4DPBX

The 1.00 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 8.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin A, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dpbX00
4CSPA 1E5ZA 4DP7X 3OM3B 2J57A 3AG1B 3PLYA 1IC0A 3G5WA 3X1BA 3TA4D 1AS6A 1E67A 5E9NA 1SFHA 1GW0A 2YXVA 4DPAX 1NWOA 3TASA 1PZAA 3N55A 3QJRB 4A2HA 1I53A 1WA1X 4BDVB 4NERA 1AS8A 2VW7A 1JZJA 2FQFA 2BO0A 2J55A 2XV2A 3IN0A 3PCYA 1UATA 1OCCB 3EF4A 1TU2A 2PPCA 2XX0A 2HLEB 3GDCA 3V9CA 3IN2A 4DP0X 1V10A 1J9SA 3NSCA 1B3IA 1OE3A 3FT0A 5I5MA 1JOIA 3AW5A 1ZIAA 2YXWA 3EH3B 2I7SA 4A2EA 2OJ1A 4N8UA 1A4BA 1OCZB 2UXTA 5B1AB 2IWFA 1XB8A 4KNSA 4BXSV 4GY4A 1ZV2A 3QJUB 4M3HA 5AFAA 1WS7A 2WSDA 3DKHA 3C75A 1PLBA 1VLXA 3FYEB 3X2QB 2ZOOA 3ASNB 1BYOA 3WI9A 1J5DA 1SHXA 1DZ0A 5I6PA 3NYKA 4EF3A 1XB3A 4TXVB 4DP8X 9PCYA 2ZWNA 4RH4A 2PPAA 2YAPA 2TSBA 3H4HA 3FQYA 4AKPA 3UAAA 3CG8A 1WA0X 2QPEB 1IBYA 1ZDQA 2X87A 3ABMB 1J9QA 4A2FA 2CCWA 3UABA 4UF7C 2QDWA 1JERA 2W88A 4L0PB 3UACA 4ENZA 4E9TA 1AR1B 2VM3A 4HHGA 2BZ7A 5PAZA 2A3TA 3GYRA 3S3DB 2IDQA 3CVBA 4KO5A 4DP9X 1RKRA 4F2FA 3S3CB 3AZUA 4M4RB 3T9WA 1KBVA 2JFCA 3WNJA 4A2GA 4KO7A 3D12B 2PCYA 1PAZA 1AG6A 1HAUA 2EILB 4HCFA 4Q8BA 2EINB 3NJHA 2MRYA 2GI0A 3SQRA 2BWDA 1ZPUA 1PF3A 2FT6A 2PCFA 4YSQA 3OD3A 4HALA 4AKQA 3FU7A 1AZCA 1YLBB 4YVUA 2HRGA 1EZLA 2XV0A 1CC3A 2EIJB 2PP8A 3ZDWA 4Q89A 3NP4A 5LDUA 1NINA 3NJIA 2MTAA 4BK5C 3FSZA 1IBZA 5F7BA 2BZCA 2CAKA 1MG3C 2Y1AA 3WIAA 4F2EA 4YVNA 1MG2C 4YSTA 2HX9A 3NSFA 3WKQA 3GXUB 4YSEA 3NJGA 1A65A 1FWXA 2OV0A 1KV7A 3T6ZA 4QKTA 1CUOA 2Q5BA 4G7SB 3HB3B 3ZBMA 3MX0B 1RZQA 3OQRA 2XLLA 3QJTB 2UXGA 1BQ5A 1KBWA 2UX7A 3TBCA 4NB7A 4BXVA 7PCYA 2YAEA 1TEGA 2XU9A 3AG4B 4KOBA 1NZRA 4BWTA 3NT0A 3PAZA 4HZ1A 4YSCA 4BWWA 3T71A 3T6VA 4WTQA 4ZK8A 4E9SA 3ERXA 2AANA 3ASOB 1JXDA 2HXAA 4AZUA 5I6LA 5B7EA 5TK4A 2W8CA 1A4CA 1OF0A 4YSOA 2VM4A 1OV8A 1A8ZA 2NRDA 1CYXA 5I6NA 1NPJA 3FU9A 3DIVA 4DP1X 6PAZA 2Q9OA 4DP6X 5F7AA 1CYWA 1PCSA 2YAQA 2FQGA 1JXGA 1M56B 4K9JA 2GC7C 1F56A 3PAVA 2UX6A 4CSZA 1X9UA 2VSMB 8PAZA 4G72B 3CVCA 1BXAA 1PLCA 3FSVA 4MFHA 2UXFA 2IWKA 2YAHA 4G7QB 3FSWA 3FU7B 1ET5A 3NJMA 1AG0A 4NAJA 2RACA 4A66A 3TBBA 2FT8A 4DPCX 1WA2X 1GS8A 3NJKA 2R7EA 4YSSA 1ADWA 3TU6A 1L9PA 1HFUA 2FT7A 2HZHA 1ASPA 3IEAA 1SJMA 1MZYA 1W6WA 3SBQA 1ASOA 2UXVA 1ASQA 1GY1A 1QNIA 4JKNA 1J5CA 1A4AA 3FYIB 1BYPA 2XXFA 2YAMA 3FU8A 4DP2X 4E9RA 1AZBA 1SF3A 3ZIYA 2DYSB 2PP9A 4DP4X 4GYBA 2BW5A 1RCYA 5A7EA 3H56A 2YAFA 3KW7A 1ETJA 1URIA 2WO3B 1X9RA 1KYAA 2VW4A 7PAZA 1AOZA 4HIPA 4HCGA 2XVBA 1TKWA 1JVLA 4FA7B 3NJLA 2HX8A 2DV6A 2EIMB 4P5SA 3DTUB 4N4YB 2I7OA 4BWUA 5B3SB 2IDUA 1V55B 3NJFA 3X1EA 1L9OA 4YSRA 4W1TA 5I28A 1JZHA 3X1FA 4W9ZA 1MZZA 4JHUA 2BHFA 2JKWA 3UGEA 5B7FA 1ET8A 4KNUA 1T5KA 4UANA 5I6MA 1BQRA 3WKPA 5B1KA 2IDSA 2XYBA 1L9SA 1QLEB 1JZFA 2CBPA 1OCOB 3UADA 3NJNA 2CALA 1JZGA 2QPDB 1JZEA 1OCRB 3IBOA 3QQXA 5I5IA 1GY2A 5AKRA 4A67A 5I6KA 4GP8B 1M9WA 2H3XC 3ABKB 4GP4B 3PXLA 1PY0A 5B1JA 5D4JA 1CURA 2DYRB 2IAAC 5D4IA 2I85A 1NTDA 2HX7A 3AY2A 2IH8A 2ZXWB 1OOWA 1GSKA 4P5RA 4KO6A 1BXUA 1SNRA 1DYZA 5B7MA 3ZX1A 1HAWA 5I5JA 3BVDB 3UAEA 3OMIB 4E9WA 1ZIBA 2XXGA 1IKOP 1QHQA 2HRHA 2R7EB 4YSDA 1W6LA 1JXFA 3L45A 3HEIB 3BQVA 3T6XA 1GR7A 1A3ZA 1J9TA 3N2JA 2DY2A 3WG7B 1J9RA 2VW6A 3SBPA 1AAJA 4AI7A 2BP0A 1WAEA 2XX1A 3H4FA 2BP8A 4QLWA 2GC4C 2XUWA 1SF5A 3S8FB 2FNWA 5IY5B 1TEFA 3RYMA 3CZUB 1AANA 1KGYE 3MBWB 2AZUA 4G70B 2ZONA 2XV3A 1KDIA 3V9EA 1NICA 4WKXA 1AIZA 1E30A 1SDDA 4UAHA 2YAOA 3AG3B 3EHBB 1E65A 2XWZA 1PMYA 2IH9A 3FQ2A 4PCYA 5I6OA 2AFNA 3AG2B 1GS6X 2AVFA 2QT6A 1BAWA 1FFTB 1PZBA 2J56A 4YSUA 1AQ8A 1SHWA 3IE9A 1M57B 2CJ3A 5FC9A 2BWIA 2DWTA 3S3BB 4KO9A 5B1JC 1AACA 2PPDA 4A68A 3NP3A 3QJSB 5ANHA 2IWEA 2CUAA 3PPSA 4JHVA 2VN3A 2JXMA 2FQDA 3ABLB 3SBRA 3CVDA 4DPBX 3JTBA 2BW4A 1NIFA 1NIDA 2GIMA 5TK2A 3FS9A 1PLAA 4G7RB 2YARA 1ILSA 3CDZA 1KDJA 3OMAB 1PNDA 4DP5X 2VMJA 4HHWA 4FAAB 4AX3A 4E9QA 2FTAA 2H47C 1W8EA 1AZNA 4E9XA 3FPXA 2GSMB 3FPYA 1XB6A 4F7KA 3NSYA 3KW8A 2EIKB 2DWSA 4YSPA 5PCYA 1BEXA 1E5YA 2B3IA 2GBAA 2IDFA 2BP0B 4YSAA 4X4KA 2PLTA 2BP8B 4HAKA 2YQBA 5B1BB 4KOCA 4BDVA 2H5UA 1N68A 1FA4A 1GYCA 3OMNB 1GS7A 3QJQB 2B08A 1MDAA 1SDDB 2P80A 4KNTA 4AKOA 2P80D 4G71B 2FJSA 4PAZA 1XMEB 3FQ1A 2OCCB 4HCIA 1OE2A 1ILUA 3QJVB 6PCYA 2Y69B 3JT2A 3PAUA 4E9YA 2IDTA 1NIAA 2GHZA 1JVOA 1NIBA 3U25A 1ID2A 1AZUA 4E9VA 3QPKA 1NWPA 4GXFA 2QDVA 4YL4A 2FWLB 1R1CA 1N70A 1WS8A 3X1NA 3ABGA 1EHKB 1PZCA 1L9RA 3T6WA 2LLNA 1KCWA 1IUZA 1AS7A 1ZDSA 3NSDA 5EHFA 3EH5B 1PNCA 1NIEA 1AZRA 1BQKA 3S8GB 1SFDA 2VSKB 5D4HA 3WNIA 3FSAA 2E86A 3EH4B 1NDTA 3X1GA 2PP7A 1L9TA 4A2DA 1BXVA 5AZUA 2FQEA 1JZIA 2N0MA 1V54B 2X88A 1OE1A 4GP5B 2PPFA 3CDZB 1L9QA 2WO2B 2J5WA 2TSAA 3NJJA 5I26A 1NPNA 2GB2A 1RZPA 2AZAA 1ET7A 2PPEA 1KCBA
chains in the Genus database with same CATH superfamily
