4DPBX

The 1.00 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 8.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin A, chloroplastic
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dpbX00
1MDAA 3TA4D 1OE3A 1FA4A 1OCZB 4M3HA 1UATA 4A2GA 2VM4A 2IWKA 1OCOB 2EIJB 3NJMA 2BZ7A 1PY0A 2PP8A 4YSPA 1T5KA 2GI0A 3PPSA 5AKRA 3UAAA 3TBCA 1MZYA 4FAAB 3FU9A 1L9TA 4YVUA 3WKPA 1J5DA 1KBVA 4KNSA 3NJIA 4TXVB 1ASPA 1E65A 2PP9A 1BYPA 5IY5B 5B1KA 2YAQA 1PNCA 3ASOB 3QPKA 4QKTA 3T9WA 4M4RB 3FSZA 1GSKA 3V9EA 2XX0A 3U25A 4BDVB 2YAOA 1OE2A 2DV6A 3CVDA 3FPYA 2YAPA 3DIVA 4DP5X 4G71B 1NZRA 1BAWA 2VSKB 2VW6A 4GXFA 2H3XC 1W6LA 3NP3A 1TU2A 3QJUB 3GDCA 2J5WA 1IUZA 1L9RA 2IDTA 4KOBA 1JZEA 2PPAA 1ZDSA 2BW4A 4AZUA 1BXVA 2IDQA 2CALA 3BQVA 5B1BB 4YSAA 5I5MA 3UACA 4AX3A 3PCYA 4KOCA 2P80D 1AZBA 4YL4A 1XB8A 2BP8A 3IBOA 2EIKB 4E9XA 8PAZA 2ZONA 1IBZA 3FSAA 2GSMB 2H5UA 1SNRA 1BYOA 3TBBA 2IH8A 3ZBMA 3BVDB 4A67A 1JVLA 2UXGA 4UANA 2YXVA 1ZIAA 3NSFA 2YARA 4KNUA 2Q9OA 2DWSA 1SF5A 2GHZA 1DZ0A 3S3DB 1ET7A 1B3IA 3OMNB 2XWZA 1SJMA 1JOIA 1KDJA 2XYBA 1I53A 4Q89A 4HHGA 4AI7A 2JXMA 1CC3A 1KV7A 4PAZA 2RACA 3NSCA 4HCFA 4PCYA 5E9NA 4YSSA 4E9YA 6PAZA 4YSTA 2ZXWB 4DP8X 1V55B 3X1FA 3T6XA 4NERA 2FQEA 1L9QA 1NIAA 1NICA 2PCYA 1OE1A 1GY1A 3H4HA 4ENZA 1AQ8A 2AZAA 1XB6A 1JVOA 3S8FB 1ZDQA 5F7BA 5F7AA 3H56A 5PAZA 5B1JC 2I7SA 4HCGA 1V54B 3ABKB 2BP0A 5I6KA 1J9SA 1E5ZA 4ZK8A 1J9QA 1KGYE 2QDVA 2XXGA 1IKOP 1X9UA 3IEAA 5B1JA 2R7EA 1OCRB 5LDUA 4A68A 3ABMB 4UAHA 1EZLA 3RYMA 2W88A 4YSUA 2DWTA 1JXDA 5B1AB 2BZCA 3UGEA 3PXLA 3WIAA 5B3SB 1A4CA 1NIEA 2J57A 3UAEA 2GB2A 1A8ZA 3OMIB 2GC4C 2IDSA 4YSQA 1ZIBA 4KO5A 1KCWA 2WSDA 2X88A 2ZOOA 3NSDA 4JKNA 1SHXA 3SBRA 2N0MA 2XUWA 1A4AA 5D4IA 3T6VA 1OV8A 3X1EA 2PP7A 1GS8A 1NPNA 2YQBA 1A65A 2BO0A 4DP6X 2XVBA 3JTBA 1RKRA 2AZUA 4DP1X 3GXUB 4YSCA 1CUOA 3NJFA 3NP4A 2BP0B 1AG6A 3HEIB 1SF3A 2B08A 3G5WA 4AKQA 2VMJA 3X1NA 7PAZA 1AS7A 2Q5BA 4QLWA 2J56A 2ZWNA 3WNJA 3QJTB 2HRHA 4A2DA 2HLEB 4P5SA 5AZUA 1BXUA 1PNDA 5I5JA 4G72B 4FA7B 1PAZA 1FFTB 2TSAA 1TEFA 2PLTA 3FSVA 2IDUA 3FQ1A 3PAVA 3SBQA 2HRGA 2XXFA 1W8EA 2AANA 7PCYA 4DP7X 5EHFA 1DYZA 2HXAA 2QT6A 4DPAX 1NTDA 3CVBA 3NJKA 1GY2A 3X2QB 2GC7C 3KW7A 4DP4X 3WG7B 4G70B 1ASQA 4E9RA 1QNIA 1ET8A 5I6PA 1KDIA 3IN2A 2BWDA 3MBWB 4G7SB 1AOZA 4HALA 2DYRB 1EHKB 1AZUA 2YAFA 4HCIA 3NYKA 2HX8A 4JHUA 4UF7C 2PPDA 1F56A 4E9WA 3HB3B 2MRYA 2OJ1A 1M9WA 5I28A 1QHQA 2PPFA 2FT7A 3GYRA 3PLYA 1SFDA 3C75A 3FT0A 2R7EB 5B7EA 4DPCX 1NIDA 2GIMA 2BHFA 1SFHA 3OD3A 3MX0B 1NPJA 2JKWA 2AVFA 1JZGA 1OOWA 3T6ZA 2QPDB 2CAKA 1ETJA 1AG0A 2YAEA 2FT6A 3FS9A 3S3CB 2FNWA 4GP8B 1ZPUA 5I6MA 3PAZA 4KNTA 5D4HA 2Y1AA 1JXFA 3X1BA 1MG3C 1W6WA 4F2EA 2PPCA 1R1CA 4DP2X 1YLBB 1OF0A 4A2HA 4DP9X 4YVNA 4BXSV 2EILB 5I26A 3AZUA 3WKQA 1NIBA 1AANA 2E86A 3OQRA 4HIPA 3V9CA 2FJSA 2QDWA 5D4JA 1PZCA 1FWXA 1JZIA 2CCWA 1IC0A 1QLEB 4HAKA 3FQ2A 3AW5A 4Q8BA 2YAMA 4DP0X 2XV0A 2EIMB 1KCBA 1NWOA 4W9ZA 1GYCA 4K9JA 4BDVA 1MG2C 4KO7A 1X9RA 4G7QB 2LLNA 1RCYA 4WTQA 3TASA 2QPEB 4BXVA 2BW5A 4F2FA 3PAUA 1WS7A 3ABGA 1AR1B 3S3BB 1N70A 3L45A 3IN0A 2MTAA 1AACA 4E9SA 5PCYA 1TEGA 2VM3A 2BP8B 2PPEA 1KYAA 2X87A 5FC9A 2VW7A 1L9PA 5TK4A 4BWWA 2IDFA 3FYIB 2TSBA 1J5CA 3NJHA 1M56B 5TK2A 3NJNA 3FSWA 3QJRB 1IBYA 1PMYA 2XU9A 2IWEA 3D12B 4W1TA 2WO2B 1AAJA 1URIA 2GBAA 3ERXA 1ILUA 3ZDWA 6PCYA 2FQFA 2FWLB 2VSMB 4E9VA 1BQKA 4EF3A 1SDDB 3DTUB 1CYXA 3CG8A 2WO3B 4A2FA 2CJ3A 5A7EA 1JXGA 3EH4B 2HX7A 1J9RA 3ZX1A 3AG3B 1AIZA 2NRDA 4CSPA 1A4BA 4NAJA 3ZIYA 4A66A 1HAWA 2IAAC 2UX6A 4YSDA 2UXFA 2OV0A 4L0PB 1JERA 9PCYA 2FQDA 4GP4B 2B3IA 1OCCB 5AFAA 3NJJA 1NDTA 3NT0A 3QJVB 1GS6X 3FYEB 1NWPA 2XLLA 3FU8A 1ADWA 4N8UA 4YSRA 1HFUA 1NINA 3FQYA 4E9QA 3QJQB 2HX9A 3AG4B 4GP5B 1WA2X 4X4KA 3CDZB 1AZRA 1BXAA 1ILSA 3EH5B 4GY4A 1JZHA 1GW0A 3FPXA 2FTAA 4BK5C 1KBWA 1PLBA 1WS8A 1JZFA 1AZCA 1GS7A 4KO6A 2UXVA 1PZAA 3ASNB 3AG2B 1XMEB 4G7RB 1SDDA 4GYBA 3NSYA 2EINB 3EHBB 1MZZA 1BQRA 3EF4A 4BWUA 4HHWA 4CSZA 2AFNA 3H4FA 2H47C 1AZNA 1J9TA 2VN3A 3UADA 1TKWA 4YSOA 3AY2A 3KW8A 2IH9A 4DPBX 1CURA 3TU6A 2PCFA 2DYSB 3DKHA 3AG1B 3EH3B 3OM3B 5I6NA 2J55A 4YSEA 1E30A 1ASOA 3ABLB 4N4YB 3S8GB 5ANHA 3NJLA 2XV3A 1WAEA 1E67A 2UX7A 2XV2A 3FU7A 1WA1X 2Y69B 1BEXA 1M57B 1SHWA 3T6WA 2FQGA 3QJSB 1A3ZA 1XB3A 5B7FA 1JZJA 3FU7B 3OMAB 4JHVA 1NIFA 3SQRA 3WNIA 1L9OA 1ET5A 4AKPA 2YAHA 2P80A 2XX1A 1CYWA 3X1GA 5I6OA 1PCSA 2W8CA 4F7KA 2UXTA 3IE9A 4A2EA 1N68A 2FT8A 3CVCA 2CUAA 2JFCA 4NB7A 2A3TA 1GR7A 3JT2A 3N55A 1ID2A 4RH4A 2CBPA 5B7MA 2VW4A 3UABA 3QQXA 1ZV2A 2BWIA 1PF3A 5I5IA 2HZHA 3WI9A 4AKOA 1V10A 1RZQA 1E5YA 1AS8A 1PLAA 3CZUB 4E9TA 1VLXA 4MFHA 3T71A 4KO9A 3NJGA 4P5RA 1BQ5A 4BWTA 1HAUA 5I6LA 1PLCA 1RZPA 2I7OA 1AS6A 3CDZA 4HZ1A 4WKXA 2OCCB 2YXWA 2I85A 2DY2A 2IWFA 1L9SA 3SBPA 1PZBA 3N2JA 1WA0X
chains in the Genus database with same CATH superfamily
