2VMJA 2FQDA 3FQ1A 9PCYA 2IDSA 2OCCB 3TBBA 1PZBA 4E9SA 1GS8A 5I5MA 4HCIA 1FA4A 1PF3A 4M4RB 4AI7A 3ABLB 3QJUB 3TA4D 2I7OA 2I7SA 3PCYA 1CYWA 1KDIA 3UGEA 4F7KA 2WO2B 3NP4A 2CAKA 5B1BB 2CALA 4HIPA 3FU7B 4KO9A 1X9UA 1PLBA 5F7BA 3CVCA 3MBWB 3CZUB 2J56A 3NJJA 1AOZA 1BAWA 1BYPA 1GSKA 1NPJA 3GDCA 2IDQA 1ID2A 4GXFA 4NAJA 4NB7A 4BWUA 2CUAA 3ZX1A 1EZLA 5I28A 2VW4A 2XV2A 4KO7A 1WS8A 3S8FB 1EHKB 1IUZA 4DP9X 4W1TA 2QDWA 4DP0X 2AANA 3WNIA 1E65A 2XUWA 3EH5B 3NP3A 2VM4A 1ZDSA 1AANA 5B1JA 2IWKA 1WA1X 4G7RB 8PAZA 2HX9A 2IH8A 2UX7A 4BXVA 1AG6A 1QNIA 3EF4A 1X9RA 2YAQA 3GXUB 1GS7A 1ILUA 2PPAA 2AFNA 2R7EB 1OCRB 4HALA 2YARA 1AS6A 2FTAA 3RYMA 1OE1A 4KOCA 2GIMA 3ABKB 4A68A 3QJTB 2UXTA 3NJHA 1KBVA 2H3XC 2X87A 5A7EA 1SDDB 1PNDA 2AZAA 1PAZA 5I5JA 3TU6A 4WKXA 1CC3A 1A3ZA 1RCYA 5TK2A 5I6MA 3OMNB 4E9YA 1ZIBA 4CSZA 1B3IA 4NERA 1OF0A 3AG3B 1AZRA 3DTUB 3ERXA 2PPCA 2RACA 3CVDA 5PCYA 3X1NA 2W88A 1KCWA 1GW0A 1J9TA 1BEXA 1TEGA 2EIMB 2FQFA 4GY4A 3T9WA 1PZCA 2CJ3A 1L9OA 2YAHA 1L9RA 7PAZA 7PCYA 3SQRA 2IWFA 3KW8A 5D4HA 4HAKA 1UATA 3EH4B 4E9XA 2IAAC 2FT8A 4GYBA 1PCSA 1JZEA 4JHUA 1M9WA 1GS6X 1MG3C 3AW5A 5I6PA 3T71A 1J9SA 3N55A 1SHXA 3UAEA 2DWTA 1TU2A 4YSDA 5B1KA 1JZHA 2FWLB 3KW7A 2IH9A 3NJNA 1V10A 1PZAA 3FT0A 2HX7A 4YSOA 4YSTA 4AX3A 1XMEB 4G71B 4G7QB 2CBPA 2PP7A 2XV0A 1ASPA 1NIDA 2H5UA 3BQVA 4E9QA 5E9NA 4BDVB 1WA0X 1CUOA 4QLWA 4KNUA 1E5ZA 2IDTA 3NSDA 4YVUA 3T6XA 4YSCA 5TK4A 1A4AA 1ET8A 3NJLA 3PAZA 2VSMB 1IBZA 3WNJA 3WKQA 4E9VA 1JZJA 1SHWA 4A2EA 1BQRA 1N70A 1E67A 1KGYE 4JKNA 2CCWA 1PMYA 2EIKB 3QJVB 3FU8A 2DYRB 3EHBB 2YAPA 3QQXA 2YXVA 4KOBA 4N4YB 2IDUA 3IN2A 1NTDA 2FQEA 4M3HA 2YAOA 5AKRA 1KBWA 1E30A 1W8EA 1VLXA 1F56A 1GR7A 1GY1A 1W6WA 3BVDB 3JT2A 4GP8B 3U25A 1XB6A 1J5CA 3L45A 1MZZA 1ZIAA 5D4JA 3X1EA 2W8CA 2N0MA 3FSWA 2YAEA 3EH3B 5PAZA 4DP8X 3CDZA 3FYIB 1A8ZA 1BXVA 3H4FA 1MG2C 3FPXA 2XLLA 4FA7B 1JXFA 4UF7C 3N2JA 5I26A 4YSEA 4DP1X 2GI0A 2QPDB 2J55A 4KNTA 3WG7B 4KO5A 1GY2A 3HB3B 1MZYA 3WI9A 5AFAA 2J57A 2XWZA 1ILSA 2HRHA 4HCFA 2GB2A 3NYKA 1ETJA 5I6LA 2TSBA 1TKWA 5I6KA 4KNSA 1ET5A 5ANHA 1AAJA 1SJMA 2OJ1A 4A67A 3QJSB 1BQKA 2Q9OA 4ENZA 1AZCA 4HCGA 1AR1B 2XYBA 1JZIA 2A3TA 1M57B 4YSQA 3X2QB 1A4BA 1QLEB 1FWXA 4W9ZA 1FFTB 4F2EA 1SFDA 1KDJA 1ET7A 2AZUA 3UACA 2PCYA 1NIEA 3ABMB 2YQBA 4JHVA 4L0PB 3QPKA 1M56B 1DYZA 2EIJB 1WAEA 5FC9A 4BWTA 6PAZA 2WSDA 3HEIB 1OE2A 3T6ZA 2Y1AA 3NJIA 3TBCA 4A2DA 4DPBX 2UX6A 3SBRA 3NJKA 1JZGA 1AACA 2HLEB 1AG0A 1MDAA 2E86A 2BP0A 2NRDA 1BQ5A 1AQ8A 3MX0B 4BWWA 1HAUA 1KV7A 1ZPUA 2BP8B 3PAVA 4G70B 1CURA 2XVBA 3NJGA 3CVBA 4AKOA 2YXWA 3AG1B 2VM3A 6PCYA 4HHGA 1PLAA 3D12B 3S8GB 2MRYA 1JZFA 2HZHA 1I53A 4QKTA 1WS7A 4PAZA 1J5DA 2BZCA 4EF3A 1W6LA 2PCFA 4E9RA 3FQ2A 3SBPA 4BXSV 2BW5A 5B1JC 4YSRA 2XXGA 3AG2B 1L9TA 5EHFA 4AKQA 3FSVA 2QPEB 4YSSA 1NIFA 3FPYA 2B08A 4N8UA 5B3SB 3JTBA 4RH4A 3DIVA 1A65A 4DP4X 1T5KA 5B1AB 1SNRA 3FU7A 2PPEA 3ZIYA 3IN0A 1XB8A 3FSAA 1DZ0A 3V9EA 2YAFA 3H4HA 3T6VA 3ASOB 4P5RA 2BZ7A 1YLBB 4P5SA 3X1GA 4G72B 1RZQA 4YSAA 2HXAA 2P80A 4FAAB 5B7EA 1L9PA 2PP9A 2GHZA 4DPAX 1SF5A 1BXAA 2Y69B 1QHQA 2XXFA 1V54B 3AY2A 2ZONA 2JXMA 2UXFA 1J9QA 2JKWA 4DP5X 2IWEA 3TASA 1KCBA 3S3DB 1PNCA 3UADA 4YL4A 4MFHA 1BXUA 2VW7A 2MTAA 3GYRA 4A2GA 3T6WA 3UABA 4G7SB 1OCCB 2Q5BA 1JOIA 1E5YA 2DWSA 3WIAA 4PCYA 5B7FA 2IDFA 3QJQB 4BK5C 1PLCA 1ZV2A 1J9RA 2XU9A 2R7EA 3PPSA 4YSUA 5LDUA 4TXVB 2AVFA 4Q8BA 2ZOOA 5B7MA 2FQGA 3WKPA 2QT6A 1SDDA 2BO0A 2BW4A 1AZNA 4E9WA 2BWDA 3X1FA 2EILB 1SF3A 2PP8A 1GYCA 4CSPA 3PLYA 2FT6A 4A66A 4UAHA 4Q89A
chains in the Genus database with same CATH superfamily
4RCAA 1WF5A 3HE6A 3IMVA 3WS3B 2RFXB 4HIHA 5HGBB 2ED8A 2H2PD 2FE0A 2XWBB 2DQEH 3C5ZA 2YWYA 3D85D 4JHAL 3T0AA 1KC5H 2OXGA 4L4TE 1TTCA 3UL4A 3ETBF 3LB6D 1C5CL 3ABGA 1JDAA 3ZLQC 1IC4H 3U2JA 3L1OL 4A7QA 3ZTNL 4DKEH 5AAMA 2X6CA 1Q0YL 2RIKA 3PWPB 5IBTH 4BQ8A 3CFBB 1U9KA 4QHKJ 2Z92A 5FUOH 1XT5A 4GUPB 2E8ZA 4LAQL 5FWQA 5BVJB 5K9QG 3CVIL 2COQA 2A2QT 2LLNA 2I26N 4F2MB 3VFMB 3BHBA 1EEYB 2PPDA 3KYOA 3HC3H 2FT7A 4BFNA 2J8UE 1F3DJ 2WGNB 3D39D 3G08A 1GGTA 3DHUA 2MCAA 3S3BB 4N0UA 4E5XB 4ISVA 1RURH 2IQ9L 2R27A 4ONHB 1LILA 3S2AA 3MMEA 4FA8A 1U93B 4WW2B 1MJUL 1U3YA 1KXHA 2AITA 4BA0A 3RVXC 3FH7A 4S1DC 1SM3L 4OZFH 5F7DB 5IESL 4P2OC 2PPFA 3QARA 1WD8A 1ZVYA 3G5XA 5ITFA 2GW5A 5TF1H 3L4WA 3IDIB 2ZX6A 3GBEA 4NNYB 5DMYA 5H35A 5MEQB 1FLRH 1RZ8B 1RLWA 1MFDL 3CFDB 4JRYB 1IARB 1TEFA 1QWUA 3QDGA 4N0YL 3WOVA 3F12A 3M1CA 4K7PL 4L3CB 3F7VB 2G2RB 4JUSA 4HEME 4D2NA 2X5PA 4FLHA 4TNGA 12E8H 1R24A 1R3KA 1J0HA 3BLKA 3MNVB 4QGYA 3AM8A 1ETB1 2QHRL 1BM3H 3UZVA 1R3HB 4QJ4B 2XTLA 2JB6B 1J12A 4AEHL 1G5GA 1I1FA 1HKFA 1U95B 4HKBA 4M7ZC 2BIQA 1A47A 3B3IA 4LL4A 3WGVB 3D18A 1RU9H 3MUHL 3SDDD 3FT2A 1EMTL 4NQCE 2WZPD 1V55B 4PJDB 1CDIA 3C6LA 5EN2B 2WQUA 4M3JA 5A6LA 3DO4A 1KV3A 5F9JA 2HUEA 4PTTB 1PYWA 2QZQA 2QSVA 2I60H 3HI5L 5E9DE 1QR1B 3EH2A 3T77A 3GI8L 4OM1L 4P46A 3L95A 2Q3XA 3TBBA 4JKMA 