4PJ7E 3MCKB 2B5IC 5D1ZI 5AKTA 4Z3GA 1RVFH 2PNDA 4B3EA 3AG1B 3WFBH 1UG9A 3MRBA 2YKKA 5EU5A 1URLA 4ALAL 1I7UB 4Y4KC 5E9NA 4JREC 2MQCA 1M2VA 3O6KH 2DYPD 4PRDA 5EBLA 1NWOA 3TASA 3FU5A 2FJFA 4M03A 1N6QH 1DO6A 4K5PA 3SYAA 4ZXBB 4IHOB 4B5ZA 4WY7H 4ZS6D 4E0RA 5D2LA 3T0WA 4YBQD 3O0RL 1F4WL 4APQA 4KUZL 1PLGH 1LYQA 1V10A 2EABA 3FRUB 3S3SA 1F1DA 5JIHA 1ZIAA 4YL9A 4QXGL 3RY4A 4M7KH 3MJWA 1FN4A 3C5JA 2ZUQB 2EZ0C 3S96A 3MAWA 4PS3A 3RUGE 2XQBL 5IB1A 4P3WA 4ONHB 3QUKB 4KK8D 3FQXA 3UJIL 3BGMA 3MRQB 4F2MB 2EVFA 3F5WB 3DKHA 3TBSB 2UYLA 2X2JA 4I4WB 4H4NA 1PJWA 3ML9A 1XB3A 5JPMC 2Q6WA 2Q76B 4K4KA 1ZA3A 4FGMA 4DZ8A 4XVSH 1CGSL 5C1MB 1H15B 3TVMA 1G43A 5LDSA 3KLKA 1JWSA 2FEEI 5IW3A 2NT0A 1J9QA 3HE7C 5DS8A 1HOCA 2BVOB 5A6IA 1L9NA 5A3IC 4P5TD 3VFTA 5D5ME 3QNXA 2IG2H 3HG0A 1KCKA 2ALAA 4QD2E 3GYRA 4I2XE 1RKRA 2IPUK 4PRBA 5ISZA 1ZHLB 1OARH 1XCTB 5E5MA 5H4YA 4PRIA 2V5TA 2WM0A 4YFDB 3FUNA 3ARBA 4YHIB 2NYKA 3K2IA 4PLOB 1GA2A 4TQ8A 2Y2WA 3H3KA 4Z95H 4WTZA 5DD3L 3ULUF 1Z9OA 3WUWG 1NCAL 1QAWA 3V6ZB 5I1EL 5A2AA 1AZCA 4ZUVA 3FHAA 3TO2A 4P4KA 4YWGL 2JJTA 4YBQC 4I3RL 3UP6A 3M1BB 2BERA 2GK2A 1R3HA 1UXSB 3IJ9A 4Q89A 3UTOA 5JOFA 1HNGA 3OAUH 5IEKA 3V52H 3ARDC 3SE9L 3RIKA 1CICB 5HJDA 4BKLA 4OGXH 1QLRA 4HWEH 5ADPH 2ESVB 1X5IA 2MCPL 3QZOA 5IOPA 5T3XH 1T5XA 1BD2E 1RIHH 3FMGL 2LVCA 3IE4A 3OX8A 3E8UL 4GI6A 1ZLUK 3HB3B 4GAGL 4PRAB 5DJDA 1IGML 4AZ8B 4I0CC 1S46A 1E4KC 4XXDB 2KT6A 2EDDA 4HIJB 2X1QA 1QRKA 3MLSH 3MGAA 1NKRA 1F3DH 4LSVH 1CXIA 4WV1C 3D2TA 2BNRD 4PCKA 3WGVB 1JRHL 4JDVA 4XPGL 2HB0A 2BRQA 1P7BA 2L04A 2XN0A 1TZHA 1P1ZB 3G5XB 3HZYB 4M6NL 3BN3B 3THMH 3RFZB 1UJ3A 3LV3A 3HR6A 5E5UB 3WE6A 1S9XA 4YHZH 4R7NB 5CBAB 1D9KC 1HHJA 3NABH 5MP6H 3EO1B 3EW3B 4LEBA 1SOKA 1MVFA 4DTGH 4UINH 3KM2A 3H8NA 5HYIA 4PM1A 3K8MA 5CWSB 2W9DH 3VGAC 2EDKA 6PAZA 3QAZC 3Q48A 1NDGB 3HN3A 1PCSA 4WUUA 5CZXD 1UWEL 5C8JA 4XB8A 4GRLC 4LAQL 3ALPA 1MUJB 4H2AA 1BBDH 3BPNC 3HNVL 4PJXF 3NIDE 5C0RL 4XMZA 5I9QB 3KPPB 2G2PA 3PAVA 1H5BB 1AGDA 5E2WL 2NY2D 3SZKC 3UTSB 5DVPA 1SEQH 2AEPH 3BVWA 4MFHA 3V0IA 4U1GC 5T5NG 4N0RA 2VZTA 1JPGA 3LIZH 2FX7L 2JK5A 5FYLD 5ALCH 3M45A 4YS4A 3CZEA 4I0PB 4NFBA 1N59A 1MCLA 4U6HB 3QWRD 5F89A 2W94A 3WJJA 5GGVL 2JKRM 5L0QC 1K5NA 1CF1A 3C08H 3A6CL 1T04A 3VCLB 1RK1A 2FECL 3P3UA 5E2JA 4XCCH 4WZ9A 1OCWL 4WI7A 2JB6A 3K72B 4Y9CA 5FM4A 5F1SA 1DL7L 4XVUC 5E03A 1JIBA 3MRRA 3VG9C 1OTUC 3HE6D 1TQBC 3S5LG 4IRSB 2RMNA 4J1UA 2Q3ZA 3G7TA 1RULL 1S9KC 4KRMB 2XACC 4LEEA 1A6TB 3SPHA 1ANUA 4UCFA 3KE0A 1E3FA 1URIA 1J7VR 2EEDA 3BE1L 4HBQA 3FB7A 1BBJB 3B37A 1RD6A 5IB4B 4Y2DC 4S1QH 1RZJL 4OSUH 5D2LF 2CU9A 3FNKA 3TPUA 4Z7QE 1T4KA 4JRXA 2ICES 4UWQB 1HXYB 4FTVA 4B50A 3L5IA 5KJ4A 4U6XA 3IS1X 3X1EA 3MZTA 4M02A 2X4RA 4AUUA 4EN3B 1OW0C 5F3HB 3W11D 5FM8A 4B0MM 4Q6KA 1KTCA 4YDKL 4L8DA 3HS0C 3Q1SL 3ZJAA 1BM7A 4P59L 4ELME 4GQRA 1MRCL 4M8QA 3B34A 4ZMQA 3WDIA 2YIHA 2FEDD 2DQMA 2YBRA 2GBUA 3HNTL 4QT5B 2NY2C 1P1VA 3B1UA 4TF4A 2DZEA 3UXFA 5GZNA 1AHWC 2Q7YA 1IU1A 1TJGH 5GSRA 3G04B 2YRZA 3ZYIA 5I5IA 5F1OB 4N22A 1FBIL 4R90H 1BLIA 4DPRA 4HQQH 2CHWA 1W16A 3ZOAA 4JQXA 1R3JA 1WFNA 1CLZH 2N01B 4OI9A 1MREH 1I7TA 3GSNB 4KAQH 2DQEL 2P5WA 4P5MB 5BOPA 1NBCA 3LJ3A 3RDJA 2X3CA 2Z8SA 4JFYA 2ZUYA 2HN7A 2I69A 4N6RA 4NP9A 2IH3B 4XPFL 3TCLB 4CVXB 2XXGA 2F54A 5ANMA 4DOHB 4PP2B 1PY4A 3PPEA 4YSDA 4V1DD 4HKJB 2YPVH 3OR7A 4J39A 3PGDA 3NCFB 3CFQA 4ELDA 3OJMB 3OAYH 3OVUB 3O8XB 4B9KC 2AQ3A 5TDNA 3FFDA 4W9KC 4RGMB 3IDGB 3KYKH 3P0GB 3HC3H 4FP8L 4LSQH 1HL5A 2DQ6A 3N1MC 3VJ6B 1FVCB 1YN6A 1I9IL 3QO0B 3REWB 2AI0L 2RIKA 4G9FD 1UWYA 2VMCA 1TTUA 3BDYL 2XUWA 3VWKA 3CVIL 1LD9A 1SF5A 2VKWA 5C6TH 2Z4TA 4X9GA 4ZX3A 4FQCH 1HE8A 4HLZH 2XN2A 1XSOA 5FYLH 1VZGA 3DXAB 1OSYA 3UJJH 2HFFA 5JXAL 3GRWL 4QO1A 1WJ3A 2AF2A 3D6GA 4BSVB 3TN0D 2CLZA 4GB9A 1ES0B 1OPOA 3A67H 1CFQB 4KH9A 1N3NB 1XGZA 5IK3A 4DZBA 3EHBB 2J88H 2C1OB 2ICWJ 4PCYA 2CH8A 2FEDC 3WJLC 3JV4A 3GI9L 3ZKXC 3TV3L 4OLXH 4O02B 2X6MA 2APSA 3DI3B 3VFOB 4ZFGH 4J2XA 1ZS8B 1F86A 2J56A 2Z8RA 3UP1A 2LFEA 2XJKA 1FC2D 5DJYA 3CXHK 5JA9A 5FC9A 4QRTB 3WNOA 1QATA 2MNJB 1YEWA 3KWUA 2CUMA 4XC3L 4HCRH 1D2PA 2PPDA 1HCFX 1JVKA 2VLJB 3O41A 4WHDA 4OTXL 2B3RA 3QUMA 1W72A 2XWBB 4MMZA 1GOFA 1XGTA 4U4BA 2X4QB 2FNBA 3FOMA 4FC3E 3SYOA 1S9WA 2VDNH 2YOAA 1EXUA 3PWJA 3UMNA 2GIMA 5ERWB 4ZQKA 5HHXH 3FS9A 1N0XH 2F1AA 2WBKA 1JHLL 1KDJA 2Y5EA 3QUZD 3ME0B 3MNMA 2EKJA 4J7RA 3VXSD 4LLMA 4NZUH 1E5UI 5AAWC 2H47C 4HJSA 4KKPA 3V9FA 3IPEA 3AMKA 3ECQA 2Z7WA 1KBGL 3MCKA 4LVHB 3LS4H 1I7UA 1J0IA 4PJ9B 4GAYB 5LQBH 1T03H 4X99B 2VMEA 1NLBL 3TN0C 4IHOA 3NZ8B 1BX2B 1MAML 1VRSA 1NFKA 4R4FH 2MPVA 4U0QB 1AE6L 4G71B 3SDXE 3EFOB 2VXUL 3R8BB 4KK9C 3FRUA 5IV2B 4U0RC 3ARVA 3M8OL 3Q6GL 2RCSH 4K3HA 3JT2A 2BOCA 1OGAA 4R84A 2DJ4A 3BMWA 1KCSL 1RZKL 2LOEA 2R15A 1UFUA 4ONHA 4LKXA 5EUOB 2DKUA 2VMDA 1BIHA 2QDVA 2Y0SA 3MRQA 4H1LG 4F2MA 5I0WA 2CHNA 2XBTA 3F5WA 3TBSA 1IBFA 4M5TA 4A6YL 3D85D 2YD8A 4I4WA 3V7MA 1UH2A 1GGTA 3FOLB 4J3SA 4RISH 5CU9A 1FF5A 4NC1E 4S10A 3ZTNH 3U4AA 1L9RA 3ZSTA 4TUKH 1RFDL 2F5AH 5EHFA 5EU3B 3D69B 4PBVC 4Q74A 2YN5A 3KPSB 1H15A 5L2JB 5J9PB 2JXMB 3LSOB 4XWOC 1C16B 3WNIA 3QUZC 2BVOA 3K46A 3JWDL 1DUYB 4J3OD 1ZANH 1KPVA 2AXHA 3SGEH 1P4IH 2F74B 1DJSA 3VD9A 2Q87A 2WGNB 4AMWA 2O6EA 3GI8H 1ACZA 4UTBL 4AGNA 1NPNA 1ZHLA 1XCTA 4JDZA 4MA8H 4Z3JA 5J6HB 4JQVC 3D51A 3K71B 