3FTGA 5C0CE 4FLHA 1SXAA 1UATA 5FUOL 4KU1A 4I48B 5F96L 1IAOB 3KBEA 1P2CB 2P46B 3ECBA 5E6UB 1T5KA 5K1NA 4JRXD 2JKLA 3QUZA 5AUMA 5HDBB 3UTTB 5JOPD 4G8EA 4P49A 4HZLA 4PIBA 1Z0MA 4HIXH 5CWSB 2JJSA 2BIHA 1E4WH 1LM8V 1IC7H 1UB6A 2CA3A 1XH1A 3S37X 3ALWA 4L9LB 5EO9B 5E99L 3FQUA 3R7RA 4Y1TA 2IDCA 3PE9A 1NSNH 4CA4A 3QORA 1AGBA 2VZVA 1ZTXE 4JQIA 2CR0A 2ZP0T 2G9KA 3VRLE 1M7UA 1UWXK 1KCRH 2FHBA 3MV9D 1HVXA 1T83A 3B7SA 3LS5L 3U4EB 4P59H 2ICWB 3MRJA 2ICWI 4FABL 2NZ1A 2AI0H 3A6CH 4P06A 4QEGA 2LU5A 4OZ4A 1UYWL 4RWHA 2KKQA 2X1PA 1LWJA 3CU1A 1NGXB 3O2DH 1FFOA 5A6IA 4H20H 3K91A 4PS4H 2YBRB 4R26L 4XCEB 3D8MA 4RQQB 3UACA 3UZQB 3B43A 4XXDA 4YXKL 1WFNA 4YL4A 1NCGA 5DRNA 1BSIA 1UWFA 1KUMA 4Z7VF 2DAVA 3ZL2A 5E03A 4DT2A 3V5KA 3SYPA 2ATKB 1INEL 3QIBC 4D8PB 3QK0A 4F2MB 1VRSA 2ADIB 4UIMB 4EKXA 3UP6A 3DO7B 4NKIH 1WWAX 3QCVL 1KB9J 3DARA 4NO0D 4AV0A 2DWSA 1KY6A 1HE7A 1FYTB 1MRDH 2XIIA 1KNOB 2XWTB 4MSWB 5JMOC 2UZPA 1EO5A 3UBXI 5FF6A 1N59B 2YD2A 1Z9OA 4TTGA 4BSWA 1AD0B 1DTUA 5ITFA 3LVEA 2YA2A 3I6LE 4UM9A 3T0EA 3TS8A 4O51B 1N6VA 1W80A 5E9AA 5ABAA 3IB4A 4HOXA 4PCYA 3P0VL 4TN9A 4WKZB 3TEYA 4OLVL 3PWJA 5ESAB 1CD0A 3ROLA 5IBLD 2PR9A 1VKXB 4IRJB 1GGCH 4HJ0C 1S9XB 2K8QA 2X3CA 2Y7QA 4BFEA 3H4HA 3L54A 2GAZA 3NCFB 3VFMA 4Z7NE 1RZKL 15C8L 1FCCA 3QIUB 4YDIL 1HDMA 1J87A 2YGQA 2F53D 2W38A 4DGYL 3NIGB 2C9SA 3L5WA 3RIFF 2FNBA 3O4LB 5TQ0H 1DANU 1NA8A 3O3EB 1H6UA 3MRRA 3Q8CA 4S1DD 4FE9A 1TVDA 1IKOP 5LCVH 2F8IA 1R6VA 3VX1A 1SOXA 3QUKB 5DHVB 3PWPB 3PJNA 1X6NA 2ED8A 5JOFB 4Y19D 4A68A 4TVPL 3FF8A 1JXDA 3P11H 3WIAA 2MOQA 2HKFH 1FZOB 4Q2ZA 3Q0HA 2J57A 3L1OL 3S34L 5K9KB 2YEVB 2RB8A 3DRTA 3BUYB 4DTGL 4BRJA 4L5FH 1IEAB 2H0JA 2NY5L 3VSQA 1JK8B 5AB0A 3GZQA 4ODHL 3ZTCC 4GQPH 3MGTA 5B1CA 5IK3B 3QRFM 1GS8A 3OL2A 2IXQA 2W80C 3POCA 4DP6X 3BGMB 2N3JA 2BNRD 3VI4F 1T0PB 3QEQD 3B2UD 5ITBL 2GJ6E 4OI7A 2IOOA 1HILB 3UOAB 3HNVL 2UV3A 4NQSA 4H1LG 2EACA 1CUOA 2VMDA 5ALBH 5T3ZH 4PPTA 2E3VA 3OWRA 1SF3A 2F54E 1QR1B 1DL7L 1WVZA 3G5WA 1QWHA 1JGUH 1MIML 1VADB 4N68A 2J7LA 5JHMA 3VXSE 1NCTA 1AS7A 2IPUK 1S5HA 2LVEA 3FN0H 4DKFH 4X50A 2ZWNA 2Z7ZA 4ZW7A 1JGEA 4XVJH 3LXBA 5E2UL 5DMYA 3KPOB 2CBQA 5EUOE 2JNZA 3BWAB 4FNQA 1VKXA 3PGDA 1F1AA 2C5DC 5TF1L 5KTEH 3QG6B 1QSVA 4YK4B 1OSZB 2G5UA 2V8LA 4M7JL 4ANUA 1FP5A 3KPTA 1GZHA 4K0OA 4KKNA 5FHBL 4QAMB 1X4ZA 4LSVH 1XHHA 2CPUA 1PD0A 4MNGA 4U3HA 2OAAA 1W8EA 2Z64C 3QXWA 4G5ZH 4ODUA 4XBGA 5FF6B 2JI3A 2M83A 1DL7H 2K3HA 5D4QA 3QUML 4K3EH 4Z7QF 4HWZA 4XP4H 4EI0A 2ITCB 4ZG1A 5BOJA 3KW7A 3PJLA 2MQ3A 3O41A 3BEWA 3KXFE 4JR9L 2L7QA 3MRHA 3UXFA 5C9KA 2Y06H 3IS1X 3QDGB 1NMCB 2BWDA 1WP6A 4KKPA 1PSKL 3NCJH 3V6ZB 1CGYA 2DMBA 5I1DB 4Y2DA 1IU1A 5IHZB 5KTEL 5EO1B 2EDEA 4K7PY 5D1QA 1JPFB 5GISH 2OZNA 4RGOL 3KWUA 1NDGA 2ZKMX 4AUUA 1WEJL 3LN5B 5FDWB 1HXMA 5D7IA 5DF0A 2NY5H 3D3VD 3GYRA 3PLYA 1N59A 3C75A 4NFCA 1QPXA 4O2FB 3U46B 4GUOA 2OYMA 4XPBL 4OI9A 1WO2A 2FHFA 3KGSA 2WLYA 5DU7A 4XR8C 3MLTA 4RQQA 2VDLB 3W38A 4EZJA 1EMTL 4PRIB 4KC3B 4UIMA 2CHDA 1NEZG 1KOAA 3C9NA 2NR6C 2ZCKL 1JV2B 2Y36H 3GQFA 4OZ4B 5DMKB 1C08A 2F7RA 4M29A 5F0PB 3V5KB 4I0PD 4PJXB 1U3ZA 1FZMA 1BAFH 4ZTOH 4ZX6A 2IF7A 1KPVA 1JF5A 4IMKC 5DRNB 3AJ7A 1PY4A 4YHML 3SJVA 4EIUA 5I26A 1RZIA 5ENWA 4D0DA 3T4YA 1RU9H 1F90H 3ZE2B 1RUAL 1SXCA 2E7LC 5DT1L 1NGXA 2H41A 1VEOA 3HPLB 4KTDH 2WBJD 3KLQA 1A6VL 5D1QD 3H55A 4KTEH 2YPKB 2IEPA 5TH2B 2JH2A 3QFJE 3ZMRA 2F18A 3LXUX 2OA9A 5SWZA 4CMHC 3T4AA 2WWMD 1WAAF 4FQIL 3HC4L 1CGWA 3BD4A 5HPOA 5CR1A 1ZXQA 2ZIDA 2WXPA 3RNQA 2UVFA 3FUNA 4GO6B 2G9HB 1AGBB 1DSFL 4YO0B 3IMBA 1IGTA 4J3TA 1MHPH 3NRFA 1WS7A 1QR4A 4YS4A 3STLA 4E9SA 2ZKXA 4X9FA 5HY9A 3V6BR 3SGDH 1FV1A 3DI3B 3WO4B 3P2DA 1AO7A 3ARFA 4IMKA 3KLSA 3U1QA 4M5SA 2VR6A 3MO1A 5HBBA 4KX7A 3D0VB 4OLWL 4HZAA 1ZSDA 1E6OL 1QBAA 1EJOL 2IWEA 1G0YR 3K8LA 1B0IA 1TO4A 4UZSA 5DD6A 3HR5B 3WUWA 2VXTL 3TL5A 4X7TA 4KMLB 5C0AE 3VFTA 1IL1A 3UAFA 6PCYA 1NFDB 3RDTC 1BVKB 1EFQA 2P8LB 4K4KA 3CSPA 3FQNB 2XHNA 4PLOB 3T2OA 3BYTA 1IM9B 2YBGA 5D93C 2DQEL 3IGFA 4HWBL 5J57B 4A6YL 4HPOH 1A6UH 4QOKB 5LN8A 1MAJA 3ZIYA 3W9DA 4G9FE 4WU5A 4MHHI 4O2CA 3WDIA 4DFHA 1SJHA 4YSDA 3IU3A 1F3DH 3PWLA 5D7JB 2X4RB 2MNUA 5EZJB 1NGQH 1NC4B 3QCUH 1QEWB 2W5PA 3EF7A 4EN3A 2Q6WB 1D6VH 2DTMH 4Y5XB 1VA9A 4FQXA 5FLUA 4GBXA 4HC1A 1GS6X 2C9VA 5LQBH 4NWUH 5IQLA 3B2VH 2J44A 2EDLA 4HXAL 1BG9A 4I3RL 4PRBB 2YGNA 2ARJA 2TRYA 1NL0H 3CNKA 4NZ8A 1MFBL 3D3VB 3JWDH 4JCWA 4X4ME 4MMZA 2F7OA 5CBAB 3DOSB 4TS6A 4OB5L 3BH9A 5I0WA 2BCKB 2UXVA 1PZAA 3MV9B 1KLUA 3DX6A 3WTTA 3NZ8B 5GZNA 5KS9F 3E0GA 1QUNA 5T1KA 1DBBH 3S2CA 5AVWB 2O30A 1QBLL 1C7SA 1CG9B 1BBJB 4JO1H 3G9AB 4OI8A 2CWRA 5D7IF 1XCQA 3QI9B 3QCTL 4RGNB 3KDPB 3QWRA 2A6IB 3L3HA 4OCYH 4HIXL 4XPHH 3NCCB 4ELKA 1G43A 2E47A 5D71L 4R5TA 3V6OE 5FHAL 4MRBA 1S7WB 2EEAA 3HG5A 5D7SL 3C08L 4YDIH 3VSVA 2DQJH 4YXLL 1WFJA 5FUOH 1PZ5A 4LLMA 1EO8H 4KZDL 3EJYD 5IMOA 1QMUA 2Y24A 3L3IB 2HVBA 2K4WA 1AYOA 4OB5H 4PWHA 3V52H 2J1WA 1NDMA 4YO0A 2WJ7A 3UGXA 3O3AB 3UYPB 5C6TH 1YMMD 2F53E 1QSEA 1X3DA 2PABA 2Y1YA 4QXGL 4G80A 3U79A 1S7RB 4XMLH 4AL8H 2YXFA 4UNTA 4NEHB 1CI5A 4OIIL 2FJFA 3QH3B 3US1A 3JT2A 1W0VA 2Q10A 1KWKA 1NGYB 2H6UA 4HS8L 3MOAL 4HIJB 4E68A 2CBMA 1JMXA 4N1EA 1OAZL 2YUVA 5SX4I 4MYWB 3JT0A 4FS0A 5F93C 2A0LD 4WI0A 1RK0B 1R17A 4WEUD 4XE0A 1OT4A 4AKOA 3D6GA 3QWRD 2G3ZA 4G43A 2J3SA 4MFHA 