4Z3EA 3ARGB 1WEJL 1IBDA 4Q0XH 5CEZD 2VC2L 3OZKA 5F7WC 1I9RL 1ZTXL 3DRTA 1IO4C 2C9AA 3Q06A 3QP3A 3KZ8A 4BE5A 5IB3A 2WO2B 4PIBA 4AIZB 4W9EC 5FOJA 3SGEI 3VVWA 2A4CA 2WZAA 2YJLA 3FU3A 4LEEA 2A74A 5E6UB 1I7ZA 3C5SA 3FCBA 4IJTA 1KGWA 3KAAA 4QXGH 1QMUA 1JZ8A 5EUKA 4TNWF 4B3EA 2R69L 5J12C 3UC0H 1BD2D 1NPJA 3UO1H 5TJWK 3WJLA 3S9DB 1G7PA 1QABA 5F6IB 4FYSA 1TO4A 1VADB 3MV7D 2IIJA 4JY4A 4X6DE 4F7MB 5I1EL 5IQLA 5DD3H 5CKGA 1G7LB 3S35L 2QV4A 3ZOAA 4HWNA 4TL4A 3NZSA 1QI4A 2JKRM 5E1AB 1MRDL 5IK3B 1L0PA 1ZA3A 4JS7A 2CDEA 1C16B 3GK8L 5IEKA 2FH6A 2Y7QB 4NO0B 4Z77A 3BX7C 3DROA 1ZDSA 3EFDH 4M93B 4N0CC 5B1JA 4ZUSA 4R97C 3HZYB 5CD3B 4Z3FA 2ZWKA 1Z0NA 3ZL4H 2PKDA 1WZMA 1A9BB 4IJ3C 4AV0A 1A3QA 1YPZF 2HG0A 1K85A 5CHNB 1H8SA 3RB7A 1NH6A 3DVIA 1ILUA 2AC0A 4NWUH 1QFUL 3SKOB 1N67A 4XB7A 4BK4A 3LRHA 1DBJH 5E5MB 1DVFD 1Q72H 4Y4KD 2MNWA 4MMZA 3RWEB 5MHSD 5FB8A 1A6TB 3WE6B 4XP1L 4XXDB 1AZVA 1CC3A 3QCTL 3VG9B 3MV8B 1YEJH 3GZKA 3SD5A 5E4EC 2F6AA 3I2CL 3VFRB 4HDIA 3BPCB 4KZEL 5F0JB 4FQ2L 5FO7B 3GMRB 1F2XK 1YZZA 2B1HH 1PY4A 4LLQA 4E9LA 1SY6A 2KDYA 2KPNA 4N2NA 4PJEF 2YN3A 1FZKB 3GXIA 2XQ0A 1T7VA 2IMMA 2KLTA 4LLVA 2WUCL 4OCYH 4J3SA 3ARYA 3MJ8A 3B9KC 4TULL 3FRPG 2NR6D 1JL8A 5HHMB 1U58A 5EORH 3QAZB 3QEUA 3KCPB 1PZ5A 3FU6A 3UEQA 3OR7A 3QNZB 2D4FA 3OZLA 4K3JH 4E9XA 1RZFH 3U6RB 5FHBL 1A6AB 1KB9K 1OGAE 1EHXA 3MV9E 3NDZE 1A1NA 5J8OA 5I6PA 5LBSA 3O81A 4GJTB 4B0MM 3RFZC 4JZJB 1LYQA 3ES6B 1BZOA 5CNHA 3VO0A 1M7IA 2ESVA 2KZBA 5B1KA 5C09E 2PR9A 4U7KA 5J7CC 3E1ZA 4KK5C 5EU6A 5BS0E 1AD9A 3NJNA 4HSCX 5EZIH 3ARWA 2HX7A 5E2WH 5GGRY 5I6XC 4HU8A 4ZFZB 4MB3A 5C0IA 2ED9A 5JW4N 5DD1L 2XI9A 4E9QA 1VFAB 3QXUA 3N85H 4U0QB 4WTXA 1IVLA 3D33A 1DANU 4J3OG 5E8PA 4YE0A 3B34A 4ZS6C 2VSMB 4QTIL 1IBZA 3QFJE 4X4YA 4AG4H 4IRZL 4QRUB 3PIQA 4M62H 3DV4A 1XH3B 1K6QL 4Y16D 1YMHB 1CQYA 2EH7H 2ZF8A 1UA7A 2DD8L 4MCMA 3PWUB 3L17A 1VGEH 2XWEA 2R39A 2XWTA 4Y2NA 5J11B 2XV6B 2VM9A 4LVHB 4C4BA 2VN7A 4JPKH 3VX0A 4MMXA 4ZNCD 2Y9RT 2F8OA 1IZJA 1XF2B 3RZCD 4Z3JA 4FQ1L 3LY6A 4KJQC 3KXFB 2BCKB 3BH9A 1IGFH 2R29H 2JTDA 2N0MA 3D09A 3FSWA 4LASL 3U1SL 2GITB 4MHHI 5EEYA 1IEHA 2AJZB 3FYIB 3M17B 4DTGH 5I0DA 5JYMA 5KVFH 1MG2C 1F1DA 4ELMB 2I9LB 1UASA 3N2JA 1TG8A 3MLYH 4M03A 3VXUD 1VEMA 5I26A 5IGXH 2GI0A 1WC7A 2V7HB 4O58L 2B1AH 2ZJSH 2RH0A 4LNRB 3EJPA 3ZR6A 5IEHA 4Q9QH 4F24A 3EJQA 4MD4A 2TAAA 1I8IA 5BVPL 4YPGA 1S5HA 1JPGB 3VSQA 2DWEA 4PRPB 1IGIH 4UB0H 3W0WA 5CILL 5HYSB 1KT2B 4NQVA 1A1MA 5KOMC 4AVKA 4ORGB 1GHFH 4WFED 4N6RA 1DVQA 2ADIB 2WZ0A 3IMTA 5ALCH 4MRCA 3RWGA 4NLAA 4EXPX 1X3DA 3GSVB 4ABVA 5C0CD 3UJIH 4FXKB 3L5XH 1G1YA 2B39A 2D31B 1MIEL 1U8QB 2WYIA 4K5PA 4PJAE 3C87A 5ANMA 4HV8B 1HXMA 1OD9A 3CSFA 5C92A 5HDLA 5LGJA 3NMEA 2DRUA 3DSFL 4HUUB 3QQ3A 1NSNH 2EADA 5T5NG 3DPBA 5KSBE 1G5AA 3QFDB 3NJXA 4Q6IB 1H0DB 2KMWA 5JIQA 5EZLA 4AWJC 4UIMA 2VIRA 1B2WH 1NCCH 2KZWA 6PAZA 2TRHA 3BVXA 1HSAA 3SYQA 3TBCA 4JRXB 1FNFA 1I9IL 1SJEA 5C0FB 3TT1L 1JPSH 4UQCA 3UAJD 1X4YA 5E0QA 4BFRA 2C9QA 2X4RB 2X2JA 4WWKA 1D5ZB 5C0AE 4QAMB 4PWGA 3FRPA 2F5BL 4OSUL 1G7QA 4ODVL 3C8HA 4ODBD 4K23H 4PV1C 1N10A 5IREA 3N1PC 4JANA 4MJ6B 3VFSA 4U49A 3QYNA 2YFOA 2ARJQ 4B41A 3RWDB 4PJHB 1NCBL 3LKOB 4QF1B 3C2SA 3GF8A 4PWFA 3MV11 1XDTT 1QA9B 4QKTA 4XE5B 3MOBH 4PR5B 3SBPA 1S9VA 1PGRB 2YBRB 3P9WB 1O6TA 3VXMB 3FUIA 1MIML 2YPLB 3SPGA 4G3YH 5EO0A 1XL6A 3DX1A 4JG1L 2HVJB 2W0KA 3FSVA 4WW2C 1FVDA 3HE7D 2AQSA 4WK2B 5FA4A 3NCWA 4X5LA 4HOXA 1YUHA 2N1KA 4JHAH 3C8DA 1AKPA 2V5SA 2PPEA 1XGTB 3DGDA 5AVSB 2BS8A 5ERWA 1PSKL 1B4JL 3VW3L 4LF3B 1C5CH 2XZAL 4AENA 4LSSL 5FF6B 2D8KA 4UQEA 2YR3A 5F1IA 4OD1L 3L1OH 4NQDA 3VXNB 3ZUCA 4P5SA 1WG3A 3DDGA 3ZTNH 1GAFL 3ZMNA 1H3TA 1Q0YH 2C1OA 2UY6B 4HJJL 5FPIA 3B2XA 2HUHA 2CO3A 4LAQH 1T21A 2P5EB 3CVIH 2P47B 4GKSA 4H20L 1XGPA 2XXFA 4PVLA 2OMZA 3RDTB 1OZUA 1QACA 3RAJH 2NY1D 2YHGA 3LEVL 4ICXA 2EECA 4GAFB 4H8QA 1KMGA 2WK2A 2X38A 4I18A 3UOAB 3FF8A 2ZSVA 1C08B 1PNCA 3FRUB 2UV3A 2IQ9H 2VDLL 4LXFA 2P8MB 1QRNB 3D07A 2IBGA 4KUZL 3QIBA 4ZMNA 1YEFL 4J3TA 1MJUH 2H9GA 2VXVL 1CPUA 4J4PC 2DJMA 5AW4B 1BF8A 3CN2A 4LRNH 3FO2A 1WH0A 4F7PA 5F7UA 5IESH 1G0XA 5D7JD 5DURD 2QFRA 4TVSa 4AW4A 3A3YB 2R2BB 4TSCH 4UT9A 2WD0A 2JTYA 3GINA 4UT7L 1U8KB 3OZ9L 1ZLVK 1UHVA 3Q8CA 5E2TL 3ARGC 1A2YA 1MFDH 4Y19D 1NCDL 1R46A 5IROD 4XMTA 1CICD 4EN3D 2IFFL 4AYSA 1OTUD 1T03L 1JCKA 3TC9A 4N0YH 2FZ3A 2OMUB 5HDQL 1VHPA 2I24N 3V5DA 4K7PH 5T1MB 2X42A 3DHJA 5DYOB 4ZW3A 2V4LA 1O0VA 5IBUB 1QX1A 2Z93A 1UH4A 3DV6B 2AK4A 1FNEB 1O7DE 2NYYD 4I0PB 1WWCA 2QHRH 1FAKT 1SJXA 1LO2H 1WA2X 1E40A 2PF6A 4AEHH 2QGDA 1Q94B 2M8XA 5IQOA 4A2LA 1THCA 4F8TA 1LM8V 2DQFA 3GRGA 5A6IA 3JV6A 4NJ9L 1OHZA 3QPQC 4CMHC 5I8EB 1EMTH 4GP4B 1N3NA 1JNHB 5F6IC 3WGUB 4Z3HA 2CDGA 1MCWW 2BP8A 3ASNB 2AMUA 5E8EA 4ZXBB 2JI1A 1CG9A 2DM4A 3OGCB 1KTDB 2AAAA 2DM7A 4IKKA 2GSIA 3VXQB 5ADOL 4MS8D 4LDCA 3HI5H 5IJVA 4XR8C 3VACA 3LRKA 2RAMA 3JWNE 1PKQB 4OM1H 5D6CA 2WYHA 4JO3L 5JNYA 