1BDYA 2ZE0A 3QDJB 1CLCA 1JTOA 1ZVYA 4GFTB 1L0XA 1QHPA 2NNAA 1A5FL 3CFUA 1Q0XL 3UTPD 2FEEL 2XN9E 2F2HA 3DNKA 3PIQB 4Z18A 3T3MF 5CKAA 5KVGL 3M1CA 1AI1L 5IMKA 4WI9A 4XNBA 1QSFB 4JG1H 1CFSB 4CRPA 4DPAX 3V6OA 1CTMA 4WWID 3CU7A 2QVIA 3V6ZA 4O5LH 1ZLSH 3JWNG 1U8KB 4HIEB 3UJTH 4ZW6A 2OR8A 3ZHDA 5GS0D 3M1BA 4IOSA 1LDPL 1U2CA 5LUMA 1UXSA 1GKEA 1JZJA 2GJ6E 1JK8B 2VDML 1CICA 4MJ2A 2X9XA 4QYOB 2ITCB 4W9HC 2CO1A 4KMTH 4EEEA 4FNRA 5CP3H 3FFCE 2ESVA 1RUMH 3IN2A 2DLFH 1USZA 2AXWA 4JZOB 1KJ3L 5SWZD 2Z31B 1JOIA 1QQDB 4PRAA 1NGXB 1EUTA 4LSSH 5GS1B 5HVFB 5H37G 3PP4H 2DH2A 4AZ8A 2A7BA 1B4JL 4HWBL 4LCYB 4HIJA 4QHKJ 3H85A 5AAMC 2X12A 5IQMA 4C57C 2VJ8A 3BUBA 4HH9B 1XZ0A 4MXQC 4RMRA 1PQZB 1OD9A 2X4TB 4JANB 3VH8B 4DOHE 3QCVL 4UOW0 2Z4QB 1SHXA 3QDAA 4TXVB 5CEZL 1WH0A 3HZYA 1P1ZA 1FH2A 3G5XA 3O4OB 4AKPA 25C8H 4UT7L 3RFZA 2LW3A 5L8LB 4Y9FA 4NPYB 3DROB 4R7NA 4KXZI 5E8EA 4M5ZL 1BEYL 4N68A 5CBAA 3EO1A 5C9KA 4QHUB 4MJHA 2AITA 2J1WA 2W88A 3DX9B 4KTDL 4TYUA 3RL2B 4HOZA 1AR1B 2VM3A 2E9GA 5CWSA 2QHRH 2WV3A 5BUGA 1AMYA 1NDGA 4TQHA 2DM2A 4K23L 5BW7A 1CDGA 4KPHL 1T0NB 3A4FA 1MUJA 2IAMA 5LGJB 3S8WA 1WUNT 4HPYH 4U1NB 4L8CB 3KPPA 3HNSL 5E7FA 1H5BA 3MBEB 3QUGA 2W65B 1FPTL 5GS0C 1ZVSB 3UTSA 2APWA 2ZNXA 2XV6B 5LG1A 4KRNA 3TA3D 1JGEB 4XC1L 1AR2A 2IANB 4AYSA 2XV0A 5IF0B 4U6HA 3QDGD 2EIJB 2E5EA 1MFDL 4FZEH 3WO4C 3LCYA 3UYRH 1AQKL 2A9ML 3VCLA 3OQ3B 1QACA 1I9JL 2D7TH 3LQZB 3QIWD 4RSYA 3K72A 4YVNA 4J3OH 3FULA 2KBGA 2QQNL 3L3GB 2VLME 4LEOB 2DEYX 2Q5BA 4G7SB 2ADFL 2PTTA 1CFVL 4IRSA 4EIZC 3L4YA 4Y9EA 2XLLA 4I3GA 1Q38A 4Q9RH 4OM0H 2E7LC 2UXGA 2XZCH 5HHPB 3VXRD 3GBNL 1A6TA 3JSSA 2UX7A 4YIQB 5EU7E 4FS0A 1BBJA 2YAEA 5INDB 2RALA 3BT2H 3NT0A 1UD6A 1YJDC 4OQTA 1NFIB 2YD0A 5IB4A 3A21A 2I27N 4W81A 4JN1L 4TVPL 1QBMH 4AK2A 5GS0H 4U3XA 1HXYA 3IWUA 4NKMB 4F58L 2PUQT 2W8CA 3QRGL 5LB1A 4EN3A 5F3HA 3GLDA 4QI3A 3ATFA 2W59A 3QS3A 2EIDA 2ZWKA 5FYJE 4JKKA 4WFED 1JGVL 2ZX7A 3LKOB 1A9BA 3CCHB 2VDOH 1I8KB 2Z64C 2HT4D 3MNWB 1OZUA 4JO4L 5BZXA 4QT5A 3S36L 1OGTB 1TFPA 2H32H 3ZL4H 4M7LL 3S0PA 3KXFE 3TA3C 3G04A 2VN7A 1UGKA 3F58L 3SKOA 3KLAB 5E6IB 5DLML 4LVOC 5BRZD 4CSZA 3NTCL 1BXAA 5EEVA 4EI0A 3RX8A 3AGVA 1MW1A 3BD5A 3GSNA 1AC6A 1LDSA 4P5MA 3ZHNA 3QIWC 2Q20A 4MXVF 4B97A 4NAJA 3TCLA 5CD5D 4CVXA 3BAKA 1YJDH 3RIFK 1ORSB 2Y22A 4PP2A 4BK4A 1A6ZA 1TZGH 4R7LA 4PJEE 3PWUB 4HKJA 5ICUA 1RK7A 3GBML 5CF3A 3EADA 3T8VA 2YD5A 3TS8A 1ASQA 2QQLL 4DGIL 1FH5H 3DO7B 3O8XA 1D5XB 4HMDA 5HDOA 2WLLB 3IDGA 2YK1L 3FU8A 2ZIDA 3VJ6A 1B2YA 1FVCA 3QO0A 5AB1A 3REWA 5MEOB 3LN5B 2AEQH 3GT6A 5DZAA 2XTJB 1URZA 2VQ1B 5TTRA 5L6YH 2WO3B 4GUPB 1Q1JH 3N42B 5D93C 4AITA 5D7LD 4ZS7L 5FUOH 3N9GL 3B9EA 2WKGA 4ZNCD 1CD9B 2CG9X 4NUGH 1GJUA 3DXAA 4OGAD 4LRIC 1Y1DA 4BSVA 1ES0A 4PRPD 1A25A 1WITA 1N3NA 3LMJH 3LHPL 2HT4C 2MFNA 2A9NL 2C1OA 5E08L 4MHHG 1JPTH 4I9XA 1TUPA 3QIUD 3CFTA 4GUOA 4FZ8H 2XT1B 1WZKA 3NCCB 4XP9L 3SPVB 4O02A 1TSRA 3VFOA 4NFDA 1ZS8A 2YA2A 2OULB 3M6DA 4P0DA 5EF1A 1UCBH 3JV5A 4PJHB 4YK4C 4FQ2L 2CBPA 1OCOB 2P8LB 4QRTA 3NJNA 2BXZA 1JZDC 4F57H 3DX3A 1PFOA 4J3WA 1YEKH 4UIKL 4WLCA 5KYWB 5DURD 2FO1A 2VLJA 5AKRA 4C56E 1U30A 3EJUA 1M9WA 3UH8A 1NLDL 4X6DE 4D9QD 3RNQB 2XWBA 4IKKA 2NXZD 3HG1D 1N12A 5JW4N 2X4QA 5E6ZA 2XPGB 5C07B 2QPUA 1PKQB 4KROD 3S37H 1J0KA 1I75A 3UAEA 3OMIB 1BMZA 5ERWA 1EJFA 3D3VE 1SLXA 2EC8A 3VXPB 1T89A 3ECBB 4K3GA 1CFMA 1NC4D 3ME0A 1CIDA 4JFDB 2YUXA 3G6AB 4R9HA 1JNNL 3PWPB 4XCFH 4WI3A 4HF5L 2BIQA 5C86A 2Z9TA 2WXQA 1S3KL 3L9YA 2VW6A 3KS0J 1NEZG 2IOMA 3LPOA 1A14H 1A6PA 1YNKH 2XX1A 4PJ9A 4GAYA 3D2UD 4HU2A 1NANH 4XZ4A 1L6PA 1VFMA 4OGAC 1UACL 5J3HC 3W2DL 3GKZA 5EWIH 4X99A 4BA8A 4XP1L 3VD0A 1X5GA 1MCIA 4ONFL 3NZ8A 1BX2A 3RYMA 4DGVH 5BRQA 3MBWB 1E9OA 4NI3A 4HSAC 1TJIH 2VQUA 1OAXL 3DSFL 4UQBA 5J13C 3MXWH 3WTYA 4CDHA 2YAOA 4HFUL 1N7ML 2YRPA 4R83A 3EFOA 4H88L 5F6IB 2Y24A 3BUQA 3RWGB 2XPZA 4WI2A 5IV2A 2IH9A 7TAAA 1E90A 2ZX6A 2E27H 1UUSA 3D9AL 4F24A 4Y88A 3U9WA 3PP3K 3MA9H 4M48H 3MC0A 4XBEH 5MI0B 4PRHB 3VQ2C 1RUPL 3RTLA 4YHYC 5EB9A 1AO7E 3FU3A 3QEQE 4QF1B 4XMWA 5F9AC 1PX4A 2XJLA 4M7ZB 2NXZC 4B9YA 2TAAA 4ICXA 4HT1L 5TF1H 4L4TB 1KENH 4Z7UE 3QI9B 4KROC 3EJYD 5ANHA 1H8OA 4DKTA 4LIQH 2R8SH 5EU3A 2QSQA 3D69A 3KPSA 5L2JA 5J9PA 2JXMA 3AC0A 3LSOA 1C16A 3KLSA 4MA1B 4PB9L 5AOZA 4OLYH 1DUYA 3ESVF 2BW4A 4A6YB 4Z78B 3FUDA 4PB0H 5FAAA 5GS2H 3N1PC 1P84K 2WN2A 2NQDA 1LK3L 2YMXL 3PDGA 4YHLH 4LKCB 2BPBA 2FD6L 4JFFD 1XD0A 5I6XB 4S1SH 2APTA 1L0YA 2G3MA 4NWUL 3UOAB 4DEPC 3IJEB 5J6HA 3K71A 3QDJA 4HS6B 5DMIH 2AKRA 4RQQB 3CZLA 2OTPA 3L7FB 5JPNC 3IU4L 2IWGA 3PIQA 2OK0H 1IT9H 3TP4A 1TF4A 1QSFA 3LH2H 1CFSA 2IH1B 1LNUB 4LHUD 2Z1PA 3CH8A 4MNGE 1U8KA 2DF3A 3EOTL 4HIEA 4Q6IB 2B14A 3MLPA 5CP7B 1QR1A 3O9WB 1B90A 4D0DB 1GYCA 2OSYA 4FKKA 4IBZA 4X7EC 4P48A 2X40A 1YQVL 2VLKD 2M8XA 2C9VA 3LNIA 1OLLA 1CXFA 3DVIA 1JK8A 4PW9A 4F8NA 4XWGL 3BWUC 4OJYA 2ITCA 4QYOA 4TRPH 5FLUA 2IOIA 2O5ZL 3RDTD 2B1HL 3OXSB 3PGFL 3FQ1A 2YXFA 4ZYKA 4JZOA 2Q8AH 4YOKA 2Z31A 1QQDA 1NGXA 3PAUA 5GS1A 1NGYB 1D5IH 4KX8A 1EEQA 2CGRL 3KD4A 1UOKA 3QHZL 4LCYA 3QQNA 2VDMB 3DTXB 4KVNL 3I3EA 