4KGJA 5ENWB 2ATPB 1OAJA 2KQMA 1XF2A 1HNFA 4K23H 3DO3A 5E9DA 3JBG7 4XGZA 1AS6A 4X0KA 2WIIB 3LKQB 4HOWA 5JOPE 3MRMB 3ARYA 2R0ZH 3F7YB 4U6VL 1PDKB 3KLLA 1OF2B 1OGTA 2XY2A 3LY6A 4M3HA 1I7UB 4JFYB 3NJMA 3BKJL 1GHFH 1R5WB 4X7DC 5FYJE 1A9VA 3U0TA 4EN3B 3SPCA 3MV11 3LRHA 4HJSA 4JQIH 1VZHA 2XI9A 2X6BA 2X4RA 2AMGA 1CFSA 3ZLQC 4OZHE 1DN2A 1QEXA 1ZV9A 3BAXA 4Y2LA 5I5RA 5IMKA 1KT2B 4XN2A 3KPQB 4WWNA 3W9DB 3HZYA 1FNEB 1SEQH 5TDOB 3O81A 2K9FB 3SPGA 4LPUA 2EE9A 1GYAA 2CKBB 5DI8B 4ZFQA 5HPMB 1IM9A 4ZSOB 3KVQA 3CN2A 1BFOA 1HCVA 1HZLA 4EDWL 1WZKA 4C58B 4HBCL 5F71A 3TJHC 4PJ9D 1NZRA 4PJ8D 2BNQD 3HR5A 4WUKH 3E9UA 1Z9NA 3FONB 1CB4A 3FUDA 4OCMC 4YHKH 4GPVA 2J5WA 4GLRH 3P3YA 5I1GH 4FFYA 3RWJA 4RAVB 4KKCD 4AQ1A 4DO6A 3CC1A 1VHPA 2DLFL 4KTEL 2PWEA 4QHPA 3QXAA 5B8CB 2P26A 1IAMA 5DHXB 5BS0E 3C09B 1QRNA 1M1SA 2OR8A 4U1KB 1ZE3H 4TRPL 1PAMA 4ODXA 1EAQA 4O02L 5BO0D 4HIIA 1P6AB 3PXHA 4G3YL 1UM4H 1GOGA 2NNAB 3OKMA 4KK6D 2DQDL 1N8OE 1Y1UA 2OQJA 4X4XB 3JTTA 4MJID 4UOZA 3KCWA 4M62H 3V55A 5T3ZD 2D7TH 2PCXA 5CGYD 2CJSA 1CFQA 5CHNB 3S3DB 2EVIA 3O6FB 1HILA 2H1PL 2FJUB 4ICWA 3H6JA 4Y1AB 2NY0D 4XH2B 1DJIA 1VPOH 2Z4QA 4UILH 1KDJA 4JJHA 1CDCA 3CX2A 3QEHB 5DHYB 5DQ9B 2Z8SA 1KGCD 1ZPLA 5H94B 1P4BH 3MTRA 3DOIA 3V52L 3LDBC 4KZ0A 4LLVA 5AW3B 4RRPA 4DH2A 5D2NE 2D8KA 1TT6A 2NXZD 2AEQL 4NERA 5E70A 1WWWX 4ADIA 3SGKC 5GS0C 3BX7C 2YEQA 1A47A 1A66A 4N0FB 1UXWA 2B16A 2YFNA 3VXRA 1AMXA 1DE4B 4ZUVA 2B59A 2QVIA 3MRBB 1S2EA 1CXFA 1UD4A 3MRRB 3D87B 5I6KA 3ZZLA 3EAKA 4KVNL 5E8DL 5E6ID 5M95B 2XXGA 4MJIA 3MPCA 5AALA 2DQIL 1VDGA 4M7LT 4DVRH 1QATA 1WGVA 4POYA 4Z76B 3VFPA 3KLHD 4Y5VC 5IJBC 4X5WB 3PXLA 4J39A 4AC4A 1DQTA 3BCDA 4OT1H 2EDWA 4WU7B 5IHZA 4KRMB 4PJBB 4KO5A 3DBXA 1A1NB 2UWEA 3OAZH 4N20A 4ETQA 4URKA 5JPNA 5I30H 4GQ9H 3CHQA 3D85A 1C1EH 2CLZA 2DQTH 3TYGL 5ITFB 1G6RB 3NIDE 1J48A 4PG2A 4N2HA 4PJCE 2VC2L 4C8XA 1A65A 1QFUL 3I50L 3ZUCA 3GBNH 1XR9A 2AZUA 4PWJA 1YUHB 1QABA 1CF8H 4MSWA 4Z7UF 3MROB 1LDSA 2Q86A 2Q8BL 1PEZA 2WXHA 4ODTH 3NAAL 1KCUH 1U3NA 4NHUB 1D5BB 2O5XL 3GMMA 4YFDB 3SY6A 1CDIA 4Z78B 2L4OA 1E7UA 4D8PA 5ESQA 1HYRC 2J56A 3PGDB 5BS0A 4JGNA 5F96H 3ECQA 4OCLC 5CJ8A 1L6ZA 1IX2A 1TTCA 2X38A 4I2XA 3MODH 5IP4A 5J1AB 2IIJA 3BSGA 4CAGA 2Y5QA 4F7EB 1J5OL 4XNZC 5LNGA 1YMME 4GLRI 3MRKA 2XRAH 2KUTA 3RGVD 3JV4B 2Q7YA 3ARTA 5ALCH 5L0QC 1QKZH 4AGNA 1CL7H 3QJZA 4TMPA 3V0FA 2E5EA 3CE1A 4RMTA 7TAAA 5JW5B 2AK4B 1VB9A 3JWOH 5J6GB 1MJUL 3FCGA 1A3LH 1I1AB 3PP4L 2K6ZA 3X2QB 3NACH 4PLJC 1WTLA 1CXLA 3RX5A 3ETSA 4IDLA 5F1NA 3TCXA 1OP3K 3IGKA 4JO4H 3ZKMD 1DQDH 4XTRD 4PJHB 4PWFA 1THCA 3S4SG 3EJQA 5AL8A 4I4WA 4MMXB 1AOZA 2BVOA 4U05A 1J0YA 1JPTL 1T1YA 5DZOA 1T7VA 3NCMA 2Y6SC 4YK4C 5IVXF 1F56A 2ICES 1DDTA 4J23A 5H94A 3ZL1A 5BVPL 2VSCA 3MA9L 5D5ME 1SFDA 1RZGA 3PWPA 1EO8L 3VXTA 4JDTL 2ZUQB 1SFHA 1SEBB 3OD3A 3LN9A 4NS0A 2C7FA 4R3SB 5DK0B 5IBTH 3Q8EA 5CP3H 4NM4H 3CFKB 3GI8H 4PBWD 3T6ZA 4ZMWA 5GRJH 4Y16B 2X4SB 2FIKA 1INDH 4QRQA 5HDOA 1YYCA 2K78A 3RY5A 4XVUC 4HJJH 5CN3A 5F9DC 4X5XB 2GAZB 5AZ2L 1Y6MR 1Q9WA 5D72L 3VFMB 3ZO0A 1FDLH 2MIZA 5D1ZI 4AUJA 3LNFA 4ZOCA 1AXSB 3L7EA 4JHAL 4RAUB 1RUKH 3VXUE 4ZD3H 1ZGLB 2F8XC 1NM4A 1GJIA 2A4ZA 1TYRA 5BVJA 4R7NA 4FFZH 3ZQXA 5T1DH 1RULH 4KHXH 2E4TA 3BMWA 4QHUB 1QBML 5GSVA 3A24A 3EW3B 2ADJB 1AY1L 4J4PA 1O6SB 1I8MA 1F4XH 3CK0H 1QLEB 3NPZB 1TZGH 4NT6A 2J6WA 5CAYB 5KG9B 1C5BL 4J3BA 2IPKA 1KNOA 1T1WA 2V8MA 3LTVA 1MCQA 4KFMA 4UT7H 3ZR5A 1N2RB 5EOQH 3IKCA 4OFYD 1JRHI 2X0WA 5HYQA 5HD8D 3JV6A 1MW0A 2Q76A 1UEMA 1OB0A 4AVKA 1HHKA 1LILA 4O9HH 1CGUA 2A73A 2QPEB 4GMSH 4YGAB 3DIDA 4FFZL 3S3BB 3LQAL 4XNXH 2WXKA 4AEHH 1ZTXH 3I75A 2NYKA 3MV7E 5EU6B 3ZSSA 4UBDD 2L0DA 4X6DE 3X17A 5IW6B 1S7XB 4FKEA 3H9SD 4XPGL 1R3KB 2NTSP 2X4UB 3TV3L 3AMLA 5J56B 1GYWA 3QUMH 4PMFA 1M42A 1M56B 2X70A 2DIJA 2YD3A 5D7JC 3KWVA 5GRXG 2HT2C 1XD0A 3CFCH 4Y2DC 3VFRB 1PZ3A 2YUWA 4Z77A 4N2FA 3TA3D 4JHZA 4BFNA 3LEYH 4WO4B 5K93A 3E2HB 5CCJA 3WN5B 2O61A 1JPGA 1NBVL 2KH2B 4HKXB 4O2EA 2WIIA 3PDOA 4XNAA 5A7EA 2CJ3A 3OC8A 3MA9H 1E27A 5DJDA 2WCGA 1ICTA 4X6EB 1AIZA 3G5VA 5CCKL 1D5RA 4ZUWB 3RGVB 4LLWB 5T1MB 5KS9B 2K6YA 1R24A 3BSZL 2Q0ZX 4A66A 1MREH 4L2YA 1CL7I 3MUUA 1CXIA 3PGCA 3WOVA 5IVZA 5I0YA 3FO1A 2UX6A 5EWIL 5ICUA 2CA4A 1DP0A 5KZCD 3ECUA 3OZKA 4WJ5B 4LAJH 4D9QD 5L2JA 1V7NH 1PBYA 4GUQA 2DF3A 3PGFH 3CFBA 4PIRF 3NJJA 1P1ZB 1AHWC 3SGJC 2WP3T 2Y7LA 2GQHA 5D1ZC 2YPVL 4OGXL 2C4FT 4PM1A 5LBVA 2QLVB 3NVQA 4UT6A 3N1QC 3H2QA 5ALCL 4CC4A 2XRAL 4XP9L 1ZY9A 3WLBB 4PLKD 1Q94A 2X4TA 4WUUA 3DVGA 2ZSWB 5DT1H 2CGRL 2ZT9C 4GY4A 4WHTB 1UCBL 1DQKA 5EZOH 3FPXA 1ERNA 1NCNA 4UMGA 3SCMA 3ZE0B 1ZANH 1DLFL 4QNPE 2W60B 1S7UA 1TVHB 1WS8A 2HG5A 3QQ9D 1U8NA 3QDJA 5HHVL 1CT8A 1RMFL 4JY6B 1SVCP 3AT8A 4TVPD 4NJAH 3UTTD 3LN4B 4LVOB 4BCXA 5KEZA 1YMMB 4BFGA 2AFNA 3H4FA 3PWNA 3AY2A 5GRWA 4Q9QL 3GNML 3MV8D 1UKTA 5EFIA 4FEIA 3BN9C 5AAWA 3MV9A 5CNHA 1HOEA 3TESA 1YNLL 1ASOA 2Z1KA 4RZCB 4CVWA 1E28A 1G9NL 3P0YL 4QRPA 2J5LB 1JYWA 3EOAB 1XTMA 1WAEA 3S97C 5I18L 3QQ9C 4MVBD 4AQAA 1CU4L 2R1WA 5EEYA 4YHYB 3EADA 4HIHB 2D03H 4DGVH 5FA3A 4FKKA 3O9WB 3WNIA 