3OJ2C 4JFEB 2ZUYA 3G6JF 4ATWA 5J5EA 4BV1A 4DP6X 4L3EA 5AKVA 4OZHF 5C0JB 1MXDA 4ZMVA 4M93C 2ZWSA 1WEJH 1ZV9A 5J4MA 2VC2H 4H40A 1ZTXH 5DK0A 5CEXB 2FD6L 2H1LM 3F84A 5JPNA 1JHKH 1U8NA 4WW1A 3BVWA 3AXLB 2HX8A 2K6ZA 3M45A 3TVMA 3VXOB 1OLLA 4N5ED 4WWOA 3W5MA 4GKZA 3WFZA 5IVZA 4FL4B 2ZAGA 5JXEA 5GRYA 2DQMA 1CTMA 4PJFA 3BZFA 3PDOB 3WLWC 5D96C 1HE7A 2DMBA 4DPCX 5F3BB 3WTSA 2R69H 3L2NA 3VG9C 2N4IA 5LAXB 2YZ8A 1XR9A 3NSCA 3I50L 2I32A 3P3RA 4J2QA 3ZHDA 5I1EH 5HHNA 3JWDC 2C7UB 2JJTA 1OQOA 1UADC 1J7VR 3U1QA 5I76B 2CKBH 1BYOA 3C5ZD 2PNDA 2XTSA 3PP4L 3CX5K 1MRDH 3T65A 3QXVA 3VSTA 1CB4A 3EO1B 3IDGA 4U6XB 3K7UA 2JKIS 1JERA 1CVSC 2AV1B 3GK8H 2GCYB 3QAZC 4Y1AD 1FORL 1OV8A 3TCTA 1FO0B 3CZFA 4X6CE 3WIHA 4E9TA 3OB0H 4ES9A 1EA9C 1NCHA 4MA7L 1IAIL 1IGJB 5FM5O 2YAMA 1P6FA 2F7PA 3GJFH 5C0BB 5E6YA 3AS2A 3IWVA 4C59B 3P0YL 1BYNA 4JZJC 4Q2ZB 3OD3A 1Q9LB 1QFUH 4MNGE 4X8JB 1WFIA 3A4DA 4WI7A 1M71A 1BP3B 3S37L 3V4PL 1FZMA 5DA4A 5EU5B 4I1RA 4QRPA 2O61B 4PRHA 4XP1H 4PJ8B 1PY9A 3QCTH 3U0TB 5FYLD 2LOEA 5C0NC 1KDIA 4N2AA 4Z5RA 3I2CH 4KZEH 4FQ2H 3KPRB 5LWYL 3BP6B 3CDYA 1RHHA 3CFUA 5L4IA 1MFMA 3EGDB 1WFUA 3QEHB 1HZHL 3CFKB 3DMMB 4ZO9A 4X2UA 1DP0A 3U4KA 4TULH 5JW4M 2CHDA 2CGZA 1BAWA 3NABL 4IRJB 1LE9B 4B5ZA 5FHBH 4FFWC 3SKNB 1J8HA 2UZXB 4GXFA 2IH3A 4UM9A 3QDGD 4LVHC 4CMMB 4JE0A 3ARTA 3ZT7A 2JXMB 1EHKB 4LESA 4X5XA 4XCCL 1V7ML 4QHKI 2AANA 3VJ6A 2D7QA 2XG4B 4BCXA 4AQ8C 2B0SL 3Q8AA 2R51A 3O6FA 1F11A 1IZKA 4G1EA 4L1DA 1C8PA 3T0BA 2IWKA 1WA1X 3D39E 1E90A 1NUFA 2CUMA 3QWRA 2VDRL 3ZRCC 3MLTA 5DD1H 3Q1SL 4XH2B 2FJGB 2CRZA 1DUZB 1OB1A 2IAMD 4LLDA 1MW2A 3C6LD 4HALA 3ZKMC 2Z8SA 3WY4A 3QIUD 2FTAA 4KOCA 2D9QB 4F37F 4L4VA 3SE9L 1JPTL 1F00I 4V2CB 3TF4A 4IRZH 3A47A 5C3TA 1I1YA 2CH8A 1FG9C 5A7EA 1P0SE 4IKNA 1K6QH 4UQ9A 3TU6A 3WL9B 3EJRA 1ZKAA 1L7TL 4LSPL 3C60B 5A1AA 2YOAA 1N59A 3DSNA 2DD8H 1ZIBA 2YC1B 1WBZB 4IGBB 3QULB 4UQ2B 2EO7A 5ECGA 4X7FC 3WNKA 3BUQA 3X1NA 4FJZA 1CGTA 3LQZB 1JPFA 3J7HA 5I0VA 2DIEA 5ID1A 2WTOA 2FO4B 4FQ1H 4FXKC 3UGXA 2O30A 3QZOA 3HN5A 2VO8A 1BJMA 4LASH 1PZUB 3U1SH 1NBVL 4R96B 4WFGD 4XC3L 3DUHA 4CA4A 3OXRA 4PWEA 4MA3B 4OQTA 5E1HB 4XCYA 2FEEL 3WBDA 2NY2B 4AIOA 3IDYB 4OJFL 2NQ3A 3K2UL 4Q6IC 2Q3AA 4R83A 4O58H 3IWUA 3AREB 2D3NA 1AYRA 4O2FB 4ZW8A 2OFQA 4AGMA 1MNNA 1TJHL 4PJ5A 5HDWA 4XBPB 2EABA 5CSZA 5BVPH 4NDMA 5F44A 4EXKA 4AX3A 3MHZA 4MXQD 1XMEB 1UXMA 1TNNA 3LNEA 4HUVA 1ASPA 5CILH 4I8DA 4ZMTA 4ZPVB 3T0WA 3TNMA 2C9SA 3NSDA 4PGEB 3CXDL 1MAJA 1A4AA 1A7OL 4TVPD 5DJYB 2Y1VA 1TSRA 5DQ9A 2GJRA 2EH8L 3NCXA 1T7YA 4L37B 4UDUB 1MIEH 4J8RB 3S36L 3O3EB 3ETTA 5FYKD 2BIMA 2AERT 1AXSB 1WHPA 3ZHLA 3L5IA 1LP9F 1PMYA 3JV4B 3GGWA 4NS0A 4P04A 4PV8B 3DSFH 5ID0A 1ZT7A 4ZRGA 1BD2E 3FUMA 1EO5A 5C08B 1WTGT 4RX4A 5E6IA 4HXBL 4PWIA 4NBZB 1P7KA 1C5DA 1P7QB 3BZ4A 3MV7E 3S34L 2KL6A 5H4ZA 2EUVA 1WIUA 4I87A 3H9ZA 4L1HA 5EEWA 1I9IH 1FL6B 1WQVT 3TT1H 1E8YA 3HA0A 5K93A 3LRGA 1ZJAA 4N1CA 1Y18A 4RMSA 5HHVL 4FA7B 3D25A 2ZCHL 5ESAB 2F5BH 3VFTA 2NY0D 4OSUH 3OKNB 4P2RA 3O4LA 4ODVH 3D5OF 4HXAL 4GLRH 5I1AA 3MSPA 2P1YA 5KVEL 2DI8A 2VT0A 3RNKA 4JO4L 2ZZUT 2Q2LA 2F54A 3RDTC 1NCBH 4N2DA 2ESVD 1S7SA 4E0RA 4WK0B 1D2PA 4PU2A 5EU6D 2H6PB 3ARFB 1ADQL 4Z8FL 4V1DB 4WI6A 5I17A 3NN8A 4R5XA 5DFWH 5I6KA 2W60A 1MIMH 3ILQD 4TSAL 5ISZA 1SJMA 4JG1H 2VZ3A 1HI6B 3RLSA 2NNCA 1H5BC 1NC2B 1D9KC 5B1CA 1DUYA 3J07A 4U1JA 4WEEA 1KJMB 2XYBA 3AROA 3PDDA 5B8CB 1MVYA 1OGPA 4BSVB 1MH5B 2Z7ZA 2Q6WB 3CX5J 1MJ7L 1FFOA 2WTRB 1CD1B 2ITCA 1PSKH 3I02B 3VW3H 1MQKL 1JNJA 2UWEE 3OG4B 3O2DA 4OD1H 4F37K 4UU9B 2R1XB 1GAFH 3ABMB 4HJJH 4S2SA 4BYHA 3H3PL 1EAPA 5JTWA 1J0YA 1RUML 4YHKL 2BVPA 4MDJB 3KPPA 4H20H 1MFCL 2XC8A 2AXGA 3LEVH 4DPBX 5LXVA 5DJ6B 5AW6B 5HYFA 4MKMA 4I0PC 1U2CA 5LJYH 4IBVA 1FVEB 4NEHB 3IMBA 1VEOA 5IKCB 5KBDA 2VDLH 4X98B 2KBGA 8FABA 3HMWL 4KUZH 4ZW6A 4MJHA 4U1NB 1YEFH 2WLMA 1S7WB 4W4OC 2VXVH 1YMMB 3M86A 4ZXBC 3FULA 2H0FA 3NJGA 3ZR5A 2KT6A 3APFA 2J6EL 1IGML 5D70H 4G8AC 4UOQA 4GB9A 2H8PB 2X4OB 2HZHA 3CCHA 2GYSA 3P73A 3S4SA 3K1DA 4WWPA 3ZDZF 1TFHA 4UT7H 1BX2B 3OZ9H 4J28A 4P5KB 4H1LB 5E2TH 1KB5A 4PMFA 5IVXA 1NCDH 2VDQL 2IFFH 1T03H 1QATA 3E1F1 3PHOA 3KPOA 1A5FH 2ZG2A 5AW9B 3LSOA 2X4UA 1IX2A 3GHPA 2VLME 4DP4X 4RWYL 4Z7OE 2G75A 2YFNA 5CCHE 1I3RB 5BZZA 3K0WA 1PD6A 5D1QB 1YQVL 1KCRL 2NY3D 3HAEA 1FG2B 4NRXA 3X1GA 4LKCB 4NKDA 3V79C 3N43F 2HXAA 3WIFA 3GWJA 4NJ9H 4PRIE 5A2LH 1LK3L 1KGXA 1LEGA 1P4LA 4OKVA 2X2UA 3SY6A 1TU2B 2YD0A 2Y69B 1USZA 1JWSA 1AGBB 1P5VB 3OAUL 2VERN 4L8BA 4ZAKA 2RA1A 1E27B 5AYTA 5IQ9B 3LS5L 5ADOH 1WZAA 4FOMA 3VGFA 3VFVB 1ZHKB 1R5WB 3RX5A 5GJTL 4JO3H 1ODAA 3WIHL 1NEZA 4LLUA 1OLZA 1DCEA 1NUNB 4KRPB 4ZTOL 4HFWA 4F7EB 4J3XA 1EDHA 1FHGA 3T0EA 3QCVL 5G4MA 2ICWJ 4GEJA 4PCYA 4V33A 5D6DA 3STLB 1AQHA 2FD6H 3ORJA 4H26A 4FD0A 4MZ2A 4WFEE 3TV3H 3EG9B 1J0KA 1B6UA 1MFBL 4K9EL 1KTJA 3FOMA 1TFPA 2W0FB 1TTRA 2G0LA 1BREA 2VRQA 4FDWA 4AK1A 2BO0A 3FTGA 3GMQA 1UM4L 2B3RA 4BHUA 1NGYB 