1BJ1J 1UASA 4HH9A 5DJ2B 3H9ZA 3C5XA 4G8GE 4CC4C 1TT6A 4N0UB 4YL4A 1PQZA 2QVMA 2X4TA 4JANA 5EC2B 3UTQB 3VH8A 2Z92B 2Z4QA 2VDKH 3O4LB 4ODTL 1INDH 2R4RL 4L5FE 1ZDSA 4C4UA 3B9KD 2BNUB 2ITEA 2ZUUA 4NPYA 1G1KA 2NY4B 1KXQA 2H1XA 3WXWL 5A2IH 4QHUA 4YJZL 1A1NB 2IADB 4UOJA 2E59A 4WWPA 3RL2A 3DX9A 5AZUA 5H94B 4GP5B 1YYLH 5KANI 2J5WA 1IJ9A 3NEOA 3VXNB 5E99H 5JIKA 1SM3H 1K6QL 3C6LA 1ZT4B 5CCJA 1T0NA 1TJXA 2R0ZL 4KQ4H 1IGCH 4YBHA 1A2YB 5LGJA 5DCCA 4L8CA 4LDLB 4Q4IA 2JMRA 1ZD6A 3S4SG 2QTEA 2V3EA 5JHBA 5DRXB 1ZVSA 3U9PH 4AIZB 1NCDH 3L3KB 1JGEA 1KGUA 4C4KT 4M1GL 2IANA 1I53A 5IF0A 1FL5B 3RDTC 3N1QC 5F9WC 3FXIC 3LQZA 1OCCB 3ZZ1A 4L0ZA 1C1EH 2AMGA 1K72A 1X5ZA 3LKNB 3QXUA 4DP0X 4UAOB 2DLTA 3MRCB 3ZXAC 1S5HB 3L3GA 2W0KA 3MV7E 4LEOA 4NOFA 3RGVB 5CAYB 4EUPH 1MHHB 2XZAH 3OB0H 5EZIH 1LEIB 2QADB 1I31A 3EO9L 5DUBB 5HHPA 4D3CH 3MRJB 3ZQXA 4K94C 4GY4A 5KW9L 4N0CD 4YIQA 2A0LD 4ZMOA 2BP5M 1X5KA 5INDA 2WZ5A 3B9KC 2WSDA 3FYEB 2XZZA 4I8DA 4K3JH 4OVVA 2MSPA 2A1WH 4IW4C 4X5PA 5AW3B 5E24E 2EDNA 1ZT1B 4NKMA 5I1CH 3BUPA 3UAAA 4FQLL 4R3SB 4YQXH 4YPGA 4FMVA 1XBRA 2HVKB 1WBZB 2WLZA 3NQKA 1UQSB 2EICA 1NCOA 2CCWA 3TH2T 4UF7C 4KBPA 1ZLWH 4WAFA 3SGEI 1NMBL 1XSKA 3LKOA 2QR0B 4X6EB 1GMEA 3CCHA 4AQZA 3IXAB 1I8KA 2X44D 5J12B 3S3DB 5CO1A 3ZK0A 3MNWA 4AYGA 5EUOF 3BAYA 1OGTA 2A74B 3PABB 5LBGA 4FQ1H 4AQ1C 4ERSH 2OSLB 4KVCH 1NGQH 2MQ3A 2EILB 3KLAA 5E6IA 2EINB 2NSQA 3LPGA 1L3NA 3ULVE 2FB4H 43CAB 4OZGE 4HALA 4C4KO 2J3SA 4OCSL 5AAPA 4KI5D 4X7SH 3NJVA 2BVQB 3QJOA 4YBLC 4BE5A 5LDUA 1ORSA 3GXDA 2GJRA 1KLUB 1PBYA 3DV4B 3BO8B 3PWUA 4WSGA 4P2RD 3MLZH 2J71A 2NXYB 4N28A 5I1KH 1BP3B 3EJSA 4H13C 4P07A 1RPQA 2EQDA 5CZVL 3DO7A 2OV0A 1D5XA 1B88A 5DJZA 4P06A 3S37X 4JGJA 2A0LC 1XV8A 4M93B 2J43A 1OAQH 2Y1ZA 3WIIL 3I2CL 5EBMB 1QFOA 4RX4A 3LN5A 3LHAA 3VAEA 3WY2A 1WF5A 2BFVH 5TJWK 2VQ1A 2EIEA 3MDJA 4MYWB 2DW5A 3W38A 4D9LL 1E4WH 3MJ7B 4C4BA 2G0LA 3OSVA 1MY5A 2CKBH 3CZGA 5GGRY 3T71A 4AEHL 4Y19B 4YC2C 3KBHE 1OKEA 5B7EA 1DQIA 1O6TA 2FZ3B 5CR1A 2WW8A 3BAWA 4PY7B 2QZ5A 3DARA 1IM3D 2VM4A 3GWJA 4M4PA 5LWYH 3BC9A 3SPVA 1CR9H 1U3HB 3CLFL 3KDMB 5JW4R 2FSDA 5IFAL 3UPRB 3GRWA 5EU6E 1DQVA 4PJHA 1UWGL 2P8LA 5K9JL 1J8HB 4FXGC 4XGZB 5KYWA 3EBHA 3TCXA 3LNDA 1VFAB 4KI5C 2VSMB 4P8QA 4JFEA 1BQHG 3V95A 3QPXL 4QRPE 2IWKA 5HDQH 1F11B 5AB9A 1IC4L 2QHLA 3P4NB 2XPGA 5C07A 4PJ8D 3NJMA 1PKQA 4BZ2H 4OKDA 1RJZB 2WGXA 3FN9A 4UOQA 1U9KA 2FCBA 3MV9D 3ARSA 8CGTA 3AXHA 2UWEE 3VXPA 3ECBA 4P2OC 4KKQA 2AABH 2X70B 1OB1B 1ACXA 3QQ3B 5CM1A 5F96L 3BH9B 2RAMA 4JFDA 3G6AA 1SGKA 3PWPA 3KWTA 2OAAA 3FN0H 1N64L 2EECA 4O51B 1GTNA 3BAEH 2PYED 3J7HA 3TTYA 4IIQC 4IK7A 1LMKA 1PIGA 4BUQA 3HRPA 5DS1A 1KV3A 5F97E 3AY4C 3ZIYA 3GZPA 4JZJC 2VTFA 1HIML 4XMPH 4ZNEA 1J0HA 2F53B 1E7VA 2YAFA 2EH8H 1E4JA 3HLAB 1CE6A 2XVBA 4ODWB 1GGCL 6CGTA 1JVLA 5FECA 3MA7B 3MBWA 1EAQA 1KTKE 3ZR5A 2DQGH 1A3RL 2H2PC 4XI5C 5DVNA 3IM1A 1SMAA 4J8RB 4PG2C 4U6VH 5FWQA 4HXAH 4LGSB 5IUCA 2HSIA 3QFJD 4GW1B 1I8LC 3RWGA 1DJXA 4JCMA 3QARA 5DZOA 5A6LA 5GRVK 4KITB 1QZNA 1CD1B 2YQ2A 3MYZA 3FH8A 2F8OA 3MNDA 3V4PH 3SPIA 4PRHA 4POZC 4Q4EA 4DCQB 5DZVA 3VE0B 5KSUB 4L18A 1DVSA 4QF1A 4JX0A 2DMGA 5D1XE 3ZDZE 2YQGA 4XNDA 4L4TA 2APVA 4I9WE 4Y5XC 4PJ8C 1D7DA 3DOSB 3QI9A 5JZ7D 3T3PB 2NR6C 4OJFH 1PY0A 1IBGL 2YS4A 3D4CA 3F00A 2NW3B 2EE2A 1YMMD 5TE6H 3HFML 4CBPA 5KWYC 4FA8A 1OK8A 4PY8I 1NFAA 2BNQE 5I5JA 4A6YA 4Z78A 5FHBL 4IDJL 4BFOA 2W9EH 1JGLL 4LKCA 2ZKHL 1JWMB 2RQEA 4NP4H 4WEEA 3X11B 3KCPB 4G11A 5EOCL 3IJEA 1JYVA 1PPIA 1MCKA 4HS6A 2P47B 2GIYA 2VERN 4KKZA 4RQQA 3L7FA 2ZXAA 4JCLA 4N85A 5HTSA 3UX9B 4PUBL 4N20A 1WTGT 5DUMH 2IH1A 4F15C 3LXUX 1TEYA 5FO2A 1LNUA 5HDRA 1Q0YH 4NM4H 3HAEH 5HHOB 4UTBA 1UJTA 3EDEA 4Q6IA 2C7UB 5CP7A 1VIWA 3ESOA 3O9WA 4D0DA 4LCUB 2VKXA 2JTYA 1SN5A 1MCFA 1CLOL 3MRFB 3DMMB 3BOVA 2OYKA 4HEPG 1ORQA 1U4FA 5K39B 3GTVA 5CNHA 3OXSA 2ID5A 2XKNA 3RPIB 2G3NA 5MHSD 1V3KA 5F7FA 1K8IB 3JXAA 4Y4HC 2WZPD 5HP5A 1NGYA 1MVUB 5AW6B 5IB2B 2E6JA 3RJOA 2E8YA 3AFLA 4X80H 5GHWH 4WIQA 3ZL2A 3PL6B 2FUTA 5DJ2A 2EDQA 3SN6N 3VFRB 3ZRCC 3N42F 4N0UA 2ZCLL 5HI3D 4OW6A 5EC2A 3UTQA 3S3BB 4XPHH 3OC8A 1NEUA 3C5ZB 1BECA 3O4LA 4Y1AE 3U0WL 1QSEB 4FRWA 3EDKA 5F9OH 2VDPL 5B1CA 1MLBB 5FGBA 2WTOA 1UM6H 1WV7T 2F58L 4HWBA 1FRGH 2BNUA 4NQCB 1UOLA 5LCVH 3IMBA 2UVEA 5HJ3B 4A63A 3A0OA 3JWOC 5LNDA 1A1NA 3KHOA 4GQQA 2IADA 3CVDA 3OWEA 5AG9A 4H0IA 2OZ4H 1NIFA 5M94B 1UA6L 3BT0A 1I9RL 5HGAB 2BSTB 2ARJQ 2QPSA 1HNYA 2KLRA 3VFPB 3QDMA 1ZLDA 2IALB 4PJHF 3VXNA 4JK0D 5DWUL 3WKYA 4FI8A 4JDTL 5AZEH 2JIXB 4DEUA 4L8BA 1A2YA 2ARWA 1WFOA 3BH4A 1GHFH 3V2AR 5DRXA 4R0LB 1DBML 1G7JB 1NCCH 3BXNB 4GSUA 4I3SL 4OCMC 4HUMB 4Q2ZB 2BP0B 5G5DB 2E3VA 1QRNE 3ZKND 4AIZA 1G9HA 1YC8A 3L3KA 2OMZB 4KOCA 4MJ6A 2L7QA 4JO1H 3D4GA 4ZUUB 1ADQL 1FL5A 5I8KH 5T3ZD 1FLRL 4IMKA 4LESA 2LU4A 1WYJA 3FAWA 3H55A 3ZYZA 2WBJC 3LKNA 2AJSH 3MRCA 3KPRE 3BLBA 1S5HA 2FJSA 5DJ6B 2E7CA 3RGVA 3JWOH 3T4YB 4D9RD 1MHHA 1FIEA 3QXWA 3ZUCA 2OSXA 1TYJA 3BHBB 2EEFA 2X38A 4UV7H 5F1NB 1LEIA 3BSZL 1P5UB 3HRZC 2H6PB 1Z6JT 5DUBA 2ZCKL 2G4GA 3MRJA 1N6UA 5FGRA 4JRYE 3RTQB 1H3VA 