1ONQB 1ADQA 1XH0A 3LZFL 5IV2B 1FO0H 3SY0A 1QD0A 1SHSA 3F2LA 1CYWA 1RK1A 1U8OB 2YKLL 3MYZA 2DLGA 4GBXB 1R3JA 1N5AB 3H9HB 3IE9A 2CRYA 3TIEB 3GLDA 1W91A 3NIDB 4J3OF 1S7SA 3Q1SH 3DECA 4XBEH 3RX7A 1J9CT 4FG6C 5LWYL 4IEFA 4ELMA 1NC4A 1OGAE 5IB5A 3V4VB 1RERA 3PWPE 3ZMNA 2XVKA 3QQNA 4P57A 2BWIA 2AEIT 1ED3A 3PPEA 4HUVB 2FL5B 3DJRA 3VU1A 2NNFA 2HFEB 3SKMA 4K73A 3WI9A 2YGPA 3QNZB 3LQAH 1MFCL 4MD5B 5I8CB 5CKAA 2QADD 3BT0A 1JS4A 3CPUA 4WW1B 2NTFB 4AGPA 3RWGB 4JGJA 4ORGA 5I74C 1E43A 2HUHA 2IWFA 5BUAA 5M94B 3X13B 4K71C 1GZQB 4LLAA 4RSYA 2VDPL 4U1LB 4A2GA 1LO5B 4UUJA 1A5FH 3V0EA 4Z0XB 2EH7L 2AI0L 3A6CL 5AKSA 5DRXA 4YSPA 3T8XB 4EEEA 1MNUH 4HEMA 3UMNA 2BNQB 3EDDA 2HVKB 3I6SA 3QZWA 1AJ7L 4MDJB 3WEBA 4OLXL 3RVTD 3VMNA 5CEYB 4HT1H 2R0KL 4H0GA 1F6AA 1D3CA 1RLBA 4Z1PA 4HPYH 3FH7A 4P2YA 5FKAA 2OW7A 3AM8C 2N1TE 1AI1H 3U4AA 1EERB 1D6EA 3CH1B 2QSVA 4Y5VB 3VFGH 1E9OA 5HHOE 1OAYH 2A4EA 1IQWH 1J18A 2IG2L 3C6SB 3EH2A 2XX0A 3GBEA 5T3XH 3V9EA 4BDVB 5IJDC 1FI8C 4ZMZA 4GUCA 4J3WA 3HC4H 1RJLB 1ODUA 3KLDA 2VSKB 3L7FA 2NCEA 2NZ9C 3VFUA 2QKIA 3V6FA 2IPTL 2GBVA 4KKAD 4NO3B 4LSUH 5TH2A 3UTSA 1X7TA 1H8SA 2BIQA 3EO1A 1EFXB 5IBUB 5IROC 2G4GA 4KVCL 4ONGH 1UC6A 5J5EA 2AV1B 2HVJB 1A7PL 2WAQA 4TNEA 3JYBA 4AX3A 3CUPA 3O3BA 3R19A 4KOCA 4D0DB 2ZPKH 3BZEB 4R7XA 1FZKB 4U7MA 1XBDA 3U1SL 2IH3A 4POUB 3HG3A 3HI1A 4MD4B 2QZQA 4GSQA 5KYYA 4BZ1L 1A6ZB 1EDHA 3LKPA 5T1LB 1I75A 5A2AA 2A74B 1VERA 4NC2B 1BMZA 5L6YH 1QYGH 3WNLA 4MJ4A 3WCYA 3ZQ9A 2KMWA 4ISVA 3GS0A 2P24B 2HMID 2HT3D 1ORQB 2XWXA 1Z9PA 4PJGA 5KSAA 4Y19A 5DURD 4H8PA 2PYEB 1AD9B 1PLGL 2Z7YA 1QKZL 2NY5C 5ES4B 4PRPA 1KPUB 1N9PA 3GO1H 1E4XH 3H1ZA 2VL5A 3GK8H 3MJ9L 1OM3H 1INQA 3M1CA 5FDWA 3LN5A 4Q89A 3UBGA 5E6IB 1L7TH 5D1QB 4UU9A 1VZGA 3PP3H 2IV9A 1AGCB 3RBGA 1EAPA 3V6ZA 4GSUA 4PAZA 1JTPA 2JB5H 2RACA 2X7LB 4D3CH 2E9JA 1U8PB 4YSTA 4BM7A 3CFIC 2EQDA 1X5XA 3FOMA 4FULA 4HKBA 3RL2B 5JW3H 3D39A 4QXVA 4RBPH 1AQ8A 5IVXE 4HQQL 3TURA 4K3DL 2F5AL 1MNNA 3HB3C 4GQZA 1JVOA 3FTWA 3FFCE 4PJHE 4Z95H 5F7BA 1MFDL 2BWQA 1TJHH 4G59C 1KTDB 3GBNL 5TE6H 1GGIL 5LGJB 5JPMA 3I6KA 3V4PL 4OCWH 1T5WA 4UQ2B 3MFFB 4MB3A 4MAUL 5C08E 3RYMA 1CFNA 2IFGA 4K7FA 5AAMA 3OLIA 3QS2A 4I0PC 4NIKB 5EC1A 1OWRM 3ZDXB 1U33A 3KPOA 3MLZL 2Q20A 4AYID 2AXJA 3U1SH 1SMDA 4MJ6A 2Q3AA 1P5VA 5K9JH 2WSDA 1C16B 4NN6B 4W9EC 4WWPA 3OB8A 1N6QL 2Z91A 3Q13A 4MQXC 3SQOH 4XAKE 1MCNA 4Q52A 9CGTA 3ARXA 1QLEL 1QAWA 3AUWB 3JTBA 5FHAH 4FERA 3S88H 1MVUB 2A6JB 3UYOD 5F8QC 3CCHA 2F68X 4XCCL 43CAB 3PV7A 4WUUD 5DQDH 1U92B 3MKKA 1CBJA 3ZYIA 5AD0B 4Y2DD 1MJ8H 3IXTB 1IEAA 4W9CC 4NENA 5E1GA 3WAKA 3EJYC 5L2KB 3EGDA 3BLKA 3PFUA 3PU7A 4FXTA 4BGLA 1GMEA 3MJ6A 3BZ4A 1MCPL 2AQPA 1NCCL 1YCSA 5JOFA 4EN3C 1HI6A 4PJBE 4TQPA 2Z6FA 1IIIA 2ID5A 5BOZG 5EZLA 3OPUA 2J2ZA 3NIFF 4H5SA 1UXLA 1NFDE 1JIBA 2HSIA 4U2ZA 5JQ6L 1UXMA 3GSRA 3NK4A 1OTSD 3KLAB 3CVBA 3QWOA 4MNHA 2BX5A 2Y7QB 1Q9KA 1S9XA 2JJTC 2F1AA 5EIIA 3QQDA 4IBUA 1FIGH 4Y4HB 4APXB 1JD7A 2IH1A 5I6PA 3RUGB 4Y0GA 4G1EB 1F4WL 2CMRH 2JMRA 4HALA 5HI3C 1AZUA 4LGPB 2PETA 4HDIB 1WD8A 4JR9H 3HS0A 3EYSH 4S1RL 4ZMYA 4GW4A 3RB5A 4BZ2L 3U0WH 3Q5YA 4A6YH 2UZXA 4J2QA 3BIKA 3DX9B 3NOIA 5D6CA 3A22A 2EXTA 1YN6B 3UTPE 5IROA 2BHFA 4G5ZL 1UZ6E 1VEPA 4MAYA 4YHYC 4HSAC 2AVFA 1HEJC 5IJKA 3U2SB 4ZX4A 3LPFA 3U2JA 4NKOB 1MHCA 3IDMB 2VB5A 5IFHH 3LKRB 3WKMH 2D4FA 3ML9A 2E6JA 1EEUA 4GP8B 1BAGA 5FOJA 3SQBB 2D2OA 3NPSB 3LRSA 2H4EA 1OCWH 5FK9B 1U3HD 4KI5C 1NOFA 4U31A 4OGAC 5C0CA 1IBHA 5D5MA 2O6DA 3VYPA 4WSKA 4OF6A 2WXLA 1F97A 5C7XL 5G4NA 2HN7B 4JM2B 4PRHD 5F8RC 1LL1A 1Z6JT 2B3RA 1FFOB 4I89A 4PJ5B 4IBVA 4M7KH 4GXVH 4YFEA 2PN5A 3I2CH 2C9AA 4G42B 1PG7X 3CPLA 3UAJC 2YMXL 2VZ1A 4NUJA 2A9DA 3AW5A 4ANVA 32C2B 2XV0A 3PWUA 1WBXA 4JKLA 5DJYB 4NRXA 4ZUTA 3VGFA 1KPRB 1F11A 2MCPH 3NIFE 2WINB 3Q44A 2LLNA 4HLJA 5IQMA 4N87A 1GZPA 2BH0A 4OZFB 5I71C 5D7LD 3VB9A 5DSCA 1DUYB 4J3OH 4LNRB 4WK2B 1E5UI 5TDPA 4MXWL 3ULUD 4FXKB 3ZYOA 4FD0A 5L8KB 1T4KB 3GZPA 5PCYA 4E42A 3R06B 3S4SB 4C56D 2VR9A 3EFOB 1RPUA 3O2VL 2VMFA 3E3QC 3QUZB 3UTTA 3T0VA 1E9QB 3U6RA 3V0VA 1UG9A 1IBYA 1IAOA 4I1NB 3QUMB 5LB1A 1BD2E 5DZ9A 2GITB 4ZUUB 5D1ZA 5IHBA 2P49B 4PJ8A 2FJGB 2VDNL 2IOMA 4PN6A 3CHOA 2ATAA 5AENA 4FYTA 4EN2A 5E1QA 3VFNB 4L1SA 4XMZA 4L0ZA 2NXYB 2XFXA 4PJ9B 2X0VA 3II1A 3VG0L 2OMZA 2VUYA 5DTFA 5FXCH 1SBSH 2DWYA 4M4RA 3WO3B 4FJ6A 5EBLA 1CWVA 4X7CC 4UDTA 3OKDB 4LSSL 4EOWL 4P5TD 4QLRA 2D0GA 2Q3ZA 4HCRA 1JZ7A 1ZWIB 4PRPD 3ZHDA 2WLMA 4QRRD 4A39A 2H9GB 3W56A 5T5FL 1O7SA 3FBQA 5CLWA 5DHEA 1PVHA 5F1KC 2JJUA 4X6DF 1LO4L 4N8VG 4JRWA 3M17B 2XQYG 4KY1H 4Y4HD 1I7RB 3LNGA 5IR1A 4TQEL 4F33A 3LEXB 3GSQB 4PG9B 4QO1A 4GAYB 2BMKB 3OHXA 3ZRFC 2OK0H 1FFNB 4PBVC 3GGWA 3MBXH 4U0RB 4BZ1A 4BUQA 3QPQD 4OFDA 3HE6B 5F3BB 3ETBJ 4M7JH 2P5ED 1MJ7H 4PVBA 3HFFA 4CBZA 4M93B 1G87A 3TVMB 4PGEB 1YEIH 4N26A 1J8HD 2IPUG 1JZHA 3P9WB 4WWKC 1JHKL 3BRFA 1M2OA 3RA7H 4P2RA 1NGPH 2H1XA 3H85A 3VM5A 4AM0B 4KO6A 1GS7A 2HFFB 4O5LL 3DNKA 4WFFD 4UQDA 3WY4A 3DJSA 5BCAA 3J27A 4HG4K 2N1KA 2I9LB 3RVVD 4WVRA 1KCUL 1BCIA 1JGUL 1MIMH 2AXGB 5ICXA 2EABA 3CTTA 4HOZA 4BWUA 4HUUA 