2V2TB 1BFOB 3UTPE 1Z6JT 3KWTA 4PJ8C 2BY3A 2YD2A 4G80B 5JORB 2G9HB 1WTLA 3I50H 4Z7VE 4M7LT 2OR9L 4MNHA 3HG5A 1IM9B 1IM3D 3L1FA 4BCYA 2OXHA 1G1OA 1QSFB 4K15A 2X9WA 3RJQB 1RXLA 2F74A 3DMMC 1UA3A 4J3OD 3PP4H 4ALAC 5E6RB 1G7IB 4ODSL 3OL2A 2JK5B 4DZBB 5IMOB 4OLWL 1WBXB 1S9XB 1FORH 3PV6B 4Y88A 4P06A 5J3HD 3IMSA 1RULL 4NQDD 4IRJC 1JV5A 3DX9A 1SDAB 4MA7H 1IAIH 2ICEA 5F1OB 3NK3A 4GI8A 4P3DB 1ORQA 4FNLL 3RUGE 3P0YH 4F8PA 4GW1B 5CGYC 4HZ1A 4P2CG 2Z31B 3O0RL 4S1SL 1PY0A 4HJIA 2CHZA 2H0EA 3LZQA 3GSRA 4KJWD 3S37H 2EUWA 2J25A 3HG1B 3V4PH 2NNXA 2LABA 3LN4B 4GKNB 1E5CA 3DHMA 2DV6A 3SBQA 3IRZA 3JT0A 4GSRA 4P23B 2YEZB 4IOSA 5LWYH 2LAAA 2VB5A 3NSYA 5CU9A 3RWHB 2WKOA 3MGAA 1ADWA 1D7FA 5EUOF 1KY6A 2J21A 4Z3IA 1ZDQA 3O0LA 3QEGL 1UT2A 3GI9L 1HZHH 3MGOB 3TX4A 1SLUA 2K78A 3BJ91 4QYAA 4RIRB 4QHUB 2W07A 2FWOA 2XN1A 3C60C 4LQ1A 3BKCL 3NABH 4X6EA 2WBJC 5T3XE 3N40P 1TQVA 3DNKA 4IGBC 2NXZB 4IU3A 1WCBA 1JZ5A 2BY0A 3U4BL 3ZZQA 4APQA 5HGDA 3VD0A 3D0LB 1YVLA 4ZNEA 4IKLA 5FGBC 2X41A 3MUGB 5EO9B 5FHAL 1ERNA 5EZPA 4ZMQA 4XCCH 3QUYD 1ES0A 4P4KD 4PJ7E 4WDIA 5DMIL 1JVOA 2AK4D 4L8DB 2B0SH 3BJLA 3OWEA 4IBSA 4OQTL 4MNGB 4NBXB 4FABL 1S46A 2ZAIA 3VB9A 2Y7NA 2NY2C 2VDRH 4QMEA 3IDYC 1Y07A 3Q1SH 4KC3B 4MX7B 4KI5F 4A6YL 5IP4A 4N26A 1BIHA 4WU7A 3AREC 2Z91A 4UMSA 4PMEA 2IDSA 3SE9H 1JPTH 4YLBA 3L4VA 3IPEA 3LMJL 4PJBF 1R17A 3RTLA 4AY0A 1CD0A 4F8OA 5AB0A 5I1LA 4PGDB 3VA6A 3DK2A 2E6QA 4L3ED 4UNUA 1X7QA 1L7TH 4LSPH 3WFCL 1LD9A 4U6YA 3DVNA 4WJ5B 4GAYA 3D85B 4Y19E 5DHEA 1M42A 1PX4A 4M6NL 3TVMD 4KK9D 3O2WL 1P53A 2OW6A 3V7AE 3HVDA 1PLBA 2ZF9A 4WI0B 5LO7A 4PG2C 4CSTA 1OSZA 4I1NB 2V7NA 1MJ8L 1NBVH 2DICA 4X6FB 4WGVB 3KYAA 3APCA 4BH7A 2Z64C 4R0LA 1T4KA 1WHOA 1LGVA 4OJFH 1U8PB 1DDTA 3VD1A 3K2UH 5KN5B 2H0PA 2FECL 4KO7A 1WS8A 5J9PB 4HOMA 3CFEA 5CSGA 5B4MC 4IMLB 3F00A 5AWNL 1C12A 5FW7A 4LCWD 1MY5A 4UOZA 1TJHH 1XZWA 4F1ZA 1ECYA 3BRGC 2JCWA 3KBHE 2Q1EA 2WCPA 3QUMB 4LSUL 4R8WL 3C8KB 4QPEA 3ZTJH 3QS3A 3RRQA 1P9MC 5AL8A 3ROOA 4BJLA 5GXBB 5T3ZD 3EF4A 3IMRA 1K4DB 1OTTD 4NNXA 5KG9A 3TIEA 4R2GB 4LCYA 1FL3B 2AFNA 4XNZB 3CXDH 2YGNA 1A7OH 4JFFD 1Q4NX 2G3ZA 1W15A 3ULAB 1TYEB 5JDSA 2EH8H 3FCGA 1BOGA 4Z7QF 2VQTA 2CO1A 3WJMA 2GTQA 4HIEA 3S36H 1PNDA 2WN2A 4JQIL 1I4FA 3MYJA 4WKXA 4XHJC 1KXQA 2BSRA 4RAHA 3RWCA 3US0A 3ARFC 4JGJA 4Y5VA 3RNQB 4QRPD 4U6HB 2WXHA 5TGBA 4OIAA 2YPKA 2GJPA 3Q3GA 5AUMA 4S0TD 3PGCB 4XGZA 1DN2A 4QO1B 1UURA 5GZNC 1DLHB 1S3KL 3OX8B 3REVB 2HKAA 4O2EB 2V9UA 2H6UA 3S34H 2EDWA 5B8CC 2DMKA 5IV2A 2XIIA 1J1XL 2GIXA 3SDDB 4XP9H 4YAQB 3VRJA 3MRMA 3MTXA 5EOTB 2MFNA 5EIIA 3TCLA 2ILLA 1HOCB 4B3VA 5CCGE 2ZCHH 2RCSL 4ZQKA 4Y1AE 1GPOH 4HXAH 3RI5K 2NLJA 3ZE1B 4GKOA 4KKBD 1J10A 4GG6F 5KVEH 2COVD 2PCPB 4UM9D 4MQSB 3AQDA 3BUYA 5DHDA 5GSVA 4JO4H 2JIXA 2ORBL 5TE7L 2AQRA 4BFEA 3FONB 4WHYH 3K72A 3FT0A 3UZEC 2CUIA 1HK6A 5HI4C 1U8OB 2QKSA 4HIIA 1U92A 1XF1A 1ADQH 3RVUC 4Z8FH 3O6FD 4ZDHB 4WIQA 4FNRA 1DSYA 3HKFA 5IB5A 4NRYB 1CUOA 4TSAH 4NFBA 2D2CC 3M7FB 1RIHL 2PW1B 3CPLB 1IBFA 4HUMB 3FO9A 5E00A 5E70A 5C9JA 5D7HA 3WNJA 4POYA 4L4VD 5DJZB 3SE6A 1BQRA 5IQ7L 3TNNB 3ESVF 1A4KA 3AQYA 1MJ7H 4HEPG 1A02N 2CHNA 1MQKH 2X40A 3EJTA 3OKDB 4LQFL 4BFBD 4U0RB 4TN9A 3D3VA 3IN2A 3QNYA 4XHQA 4XOCA 2ITDB 4HT1L 1G7JB 5KSAD 3H3PH 2APBA 1F56A 1TEYA 1RUMH 4YHKH 4H88L 3V6FB 5FM5M 4BZYA 1PS3A 4CJ1A 3VRIB 4OGAC 1IC1A 3QQ4A 1MFCH 4PJXE 4JPSA 3L3IB 4MJ2A 3RVWD 1A4JA 3K80A 4IDLA 5D1QC 1JXFA 4XT1C 3RVTD 3ZGHA 1OP3K 4AQ1A 1TTFA 4RMRA 3HMWH 5CEYB 5DHMC 3AACA 4F93B 1O9WA 4P2OA 1DVFB 1SN0A 4C47A 1CFVL 2WMPA 1JYNA 3WKYA 4PTUA 3V8CA 1JK8B 5JA9A 2J6EH 1IGMH 3CSTA 4KXBA 1IL1A 1M05B 4O2CA 3L3OB 2VAJA 2EEFA 3SY0A 2F8IA 4BZ2A 4P2YA 4KRPC 1EZUA 3LVTA 5A2FA 4HZAA 2VDPL 1ET5A 3O6KL 3O3BA 2WXKA 2VDQH 3ULUD 1OCWL 4G43B 4HC1A 4HWZB 5KUKA 3K6OA 2X4SB 3ZDXB 3O8XA 3MLUH 3LD8B 1WLHA 2VDNB 4NKMA 2R9HC 3EGSA 1RZIA 1DVTA 2FATL 3NIDF 3WS6C 3JVGC 3MA9L 3VI3A 4L9LB 1HEZA 4QRRA 1YQVH 4H8WC 5DVNA 4ZZKA 2C3VB 1ET7A 3D4YA 4APXA 3IFPA 1NIEA 2J1XA 1E9QA 4WFGE 2Z8RA 4NLHA 3P3UA 3OLGA 4OZGA 5JIDA 1UB5A 1LK3H 1WK0A 4OJAA 1N4XL 4H5SB 2BVQA 2OMXB 3TEZA 3ROLB 3L3KB 1AIFB 4YK4B 4Z3TA 1Q9WA 3EDFA 3OAUH 3BWAA 1OE2A 4D9QD 4X7DC 3DX6A 3LS5H 4ZOCA 2WZ5A 15C8L 3MUJA 2ZCLH 4GW4B 5ICXA 1A66A 2IPKB 5GJTH 1XCQA 3WIHH 4OFKA 4LPXA 4ZTOH 2P52A 4EKJA 2KDGA 3WFBL 5K59F 3NCJL 3QCVH 4G8EB 1ITBB 3BEVB 3ARSA 4EJ1C 3BZEA 4GUOA 3H85A 3RHWF 1AP2A 3TL5A 3OXSB 3BSZA 1D7DA 1JF6A 1OM3L 2IGFL 2O6PA 4Y8DC 1S9YB 2Z31C 1ZVSA 1JZFA 3HPLA 1H3XA 1DQQA 1J5DA 1MFBH 4K9EH 5DRZA 4NM8L 4ODXA 1A6UL 1G9HA 4JQVC 4BXSV 3A22A 4QTHA 1UM4H 2OCJA 2QLYA 4N2FA 5FYKE 4OZIE 5D5MF 5KSVA 1NIFA 5L8LB 1ACYL 1F13A 5KYXB 4FERA 5ISZD 5BQ7A 1RJYB 4P23C 3MRKA 1O6SA 1L5GA 3JTBA 2ADYA 4L9DA 1T5KA 4DGVL 1G6VK 3FT1A 3RX8A 3FU7A 4LPCA 4FF9A 1P7HL 4OGXL 3R7QA 3MOAL 4U1KB 1F42A 4QEGA 3FO0L 3GEWB 5BRZA 3HHSB 4ODSH 3ASOB 1MCBA 3VXUB 4OLWH 1N12A 1UT1A 3V4VA 1KWKA 3OAZK 2ZYIA 3PQYB 