1IQWL 1NJ9B 4KJWD 4BH8B 2HTKD 2QGEA 3OR6B 1FSKB 4NN5B 1N70A 1KBPA 3VFGL 3JVGA 1HHIB 3X1NA 5KBPA 4KV5E 3W9DB 3BVNB 4GBXB 2PXYD 1VGEL 1AIFB 1OF2B 1AS7A 2CJUL 4NQDD 3ARTA 4R3SA 5F7WC 5C7XL 1J0YA 1SFDA 3KJ6H 3PQYB 5EIVA 2HVKA 1QLEH 1CGUA 1RLWA 4B9CA 1UQSA 3Q2CA 4OCNC 3RY6A 1NDTA 4JBSA 2XXCB 4ESKA 1W8OA 5CXPA 4IRJC 3WN5A 4DERA 5IROD 4X6EA 1MRDH 1A22B 4P23B 3IXAA 2HFGH 1IM9B 1A6AB 3NJJA 4FCAA 4R4BB 2OYMA 2A74A 3PABA 2JCWA 5I5MA 2OSLA 1CDYA 1H6TA 3LRMA 3BLKA 1E8ZA 3OM3B 5KS9B 4AJYV 1CZ8H 4XO5A 3UZEA 2Y3AA 5LN8A 3MGTB 43CAA 1UWXK 4LSTL 2J8UE 3T09A 2B5IB 3HI6H 4J6RL 1HZHL 3WOVA 5IQ7H 1JXKA 2V2WB 4NCC1 4PG9B 3B9DA 4GFXA 1UD2A 4BGLA 4M61B 4Y4KB 3L9EA 1NH6A 4JREB 4HJ0D 2BVQA 1BZ8A 2ZXEB 5HDBE 4B95C 3ETSA 1KLUA 3DV4A 3BO8A 4XAWH 3KVPA 1G6RH 5EIQA 4YE0A 1A7RH 4F91B 3R4RA 2CXGA 3D39E 3E3QC 4TVUA 4OM1L 4JY5H 1AY1H 2CCLA 4ORZC 2NX5B 4GNKB 1D6EB 2HTKC 5EBMA 1T83C 4JM2C 4KZDH 3ZE1E 2DM4A 4X0KB 5GPRA 3JWNC 1FDLH 5BVPH 4OZFH 1TMQA 4BXSV 3R19A 3VG0L 1N4XH 2PXYC 3QJUB 1X5JA 2GABA 5BUAA 2DQJL 4RIRA 4YUEH 4P2QD 3MRMB 3MJ7A 5JUEH 1MNNA 3SDDD 3GKWL 1TG8A 2Z8VC 5IEHB 1UC6A 3OKKB 3KH4A 2VDRL 4Y19A 3TZVD 3ILQD 1F4HA 5SWSE 2R2EB 4JFTA 5I18H 2FZ3A 4PY7A 5DHDA 2NY6D 3I50H 5JPMB 1Y18B 3QQDB 4WO4D 3VSQA 4E9TA 1WD9A 4NZJA 1GZHA 4MJIB 1U3HA 1OM3L 3KDMA 5PAZA 3UPRA 4OI8A 2DQHL 3CVBA 3IDMB 3KEHA 4NKQB 4DP9X 4EBQH 1R3IL 4FQIL 1OSZB 1Z3GL 1J8HA 4YX2L 2PABA 2ZKXA 3ZE0B 4OIIH 1XCQB 3MRLB 3MUGB 1XGQB 2WSKA 1VFAA 3GJFK 3N44B 1G6VK 2GI0A 3LEYL 4LL4A 3ZTJH 2DYPB 3BVUA 2FT6A 3F7LA 1F11A 4OD1H 2RFXB 3KGRA 3MJGX 4FTDA 4N2AA 1RJZA 1RURH 1CC3A 5LBSL 3ARGD 1PL3A 1M3JA 5E9DE 3NP4A 4MNHB 4JEGB 3LNEA 4BK5C 1CK0L 1UVQB 1HZLA 2Y1AA 2X70A 1OB1A 3QQ3A 3BH9A 4QOKB 2YEZB 2AGJH 5CGTA 4HZAA 1M05B 2A6KB 1GC1C 3ARDB 1BD2D 3NESA 3RX5A 4AM0B 3RB7A 3SPJA 4O51A 1L4IA 4MBRA 4OB5L 3ZBMA 1F58H 4FDWA 4V2CB 2YD4A 4OGYL 3ZDYB 1HEHC 4KZEL 2GTQA 1JV2A 3SDDC 4GMSH 4GT0A 3IDYC 4JM4L 4DKEH 1KELH 1M7UA 3TJEL 2F53A 4H25B 3DJTA 3ILQC 4PJBE 5JR1L 1WAAA 3HLAA 2Y36L 2OJZL 2GPZA 3N04A 3VD4A 4ODWA 2ZG1A 1U8HB 3MA7A 3TFKD 4AT6B 5TE7L 1UGNA 2QSCL 2W0PA 3CAFA 4WV1B 1ZLVH 1KF9B 4J8RA 1SQMA 4TL4A 3KZ8A 1GRWA 1A4CA 4GW1A 3CSGA 3G9AB 1FFRA 3D87B 3T8XB 4LCVA 4RRPM 2PMZA 5IT2H 3LS5L 4YFLI 4Y16D 3QEHB 1CD1A 3IDXH 4MASA 5J7CC 1ETB1 2WXHA 1D9KB 3BT2L 3LQAH 1IEAB 3ZTDC 5E8DL 3BZEB 2HH0L 5KSUA 3VE0A 3MMEB 2Q9OA 2WQRA 1YEDB 1F4XL 4K9JA 4AV0A 3CBRA 4AQEA 3VGAB 1ZLUH 3QYMA 3QAZB 1WCBB 2R51A 1F90H 2DN7A 3H3BC 3DOSA 2MWCA 4MZRA 4P3CL 5AVTB 4MJJA 4EIBA 1O7SA 4GRLB 5HDLA 2GY7B 2XBDA 3ARGC 4JS7A 3BPNB 2AQ1A 2NW3A 2BY2A 3VXQB 1T1XB 5DC0A 5EF3A 4N8PA 4WUKL 1U8PB 5ABAA 12E8H 2Y7LA 5FO9B 3FQWB 1TJHH 4TOYH 2DTML 3GTNA 4U1GB 5IJKC 3NJKA 4ADGA 5DO8A 5ACZA 1FNEA 1ZXQA 3ETBF 2J73A 1ADWA 1JJUA 1JWMA 1ITBB 1H3TA 3X11A 1NUGA 1MIMH 1DSFH 1MZYA 3KCPA 1GIGL 2AJXH 3N91A 5L0QB 1BVNT 1CLYL 4K5OA 1RU9H 3IAQA 4JFWA 1B3JA 3S9DB 3D48R 1DDTA 1U3ZA 1N8ZA 1SF3A 1KN4H 5DZ9A 3TFKC 3AQDA 4LZKA 3LNFA 4JCWA 3VG9B 3NFPB 2BK8A 1VB9A 3H56A 5HHOA 1TQBB 4XAKE 1JGUH 2C7UA 7PAZA 4HIPA 1A7QH 3GZKA 4JY4B 4E41D 2FDBP 3KYMB 4LCUA 1U8NB 5IHUL 4MDJB 2EIMB 3MRFA 3DMMA 4NJ9H 5L2KD 2WNWA 3V8OA 1DQJA 2YSSB 3MO1B 4P49A 5K39A 2PTUA 1E5BA 1OIOA 3STBA 1CBVH 2I60L 3U7YL 4YSRA 2EXSA 3RPIA 4Y2DB 3GMRB 1MFAH 1T0MB 1K8IA 2FK9A 1SYSB 1JZ8A 5LG6A 1MVUA 4OF0A 5IB2A 5AYTA 1WUZA 3HS0B 2A77L 3OLIA 1EUUA 1M53A 1IC1A 1YECH 3FTGB 3H1ZA 3VFRA 5JW4Q 1VFUA 3VXUD 3IJYB 4LXFA 1UZ8B 1A9VA 3IBOA 4B41A 3NH7L 3C5ZA 1QSEA 3V4VH 2NY2B 3I3BA 1MLBA 1ZE3C 1AHWB 2JVUA 4ZZFA 1FAKT 3PV6B 4H20L 3AY2A 4FFWC 3T77B 2ORBH 5HJ3A 2MOQA 2OR9H 3DYPA 3SCMD 1BXUA 3EJCA 5G4OA 3MODH 5HGAA 1IKFH 2BSTA 3UDWA 5JXEA 1ZGLP 2E46A 2WWMC 3VFPA 1ZA6A 2IALA 5GJSL 3ZO9A 1T80A 1PW3A 3VFUB 2HRPH 5EOQH 5I15H 3T6XA 1GR7A 1R34A 4N8VA 2JIXA 3ZQWA 3PS6A 1H3PH 4PJAE 3INUL 3N2JA 1YEGH 1J1PH 2DY2A 1E9PB 3L16A 4N5UA 3OHXC 5FYJU 4R0LA 1DUZB 1G7JA 5IBUG 3BXNA 4Q2ZA 4JHWH 4PI0A 5G5DA 4AI7A 2BP0A 4EZMA 1MI5A 4O9HL 1BXXA 3BKYL 2QLYA 4OCYH 3IWVA 3KVQA 4NZDA 2OMZA 3BYYA 5ICZA 3VW3H 1MFBL 1MWAL 2EO1A 3AAZB 4IU2B 5FGCE 1ZK9A 5FK9B 3V0WL 5LXGL 3BD3A 1M6OA 5T3XE 4ZUUA 2A83B 1C5BH 1UM4L 2AZUA 1OAUL 3L2LA 1KDIA 5GISH 3V9EA 2KKQA 1E30A 2B9AA 4NDMB 5B8CC 4MDRA 3FUEA 3NA9H 4WU5B 5AKVA 5DJ6A 4QY8B 3FQRB 1YNKL 5D6DA 3T4YA 5J1SC 4XMUA 4WEBL 1U8LB 3VFSB 4LE8A 1NCUA 5EWIL 4ZUSB 3BHBA 3N85H 5F1NA 3RVWD 2Z7UA 1P5UA 2KH2B 3GS4A 4Y7OC 4U6TA 4AQ8A 3EUUA 4EN2A 1NBZB 5CN1A 3NCBB 2BIOA 3BWZA 3RTQA 3TIDB 1EMTL 4R8WH 4W9IC 1WAAF 3ZKXB 1R9FA 2R0LL 1NJ9A 4K7PH 4BH8A 4ZBJA 3IFNH 3OR6A 3V5DB 5AB2A 1R5VA 1ZXKA 1HHIA 3W9DA 4HSQA 3BVNA 4GBXA 4LPXA 3ILDA 2VLRB 1AIFA 1OF2A 1FFPB 2J1XA 4LOUC 2G9HB 3PQYA 4GKLA 3WLWD 2JELL 2KC0A 1FE8L 1TZAA 3ATEA 3VO0A 3LXCA 5AVVB 3AS3A 2AJVL 2DDQH 4JFHD 3JTBA 5J6SA 4RAUB 4WENB 4DAGL 2J5LC 2VR8A 3EF7A 4G7RB 2ZKYA 4P23A 5FF6B 4V1DB 4GAJH 4F8LA 1IM9A 5GRXG 4K2UL 1A6AA 4DP5X 4EOWH 2G0KA 4R4BA 2NSMA 3H42H 4KKRA 3SDAD 1RSFA 4E9QA 5IJBC 4UDTB 1Q9KB 2PW1B 4OBRA 3VGHA 4E9XA 2ZYHA 1E50A 2CM5A 3FPYA 5KS9A 3T3PF 1IQDB 4YDLC 4KK6C 