4CILA 1HH9B 4GXUN 1SVBA 5D1ZB 4W9KC 3SBWA 1QW9A 2KLRA 5I75C 1KGXA 1MVFA 2Z93A 2NXZB 1MWAB 2VC2H 4LQ1A 4OIFA 4CU6A 3FCTA 3POHA 1HL8A 3NN8A 3RWCB 2EXWD 4FG6D 3S5LA 3S8GB 3S96B 1ZD6A 2CIIA 2B39A 1NUGA 5DLMH 5CU5A 2YWZA 3MRPB 4XVTL 3U36B 3FU0A 5F9JA 4ANKA 3C2AL 4PRDB 3UAJA 4E42B 2UX7A 2XV2A 1MHHA 5FWRA 4YHPA 2R23A 4WLCA 1A2YB 2A9NL 4MD0B 5TGBA 3HAEA 5KVGH 4BZYA 2FD6L 1PKQE 2IBZX 2JQMA 4K15A 1E8YA 4FFVC 4PJFF 3ZHKA 5FCUH 1JWMA 1Z7JA 3FC8A 5I1CH 1H3PL 3P11L 4UINH 3BIBX 1T89A 1YNTF 2W8CA 3L4ZA 1DFXA 4JFHD 3QIBB 1P9MC 1KTKE 2BRRH 5EH1A 4YQXL 2VH5L 3L4UA 2B14A 1MCWW 3QHZH 4NQVB 1TNMA 2LR4A 1A22B 2AJ3B 3BEVB 4YBLB 3GBDA 2ZOWA 1OAKL 3AWGA 4AEFA 1U3JA 4JHBA 1EV2E 1FYTE 2AJSH 3FUIA 4H13C 4R90H 2APTA 1HEHC 4JAMA 4XVOA 4NQDE 1V10A 4XTRC 5IOPB 1AS8A 3DX2A 2ZWLT 3S35L 1IM9D 2OI9B 2XJLA 2AV7B 3CZGA 4BWTA 3KVDD 3RZCD 3WDHA 3ZZ1A 4UDUA 5DO8A 2HLAB 2VJ8A 5F7LB 5AYUL 4OR1A 2I85A 3SBPA 3KYMB 3KM2A 4HH8A 5EO0A 1DVFB 1OE3A 3LKRA 3BWUC 3DTDA 2YQ2A 3UG5A 4L48A 2P47B 3LQZA 1SQ2N 5CJXC 4ATWA 4AYGA 5CLZA 4M8VA 2XBZA 3H3PH 2XKUA 4LSPL 3WFBL 1MFUA 5FLVA 3FB7A 1BPLB 1CQYA 2EECA 3MOBH 4GKOA 4KNSA 2VXUL 4EI5A 4F24A 5D6CB 1DQMH 1KGIA 5D1XD 4JRYE 5I8KH 4GS7C 2JLPA 1T20A 3RLSA 5B1KA 1WC7B 3BO8B 4JPKH 5C2BL 2LTQC 1RFDH 4OAWA 2XV6B 4C54A 3IPBA 2Z35A 3S9DB 4XP1H 2NUPA 4HWBA 4D0BA 3FK3A 1H5BB 2FEEI 4ALAL 2A9MH 2P48B 3U25A 3SPVB 4LCWA 2YAPA 1RD6A 3UBXG 3W1ZA 2PR4H 5I17B 2R1XA 3EG9A 4FGMA 5F9OH 1JZDC 1BAWA 2G2PA 5CEZE 2WYTA 1ZJAA 4LEEA 4LU5L 4QRFA 3QWOB 4MNHB 3KLAA 4A63A 1IE4A 4PWKA 3A47A 2G5BA 4LSRL 1EEYA 3TYGH 2J1YA 2CRZA 4HF5L 1BXVA 2EDKA 3QISA 5DDHA 1HS6A 1IEBA 5EZLB 4J3SA 4XWGL 3IMUA 2OULB 2JELL 3N06B 1A7RL 2A2QT 2LHAA 3MUJA 3IDIB 2MNWA 3GINA 3IBOA 4I5BA 1TZOA 3F85A 2OXGA 5KSUA 4PCTA 2ZONA 1IBZA 4F7MB 1USQA 3FUMA 2HYMA 5AVZB 4FG4A 4JJ5B 1IGML 3FQ4A 3BUBA 5T1LD 4B9CA 1KB5B 4ZMNA 1IC4L 4WJKB 2X6MA 5LQBL 3L4WA 4DWHA 4I7ZC 4OH2A 4U6XA 5EOTA 1QOKA 3GPEA 1CLCA 5GGRB 3ULSA 4JG1L 2ED9A 2FO1A 4G8GD 4YHKL 4MMYB 1ZLVK 1WV7T 3CDGA 1HU8A 4JLRA 2FO4B 4H25A 5FECA 5JHDA 3ZHNA 4OJDH 3FH8A 3OKOB 4ZZFA 3P77B 4PBXA 5C3IA 3BAIA 2YGOA 1JNNL 3HRZC 1JGDB 2BVYA 4RWYL 3BW9A 2JB5L 2YLKA 4YPGB 5T5NG 5HYSA 4AI7A 5I0ZA 1WAPA 1X5JA 2E74C 2JXMA 2XN1A 2Z91B 4LEBA 3ZYZA 5I6XC 4RFEA 1EA9C 2KDYA 4LVOC 4PP2A 1UXSA 5A16B 2A1WH 4XMKH 2XZZA 3UTQB 3A6OA 5E9NA 1MF2H 4BFRA 1F4AA 1KB5L 4DP8X 2XWJB 2AK1L 3T6XA 3VFSB 2J1KA 1L9QA 1OE1A 4IMLB 4PRHA 3BPCA 4NGHL 2GSGB 4MJ5B 4D9QE 2P7TB 3EZ8A 5D8JL 2AK4D 1EHXA 4V1DA 1XB6A 1UJTA 2AABL 5ACZB 3I6KB 5F7AA 5HYSG 2ZX9A 1YEGL 2XZQL 4JKPL 2DH2A 3CLFL 1V54B 4P8QA 1VACA 1OAUL 1CICC 2R2EA 5CEXA 5DEGA 1NAKL 1X9UA 4OBSA 5D7LE 1Z3RA 1JHTB 4AYFA 3IEAA 4LRIA 1AIFB 2AEPH 1AMYA 4GW1B 3D48R 2PW2B 4K8RD 3M8OL 3GSWA 1R5VA 1ZLWH 4YSQA 4J6IA 2NW3B 4L8BB 1KCWA 4NSKA 4BA0A 4LSUL 4ANWA 3NSJA 5CGMA 3MV01 1G5AA 1A4AA 1BFSA 5HJ3A 2YZ8A 1XGUB 2XN9B 4PJ9C 1NPNA 4PJXE 5AEAA 2VL5B 4FFVD 4PJEA 3LH2L 1IGYB 4KX9A 2QADB 5BO1H 4FXGB 5KVEE 3QJHB 1MFEH 3HFML 4F93B 5DJ8A 2QV4A 2FLBT 3QXDB 2RH0A 2GJPA 5CJQH 4AXWB 3ZTNL 3DX8B 5MI0B 2NDFA 4BK4A 2VQUA 1XV8A 3OTTA 1WFMA 4QCIA 7PAZA 4DO4A 2XPGB 2Q5BA 4HISA 4QLWA 4WO4C 1IRAY 3ARBD 4BQBA 4I18C 2H3NB 1LTXA 2ISDA 1SPDA 2APXA 4JFOB 4GKZB 2PW2A 1A6ZA 4ECNA 2VAAA 5AZUA 4XN4A 1PNDA 1YHPA 4F92B 3HI1B 1OSEA 4H8HA 3VXMD 4N2LA 4KQ4H 1TEFA 2AJVL 4PREA 2R69H 4XZ4A 3ZE2F 4WI6A 3IJEA 5JTWA 3FQ1A 4EXPX 5B38B 3UTSD 2FECI 3VFGL 1B4JL 2P7TA 1KC5L 4YNYA 4P07A 5EUKA 2GC7C 3F12B 1Q1JH 1KTCA 4C55A 2VDOH 3ARGB 4XE5B 1UD3A 2HJLB 3KPSB 4A6YA 4MDRA 3V7AG 4UTCA 1AGFA 1CE6B 1EGJL 4FI8A 4KKBD 5EOTB 2A7BA 5TE4L 3VO0A 1HYSD 1T0OA 2WBJC 1UACH 3ARDA 3K2IA 2XACC 4Z9KB 1ZK5A 5JPMC 4P04A 1BJ1H 2OJ1A 43C9B 1CTNA 4OU3A 4H20L 3SO5A 4R8WL 2XQBH 1II4E 4JPWL 4DAGL 2X1WL 2R2BB 3Q6GL 4Y1AE 3DRQA 3HRZB 1TVBB 4NC0B 4P5KA 3RTQC 3CDGB 4ATTA 2KBGA 5K59F 3KPMA 2R0ZL 3IETB 1E9PB 3LS4H 4MCNA 4PS3A 2H45A 4JFZL 4M1DH 4W81A 5DZLA 3ILQD 4WCYL 2GI7A 1A7OH 3VSUA 5I6XB 3AWEA 1FUNA 2ZOTA 4I18A 1UKQA 4NRZB 4Y4HC 3U7YL 1NFDF 3IJSB 1ZPUA 1F4WH 2CMRL 4FLOA 5I6MA 3O6MH 5E2WH 5GZND 2ZAHA 4YHIB 1MG3C 2MOGA 3BAKA 4HGMA 4G8FA 4JFSA 4NAQA 1XO8A 3IDIA 2E7CA 3QDAA 4HA1A 3K46A 1FNHA 4PP1D 4D0BB 3P30L 1OAZH 1SOKA 2BNRE 3O6KL 1U8QB 3MJ9H 3QHTC 4Y4FA 4N0RA 3OMZA 2YWYA 5GGUA 3C2SA 3QR0A 1RP9A 1TETH 1ED3B 3IAPA 4HUVA 3TBTA 1CN4A 3VTTA 2OJEA 3OSKA 3B56A 3BCFA 2YAMA 4R0LB 4LPXA 5HHVH 3O11B 5I1AA 3LYRA 3NZUA 4QT5B 4IJ3B 5KANI 4FQQB 4P9HH 5KVGE 4E2OA 3CFJB 3OKEB 5CN2A 4GRWB 5F6HJ 4IKKA 1LWRA 2AJZB 3TASA 1DVFA 1GW6A 3KDMA 5FM4A 3T3ME 4AWJC 4YR6B 4YGVB 5LCVL 1QO3B 4UDUB 4NQCA 3C8KB 3MRQB 3UCRA 1ZT4B 3RTLA 5TTRA 2ZJSL 2YEZA 3LQAC 2IDFA 3UZVA 2R8SL 2NY1D 3SE9L 3LKNA 4TTDC 1H6EA 1M71B 3NJNA 3FSWA 5DUBB 5E7FA 2FX7L 3ARVA 4L1DA 5IB1A 5D2LB 3HPJB 4ZAKC 4KI5D 2K8MA 2GBAA 4NQVA 4ZW6A 1ILUA 3ZDWA 2PF6A 3LN4A 5I8EB 4MB5A 1G1OA 3HC3H 1HTYA 5C6PB 2HLAA 5E4IA 5CFAA 5JIMA 3GMNB 5BW7C 4PJ8C 4A2FA 3ET9F 4X6FA 5BQ7B 2Z9TA 4EIBA 1ZLUH 1ZVYA 4Q4EA 3AS3A 5SWQB 5KBLA 4TLSA 2LGNA 4ZQKA 4X6BA 2OI9C 4XCNB 3AADB 4LLYB 5FM8A 3LV3B 4H44C 