1RULH 3ARPA 2AJ3A 4G6AC 4LSDA 4AM0B 3LXBA 3P77A 5B7EA 5C7XL 3FN0L 2GHZA 2NXZC 1SF5A 4K8RC 4M5YL 4FNLH 1EANA 4HH9B 3W1ZA 5HYIA 1NFIA 3AY2A 2B77A 1CE6A 4QJ3B 1H9VA 5FK9A 3O0RH 4S1SH 2GUOB 3DK0A 1Z7JA 4N20A 1JBJA 2LU5A 4UBDC 5L9DL 2VW7A 3BUTA 2Z0UA 4PLKC 2NY4D 2EXWC 3KM2A 3KPMB 2DWSA 3MRLA 3WIAA 3QDAA 5IIEB 5KYWA 5C0CB 3T2QA 1JTPA 2OMVA 4YBQC 2N59A 3VVVA 5IF0A 3GXDA 5KJRL 1HHIA 3ULVE 4M43L 3QEGH 3LZRA 4ZFOL 3GI9H 1XAKA 4ONOA 1RHFA 2HN7B 1H8LA 1EHNA 2VLRA 3C9NB 2PP8A 3EIFA 5I73B 3PLYA 1HQRA 3BKCH 2YUZA 3LKNA 3NFPB 5KANI 1F5WA 2B4CL 4AUYA 1C7SA 3V5KA 4WK4B 2BXZA 4C56D 2J5LB 1UZ8B 4Z7UA 1M3IA 1QVOB 5EU4B 2H32B 2BHFA 5I8CA 4GIPD 1CZ8L 5FHAH 2OYMA 5DMIH 2PWFA 3ARUA 2NY5L 1NFAA 2WO3B 4OQTH 3EBGA 2ZAHA 3P4OB 4FABH 4QT5B 5EWIL 5A16B 3OMAB 1BBDL 2HT2D 5BRPA 3MRQA 2OZ4A 3KCWA 3TM6A 3N9GL 1AS8A 3I9GL 5D7IA 3QO1A 5F1NA 3WFDL 3CSYB 3WEMA 4A6YH 1D5RA 5L2KD 4OJDH 1HCZA 4IU2A 1FJ1B 1XZ0B 4FC3E 1NCAH 3IDUA 2O93L 4DKFL 3ZTJG 5KBKA 4AL8C 43C9B 5ETUA 3QXWA 3I6GA 1OE3A 1X6LA 3MRBB 4HMDA 2JKJA 3IKCB 2MHAA 2WLIA 3MJ9A 3OF6D 4GBXB 3T6QC 3TBVB 3WFCH 1UOLA 1CFQA 3H7LA 2XPGA 2WLLA 1J0ZA 4I48B 5DGQA 1TVDA 3HBQA 4XNZC 3JVFC 1F45A 4M6NH 2BNRA 4N2IA 5BNXD 3MODL 4G6FD 3O2WH 4DF9A 1F4YL 5I2IA 5EOQL 4MD0B 3E38A 3JBG7 4J1UA 3RHWK 3PS6A 3SO3B 3L5HA 3L4ZA 4NZDA 2ADJA 5DHVB 4M6MH 4GLRI 1GZHA 1I7TB 4HS6B 1MJ8H 4AIXA 1R0AL 1NEPA 2QPSA 4MWFA 1MHCB 2ZUQB 3V0EA 4AZUA 4M4PA 1T1XA 4MLSA 5CP7B 5DYFA 1E8ZA 2XG5B 3K4ZA 1MHHA 2K6WA 3S5YA 4NO2A 4RMQA 5JPMB 4HA1A 4U2ZA 4ZSOB 5B39A 2CGYA 3NIFE 3B6SA 5HJBA 4BQCA 2EINB 1HESA 2WY3B 3OAZH 4UT6A 4LSUH 3SDDC 5DSCB 3GMMA 5BO0D 2W95A 2YA2A 4Z0XA 2LVCA 4KUCD 3V8OA 4DGWC 3U4EB 5B3JF 1QEXA 1KGCE 1AGDA 2DQDL 3HCVA 5DURB 1LEIB 2J1YA 1GZQB 4A2HA 4WHYG 5GRVK 4XXWC 1HH9B 2VMJA 3F2LA 3FXIC 4M7KL 1T2QL 3NEOA 4Y19B 4JQIH 2BP5M 1CICB 1OT4A 2VO5A 4EN3B 1PF3A 5AD0B 5ILTL 2K45A 5EU3A 3IU3A 5HDBE 4ODUA 2I7SA 1X6NA 5ESVA 3BISA 4ZUWB 1T7XA 4HVBA 5KJ4A 3WS3A 1AHWA 1DFBH 3CFMA 4IOSD 2NY6D 1PQZB 5HGBA 2JKLA 2XWBA 4HU2A 5CINL 1S3KH 1AFVL 1AD0A 3EYQC 4DHLA 3UZQA 4BFFA 1ZHNA 3I84A 3HZKB 1ONQA 2MCMA 2V3EA 1MVUA 2R0LL 1E7VA 1JFQL 2C4FU 4GRWE 3ZW3A 4U0RC 2RCSH 4HS8L 3IPBA 3EHBD 4J7RA 1PL3A 3Q2WA 3FO1B 4WUKL 5T5FA 3MRPB 1VKXA 5EDXA 2Y1ZA 2ZE0A 4JGMA 4YXLL 5JW5B 2ORBH 5TE7H 3S97C 2F1AA 4O51A 2F1EA 3VFOB 3K6SA 3ZDYE 4KKAC 2VM4A 1E28B 1U8HB 3FT4B 3VI4A 1PG7X 2CJUL 3LKRA 5H37G 4HK0B 4R26L 1HDMA 4WHTA 4Q52A 1A3RL 2DQHL 3RB5A 2YAQA 4MYPA 2PPAA 1RIHH 1YDPB 4NSKB 3RYMA 1SOKA 3HN3A 5B38A 2AJVL 1DVFC 2L7EA 3CVHB 2IH1B 2N7BA 3CHQA 4N3TA 4N24A 5DGRA 2VXQA 1JMZA 1SDDB 1QLEL 1WZ1L 4HD9A 4XVTL 2V0AA 3L3OC 5IQ7H 4FQJL 5E4OA 5GGQL 5MENA 4LQFH 4O02L 5DHYB 5I82A 5GRWA 1COBA 5KSUA 2EYSB 3HE6B 4HIHB 3C5ZB 4FHJA 4L3CA 5LLIC 2OXGB 4H88H 2NR6C 3T9WA 4EI5A 3NTCL 3SOTA 1TETL 4NQXA 3L7EB 3LD8C 1QSED 1HH6A 4NUJA 1AJ7L 3IJ7A 4YN3A 3HAEH 2GJ6D 3IFOA 4AJWA 4L9LC 1DVSA 1IBHA 3SO5A 5ADPH 2Z92B 1OW0A 2G5BA 3APNA 3BMVA 4NFCA 1JHTA 1B9ZA 1ZY9A 5CWSA 2OBGA 1JRHH 3CMOL 3EZ8A 4YNYA 3WNLA 1HSBA 1XF4B 3BHBB 5D2NA 3FFDA 3KYOB 4YK4C 1QP1A 2ATKA 1N6VA 2XWJA 1CFVH 3G08B 2D7PA 4DQOL 3GM8A 1PIFA 3N44B 4N0UB 4ISVB 4U3CA 4W81A 2Y06H 4G8GE 5CFAA 4YSOA 1CI5A 3QS2A 4YSTA 1Z5LA 3ARGA 4UV4L 3MMEB 3JV0A 5I24A 4CGUB 3QEQA 2PN5A 2AQ3A 4RFNB 1KTCA 1WA0X 1KXVC 2VDPH 3O6KH 4WEBL 1QFHA 2AXFB 3HPJA 1MXGA 2Y6TE 5DRWA 5TK4A 4FQPA 1OCWH 3G5XB 5K39A 3N40F 3EFFA 2AJUL 1TLMA 5A3ID 3WTUA 5H35B 1U3HD 3LH2L 4QY8A 1BDYA 3ZE0B 5HYJA 1EJ6A 5HSFA 2FATH 3GQFA 3MA9H 4OF7A 2EIKB 3O3DA 3QDGB 5D2LE 3P0VL 3F12B 2FVNA 4I3SL 2FJHA 3TA3D 3QDMD 3MOQA 4KKCD 1E30A 4C4KO 1N4XH 3BVDB 1RPKA 1R24B 5F7HA 1R3KB 4DPRA 5E08H 2C26A 4DOHE 1IIIA 3UPRA 1X5ZA 1S6NA 5D4JA 5F7YC 4AYFA 1CXLA 2RQEA 5IK3A 4HBCL 4DGIH 4J5VA 1I1FB 2JMRA 1C16A 15C8H 1EGJA 3WTVA 2VQ1A 4ZUVB 3B3IB 3DGCR 3SGJC 1FC2D 1NFDF 4LCWE 3FT2B 4JM2D 4OFIA 3HZYA 1K72A 5SV3A 3BRDA 2IAMB 4AMWA 5D1ZI 3WFBH 3C6LB 3UDWC 4HX1B 2VL5A 2E7DA 3NCJH 3QIUB 2WQAA 3V55A 3N41F 3VCLA 4G42A 1SN2A 5F9JB 1PYWB 1AOHA 3KLHD 3T77B 5L7XL 2X6AA 2Q8AL 1OM3H 2IGFH 4P46B 4U2YA 5T1KA 2JIXD 2XWZA 2CO6A 4F8LA 1E4XL 2DH2A 5JR1H 4JFFE 4HCFA 3GPSA 1ZHLA 4RFEA 5E2UL 1L0QA 4NM8H 1MAKA 1A6UH 3DRTB 3VX1A 1TKWA 1Y1UA 5INCA 4RLDA 3MBEA 1KYFA 3KYMA 4N2MA 5IB3B 1A21A 1RK1A 4HJGA 1GGUA 4N8VA 3P4MA 2A74B 1KIPA 4KMTH 5D72L 1KBGL 2VMEA 4DGVH 4HPHA 1B0GA 3H9SA 5EUKB 2OLDA 3X2QB 4Y9FA 3MOAH 4W9ZA 4IIZA 1YG9A 3FO0H 3LHPL 1G7PB 4K73A 1WFNA 3FFOA 5I73C 4L0PB 2ZQKA 3D3VD 1Z2KA 3BQUA 5C7XH 4J3BA 3FN0H 1GH7A 4M5YH 1ETZA 1ZA3B 3AVEA 3UAJC 2CDEB 3R4DA 4Z77B 3DROB 1AR1D 3JQOB 4X4ZA 4ZUSB 2K6YA 5L9DH 2EC9U 3UYRH 2A9ML 2MMXA 4PJGF 5EIQA 4KVNL 5GS3A 1UWXK 3V6BR 5GHWL 2ZWLT 3C5XA 1GW6A 3L4YA 5DZLA 2FL5A 4KXZH 1MWAA 4M56A 5GGVY 1DJIA 5D7SL 1U8MA 1F3JA 3O3AB 5KJRH 4ANKA 3D12B 3DXAA 4PS4L 3RGVD 1QSZA 4MMZB 3G7TA 5AG9A 2WYZA 5FB8B 5A43C 4M43H 4HMEA 3BO8A 4TVUA 1UC6A 2E6PA 2FEEI 3MJ7B 