5TFSL 2B3IA 3WHE0 3MGTA 4G9FB 4OZIE 2O5XL 5CSBA 3GHBL 5AVWB 2P44B 3T0BA 1MQKH 4YHNB 4ATTA 4NQED 5DHVB 2B1AH 2V2WA 3FC8A 3MFGB 1IC5L 4PG9A 4QCIB 4URTB 2H0JA 2H5UA 4Y4KA 2AJYH 5JTWA 5ACMA 4GXUM 4L29B 5EDSA 4GKNB 1WGOA 4M9PA 1CMOA 2K4WA 5DMIL 5D7EA 4ZZKA 1GW6A 1SDDB 2ETWA 4KNTA 3TN0B 1J48A 1TJMA 3GS0A 1SY6L 3RVWC 5CN3A 5FA3A 4N3UA 2HPTA 2D0GA 2R2BB 4BIKA 2HFTA 3HMWL 3CMOL 2MQ0A 4NKIH 5KJRH 2NX5A 1D6EA 4U49A 3RNKB 4U0RB 3FO9B 4X0KA 2KPNA 1AZUA 2IFGA 2F1BA 1U41A 4E9VA 4G3YL 4DK3A 2HVJB 4LP5A 3WEXA 5IEHA 3OKKA 3U30C 4XVTH 4GJTB 5MEND 1KCUH 2VXQL 2J12B 1KCWA 1IUZA 4M43H 1INEL 5T33L 2R2EA 3AREA 3ZE2B 1AZRA 3G6DH 4DO6A 1F3DJ 3TV8A 5EEYA 1YY9D 5JPMA 1MN4A 3UIYA 5GRUH 1Y18A 3QQDA 3ZZSA 2XN1A 3SDAC 4AIXA 1MJJB 3WBDA 1MCDA 2CR0A 5D7JC 3T1WA 4MJIA 4MB3A 4C55A 3LH8A 2BNRE 2VDRB 3QUZB 4UV4H 1R17A 35C8L 5E6SB 3IDMA 3FCBA 3VXSB 2R9HD 3GK8H 2UUDK 3FQTB 4GT7A 2CBQA 3PHAA 1OSZA 4LLWB 3T0VA 4BFBD 2UZIH 3L4TA 1Y0LB 1XCQA 3DETC 4OI7A 4U7SA 3MRLA 3MUGA 3MRDB 2YD6A 1HSAB 1KMGA 2DYPA 3W39B 3BW9B 1S2EA 3L1OH 4HKBB 1J87A 2YXVA 1CXHA 5B21A 5GZOC 5E4OA 2RFXA 2NTFB 4M29A 1EO8L 4BDVB 4NERA 2IV9A 1VPOL 4WRLA 3U7AA 2VLLB 5JMRA 1PSKL 2CBMA 1KPUB 1AS8A 1I1RA 4MNHA 1UVQA 2J55A 5GQBA 1FUNA 2DEWX 1UATA 1JNHB 5D8JL 5I0XA 3FFCD 3AQYA 3UC0L 1MCOL 1OY3B 2XX0A 2YEZA 3QC6X 4QOKA 3WFDH 1M05A 2A6KA 1A6WH 3G6JE 5ABDE 2Z65C 3ARDA 3ZHFA 4AM0A 2ADGB 2V17L 2EDWA 4G1EB 1P4BL 3EH1A 4I77H 4N8CH 3RWCA 1A4BA 5FYLE 5CD3B 3QCTL 1BVNP 5IVXE 3BZDA 4O4YL 4JHAL 4NC1C 4P9HH 4H25A 2OP4H 5IVZB 1E4KA 4XPTH 2VYRE 1VLXA 1U8HA 3VRLE 4AT6A 3ESNA 2K6YA 3IS0X 1YNLH 1CD8A 3VNZA 4HK3N 4WV1A 2WANA 4WI8A 5IQOA 3EH2A 1KY7A 1TETL 3FB8B 3VMOA 2AK4B 4NM8L 4WJ5B 1QYGH 4MAYD 4ES9A 2GI7A 5CINH 3B4NA 4XE0A 5AQ0A 4GAFB 4UT6L 4R26L 3T8XA 5I5RA 1KIRB 4GPVA 2Y7MA 4PR5B 1LMIA 4FG6D 1GH7A 1IFRA 2R9HC 3QEHA 4XOCA 4ZJ9A 5EU4B 5HPOA 4KQ3H 4G9DA 1D9KA 3BKCH 3IF1B 2F19L 1LVEA 1IEAA 2A1WL 3K4AA 5DT1L 5BZDB 3BZEA 2QTVA 2X4PB 2XKUA 3CC5B 1YEDA 3ATBA 3AZUA 1X7SA 4RZCB 3ETTA 2AV7B 3TWCH 4KO7A 3ORJA 4DKFH 1WCBA 4AJ0A 3Q7JA 5I19H 3IRZA 1WFUA 2V5YA 4GRLA 5IREA 4DN3L 3HZMB 1QKZL 3VXQA 1KC5H 1T1XA 2ERJC 5I1DB 2IQ9H 1SN2A 1QABA 2DPKA 3NG5A 1YLBB 4L05A 5FO9A 2HRGA 4MCYB 3FQWA 3STZB 3A6BL 1NAML 2R56L 3ABZA 4FYSA 5EA0H 4WW2C 2WC7A 4IRZL 5CJBA 4LOEA 4ZTOH 5F7BA 1S7XB 3GINA 5IWLA 2E74C 4XP5L 4IJTA 4BM7A 1CN4A 1DBJH 3WO4B 2UZXB 2MMXA 3ZTEA 4PD4J 3PUCA 2VDOB 1EERB 4G8EB 4FQXD 1A0QL 3GMNB 4HUKB 3O3DB 3T6ZA 4K94L 2YGPA 1CUOA 5INCB 3VWJD 5KS9F 1P7QD 3CZNA 4JQIL 4P3DB 1YC7A 4K55A 1BGXH 2ATPB 1J1OH 3CHQA 2ZOKB 2CJSA 2OPCA 3NFPA 3QEGL 4JFZL 4L3FA 3QR2A 3Q05A 5EEZA 3Q8FA 1WHPA 5A2FA 2V5RA 4H0HB 4JY4A 4MAYC 3KYMA 4V1DE 1KCRH 1S7UB 5DVKA 1U8NA 3LZFL 4JO2L 4MDJA 4TLKA 2ZOUA 3WU1A 1NMAH 1EEUA 4FG6C 1U8IB 4K9EH 4QHNB 4TSBH 4JO5A 1JXDA 2YSSA 3MO1A 3CFEB 1OAQL 5LGYA 3JV6B 5DEZA 2ZUXA 5FYKE 3HC0B 4DJMA 1OF0A 2WXOA 6FABL 4FQHB 4Y2DA 1F42A 3GMRA 4X7TB 3BDXA 2E9BA 5CHNA 1T0MA 1SYSA 3L3HB 4G6MH 4GIAA 2WY3B 1CYXA 1OW0A 3BRFA 3O0LA 5C97A 1T2QH 3FTGA 4DP6X 1CYWA 3B6SB 3G5ZA 3GEWB 3IJYA 1U4EA 1UZ8A 3BZFB 3KXFD 3LZOA 1KOAA 1ZTXH 4H26B 2DH3A 1F56A 1Z7JA 3KJ4C 3CFDB 2CUIA 4OIFA 1AHWA 4W9EC 5B3NA 1IC7H 15C8L 1FV1B 2N7BA 3PV6A 4WK2B 1UB5B 4XNZC 3QK0A 3BVTA 3T77A 1CR9L 3TA3B 3W0WA 3MRNB 3AGWA 4JO3L 4FEIA 4LVOB 4W93A 5J1TC 3QDGB 1G9MC 3QWRA 4AUYA 4DNLA 3SKUD 4ZW3A 4K7PX 5IUSA 5C3TA 1T66D 4YZFE 1A4KB 1K4DB 4FQXC 5L7XL 1GZQB 3TU6A 3VWJC 4NIKB 4PJIA 4FLRA 2FT7A 4J28A 1MEXL 3CN3A 3OAWA 2F0CA 3VFUA 2DRUA 1ASOA 3H54A 5KN5B 1E4XI 1IGTB 4OT1H 3CJJA 2BINA 1TR7A 3FYIB 1H9DA 3L5HA 5EU7C 4FNSA 1E9PA 1OSPH 3N44F 4HIHA 4E9RA 3KL0A 2EXYD 2VL5B 3HN5A 1VEPA 4YHNA 2AEWA 2BW5A 4AYBA 2K0RA 1PD1A 1BFVH 2Z7YA 3LXBA 3ATDA 2VN6A 1EEZB 3AAZA 4IU2A 4H8WH 2Z0UA 3VI4E 3WXVL 5FK9A 2Q8BL 3RHWF 2HRLA 4WFHE 4X4ZA 4X8JB 5E5RB 5L9DH 1TKWA 2A83A 2FX8L 1B9KA 1YPZE 3T08A 3VFVB 3NN8B 1V7MH 3KPOB 3VXSE 3TBWB 1QLFB 3EAKA 2QSTA 4MZ3A 2I7OA 5D93B 1GPOH 2IDUA 4WU5A 3SJVD 1D2OA 4G7VL 4QY8A 3FQRA 1MWAB 1JHKL 1CDJA 3EOBB 5DD5L 1KGXA 1U8LA 4I5BB 1G9MH 4PMFA 3CFMA 4W9ZA 3ZDYF 1SUJA 2EH8L 3L4ZA 1ADQA 4ZUSA 4HPOH 1OPGL 3RAJL 1CGTA 1H19A 5CEXB 1NBZA 3WJLA 1X5YA 3CUPB 3TIDA 1S7VB 2ITDB 2VC2H 3V5DA 4IBYA 1FGNH 1UZ6E 4OCRL 1DQQB 4UTAL 1AGCB 4NUMA 3V6FB 2YSTA 3D1MC 5BRZB 4TNWK 2L0DA 3NFNB 4LCCC 2VLRA 5I66B 4LVEA 3BSZA 1FFPA 4W9JC 1XIWC 1T66C 1U58B 2VERA 3LEVL 5E2UH 2QV4A 3GB7B 2ZXWB 1NCWL 3QG6A 4XP6L 3WNNA 2I9LB 3U4EA 3MJ6A 1DQLL 1SNRA 5B7MA 1YEEL 4PFEA 2WOBA 4RAUA 2VUKA 3D3VD 3IAPA 1QHQA 5FF6A 3RU8L 5KVEH 3QVAA 2WXJA 2KQNA 1IILE 1UEYA 4WDIB 1S7SB 2GW5A 4ANUA 2EXYC 3GM8A 4MNQE 1T7YA 3WD5L 2RD0A 2ZAGA 1Q9KA 2PW1A 4UDTA 1R5WB 2W92A 5B3JF 3A4DA 2B0SL 1XGRB 3MUJA 5FUZL 4KY1H 3ZDXB 3FO0L 2VRQA 5A2JH 2X6VA 3LPWA 4G9FA 4FFVD 1VAHA 3MLUH 5HVHC 1TENA 3NQIA 4OZHE 4Z77B 5DUPH 4OCWH 5DHVA 4O2FB 2O6PA 5F1IB 4QCIA 3DJ9A 1F45A 4P2YA 1LQSR 1S7TB 1DQML 3CZUB 3MJ8B 4GKNA 3DX8B 4KKBD 5GGQL 5GGSY 5TE4L 2XV3A 5IESH 5ENWB 2W81C 1SDDA 4N5EC 4MA7L 5DS2A 3TN0A 3VGFA 4PRPB 1TCMA 3PGCB 5C0CB 1FNGB 4POYA 1KBKA 