1WF5A 3OGCB 4GIOA 3P30H 2QELA 5C9JB 4R7DA 4XO5A 1HK6A 2F7PA 3HLAA 3BJ91 4Z3TA 3B7YA 2VMCA 4Z7VE 1Z5LA 3S5LB 5LXVA 2DQMA 3BFQG 2WKOA 1INEH 2CGYA 2V3FA 5FB8B 5CZRA 4EUPA 1XTLA 5JW3L 4LKXA 3HN8A 4XNXL 1T22B 1F2QA 3V4VH 4JO2H 4N8UA 4HUCA 4IHOB 2OFQA 4JFFE 5ID0A 4Z7QB 4RX4A 1DBJL 4N0UA 2PW1A 3AUVA 3GPSA 3PS6A 4HFWA 1WFOA 2F54A 2X4QA 4JVUA 5J11C 4YWGL 2J20A 3FO9B 3GMQB 4P2RB 5EC2B 1DLHB 5J7CC 1SY6H 3QFJB 3S2AA 3PYCA 3LHPL 4BH7B 4W9JC 1C5BH 2I24N 3FCTB 4OTXH 3TBSB 1NKOA 1SDDA 3FAWA 3QT2A 4MJIE 1URLA 2O61B 3P4OA 2EINB 2QGDA 3LDBB 4U6TA 3ALXA 3Q1SL 1EGJH 5TE4H 5JYMA 4L5FE 3SJVD 4QO1B 3OF6D 1UD2A 4V2CB 3VFRA 2DB8A 2VDMH 3HG0A 3C6LB 4BGDA 1UJ3A 5DD5H 1I7RA 1F90L 1FNSL 3PJSA 4C4KO 3VQMA 2BDNL 4AUYA 1C5CL 2X4UA 4HUNB 5TFSH 3RWDB 3NMEA 4XP5H 1H3WM 5E99H 1AGEA 1T2XA 3ASWA 1X5YA 5IW6A 3T0EC 2QR0B 1GGUA 1ZLSL 1T03L 3GHPA 4HF5H 1Z9SA 2KZWA 2ZJSH 2D7PA 2OMWB 1BEXA 2IANB 3RVTC 3QJSB 4Z0BL 1G9NH 3P0YH 3NSXA 3FU7B 4NZRH 2F5BL 1EHLH 5EBLB 3ALPA 1XF3A 3BPNC 2YAHA 3TTYA 2BMKA 3OHXB 2J8UB 5KVFH 2XVGA 4GG6F 5IR1B 1ZXKA 5LAXA 5DMGD 3EOYG 3KPNA 2RFXA 2WM0A 3AMKA 4I77H 1DVFC 1DVQA 3IKCB 1LD9B 3A0OA 4HX1B 4L0YA 4PRAB 2H9GA 5BS0D 1TCRA 2GITA 4ZUUA 1DVZA 4YHMH 1RAMA 1DBML 1FC2D 4PJ5D 1BJMA 1ROCA 2Y6TE 4JM2C 2A6DB 4AW7A 5F7HA 3UX9B 1S9WA 3E8VA 4NKDB 3RE0A 5LXGL 2I27N 1VLXA 5BO1L 5DC4B 1G7IA 1XR8B 1PYWB 1A4KB 4W9FC 2EYSB 3CXHJ 1RIVL 3MACH 4WKXA 4NM4L 3TXAA 1ZCRA 2WWNA 5ETUB 1WCBA 3LRGA 1AHWA 2LU7A 4WFGE 3LHPH 4X5XA 4Y5XC 1FA4A 4KJPC 2PYEE 1TPXC 4QRQB 5TDNB 5KSBB 2WLLA 4ZRGA 4LPCA 4A55A 5CD5C 4J3OG 4Z8FL 5AW8B 4PR5A 1WT5C 4GAAA 4AQEB 1Z5LB 4NRXB 1T7XA 3FNKA 4OM1H 4B9JA 5D2LE 4F8QA 4ODSL 1HHJA 35C8H 1FNSH 1D5MA 3GSUB 5ISZD 4KI1A 4ELMF 2WVUA 1U58A 3QIWB 4M9PA 3TCTA 3LXAA 4PJ5A 2PTVA 4L4VA 3HRPA 1DJZA 4GIAA 1GSKA 1N8ZB 4B96A 1XGRB 1AYRA 2X4PB 5ALBL 4WFHE 3L3KA 1IC4H 4XX1E 1UZ6F 4QMEA 3DX7B 4S0TD 2A1WL 1QQDB 2VDRH 1LEIA 3N44B 2P5WB 4OZGB 2MWCA 3PWVA 5IB1B 2BSEA 4GQ9L 3QA3B 3I9AA 3MBEB 1FRGH 1PZSA 2Z8RA 4KOBA 2XICA 4OKDA 4C57C 3S7GA 3EBIA 2HH0L 1N67A 2I60L 3KYKH 1FYTD 2BW4A 5FUCE 4JRYD 3LIUA 4PD4J 2Q7YB 2V5RA 1KELH 3D9AH 3IDYB 4Y8AA 4UT6L 4LQFH 2HA1A 1HXYB 4B9GA 3BIKB 3DX9A 2BJML 5BJTA 3DX4A 1TNNA 4U1SA 4I2XE 3H9YA 4YR6A 5TPWL 2Z8VC 5FFLA 1RVFL 1RL1A 1I7TB 4P2QA 4AVIA 2BS71 2HKHH 5GQBA 2XFGB 3S36H 4A67A 1F45A 4BA8A 4ABWA 3C6LD 1S7VB 3BVXA 3BQUB 1TOXA 3H7BA 3ML8A 3TO4D 1ZIAA 3D0AA 3U2SA 3CX5K 3G08A 5GGQH 1W2KT 2Q86B 1CZ8H 2H26A 2WD0A 5EIVA 5F88B 1OANA 3NJVA 1GZHC 5D7LB 1JG9A 1YUHA 2XWZA 4AT6B 1XR9B 4EPSA 1KXQE 1OIOA 1TIUA 4GINA 3N42B 1I1YB 3HNTL 4KK9C 5FGBC 3HMWH 2QFPA 3HS0B 3LPGA 1FORH 3IMVA 3UJJH 1CC3A 3DBXB 3UP1A 3WELA 2D3VA 1A1MA 1HI6B 2IH1B 4APXA 1LVEA 4CVUA 3GNMH 1LO4H 5EEZA 3BZ4B 4EIGB 3D0LB 3EIFA 4UTAL 2Y72A 3JVFC 1NICA 2EXYD 2Z0BA 3EOBA 3RIFK 1D2PA 1OARL 1N5YH 3EBHA 5A2CA 1IFRA 3DX1A 3U4BL 1WYJA 2B20A 1E3ZA 4LAQL 4PJCF 3BPOB 4TNWK 5C3LD 1NGZA 2DMHA 4LRNL 1TTUA 3B8SA 3MXWL 4H5SB 4BRVA 5F72S 4P5KB 4XN8A 4J3OD 3SE8L 4RRPG 2WQVA 4GKSA 4HH9B 3MUY1 5IM7B 3TZVD 2R2BA 3EYOA 4P0DA 1YG9A 3VXRB 4B9ZA 1NEZB 3ATFA 5LDUA 4JG0L 2AC0A 1G7HA 4YSUA 2DH3A 1QSFD 1P5UC 2LFEA 1AXTL 4AE1A 1OHQA 1ML0A 4YQXH 4QTHB 4PJ5E 2M8XA 2FAUA 1CVSC 1Z3GL 5LG1A 4G6ML 3K80A 2MPVA 5KSVB 4C59B 1R3IL 4Y5YB 3BKYL 4TUKH 1MLBA 2N0MA 4HEPG 1YYLL 43CAA 3F04A 4E5XA 1JYXA 1J5OH 1JNJA 1Y7VA 1NJ9A 4XI5C 1I3GH 1E4KA 3TNNA 4I1RA 3TV3H 3MFFA 1MVUA 1AE6L 1CL7L 3KYNA 3TX4A 4R5XA 5LGJA 1DBAH 5LKNA 3NP4A 3KJ4C 4QHLA 1KTDA 2GABA 4M6AA 1N6UA 1JXKA 2DBLL 3VGAB 1NBYA 2JKSA 1BOGB 2P44B 4QHKJ 3TIDA 1T7YA 3WDJA 2ZYRA 3FTVA 2XTJD 2ZWYA 1G6VK 1CVRA 4G6KL 3BPLB 5FR3A 5C86A 5HHXL 1PCXA 4BV1A 3EXLA 2ILLA 5CKGA 4U1KA 1PIFA 2WPGA 2CR6A 4QCIB 4U49A 5B8CA 4IU2A 5JPMB 3MMEA 4R9HA 1D5XB 4UU9B 5AVXB 3MUHL 1K4CB 3OAUH 4JFWA 4KFZC 5LBSA 3EOTL 1DR9A 1U21A 5DJ8B 3W0WD 1E5CA 2PCPA 3O0RL 4MB1A 4X9HA 1MSPA 1IJNA 4ZOAA 2PYEA 1I1FB 1MQ8A 2FBRA 4NRYB 4DP4X 1T0NA 4LCUA 2VDOB 4OGZA 1BF8A 4N28A 2MHAA 2PR4L 1IFHH 2O26U 4XP6L 5B39B 5JQHC 4Q9QH 3F84A 1RV6X 5E00A 2YAFA 3AU1A 1TQCC 5AVRB 1BZQK 3G5ZA 3HE6C 1IFGA 5T1LA 3BISA 3ATAA 1YNKL 3C5ZC 4PVLA 3DSFH 3OAYH 5H4YA 5C8JB 4ODWB 4TLKA 5I15L 4TUJB 1HIMH 5FKPA 1JHTA 4AYFB 2J8UE 1J10A 1AD9A 4P48A 2QGEA 5A40E 3QPXH 3FDWA 3OG6B 4MS8D 1M6OA 5EN3A 5HJBA 3CUPB 3O3BB 3U0WL 2FBJH 2WTRA 3VXUB 1F58L 1X7QA 2WLHA 2JKWA 4WNJA 3SO3C 1VGKA 5BRZE 5E1AB 1OOWA 5DRZA 2VIRB 4Y7MA 4LL1A 1RFDL 3L9RB 4BSVB 1HT6A 5ACZA 5F6IB 1RZ8B 2QVMA 5HYJE 1XSJA 1CLOL 1EANA 4BFOA 1PGRB 1ZHBA 4PWEA 1FQ9C 5IBUG 2GSGA 3JWNE 4QWWC 1FIGL 1IKFH 4RFNB 4P2QD 3QC6X 1BHGA 1VFOA 4BQ8A 2G0KA 4NO2B 4YAQB 2D7TL 4LSPH 2JQZA 2L7EA 2BC4B 2VO8A 3FCSB 3H6AA 2BHZA 4N24A 3HZVB 3KH3A 4NN7B 3QCTH 5ECJE 3BPOC 4MWFA 2FZ3B 1JFQL 1R33A 2AV1A 4G43B 3B9KD 5IBTL 5MENB 2P5EA 2IGLA 5B4MD 3BW9B 4QKXB 1EFXA 4WI0B 3EO1B 3MLVL 2BHYA 4KJQC 3AFLA 2YFOA 3WKYA 3K6DA 1UWYA 4G82A 4Q8BA 3QJFB 3DGGB 3KNBA 1NGYA 3NCWA 5HI3D 3BP7A 3QHFH 2IJ0C 4DKEH 4QF1A 3B5GA 2F1BA 1RJZA 3IDGA 1MG2C 3OQ3B 4K71B 2XVLA 1T21B 1S7RA 4WTWA 3VXRE 3DUSA 3KHOA 1LE9B 3ZPDA 