1PAMA 4HDIB 4GBXC 4LLQB 1BHGA 2WB7A 2YPVL 1BQHG 1JDDA 4OB5L 2B4CH 4AQOA 5T1DL 1XF2A 4LLVB 2WGXA 3LZNA 4R6UA 3DIVA 4G9FE 4L3FA 5D7LD 2DWDA 3MJ8B 4CN6A 4IBWA 5TDNB 3IGUA 1U58B 3O8XD 3QEUB 4KTGA 2QADB 1PZ5B 3MUUA 1ZK9A 2GITA 3WTWA 1DJZA 2OJEA 2BP3A 3SO3C 2NY5H 3H42L 4XOEA 5GRUL 2B2XL 3K0YA 4JM4L 1NJ9A 4RA3A 3BYTA 1BA9A 3EJYD 4YIQB 4OIFA 2RD0A 4LGPB 5EWIH 2ZUQC 3GRWL 5EPMB 3JV5A 4B9KC 1BBDH 2QPUA 3H54A 1M7IB 2ESVB 3N9GH 3WFDH 2XOTA 3I9GH 3N6YA 5EU6B 2LGNA 5JPMC 1AD9B 1FLTX 3SE4C 4FYQA 2GY5A 5E1IA 4DKFH 4Z23A 4RRPM 2HYMA 3NK4A 5E99H 2YGVA 5C0IB 4N8CL 4A2GA 5JIIA 4MXVF 2C9XA 4DN3L 4Z7UF 3TBTA 5E8PB 1J9RA 1MW0A 3KWWB 1OK0A 3HUJE 4ZX5A 2F53E 3N1QC 2DQUL 4X4YB 3PIQB 2D31A 3T0VA 3PP3H 3DV4B 4OLZL 3QA3A 5B7MA 3MODH 1F4YH 2QBWA 5EOQH 1XR8A 1IV8A 4X99A 5IROC 1CICC 4MZ3A 4EN3C 2XWTB 1OTUC 3LIZA 3GSUB 4R5VA 1R0AH 3S5LG 5D7IF 5AVZB 3VNZA 4MMXB 1UA6L 4XPGL 1SVCP 2JI2A 2D9CA 4CAGA 3EJZD 1S7RB 1WFJA 3WXWL 3EAKA 1AZUA 2NYYC 4LNVA 5E8DL 1X4ZA 1VAHA 3OBAA 3OJDA 4W9FC 3GSXA 2Y3AA 4JK0D 2ZXWB 3ZQ9A 4WTZG 4XNXL 2C3HA 3H56A 5AOJA 4TS6A 4E36A 4XODA 3TJHD 3L6FA 4XXCC 5IQNA 1JHLH 4Z7WA 4I7ZC 2DQDH 2YGPA 2XQYK 1P84K 5DJAA 2X0UA 5IEHB 4J6RL 2JFCA 2WXGA 4MD4B 1AO7A 1I8IB 4YPGB 4MJIA 5DFAA 5DF0A 4K9JA 3HR6A 4BELD 4M7KH 2DWEB 1XCXA 1GGBH 3W0WB 1QRKA 5AENA 2X2HA 1A1MB 4PR5A 1UWXH 4PJCA 2QPFA 2YPLA 5ILTH 4N6RB 3T8VA 5DJ2A 1NQBA 5CLZA 3QO0A 3RWGB 4N5EC 5KVFE 1HVXA 2R2CA 3DBSA 3BAXA 4I88A 5CP3A 5HYQA 5C70A 1ZXQA 5CINH 1N5YL 5ANMB 2QMKA 1AFVH 1HXMB 2BXYA 3Q5OA 2N1TE 2VYRE 5DD0L 4AQZA 5LGJB 1Z66A 1CGSL 5AEAA 3QQ3B 5FCUL 2R0LH 3DPBB 2VLRD 2WW8A 4XVSL 1JFQH 5E7FA 5EZLB 2WLKA 2VIRB 3HE6C 3U2IA 5SX4H 5I5IA 2WQSA 4JHBA 3Q2VA 3QCUL 2ITEA 1HSAB 3C5ZC 1SJEB 3ECUA 5INDA 4YXLH 1FFNB 4QWWD 2ZTBA 1D7BA 3FRPB 1G7QB 3U0WL 5AAMC 2P8MA 2CJUH 3ZIMA 3PXLA 3VXRA 4R26H 3VFSB 3KYNA 3ZTCC 4AC2A 3EJJX 2Y4SA 2H2SD 1H5BA 1A3RH 3JZ7A 1FGNL 1D9KA 4XNYL 3IE9A 1G6RA 3V5HB 3QJRB 1KWGA 5FKPB 2FQDA 2YWZA 4XCNB 4OCXL 3KPLA 2AJVH 5BW7A 3IRCA 2L3BA 2FBJL 4FQLL 5DZOA 4HCRA 1WZ1H 1JNLL 1S9VB 3OKEA 2GSGA 4XVTH 4BZ2H 2A9AA 4I2XE 4FQJH 5EO0B 5GGQH 1IAOA 2BNUA 4O02H 1FVDB 4MCNA 4L4TA 4K5NA 4RMBA 4RFNC 3V0VA 4DERA 5FA4B 3DC0A 4G6ML 1YUHB 4P57B 4D0DA 1OP4A 4KO9A 3VI4F 5DMKA 4ENED 2N01B 5H8DA 3T3PB 4QTFA 4C56E 2BNRD 3NTCH 2FX7L 4AENB 3WKNA 5DHXB 3FK3A 5F1IB 1CO1A 2NSMA 1AJ7H 2BIIA 4NQDB 2X28A 2VXTL 4EO5A 2C1OB 3NA4A 4NT6A 3LPOA 3ZDZB 1KCKA 4IIQA 2J8UA 3Q2CA 2DQCL 5ACMA 3WEXA 1T21B 5DI8A 5D71L 1AXTL 3CMOH 4GKSB 1XGPB 4NZRL 1HE8A 1LMIA 1YQ2A 2OMZB 1JD9A 3Q48A 5KBNC 4KROD 3OGCA 3S8FB 4FQXA 2WZ6A 4EAEA 1INDL 3B2PA 3AM8C 3BWZA 1D3CA 4AGOA 2ZX8A 2ZSVB 4IBQA 3A4EA 4JM0A 2PXYD 5ICUA 2BHZA 1ACCA 3MDJA 5L2KE 4XMXA 2OTWA 5H2BA 3W5NA 3QIBB 2HX9A 4UV4H 2NUTA 1QNIA 2H9GB 5D55A 1PKOA 5CEXA 2IAMC 3C6LC 2KC0A 4JAMA 1U3JA 4WEBH 2Q76A 3FO2B 3QIUC 4WEMB 4F7PB 3FMGL 5F3HA 3K46A 3QJTB 1CJYA 5DUML 1UOKA 2AJUH 4P46C 4PWKA 1RMFL 3IDMA 3BPOB 4IW4C 1BZ8A 3LH2H 4PI2A 4NUPA 3TFKD 1E5BA 4ZMXA 3BKYL 1A2YB 1T83A 5F3BA 4HEMA 3NCYP 5FA3B 3NCYS 1IFRA 1SEBA 3JWDL 5FUCE 3P0VH 2FZ3B 4NERA 3ERXA 4I3SH 4EDXA 3ELQA 5T1LD 3V5DB 2XACC 2Y1YA 1D5BA 2W88A 4H7VA 5EU7E 4N1HB 1GW0A 2P5WD 4P4KB 5IVOA 2Z93B 2NSQA 2AK4B 4IBZA 4NQCA 2A74C 4LVNC 4L5FL 5I0WA 1IGCH 1E50A 1XSKA 2DJUA 4HBCH 2FLBT 3MPCA 5BPPA 1MNUL 2DQFB 2X0VA 3IAQA 3EH4B 3JV6B 3KYKL 5E9DA 1MVFA 4MQ7A 4K71B 3WJLC 1N3NB 4OUUA 2CDGB 3B9EA 3PNRB 3QGVA 2O6DA 5E8EB 1W2KT 1CG9B 4LPUA 4XX5A 4FEIA 3PU7A 4KDTA 2GSIB 4XBEL 5IJVB 2VAAA 4L1BA 4ELKA 1UM6H 1Q9LA 3RX7A 3QUXA 5I8OL 5L7XH 2Q8AH 4K94L 5D6CB 4EUPH 5JNYB 1I8AA 2UYLA 1FZJA 4MXQC 4L3EB 1E4XH 1JGUL 1A9VA 1YPZE 2EXTA 2IADA 3G5YA 4N90E 5E2UH 5CIPA 5G5DB 2EKSA 1UD3A 5DK0B 2H5UA 5EEVA 1A7NL 1EZVX 4KNUA 3TVMB 3MLRL 5I0XA 4YGVA 4GKZB 5F7EL 4U3XA 2VJ8A 2BSEA 5IVZB 3B2MA 2WWKO 3P9MA 4Q6KA 3QEHA 1ZLEA 4PJFB 4RZCA 3BZFB 1KBGH 4RNRA 5D72H 2W59A 1U33A 4MMZC 2MQCA 2ZNXA 4HUKB 3E3QE 4X6DA 2GTZA 2FLMA 3VD4A 4DOHB 4PJEE 1JTOA 3LHPH 1WRFA 2D2OA 4A37A 2WIMA 5MEND 4DQAA 3D51A 5AKRA 2WNXA 3Q8FA 4QNPE 3IVKA 4CMMA 2EVJA 4GOSA 1XB6A 4OF0A 1GIGH 2G3NA 2XHNA 1ZTXE 3T65B 3I6LE 2XG4A 3IDGB 1REIA 4UZGA 4RFOL 1T3FB 4EI5D 5CR8A 3CZFB 1BZDA 3H4FA 4IHOA 4YDIL 4PB9L 2NY0C 4OF5A 4HSQA 3EBHA 3IMWA 1EAJA 2QSTA 1IVTA 4P9HC 3AC0A 3D8MA 2XIBA 1F8TL 2A9MH 1B0WA 4NHUA 4KVNH 2OZ4H 4L8SA 2J55A 3WG7B 5GHWH 1JCVA 3EBIA 1MCWM 1U2HA 5CUSL 3WI9A 4YHZL 1M71B 5E0FA 2DWYA 3CZKA 3IBEA 5D7SH 3UIZA 3ZZSA 1FZMB 3SCMA 4PS4H 2K8MA 5SWZD 2J1ZA 4MYWB 2BOBA 4QRPB 3HC2A 4YDNA 1UTDA 1YSOA 3C60A 2GI7A 4GXVL 2WBJA 4Z5RB 1LWJA 4UQ2A 4F80A 3GM0A 3QJSB 4NC1C 2FECI 1RHHB 2FEDC 2YPVH 5D1XE 3ATFA 2N7AA 4OB5H 5DCCA 3SGDH 4HCGA 5T1DH 4XB8A 2ED6A 2FO4A 3HB3D 1I7UA 2GTWA 3MV9A 4KQ4L 3LRSA 2Y6SD 2P8LA 1M57B 3QNFA 1JFHA 2VDKB 1N5AB 2WQRA 1PZ2A 1KCVL 1NBYA 1QSEE 2NTFA 1T0OA 32C2A 3H42H 5C09A 5GRUH 1MEXL 2B2XH 1AMYA 4JM4H 2GJ6E 2IH3B 2NW2A 3UCQA 4UM9B 