2R2BA 5J13B 1YMHB 4J3TA 4ZQTA 4RMTA 2F9BT 2AFNA 2WSPA 4ADJA 5TPWH 1EBPA 1GS6X 1MCSA 1LO4H 3RNKA 1JCVA 2BJMH 3GIVB 1AO7D 3JTSA 3QEQD 1X5FA 3G9VA 4W4OA 3CXDH 1QNZL 3B7UX 5DC4B 2ZNWA 5GGTL 1DANT 5DURB 4YHYB 3F7VB 3NP3A 1HESA 4L9LC 3L08A 1E40A 5EZOH 4DW2L 2NXZB 5SWZE 2GTZB 4OGQC 4X80L 4KROB 4Q0XH 5KVFH 2C4XA 3ABLB 4XP4H 1MJJA 1VGKB 4ZNEE 1BG1A 5K59F 5C09B 1ITCA 3D5OF 4W9GC 3T2QA 4TQPA 3ROOB 3AM8C 4Q97A 3FQTA 1QFWH 4LLWA 1ZAGA 4FFVC 2J1KA 1IL1B 2DQCH 1Y0LA 2V9UA 2CGYA 2CKNA 5TDPB 1YEHH 4MYPA 3ZRSA 3MRDA 1TFHA 5I73C 4DEPB 4JQVA 4XN2A 4L9DA 1AJ7H 1QBLL 3W39A 3BW9A 2H3NB 4HKBA 2FJHB 1KEGH 5JPNB 4J2QA 4JFOB 2IGFL 5HGHB 1LO0L 1GGIH 2NTFA 2K7QA 2CO6B 1DEEB 4BDVA 4NQVB 3Q01A 1FA4A 5C0AA 1IGFL 1KPUA 3JQOB 2XCMC 3ESPA 5CGYD 3TF7C 2WAHA 2X05A 1Y6MR 4F5CA 4HBCL 3NPZB 1JNHA 1GHFL 4BUGA 2J4WL 4EQ3A 4Z8FL 4HUNB 4MHHI 4UT9H 3NZSA 4AG4H 3S34L 2ADGA 3N3EA 2BS9A 2FX9L 4G1EA 4QHMA 5LBSA 2Y69B 2Z35B 1QFUL 5CJQH 3SKJH 2EEAA 2ICWI 3R4DA 5CD3A 2DLGA 3O2WH 4GXUN 5F70A 1KBBA 2L8AA 4G8GD 1NCIA 4X5XB 3QPKA 5IVZA 1XL4A 1X6LA 1OSEA 5AAMA 3VXTB 1BJ1H 1WS8A 2RHEA 3JUZA 3KCWA 1NC2D 3FB8A 3R7QA 4XMLH 4ODBD 2AK4A 4WJ5A 4AVHA 4UV7L 3HKFA 2CK0H 4ZSOE 4ZTPL 2VDLH 5DD1H 4QRUB 1TQCC 1KIRA 4O58H 2X5PA 4PR5A 4QXTB 3C2SA 5ILTL 3SO3C 3VXRE 4CW1B 2YWYA 3IF1A 2D9CA 2N0MA 1RUKH 2WXLA 1UFGA 5DEGB 4Z1PA 1L9QA 4HXBH 4JFFB 5HHNA 4GRWH 1LTXA 5BZDA 2X4PA 1YEIL 3LNGA 3CC5A 3P54A 5E95B 5FW8A 3R7RA 3LD8C 3V0EA 2GB2A 3K8KA 4N2HA 3V0FA 2ZTBA 4RZCA 2AV7A 3QR0A 2J25A 4FFZL 1SXSA 3CTTA 1RJCA 4I88A 3D33A 3HZMA 1BHGA 1AS6A 4NHCL 3MLXH 4LHUB 5CGYC 5I1DA 4XN8A 3N55A 3NCYS 1SUHA 5MERB 4NSKB 4MCYA 4LL1A 5H2BB 2EACA 3STZA 3WFCL 3QO1B 4EZJA 3WE1A 4LQFH 5GRVL 5CU5A 4HEME 3D4YA 3OGCB 4BKTC 1S7XA 3US9A 3KAAA 3RKPA 1OAYH 1WISA 3RDTB 3GDCA 2UZXA 3U2JA 3IK2A 4JPWL 4DGUA 4PWEA 3MV7D 4G8EA 5BRZE 3VQ1C 5F9WB 3VSUA 1A6UL 3NSCA 3GMNA 4PSRA 1NSNH 1O7DE 4WSJA 5INCA 2OYPA 3CWGA 1NAMB 3ECWA 3UAFA 5ES4B 5I8OL 2V9RA 3V4UH 1UXMA 4P3DA 1N5YL 4OD3L 1OQXA 3RVUD 1UB6B 4P04A 3ULUD 2ZOKA 2J8OA 3O2VL 43C9B 2MCMA 3QQ4B 2JKXA 4MRCA 4ETYA 4CU8A 1ZTMA 4BYHA 2E7LA 5FV1L 4UNVA 1MSPA 1S7UA 4YO0B 3FTZA 4K3DL 5BCAA 1FORH 3QDME 4AH2B 2VR3A 3I9IA 9PCYA 1U8IA 3HIZA 4QHNA 3LZPA 4JUSA 4FABL 3B9KB 3Q2LA 3CFEA 4LOVA 3JV6A 1J1XL 1QI5A 1V5JA 3HC0A 1ZDQA 3ATAA 1XL6A 4OLUH 3MOAH 4KU1A 4X7TA 2P52A 2MPAL 3UABA 4NOBA 3O6LH 2QDWA 3SQOL 2AK1H 3L3HA 5F93C 1N10A 2BZ7A 4Y2OB 4M6OL 1NCJA 4HUCA 4YZFF 5E8OB 2A3TA 2AAVA 2NUTA 1DLFL 3SODB 3FH5A 5D7LE 4LIQE 3O2DL 3GXFA 5FM5O 1F6AB 3B6SA 3MV11 3LQMA 4FLQA 2ZXCA 4WFFD 4UQEA 1P0SE 4HLZG 3DBSA 4OFKA 4NI6A 1XVSA 5T3ZL 4YE4L 3WNJA 2VXSL 3PJNA 4H26A 3PWNB 5I17B 3VACA 2X7LB 4ONGH 3CNKA 3CFDA 4BFJA 3NJHA 5IQNA 1LP9E 4AQ1B 3ZE2F 3FU0A 1FV1A 1BREA 3ZZQA 1UB5A 1BF8A 3Q0HA 4J6IA 3MRNA 1A6VH 2MHAA 3PYCA 3QDGA 1YO4A 3C6SB 3DHUA 4J8QA 3VXOB 2AAAA 2ODHA 5C0JB 1UYWL 2EIBA 1A4KA 1K4DA 2CIIB 3NJIA 4KKLC 1GZQA 2EYRB 3IJ7A 3FZUD 1Q94B 1IMHC 2EE3A 4YBLB 3RVUC 3WKQA 5KN5A 1IGTA 3ULUC 5E2TL 3P4MB 4QJ4B 4N2MA 4D9QE 3TT1H 4PWIA 1QTSA 5BV7C 3HG1E 4JPIB 5I0VA 2R1WB 2VL5A 2Y7NA 4Z7NB 1FNLA 1LO2H 2HTLD 1MPAH 2B77A 2Y07H 4DFIA 5KYXB 4H44C 4OD2B 3W3BA 1EEZA 2VAJA 2VL4A 1WFIA 3T2PA 1F13A 4QHKI 5BO1H 5D7KE 4X8JA 3MJ9L 4BWTA 3KYAA 3VFVA 1E4XL 2BX5A 2OMXB 3KPOA 1H9VA 3NN8A 4I48B 3TBWA 1QLFA 1P6WA 4GKOA 3UFIA 4AZUA 2GEEA 1VFOA 5AYUH 3H9SE 1OTSD 4WW1A 2X4OA 1VJSA 2LVEA 1MWAA 1RIVL 2ZX9A 4YC2B 1LL1A 1CF8H 3EOBA 3B3IA 4I5BA 1IBDA 1O9WA 4K5MA 4BCYA 1E6OL 2SODB 1NEPA 5DSCB 2M26A 4MCZB 2NRDA 4LDEB 1VKXB 4LHJB 1CGVA 5E6YA 1UH3A 3BSHA 2JCCE 1CDUA 4ZUWB 5CEXA 4JHBA 3MREA 1MJUH 2GUOB 3CUPA 2GCYB 1Y7VA 2LLGA 1S7VA 5D71H 4ANKA 2AJUL 2FGWL 2ITDA 4PTUB 3ULVC 3ULUH 2N7SA 4P4RB 4AVJA 1DQQA 3M17B 1AGCA 3V6FA 3L4VA 1AFVL 3NFNA 3GJEB 5I66A 3RVXD 4APQD 1KTRL 2W0LA 2F7PA 4NKOB 4DGYL 3NRFA 4FXGB 2D03L 5ICXB 1U58A 4QRPD 1UM5L 3GB7A 4RMWA 3W57A 2I9LA 3FU7B 2FRGP 2NYZA 3FZUC 3POHA 5FV2A 1AG0A 4OLWL 5CILL 3TJHC 1THAA 3QIBC 1GC1L 3DRTB 2QQQA 3D07A 5ADOL 3VI3B 3WY3A 4FNLH 1K8DB 3TF4A 2IBZY 2Z7ZA 2K7PA 3IEAA 3NCJH 4D2NA 4WDIA 2XWEA 1S7SA 3V4PB 3KHQA 4RFEB 5FHAH 4BZ1H 2HTLC 1RZ8B 4GLRH 5DFTA 4P2OB 3CDGB 1R5WA 3IDIB 3L5XL 3E9TA 1BYPA 5I30L 2XXFA 1XGRA 4DEWA 1M7DB 2WUBL 4JR9H 4GSDH 5IR1B 5FCUL 4DP4X 3CIQA 2CMRL 5D1QA 4Z77A 5E2VL 3L13A 4IIQB 4O2FA 4JB9H 3KW7A 2HLFD 5CIPH 3FCTB 5F1IA 3VQMA 1P7HL 4XCNB 4B9IA 1P5VB 3TEYA 1OTSC 4JZJB 5T1KB 1S7TA 3K2UH 1A7OL 4Y9GA 3MJ8A 3RJQB 3DX8A 4YDIH 3QWOB 2DV6A 1J88A 5ENWA 4KRLB 3VB9A 2JB5L 5J5EA 4PRPA 3QSKB 2E6PA 1KJ2H 1OVZA 3GSVB 3PGCA 1USQA 2C3VA 2WQVA 2YA1A 3ARBD 1IM3B 1FNGA 2ED6A 3BKMH 4MQTB 3T2NL 4LRNL 1YMHA 4W1TA 4G5AA 3NAAL 7FABH 1CBJA 4X9FA 4HX1B 1HHHB 2VXVH 4G7YL 1QFWM 3SDYH 5IFHL 1Z32X 3GIVA 2FIRT 2VOTA 3SPGA 4ZMWA 5B1KA 4AL8C 4XNYH 2VNCA 5KOMC 3V5HB 4APQC 3BKJL 5ALBL 2VLKE 3WIHH 2VH5L 4L1BA 1UOWA 4F92B 3F7VA 4JUTA 1DJYA 4G6KH 4JG0L 1WEJL 4RBPH 3NFSH 1COBA 1OZTG 1O7VA 2GTZA 2P28B 3D25B 4Y5XB 2P7TB 4PJ8B 3I75B 4Y4FC 1KB3A 4RFOL 1I3GH 5E1GA 3U2SB 4HA1A 3CSPA 1T21B 3BVDB 3ML8A 3GIZL 1VGKA 3E80A 2EDEA 