1YEGH 1N4XL 3GIZL 4P2OA 4HIQA 4F7MA 4APQB 3PAUA 4XNZB 3QDMA 1MH5B 5I1IH 4NZFA 4XHJC 4R84A 2UUDH 4KAQH 3BT2L 4M7KL 2ZWSA 2PUQT 4Q0XL 2QVKA 2UWEF 4P05A 3REVB 5IKCA 2JKXA 5K39B 1J5CA 2W9DL 4G6JL 1Q0YH 4DQOL 4ELKB 4Z0XA 4S0HA 5CEZH 4GI9A 2BVPA 2AF2A 4KV5E 4LKCB 3DPDA 2F7IA 1T2QL 3G6AA 5D6DA 1KJMA 5KYXB 1Q38A 3HUJF 2DWDB 1E8WA 4FTVE 3WD5H 4KMTH 5KAQG 5E8OA 5E94B 4A7TA 3MUZ1 1PY9A 3WFHA 4JQIL 3IXAA 2BCKA 4IKIA 4LHUA 3L1EA 3KZ8A 5DYOA 1L9MA 4DQAA 2NUPB 2CUMA 1NLBH 5GGVL 1XGYL 2WV3A 1HHIA 1ZLEA 4FXGC 4NAJA 5ELIA 3R8QA 2WB1A 3VGBA 1TJHL 5I0VA 1PIGA 1L0XA 1I3UA 4NZDA 3MTXA 4H26A 5J6HA 1OD7A 5F1IB 3D1MC 1JERA 3V4VA 1LP9E 3K81A 4M61B 3LIZA 2UWEE 3VRJA 3ME0B 3R1GH 2R15A 3HBQA 4BD4A 3U9PL 3H9HA 3MGOA 1IB5A 1HEZB 2WQAA 4M02A 5EFIB 1MJJA 2JB6B 2I69A 1RK1B 1NMCC 1UHVA 3DETD 3E6HA 1ADWA 4ZSOE 3T08A 4ETYA 3FT3B 3BVTA 4DKEL 2O6PA 1FJ1B 3V5DB 3FO0H 4EQ3A 4LAQH 3CMGA 4IRJD 5KWYC 3H3PL 3WFBH 4NQDB 4CN1A 1ZMYA 4YBQD 4JY6A 3GI8L 4AQAB 5F2FA 3DK2A 1B0GA 2OMBA 3UMTA 2W60A 3MLVH 4EOWH 2XZAL 3T0BA 2KZ1B 2CIKA 4UILL 1E28B 4K5MA 3U9WA 1Q0EA 1QBBA 2X28A 4PTTA 4XWOD 2CUIA 4ZAKD 3GDBA 2V9QA 1BVKA 5C6TL 5HVFB 3NSYA 3Q8AA 12E8L 2NZIA 3QGVA 3P3TA 3OR7B 3MBED 4FQ2H 2D0FA 3QZNA 4G1MB 2IH9A 4ZO9A 5D2NA 2VE6A 3NPSC 2Y2TA 3TJEL 5C0BD 3DKHA 3LVTA 4JRYB 4PGBB 4I9WE 1XZ0B 4BYHA 1Q0XL 2GSIB 4KK8C 2WY3B 1FL6B 3GJFA 4F57L 3QQ4A 5AG8A 1JWMB 4WJG3 2YC1B 5KYNA 2ZX5A 2OX5B 1E4KC 3HAEB 1M7DA 4ZS7L 1A3RL 4LEXL 5IVZB 5FYJU 4IGBB 5IG7A 1JZJA 2VDLH 3FFOA 2LFGA 1UM6H 5F9JB 3GBLA 1DQIA 1G9HA 1GGYA 2OL3A 1FSKB 4X2UA 5TE7L 1IIKA 1KJ2A 4ZPTB 4KMQA 2H7WA 1JMZA 3CSFA 3PDOB 5KVGL 4N2GA 1BM3H 1CD1B 1JL8A 4F9PC 1HQRA 2ICEB 2JE8A 3W9EB 2C9UA 3RIAF 2F9BT 4GFTB 3JV0A 4RH4A 3CFNA 2OXHB 3P4LA 1D5IL 4BKLA 4N1HB 3CZSA 5I24A 4XNBA 3GXPA 1YECL 3CVHH 4NWTH 5J12B 5JR1H 1RZQA 2XN9D 2V17L 5C0ND 3V0IA 3TCLB 4V33A 3SKUD 5C07E 5KW9L 3NJGA 3S88L 1TZIB 4ADJA 2F53A 1OK8A 3QEQB 5DHVH 1WFUA 5E6IC 4UOJA 1RVFH 2I7OA 4TPRH 2NX5E 3W0WA 4OD3L 3TBWA 5FCUL 3WN5A 2GCYB 2ZKWA 4JRLA 1S6NA 1A1OA 4PG9A 4EDWH 3N50A 3UPRB 4B53A 3BPLC 2EIJB 2PWDA 3AVEA 3GMOB 4PW3A 1PY0A 35C8L 5H2BA 2YD6A 2C3WA 2X70B 4CNIB 4OT1L 3OKNA 2VR7A 3K6SB 2R4SL 3TZVB 1LEGA 3P4MB 1F13A 5JIDA 2D7MA 4JFDD 5IFJB 5HHMB 4AJ0A 3P3SA 1UUNA 1S5IH 2WOYA 4AJWA 4HU8A 2WUBL 4NZTL 4DESA 1I8MB 4JRXE 4P4KD 5CP3A 1IAKB 1P7KA 5DRWA 1OAXH 1PEWA 4Y2DB 2CO4A 4KJWD 5I1JH 1A6AB 2VABB 3L3JA 4WW2A 1YY8A 3U48A 5FPIA 5L8LB 2DV6A 5JHDD 1TPXB 4G6FD 5CSZB 1YYML 3TGXA 4MB4A 1BGXL 4XNDA 1T1WB 1RZ7H 1U6AH 2FYYB 1DO5A 1S78C 1W6LA 2BERA 4LCIL 1SBSL 4OSUL 4RGMB 2VZ3A 4YDJA 4Y16A 5L0QB 3W81A 2ADJA 3DOHA 4JREB 3TN0C 3PCYA 3TO2A 4CKQA 3EFOA 1OWWA 1SEBA 2OSYA 3CZKA 3KEDA 5DK0A 4HHAA 4BFKA 4JFED 2BOCB 4Y89A 4O00A 4RMWA 4RSVA 3ARBC 3N43F 3MUGB 5FOBB 2R8SH 3O2DA 1IO4C 4QY8B 5F6IC 4LCYA 2CK0H 1BYOA 5JQ6H 1DUYA 4Z18A 1QHPA 3THMH 4XBPA 4FMFA 3U2IA 1TJIL 4H1LA 4UTAH 3PQYB 3BN9D 5DQJB 2BVOB 1HCFX 1A9EA 5H37H 1SMOA 5D7KE 2YO3A 3WIIL 1OEZW 1PD1A 3VE0A 5IF0B 1DBMH 1WZ1L 4ZUTB 4F8LA 1SF5A 1KACB 1ET7A 4L5FL 1H15B 5KANG 4AQZA 1ZVNA 3FB8B 3OAYK 4KKCC 4JQXA 3CPLB 3B9DA 4PJDF 1RZFH 4XMPH 3VXOA 1VCAA 1X4YA 3WTUA 3FFCB 4ONFH 1MCKA 3BWZA 2C7UA 2NY3D 3SE4C 3S37H 5D5MB 3VXMB 3BUYA 5EDXA 2BVUA 5E2TH 2CRIA 4OFKA 4IS6B 4K3HA 4N9OB 3WJMB 1KYDA 2F74A 2PCYA 2Y22A 4JL2A 2CUHA 5D2LF 4XP5L 3I02B 4XCYA 1ZVSA 4K2UH 4RGOH 3SQOL 2D3LA 3IVKA 4NP9A 1TMQA 4MXWH 2VUKA 2F58L 4PV1C 3VWJB 5LUMA 3LKSA 1JWUB 2I7SA 3ETBF 4NHUA 1H6FA 1KGYE 3L5WB 5SV4A 1RUQH 3HNSL 1FVDB 3MX0A 5AWNH 3RVWC 2VISA 1BREA 2WZ6A 1FFRA 1SXBA 1G1CA 4GRWE 1I8KB 4JN2A 5DWUL 4FFZA 4LASL 3VA2C 2VDKH 5BW7A 4OTXL 1YEDB 5B1AB 1GGBH 1G6RA 1H19A 4GW4B 3VA6A 5IZ7A 4Z7VB 1OTSC 4W9LC 2HJKB 1GCYA 4XBEL 4NWUL 5ESAA 5BS0B 1N12A 1XL6A 1UH2A 4JO5A 4ZW3A 1UH3A 3MJWA 5EBWB 1DBJH 4Y4HA 1OSYA 3BWUF 1IJ9A 2SEBA 1F2XK 2E9WA 1N10A 2AQSA 4HSQA 5A6MA 4FX5A 1RUQL 3HNSH 4WIQA 3L4YA 3RRQA 1XGZA 5HVHC 4KTYA 1XSIA 4DKFL 2CCLA 4N2IA 2RR3A 3D85B 5E5MA 2EYTB 3IFPB 4PUBH 2D4DA 5A6LA 4AKQA 3X1NA 4N6RA 2YUZA 3GB7B 1PW3A 4MCZB 1JI1A 5L6YL 1E90A 1S78D 3H8NA 4H40A 5I71B 3DK0A 3OJ2C 3VFPB 1NMAL 1GA2A 2CJTA 1FHNA 3EDEA 3I9GL 4GAFB 4M5YH 1FFTB 1KEMH 5C07A 2TSAA 3FSVA 4UI2A 1AY1H 1UD8A 1AFVH 3RUGE 5C3TA 1LK3L 3VMOA 4LVNB 4FHKA 1UCBH 2B59B 2X53A 2AANA 3L17A 1T1ZB 4OLZH 2QVTA 3LRKA 1XVSA 4TVSa 1A6WH 5BXFB 2MJWA 3V5HB 4CADB 3GIVB 3L81A 1J8HE 3G6JE 2A9AA 1X5IA 5F0LB 5C0NC 5I23A 2EVGA 3L5IA 2J8UF 4X99B 3V6OC 1EHKB 4R2GD 4NO5A 1XCTB 5IVXB 4X6DB 4XNMB 2P9RA 3GI9L 1CGXA 4ZX5A 3D05A 4QY8A 4UB0H 5CZVL 4Q97A 4L9LA 3QEHA 4FTVB 2V7NA 5DQ9A 5EO9A 2IQ9H 3UFIA 5FYKU 3JUYA 4N2NA 3H9SE 5AAPA 5DD1H 1B4RA 1NIDA 2CM5A 3QXAB 5CHNA 3WL9B 1NPJA 5GGVY 3H0TB 3WFEL 1SDAB 1JZGA 3FRPA 4G7YL 3TBVB 3UIZA 5JDSB 3FQTA 2EP6A 4Z7QE 3VVWA 4I48A 1L6XA 3GBMH 3IJYA 3N1FC 3FS9A 3OJDA 4QRUA 1KXHA 3C6LC 4NNPH 3BRDA 3LEVL 2E56A 4PJ7F 1D9KB 5T1KD 2Y36L 3BD3A 5KSBE 1R1CA 1QZNA 2ZKHL 1MRDL 1QZ1A 3ZKXB 4DP2X 3BVNB 2BXZA 4E41A 4KGLA 1NCJA 2OSLB 4QXUH 4KUCF 1MWAL 1P7KB 1PQZA 3QUYC 3I74A 4GRLC 3WTWA 4WWKB 2YA0A 3KPQA 3TT3L 