2OTPA 5BS0A 1XCWA 1W72A 3HNVL 4MMXC 1FE8L 3GRWH 3KEDA 3WIIH 4X5XB 2M26A 2BIPA 3VJ6B 3T6ZA 5DZJA 4N8PA 2CSPA 5ENWA 3T09A 1AG0A 4OJCA 3O6FB 1F11B 3A4FA 4G1EB 3WCYA 1W0YT 3UBXG 1RPUA 4NRZB 3JUZA 3KNBA 4BINA 4MAYD 4BKSC 4N8CH 3QFJA 4ACPA 3MLTB 3VU2A 2WXPA 4DN3H 4ZPVA 1OWWA 2ZYRA 1OB1B 4LLDB 4KMQA 3ILDA 1UKQA 4L0YA 3KPQA 2Y7MA 2G4EA 4NKIL 4Q9RL 4L4VB 2CZNA 2DQGL 2UUDK 3MC0A 4M1DL 1NMCB 2CUHA 2DQUH 4LMQE 5GS0D 2EEAA 1RZJC 4L37A 2MRYA 4QJ5B 1I1YB 4J8RA 3CHPA 5T1KD 3PPEA 4OLZH 5DEJA 4ELMF 1QO3A 2J8HA 2BZCA 4PG2A 4KVPA 2PCFA 4HH8A 2R4RL 1NDMA 1N59B 3DSNB 2M2DA 2QVTA 2OYKA 4M4RA 3HJEA 4HUWA 5KSAB 2E0PA 1D6VL 3NDYE 2X12A 1UA6H 4XPGH 1VJSA 4YHPA 1OP9A 3IAPA 1JPFB 3PV7A 1VGKA 5EF0A 5ID1B 5CMAA 4S1QL 4FS0A 3S48A 4RH4A 3QDME 2QELA 4HF5L 3WXWH 5E8DH 3QDJE 3N0PB 3QJZA 1PDKA 5HP5A 3WXVL 3MBWA 5FWRA 3H9SD 3OXRB 4YXKL 5CLXA 3FQXA 5GISL 4P5RA 1N64L 2VL4A 3FBQA 1RSFA 4XCYB 1BIIA 2L0DA 4XNXH 2JJSA 5FLUA 3H2QA 4Z78B 3B3BA 1ZLUK 3BAWA 2E4TA 1IT9L 4CVXA 2VUOA 4D9RE 3F7YA 4DK3A 3BQUD 2J4WL 1J9QA 4PJ5B 4KH9A 3WUWG 4J6RH 3QG7H 5CSZB 2E75C 2HFEB 2I5YL 3CLWA 4GI9A 4HJ0C 1FYTD 3GLAA 4NDMB 3VGGA 1TQWA 3GYRA 4DSYA 5SX5K 4AQEB 4HUVB 1U36A 3UIYA 4QHMA 3V10A 4PJAA 2BS9A 5ELIA 3TNMB 4P5TD 2PW2A 1BQSA 1QUNA 1UZ6F 1TCRA 4JFZL 3H3KA 1ZVNA 2WOBA 5DQ9B 5DVOA 3GMLA 1T89A 5IM7A 4GAGL 2ALWA 2OKMA 4TXVB 1KJMA 1F6AA 2YRBA 4V2BA 5B8CA 4MVBD 1DBKL 1N5YH 5KSBA 1KN4L 1OY3B 1U3NA 2DB8A 3GGWB 3JWNG 5DD0H 1ZT1A 1P5UA 3EOBA 4ZD3L 1SF3A 1JRHI 2HJFA 4H25B 4RRPA 4Z7WF 5ID0B 1CGSH 1ZT7B 3MRDA 5FCUH 2FT6A 2KHAA 4C83A 2WKGA 4XVSH 3OKLA 1L9SA 1JUFA 1P7KB 2AKRA 1C5DB 1NCGA 5C0AA 3BZ4B 1CFMA 2AF2A 2EYRB 3QCUH 3HHMA 2B3IA 4XCFL 2YS4A 5IT2L 5DJ6A 3T2LA 1A14L 5J3HC 1Y18B 1S7XA 2ZWNA 3VFTB 4JJ5A 5IKCA 3LQAC 3U0WH 3O4LB 3DX8A 2QDVA 4XO8A 1GYWA 3LZLA 3RNKB 2EIEA 1NCOA 5D4IA 1TJIL 4X80L 4OVUA 1FGNH 2F54B 4XNYH 5JW4R 1HS6A 2XSKA 3LYRA 1KYUA 4AYBA 4NZJA 5M94B 4KJWC 1CDYA 1S7SB 4E0RB 5DK3A 4ZFGL 4OCXH 4DAGL 4FQLH 2FBJH 4RISL 5CAYB 2B15A 3EYSL 5I17B 2VSKB 3GKWL 1JNLH 3NN8B 3F8UB 1Y6NR 5K1JA 2XQYG 5ISZB 3QIBC 4I5BA 1A1OB 2P3YA 1KN2H 3PHQB 4GSUA 3KBPA 2CO2A 4X5WA 1I3GL 1LO5B 2ZIDA 1DUYB 3QZNA 4U1JB 1KLUA 2P5PA 2GUYA 5K69A 1FFOB 2ITCB 2FX8L 4WENB 5D7LE 2FX7H 3BPOC 1QI3A 1NIBA 1LXMA 2VXTH 3H9HA 4S2SB 2BHUA 1EAPB 3SDXE 3VH8G 5KJ7E 2BVPB 3KPPB 5D71H 1AXTH 4NZRH 2LU4A 4O5LL 5DQJA 4QXWA 2AXGB 2E5EA 4P4KC 2X89A 2Y24A 4Y4HA 4IKIA 4CU7A 1INDH 3V0DA 4FRWA 2YZ1A 3IGFA 3U46A 3NSFA 1FO0L 3MRNA 4ZFFA 1ZLUH 5G4OA 3OM3B 4LVEA 3NIDB 4F7EA 1BAGA 3FTZA 2WAHA 1PBYA 3ARBA 4K71C 4OGQC 3IETA 3JWOC 1J48A 3KGUA 4PGCA 3IEAA 1AQMA 4DEUA 3FMGH 3G6JE 3K6FA 4V11A 4OZHE 3CCHB 3P73B 5DUMH 3S4SB 1KGUA 4MJID 1RMFH 2C1PA 1GS8A 3GTTA 2J8UF 3QIWA 5CF3A 1KB5B 3TXAA 3BKYH 1B0RA 1DBBL 1T66D 5IVXB 4FE9A 3TWCH 2I7OA 3V2AR 4C56B 5E6SB 4F7KA 3JWDH 2W9DL 4JKWA 3VXSD 3AS0A 4QRFA 3TVMC 3PHOB 3KPOB 3GMOA 3MREA 4KK9C 1VZGA 2X4UB 1AE6H 1SOSA 3RGHA 2X4NA 2WYTA 5I0YA 2OK0L 4TUJA 1EXUA 5JXEC 3K8MA 1CYGA 3CVCA 3O41A 3E7JA 3F85A 3WNMA 1QFWM 3WY2A 1GA2A 1TQCB 2PYED 4NRXB 1F18A 1MNUH 4NKDB 5LVEA 3DX7A 3WIFB 2VN5A 5F88B 4X4XA 3D7PA 1P4LB 4LLMA 1SMAA 3L5WA 3Q13A 4KAQL 4OKVB 2R59A 3UAFA 3KDMB 1JWSB 4L8BB 2VW4A 2XV2A 4ZAKB 2H45A 1K8DA 4XBEH 5I8OH 3WDHA 1J1OL 3UTQA 1NEZB 4CNIA 4G6KL 3UTTD 4XBGA 4PPTA 3L1GA 1JGUH 2OSXA 3UTZA 3T0EB 3FKUS 1MKFA 1N0XL 1R6VA 1A6VL 1QTYT 2GAZA 4D3CH 2GHWB 1OTTC 4CDGC 1TNMA 4F33A 4JZOA 1V3MA 1A7NH 4H26B 2Q87A 2OL3A 4G6FB 1MWAH 3MLRH 4FG2A 4JREB 2MSPA 2WXNA 4X7EC 5F7EH 1H3WM 3IJ9A 3K8LA 3THML 2CNZA 3FOMB 3PGFL 3KVDD 2Q2EB 1OAUL 3F3HA 2J1WA 3FTGB 5E24E 2KQMA 1DLFL 2VABA 1S9WA 4KRNA 3KGTA 2JLPA 3W39A 2J3SA 3H2WA 5J89A 4RIRA 2IMNA 4FKHA 4JFDE 3MROB 5GS1C 4CSZA 2CK0L 4YDKL 3AQXA 3DTUB 3O11A 4FNPA 1I8UA 3NG5A 4L4TD 4NAQA 4TTDD 3D0LA 4X6CA 4Z7NB 2OXHB 4ZW5A 5EO9A 3QJHA 2F74B 3M1OA 4XPBL 1EK3A 5BZDA 4KITB 3KPNB 3RURA 4LGRB 4RFOH 4AUUA 2OYPA 1UATA 1JZ4A 4X0NA 3QHTC 1XGYL 4M5TA 2JNZA 4GYBA 4PB9H 4XPHL 3CBJB 4YDIH 4MNGA 1ZMYA 1VERA 1JV5B 2DLFL 3DX9B 3NRFA 3WNNA 3DYOA 2ICEB 1MG3C 3AW5A 2HLAA 4KKBC 1F8TH 1U3ZA 1ORQB 2DS4A 4YHYB 4U1IA 3DJZA 1IU1A 3ML9A 4X6DF 5CUSH 4F5CE 1YNTA 3ZZ1A 3GSRB 4FQXD 4YHZH 1ZGLA 1I1AA 5EEZA 1FUNA 5A7BA 2H26A 3O6FC 1EZSA 2Y23A 1PX3A 2BJML 4XN7A 2VLJD 3AT0A 4PGDA 3CQPA 3GJEA 1JK9A 1BF2A 2R0ZL 4GXVH 4WUUE 3VMOA 2Z7UA 3D85A 3B1TA 3DRQA 4JN2B 3X12A 2ZXAA 3RKDD 1NMCC 5IJDC 3UTSD 4KQ4H 1PLGL 3B9AA 1QR4A 4HKXA 1EEQA 5HHOE 3BRFA 2FWOB 3LIZH 3N42B 4X5PA 3EHBB 1MQ8A 3WD5L 1D6EA 1ZLSH 5F6HI 5KSAC 2XQBL 4M3HA 4HLZH 2NW3A 1MEXH 4D0CA 2YAOA 1WCBB 5DMJB 5HGDB 4APQB 2X4QA 5KZCD 3HNVH 1T5WA 4YO0A 5KN5A 2PWDA 3D39A 3L45A 1CXFA 1ES0B 1A7RL 2V3DA 2W8CA 4WDIB 2AEPL 4F92B 4FP8L 1A6ZA 4OF3A 3QUMA 4GT0A 2FIRT 2FSEA 4LRIC 4N2LA 1I8KA 2BNQD 3IAGC 4OI8A 4KJPD 3ZXAC 1MI5E 4JJOA 5E9DD 3D48R 2ZUSA 4NI6A 2V9QA 4WU7B 5IW6A 3CJJA 4HSAC 1WPCA 4N5UA 2Z91B 4E5XG 4NKIH 4Q9RH 2DQGH 