4LASL 1DVFD 5C09A 3V4VL 2VXQA 3N0AA 4TLSA 3ROOA 3PXHA 3WS3A 4ZAKD 1KSRA 5DR5L 3FTXA 1A3ZA 4M1DL 1IL1A 1J9TA 5KBMA 1DBKH 2NQCA 5TDPA 4LCIH 4ZW7A 2HLFC 3KL3A 4MMXC 2J20A 4FE9A 2B4CH 5BQDA 2H1PH 5DHEA 2H3NA 3P11L 2FJHA 4IS6A 2QKSA 4QXUH 4JFOA 5DMGD 5JPNA 1PG7H 1MJ8L 4HDIB 1WPCA 2CO6A 2I5YL 3HMXL 4HAGA 1DEEA 4HC1L 1R47A 4KHXH 1GXEA 4F15B 5IY5B 5B38G 1B0WA 1MHCB 3ARBC 5JW3L 1KGYE 4G70B 3QE5A 4MDIB 2ZONA 2WKOA 1DN2A 1OWWA 2OA9A 3D8MA 5E0QA 5L8KB 3CIAA 4HLJA 2Q7AA 4WUUD 3QWNA 1NAKL 2D4DA 5JIIA 3QFJB 1PZSA 2ZCHH 2JKJA 4KXAA 1E5CA 1KLFB 2VZOA 5JOPD 1KCVH 4NZTL 1PDKB 2FBOJ 2GK0B 5A7BA 4LGPB 2Z35A 3C6EA 5F0MB 5HI4D 4NO5B 4G8AC 4YXLH 3PF2A 3ZY7A 4Y4HB 4X5XA 2AW2A 5G4MA 2Y5TB 1ETA1 3IT8D 4HIQA 1OL0A 1M7IB 4KO9A 3VXTA 4U1IA 1HQ4B 4Y1AD 1KFGA 2XETA 1BWWA 4X6CB 1KTDB 2EDOA 4ISVB 4J3OG 4ZRGA 2IWEA 5HD8D 3OZLA 1I1AC 4QTIH 4XMKL 3QR1A 4APXB 2CUAA 1YMMB 4JFQB 1HWWA 4QRUA 1DVFC 3UTTB 2QMJA 5KVDH 1E27B 3IMTA 3LYRA 3H2WA 4EDWL 5LLIC 4ZAKC 4CW1A 4FKHA 2OXGB 3QP3A 4ZFZA 2VXTH 5CJOL 5DEGA 5B4MC 1ILSA 4JFFA 2Z34A 4D7BA 1DJZA 4BHUI 4FERA 5AVXB 2WVSA 3NJXA 2WAQA 2YRBA 2W1NA 2XIBA 4UT6A 4AGOA 2IO5A 5ETUB 3F65A 2GYSA 4JRXD 4TNVF 3BRGC 4F7KA 1JK9B 4NEHB 2G30A 5K93A 1KTBA 3H53A 5PCYA 2CRYA 3FT2B 4JFPB 2A4ZA 3O6ML 4X4ME 3GSUB 4LHUA 2BP8B 3H3PL 2H0PA 4GQ9L 3VXME 1UD8A 2WNXA 5B1BB 5MERA 2WQ8A 3MLWL 4HISA 5H2BA 1NCNA 2CSPA 5KSBB 1ONQB 4X5WB 1HDMB 3KNBB 1QPPA 1J11A 3OMNB 4ZT1A 5G4NA 4F7EB 5LGHH 2WXGA 3OGCA 1NL0L 2B08A 4K71C 1XF4B 1H3GA 1ECZA 4GW5B 5ECJE 5DFVC 1ZGLB 5GZND 1F3JB 3RDTA 4YHML 3PHQB 1SXCA 3KPRD 3R1GL 1GVIA 5HI4C 2W0FB 2WP3T 1BOYA 3FUKA 3OF6D 1S8DB 5HY9B 2A9DA 1NAMA 3QXAB 1O6SB 2WBJB 3ZDXF 3WJJC 1NCBH 3TEXA 4C83B 4IRZA 4L3EB 5IBTL 1UB6A 1CFTA 2IDCA 3EDFA 1OP9A 4KI5E 5DD6B 2B2XL 43C9A 1ID2A 2OMBA 4JRYD 4DKDC 3QQ4A 3ARZA 3QXDA 1NWPA 3HRZB 5I1JL 5AEAA 1W8NA 2F54D 3NIGB 4GG6B 3HHRB 4P2RE 2WLKA 4YO0A 5EIIG 5CGMA 4LBAA 1OANA 4AH2A 4JQIA 4XVJH 4Y1TA 5C0BB 3B9KA 3QZNA 1EPFA 1FHGA 3NSDA 2R23B 5EULV 3HJEA 1PNCA 2HKFL 4RWHA 2H9GB 1JZ3A 4MD0B 1H8NA 4NGHH 5KSVA 1MY7A 2E86A 1E2VA 2XRAH 4WCYH 4UNTA 3WDJA 1J18A 1JZIA 2WUCL 2X88A 3RWDB 1OE1A 1AHMA 3QISA 4Y2OA 4EZLA 1F00I 5E8OA 1K3ZA 3VWKD 1U91B 5DWPA 1X7QA 4JKWA 2VWEE 4JZNB 1F6AA 3SD5A 5EORH 4IRJB 4M7LT 1ACCA 4LFHD 4ZDHB 1G9NC 2X09A 4OFQA 2C5DC 2YKLH 2O6CA 3KEDA 3PWNA 1TIUA 5I17A 1TQTA 2X7LA 4OF8A 4XNXL 3IJHA 4P46C 4AQ1A 4MXWL 4PJDB 1WZ1H 1DJHA 2P26A 1WFJA 4IKLA 5DDHB 5F7NC 1KZQA 1LO3H 2NY1D 3C6SA 4YXHL 3SY6A 2BSSB 4RGOH 3VXOA 3P2BA 4AMXA 1KYFA 5C0JA 3B9VA 3S5ZA 1AXTH 4RA0C 4AENB 2CIIA 2PO6C 1ZHKB 2EYRA 3U1SL 3RIFF 1TTFA 3IN0A 3RVTD 3WFHB 4TQIA 2QQKH 1Q94A 3ZRFC 3FB5B 2PPCA 1H6UA 2EYSB 1P2CB 2D7PA 2WP3O 1FYTA 3RWIB 1J9SA 4ANVA 3IGLA 3P4MA 3D39D 3W9EB 1L7IH 4HHAB 4M8UA 3RWHB 3IGFA 4JPIA 1RI8A 2OJ1A 2R1WA 4N8UA 2UXTA 3K6NA 3BRDA 5KYXA 1V3LA 4OD2A 3I85A 2NY7H 4WK4B 3MV9E 2MKWA 4YGVB 4L1LA 4RVBA 5C71A 4EI5D 1HXMB 1WG3A 4JM2B 1V7NH 4FQQB 3WFDL 3RZCA 4GUQA 1XBDA 2AQ2A 2WKOF 3CFJB 5F7DB 2OMXA 4I48A 4Q7DA 3QG7L 5GSVB 4LCWE 2HKHH 2PXYB 1U6AL 1ZVHA 5IJVB 5HVWA 4RH4A 1ROWA 1BIIB 5SWSD 1OHQA 1SBSL 1UWXH 4NQDB 3RWFB 4JNXA 1T1ZB 2FVNA 4QYAA 5ITFB 4E5XG 1Q72H 3U6XA 1HKFA 2PYEE 4N0FB 3VWKC 1U8MB 3BWUF 2G5BB 3JZYA 4M6MH 4HD5A 1B9ZA 1BZ7A 3EYUL 1F8TL 3DA0A 4HUXB 1VSCA 3NCXA 4MCZA 5DSCA 3UACA 1VKXA 3S88L 1G7MB 2R0KL 4OCXH 5HHVL 4PS4L 2GUOA 5HYEA 2B20A 4M4RB 2DQIL 4X6FB 2NSXA 3A23A 2OX5B 9CGTA 2JFCA 4K0OA 4PTUA 4PJ7B 4P4RA 4KX7A 3GJEA 3FB6B 3V8CA 4B27A 2R4SH 4FXGA 2BWDA 1OAZH 3NRPA 3BKCL 3W5MA 3LB6D 3FU7A 3RVTC 4ODSL 1VA9A 2H1LM 1OGAD 2JLPA 4DQOH 1FYHB 3DBXA 1MDTA 1UWFA 1HYSC 2E56A 3DRTA 4UTAA 5D7IE 5H8DA 2MTAA 3EBIA 3VI3A 3NPSC 1K8DA 3CLEL 3UAJC 1FVDB 1HYRC 1CPUA 4RFEA 4YSEA 1RZ8A 4P2OA 1EJ8A 5TQ2H 5ESAB 4BRVA 5F8RC 3IDIA 4YAQB 5ESVB 2OL3L 2RA1A 2WWNA 4KDWA 1M7DA 4OLVH 2JWYA 3QS2A 5DA4A 3TIEB 4B5EA 4EI5C 4CL7A 4MVBD 2XOTA 5IR1A 1JPFB 3RUGB 1U8CB 2J2ZB 3H0TB 1XDTT 2NYYD 4IIQA 5GRJL 3LIUA 3FCTA 4XX5A 4OLEA 4XCNA 1P5VA 3AG4B 3AY4A 4JZJA 3SDDB 5T1KA 3IDYB 1WO2A 3QWOA 2DQUL 1CGYA 2AQQA 2N0KA 4YPJA 2CO4A 3MCLH 1AKJD 4AEIL 1V3MA 2YO3A 3GGWB 4TKWA 1E7UA 4JPVL 4Z5RB 1A3LH 1PG7X 3G08B 2ZX5A 3MLYL 1I9EA 4PG2A 4HX1A 4UQIM 1HHHA 5F7YC 4AJWA 3MLVL 5D5MB 3X3GH 1CWVA 4HOXA 3P30L 3D08A 1I8LA 1KT2B 3E7JA 3HBZA 4UM9D 2CBTA 3FU9A 4I2XB 1T7XA 3CFKB 4PN6A 3PV7A 5CZRA 1VACB 1BM3H 5E1AB 3QUMH 4TPRH 3V5HA 4BCZA 1W72H 2HKAA 4TSAL 4DVRL 1QO3B 3PJSB 5C08A 4Z0BH 1JE6A 1C9SA 2NOYA 4GKZA 1AKPA 2ZPKH 3NIFE 1TQVA 5KSAC 4CJ1A 1CICD 2XDHA 3LB6C 1DBBL 3RL1B 3BYTA 1HH9B 2WCGA 5IW1B 1PAMA 2ESVD 4UNIA 2NY5C 5MHSE 3ULSB 3ENEA 4OF6A 4WI6A 4G6FB 5M95B 1ZSHA 1I8AA 3L9BA 4Y5XA 1D6VH 2O5YH 2P7TA 3I75A 3HB3D 4L2YA 4PJ8A 1ET5A 4UUJA 5DC9B 5HI5D 5C0IB 3U2SA 4ABQA 2NR6A 2AS5M 1I1YB 3ARGB 1T21A 2O93L 4G5ZH 5GGTA 2JNZA 1R3LB 3VA2C 1OQOA 2HMID 3LRKA 4IEFB 4XHQA 1UT9A 5KBKA 1CGXA 1LK2B 3MBXL 5DRZB 2HZHA 2OZNA 5CKGA 4MVBC 1AC0A 1BD2B 1QNIA 3NZHL 4AJVA 1J5CA 5JQ6L 4BJLA 2ZF9A 4G6JH 2OW7A 3HC4L 1FGVL 4DK6A 5FO7B 1HKLH 4UNUA 2DYSB 1BJMA 5I1HL 1L7TH 3X17A