4PU2A 2H0FA 2NNCA 4FF9A 4RMVA 1UWEH 1JZIA 4AMKH 4DZ8B 3F3HA 1IC0A 4XWOC 1BLIA 2EDFA 4EI5D 1WBZA 5HYJA 2CO7A 4RMRA 4Q9BA 5D7EA 3GS4A 4JFZH 3RX8A 1T66D 1UENA 4O9HL 1LEKA 1GYCA 2A9CA 2QBWA 4AEIL 2IMMA 2AKRA 4ZMPA 3ULUE 3KVPA 3K4DA 4OGAD 3GXMA 3KAAA 4AL8C 2OSXA 4HC1L 2DJMA 3CJJA 2ZXCA 4AIOA 2CRMA 5I76A 1MXGA 4Y19E 5CO1A 3ZYJA 5HGHA 1PDKA 2ZG3A 1BV8A 1HHGA 4J8RB 4Z95L 2AEWA 4FQ1H 3MRMA 3AS1A 5C0EB 5I9QC 1FL5A 1LDPL 1AKPA 1WGOA 3QDHA 4BUHA 5E8NB 1WLHA 1KYAA 3HUJE 5I8OL 1DUZB 5CP7B 3VRIB 2ATPA 1SLWA 2C9RA 4LP8A 1TTAA 3STZA 1XH2A 3UZEC 4HWUA 1I3RA 4ZNEE 1PMYA 3VACA 1FO0L 5K9OB 3D39E 4NPJA 4PEEA 5KZCB 3QBTB 2GK0B 1DVFD 3C60A 1UT1A 4BHUA 4HMDA 4X9BA 5DO2C 2EH8H 2A6KA 2E6QA 4U1GB 1W0VB 3M1BB 4EJ1C 4PJXF 4XN5A 5FO7B 4XGZB 3SDXA 2WO3B 1KJ2B 4ZPTA 5CMAB 4XXWC 4P4KC 2R2HA 4POZC 1T0MA 3MLSH 3BT2H 4WEBL 1TZ8A 4XX1G 4Y88A 2G75A 4JO8A 4RVBA 4XPAH 5IW3A 1GMIA 4HP5A 1EJFA 4DO5A 5T3XL 2ZUYA 3NGBB 9PCYA 4X8JA 1C8PA 4OV5B 3D3VE 2RQ8A 3QZMA 2FH6A 5GS1B 4N0YL 4PGBA 3TEXA 5TQ2L 3GHBH 4LL4A 1X5FA 4IBWA 3FYEB 2A6IA 3L3HB 2XKNA 4G9DA 1G7LB 5E6ZA 3KWTA 1GZQA 1P6WA 1JBJA 3T3MF 2ZOKA 4E9QA 1NGWA 1MN4A 4UT9L 3RAJL 2D31A 4X5RA 1NDMB 4GKNB 1AZRA 4PTTB 4Q6KA 3DPBB 4DZBB 1A3RH 2WANA 1W72H 4LEXH 4F37K 5F3HB 3OHMB 2WIMA 1MOEA 1M05A 4E41E 5CMAA 1CTMA 1G9NC 3HN3A 3WS3B 2VR8A 1BIIA 2Z31C 4JPKL 3PRZA 4TVUA 5GSRA 1X5AA 3WEXB 5ICZB 2QKSA 3T8MA 3GHBL 1FJ1A 3G04A 3IYLW 4JZOA 2WXMA 3O45B 4M7LH 5IB5B 2B77A 4BBWA 4F7CA 1SJEB 2OMYA 1GH7A 1PSKH 2M2DA 3NCJL 3BZFA 3MQIA 1QUNB 2UZIH 5T1KB 1HEZA 1U3HB 4PB0H 4EKJA 1H0DA 4HT1L 1R3JB 3ULVC 1OARH 3NEEA 2IQAA 1E30A 2VDQH 1S3KH 4H2CA 3VRIA 3NJLA 3QPXL 2Q8BH 5D7JA 5E8NA 3MRDB 1IE5A 3DVFA 1GYUA 2VZSA 3UBXB 4H26B 4EZMA 1SY6L 2YD4A 1M3JA 2YOAA 4O2CB 4WU5B 5C0EA 2W07B 4X83A 5B4MC 2OMVA 4IGBD 4RGNE 4Z7AA 5CILL 2EDJA 4GI8A 4PJ6A 4AKPA 4EDXB 2BXYA 3I9PA 4AV5A 2IQAB 2OR9L 1ZGLP 4CW1B 2XNAB 3WFHB 3WD5L 4EVNB 5JHDE 1LEKB 4NB7A 3N55A 2VSDA 4NN5B 1MDTA 4FNTA 5K33A 2WNGA 3MCYA 4JCLA 3G04B 3UABA 4JZOB 5KYXA 3L6FB 1A7NL 2VXQL 5GS0H 1NC2B 1GC1L 1ZSDB 1SJHB 1P0SE 5FWQA 4P46A 2EJ1A 4QRBA 4M8RA 3MO1B 4KDTC 3LPPA 3MNMA 1YEEL 4H88L 3REVA 4XOCA 1HL9A 4P2OD 4HJEA 4KO9A 2A38A 4E41B 5JNYB 3GLZA 3MJ7A 1FAKT 3STLB 1FSKC 1Q9LA 4GKNA 2ZAIA 4HXBL 3OXSB 3HZ3A 2PMZA 4HC1H 5C08B 4JGUA 2A5UA 4NC1C 5EF0A 1F86A 8CGTA 5I66B 3T0WA 2Y07H 3MNVB 4TUOB 1SLXA 3QSKB 2X3AA 3I85A 5AZ2H 4KJYA 2YK1H 2HJFA 3FRPB 2GI0A 3TBVA 4QJ4B 1ECYA 2R0LH 2FATL 2WKOF 4GAGH 4WJ5A 2YPLE 1J8SA 2G2RA 4WI7A 5HHMD 1FVEA 4QRRA 1R3LB 3WIIH 4WENB 2VLRD 5CSGA 1MCCA 2FE0A 3NCXA 5CM1A 1LO2L 1PNCA 3IMWA 2APSA 1ZS8A 2R2HB 3GXNA 4DCQA 4KK5D 4NO5B 1E27B 5AKVA 3RVVC 1SUJA 2P3YA 3CDYA 15C8H 1OE2A 4H8WH 2DEWX 4OZIE 1U91B 4MNQA 5IEHB 4H0LC 4M1CC 4F15B 1HL5A 1TJGH 4G11A 5DD3L 3ZW3A 1EHAA 1F3JA 5IW1B 3GTTA 4HKZB 3S36X 1L9RA 2IDTA 1S4IA 2XN9E 1KXVA 1JZEA 4JK0D 3IFLH 3QHZL 4PRIA 4QUOA 2CG9X 2DQ6A 2UY6A 2CDGB 3NH7H 4WI4A 1R3KA 1A64A 4NFBA 2B9BA 4MA8L 3IDNB 3QUXC 4W4NA 4XPFH 4Z3FA 1HXMB 5D7IB 3FSAA 1FZMB 3GKWH 2GSMB 4K5LA 3CN1A 3G5ZB 3GMRB 3WFCH 4HBCH 4AENB 4F58H 3Q6FB 3GB7A 1HHKB 1JV2A 5FUZL 1Z9MA 3O6ML 5HYQB 4G3YH 1MRFL 4MLIA 1QP1A 1Z5HA 2BPBA 2DOCA 5IEKB 4S0SD 1M1XB 1HXKA 5HJGA 1WBZB 4RFOH 5HYJB 4NX0A 4XCFL 2DLFH 1P1VA 4XBGB 1NUFA 1JP5A 2VLLA 4FI6A 4OCRL 3RWIB 5JA8B 4DVBA 1TYJA 4DGIH 1E6JL 4Q6IA 3EDFA 2X6CA 1EWHA 1PG7H 3NSCA 3QXVA 4ODTL 6PAZA 1BX2A 2ZXWB 2DTML 3MRHB 3EO0A 4ENEC 5B38G 2AAVA 3X1FA 2AP2A 1KCVH 3RDJA 5ABDE 1UB5A 4Y9BA 4OJCA 4V11A 3HUJB 3D2UB 1DEDA 3PHQB 4HKJA 1XCXA 3PL6A 2C4XA 2H2SD 3BE1H 1GTNA 3WHXA 5JDSA 4RZKA 4UTBA 1G6RH 1E4XI 5IMMB 1E5ZA 2VLRE 3QZPA 2WP3O 4MJHA 4Q0XH 3HHRB 4AVHA 2YPLA 1QFPA 5B1JA 4F80A 1E6JH 1MELA 2V7NB 4DGIL 2IXQB 2F74B 4E5XB 1BQHA 3FTXA 2FSDA 3HI6H 3MJGX 3NZHL 2F8OA 4XNUL 1VAHA 5D2NC 5CBEB 1CXEA 3T4AC 2Q8AL 4ZJ9A 2DBJA 4U1GC 5CEZD 1OP5K 5DJXB 4PJHA 1XXFC 3IU4L 1P4UA 4IJTA 1ZHKB 5D4IA 3X1EA 5F1NB 4Q2ZB 4DW2H 2V6HA 2WGNB 3ZE1F 1SLUA 2B4CH 2DKMA 1S7QA 4S11A 2PKDA 2YPLB 5JW5A 1F41A 1BQHG 4NAMA 4GKSB 4HH9A 2FJHB 4MZ3A 4ZFGH 5A2JH 1I3GL 5AW0B 2XSKA 3KM1A 3KR3L 3S6CA 1QFWL 3EFFB 4L23A 1ZEAL 5DJXA 4JFUA 1ZHLB 1BZ9B 1LMKA 4B9YA 4RA3A 4WEMB 4Q58C 5DQJA 5LAPA 1WCQA 1N5YL 4B41A 2OMUA 3ARGC 1QUPA 4LLUA 2LT9A 4OCYL 4F9PA 1Z3GH 1V5JA 2OP4H 4A7QA 2VRQA 1G84A 2HRHA 1MCWM 3KXFA 4HU2A 4JFDB 3K71B 5ESQB 2JCCF 5BVPH 1CD8A 3RY6C 3VI3F 2QSTA 4Q6IB 3F6IA 1ZT7A 4QOKD 1FNGB 5E5MB 5IMMA 5MERA 3PAVA 1KENL 5HDRA 1I1YA 3HAEH 4LARL 5DEFB 5EHFA 4DP7X 2XA3A 3SDDC 1O6TA 3FT4B 3FT2A 3P2TA 5D7JD 5JIQA 3W82A 3NJKA 1IGIH 2H26B 3ZL4L 5C0JB 2A0LC 3QUXB 2ZUVA 5A2IH 1U95A 3QORD 2HG0A 2VTFA 3S5LG 2Y2YA 3RG1C 1ET8A 3PWJB 3APNA 4G7SB 1XIWB 3MBWB 1OZUA 4U1HA 1XMWA 4WDIB 4K3GA 1YEFL 4FZEL 4F3FA 2O93L 2W9LA 4O51A 5FGSA 1JDCA 1GGTA 4UIKH 4ZYKB 3O2WH 5CD3B 2PPDA 4GIPD 1TMCB 4X5WA 5F70A 4U1SB 1IC5H 3MRGA 2AEOA 4LSTH 3WE6B 2IVFC 2N01B 4Z76A 5B7EA 1B2WL 1KELL 1XX9C 1LK3H 1YPZB 1NCWH 2OYKA 4Z3EA 4F5CE 2CDGA 4WWKD 3K6SA 1O9ZA 3ARPA 3RIAK 5JXAH 3D18B 2QPDB 2FWOB 5AW7B 5E5LA 3IVKB 2ADFH 5I82A 1OALA 1UXWB 2IGF