3MU3A 4M1DH 1XV8A 1TO5A 3BP5A 2E74C 3IYLW 3QUXD 4DNLA 1OHQA 2WSPA 2FUQA 5I1LB 2WPGA 4IS6A 4Y9BA 4MBRA 1X7QB 4UAOB 1OVZA 2R4RH 2CIKA 1LD9B 4JO2L 4TNEA 4U6YB 3DVNB 4KNSA 4GAYB 3D08A 1RZGA 3ULUC 2HRPL 3DOIA 4D7BA 1S7TB 2R1YB 1WWBX 1KY7A 4B9ZA 5HHQA 5IHZA 4MJ5A 2K3TA 4IK7A 4S1QH 3OX8A 4HP5A 3REVA 3QXDA 4XAWL 2BSED 5CFHA 4HF5H 1LP9E 1UD8A 5LXGL 2P28B 4MMYA 4ZMAT 2P5WE 4WHCA 4YXHL 3SDDA 1IGTA 1T1WA 2V7NB 1U91B 1FWXA 3WXVH 1FFTB 4TNVF 3VWKD 2AZUA 3CQQA 5GISH 2RB8A 1N64H 1T4KB 3D34A 4R0LB 3T1FA 3UMNA 4BH7B 4URKA 5F7NC 1PVHA 3VG0L 3F7LA 3G6AB 4I3RH 2AS5M 3EH1A 4OD2A 3V6ZA 1IT9H 4BWTA 3CFEB 3KLQA 4MNQD 2R56L 2C9VA 4ONGL 1J0JA 1C12B 2J4WH 5HPOA 2G5RA 4PCSA 2CKNA 3O9WA 3FCTA 5D93B 4Q97A 1BM7A 2I5YH 1TUPA 2F5AL 5J0BA 3VQ2C 1CD8A 2NRDA 4PS3A 5CM1A 4PJ6A 4AC4A 2MQ3A 4EIUA 4PS7A 3ROOB 3O6LL 1OAJA 2OMTA 3Q2NA 4OR1A 2ZP0T 4KPHL 4OT1L 5KG9B 3TIEB 4LCYB 4OH2A 2E9JA 4JFZH 1UD2A 3F64A 4AKOA 3AG1B 1GGIL 3EO9L 5JDSB 1GXEA 3Q43A 3PFUA 4GAGH 3WJMB 4HIEB 2B1OA 1I4FB 3MYJB 4L2YA 1BD2A 1KN4H 3RWCB 3SCMD 3ZMEA 1UH2A 3I6KA 4HKJA 4P9ML 2OQJB 4Y5VB 3OKDA 4P48A 5FGCB 4OIIL 4ZD3H 5I75B 4B95C 1U8CA 3MV7A 5TGBB 3L9YA 3U0PA 2YPKB 3Q3GB 4YFLI 5AUMB 4FFYA 2EDOA 5E2VH 5C3LD 2PYFB 1UWYA 2DQEL 4BUQA 5C0RL 4LGSB 3VSUA 4JDEA 4F27A 3LPFA 5B1AB 5DU7A 5IV2B 3R8BB 3TYGL 1VFBA 1QYGH 2CO4A 1OGAD 4XCFH 4KY1L 3MV9D 4LLWA 5IT2H 4DKEL 1A14H 3MRMB 4MKTA 5EIIB 5KEZA 3TCLB 1YLBB 5FUOL 5FDYA 2QGBA 3LPPA 4G11A 4XTRD 1LLAA 3FN9A 4RQQA 3V0IA 5C09D 4N86A 2NLJB 5JHDD 4ZMZA 5LN8A 2DF3A 1UKSA 2NDGA 1II4E 3NRPA 3BUYB 5BS0D 3CFNA 2JIXB 1TJIH 4X80H 1S7UA 4Y4KA 1UEYA 2A7BA 3LV3A 4JPVL 3K72B 1JK8A 2IWEA 1G7MA 4TQIA 3BH8A 1TZOA 3OV6A 2NCMA 4ZFGH 1OT1A 1XBDA 2VDMB 1OB0A 2XETA 4DAGH 1U92B 2MTAA 1MPAL 2NY4C 4RISH 3EYSH 5F7LB 4KZDL 3GKWH 5SWZE 2CIIA 5IB5B 2VWEE 4BK5C 2DPKA 3QFJD 3DOSA 1SXBA 3DWTA 1ZHBA 2L7QA 4GT7A 1I3GH 4JQXA 2XU9A 3FO9B 4JCMA 4M02A 4YC2B 5E00B 2NX5D 2WJ5A 5C9JB 2UWEA 5AVTB 2X4SA 4WO4A 3BEWA 1FFPA 4ONFL 1FP5A 3WKPA 2QT6A 4H8WL 4R4ND 2FX8H 4B96A 1JE6A 5KVEE 3WAKA 2EUZA 1AI1H 1J88A 1ODUA 3D3VB 1LO3L 2C3VA 2YK1H 3QNYB 5GS2D 4BFKA 1NANI 3OKKA 1D5MA 1YECL 2IV9A 1IC0A 5FGSA 2Y25A 2ISDA 2O4EA 1TITA 4CGTA 2IJ0C 1A7QL 2PLTA 1BM3L 4JFUA 4QAWA 1E4XI 3OKMA 2X1OA 3RPBA 4GS7C 2CCVA 2LE9A 3K8KA 1A4JB 4E68A 5AZUA 3SKUD 1FO0H 3POHA 4D0BB 4XCEB 3NPSB 4AQ1B 4K7PX 3FC8A 1KXVA 2HT2C 2WVUA 2NOYA 4YSPA 3A21A 3EO0A 1SLWA 5D8JL 1H19A 4FQIL 3OXSA 4WSKA 2DQTL 2WMPB 1AS7A 4ZAKC 4PTUB 4Y16A 1JNNL 1IL1B 2EDYA 4O2CB 3SY0B 4GP5B 4ZI8A 2ZXBA 3MR9A 1AQDA 3FSZA 4N2EA 3CSPA 1DBBH 5JW4Q 4DKTA 3LRMA 4X5RA 3IJYA 3RZCA 3DPDA 5F7AA 3CSBA 5JHLA 1ZA6B 2W9DH 1HFUA 2FAUA 3Q0HA 1Y0LB 3O8XB 5E95B 3GBML 4JREC 3GDBA 2QMJA 1DJGA 4NKMB 5BO1L 1U8IA 2OK0H 3EGSB 1RZIB 4ALAH 4PRIA 2GC4C 5AW8B 3VI3B 1JPEA 3SGJA 5E9AA 1HEZB 1GOHA 4QRRB 3S5ZA 1AIZA 3X13A 5EU7C 4APXB 3IFPB 2WNWA 4K8RL 4A7GA 4OZGB 1UB5B 4GSXA 3FB7A 4KAQH 2WWNA 3TBWA 1Q9WB 4LFHD 5LDSA 3KE0A 3BWAB 2HPOA 1G0YR 3DX6B 1MF2L 3HFML 4NBYB 3F83A 5ICXB 4U3SA 5AYQA 1J1OH 1F86A 4G6KH 3ZL4L 3OPZH 1KFGA 2JQMA 2K9UA 1FYTE 1N0XH 1A6VH 1HAWA 2EDHA 4GNKB 3SGDI 5IIEA 3BZEB 2ICEC 3BPNB 1AP2B 3M8OL 5HTSA 3F7QA 1BFVH 2IOOA 4YHYC 3V0JA 3P3YA 4Q4IA 4Q6YA 3DYPA 2K9FB 1CI3M 3FFCD 1ZVSB 1KSRA 3HPLB 3WLBA 1DBAL 3THMH 1DQQB 3VA2C 1AQKL 2D7MA 3BP4A 3PGFH 5DRZB 5HYSG 4ODXB 5IFJA 2X70A 3INUL 1OAUH 5AAWA 1DLFH 1FDLL 4DKAA 3W37A 3DBXA 2HH0L 4QTHB 4Z7VA 1FA4A 4AI7A 2R23A 1BVNP 4CVZA 3V0HA 3OR6A 2CK0H 1MREL 3NFPA 5BQ7B 5EUOE 3MRKB 2R8SH 1DE4A 1O6SB 1L5GB 25C8L 2B8OT 3KWVA 2R1WA 4OCYL 1TJGL 2CALA 1CFNA 4FFTA 5BUAA 3FU7B 2H32A 2OJZL 1BZ7A 3L9EA 2FWSA 5F9WB 4XPBH 5IQMA 3RUGA 4Y8AA 3WN6A 4HLZG 3V4VB 4RMVA 5AALA 1XGYH 4XPHH 2IDQA 2AJ3B 5E8NA 2SEBA 3EHBC 3AU1A 1IQWL 3P77B 2DLFH 1MUJA 4QT5A 5A16A 4D9LL 2IWGA 3UBHA 4W9DC 1NFIB 3IB4A 2VLKE 1CE6B 4IOIA 1RPQA 4GFXA 5IMMA 2XYCA 2DM3A 4AL8L 3B7RL 1FJ1A 4Y4HD 1X5MA 2H3NA 1EBAA 3MRBA 3ZUNC 2BJMH 1TIUA 3RU8L 4OD3L 3ZSTA 3MRLB 3G9VA 3TIDA 1MRFL 5K5YA 4KI5E 2XBDA 3HE7A 3KBFA 4AK2A 1M1SA 2ARJA 1G94A 2RTTA 1GJUA 2R0ZH 1PJWA 2QSCL 4G9DA 4K07A 3TBYA 2OMVB 2VKXA 1OCRB 5IF0B 2EICA 4PJBE 3JTSB 4TUKL 4M62L 4NQQA 1HHIB 1J8HE 5GGSA 2OSWA 3GZPA 4KGLA 2X87A 3CN1A 4HZLA 1KFAL 1PLGH 4RBPK 4F15B 2VLRB 3BFWA 5EN3A 2J1KA 1U8JA 4JRFA 4DCQA 2EDDA 4UAOC 1HQRB 1I7TA 4HS6A 1JGEA 3QNXA 4KZ0A 3LKNB 4F3FA 3WD5H 1OF0A 1L9NA 5E1QA 2XQBH 3V5KB 2V3FA 3U7AA 3RVXD 4KGJA 2XG5A 1XGQA 3DHPA 3GEFA 3UPCA 2V6HA 5I8CB 1UXLA 4W6WB 1ZE3C 1L9OA 4ZSOA 1A7RH 4DTGL 2AEPH 3KW8A 3RJDA 4FP8H 5T1JA 3K6IA 4WY7L 2VH5L 4R0LC 3KVQA 1J9SA 3MRQB 1SHXA 5F1NB 3QO1B 5D7JA 1LEIA 3I9AA 1EIBA 3UBGA 4IU2B 1JZHA 1ML0A 5CEZL 4AEFA 2AXWA 7TAAA 2MNJB 5AYUH 1EERB 1DDHA 1BLNB 1PZAA 3DVFA 3I6GB 3QR1A 4MHHG 5DJCA 5ETUB 2IANE 1DJWA 1G4MA 1JF1A 3RIFF 4Y19A 5IROA 2WLIB 4BZ1L 2CBPA 1N7ML 2I69A 4BFIA 4JO2H 5E9NA 3F6JA 1CFQB 3AB0C 4AE0A 1KNOA 2XPGB 3SJVD 2WLLB 3T6XA 4TTGA