4DPBX

The 1.00 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 8.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin A, chloroplastic
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dpbX00
2GBAA 2QT6A 5I6KA 3TBCA 3X1EA 3DKHA 3SQRA 3ERXA 2IWKA 2ZWNA 1ASPA 4YL4A 1PF3A 2YAQA 3SBPA 1NWPA 2J57A 5E9NA 3NSFA 2AFNA 3OD3A 2QDVA 1RKRA 4HHWA 2FQGA 4A66A 3CVBA 4KOBA 3ZX1A 4G7SB 3FQ2A 2ZOOA 3UGEA 3AG4B 4KO9A 4E9SA 1MG2C 2JXMA 2DYSB 3GDCA 4GP4B 3NJIA 4NB7A 5B1KA 2VSMB 1AZBA 2IDUA 2PP8A 3AZUA 3NJMA 1E5YA 3FSWA 1B3IA 2I85A 1E67A 4WKXA 1KCBA 3FS9A 1PZBA 3NYKA 1X9UA 2NRDA 1JXFA 1M56B 2XV3A 4HZ1A 4GY4A 2IWEA 1GY2A 3UACA 2UX7A 5FC9A 2QPDB 4N8UA 1E5ZA 1NPJA 2YAHA 1KV7A 3X1FA 5I6MA 1A65A 1AS7A 4P5SA 4Q89A 1DYZA 2I7OA 1JVOA 3ABLB 4DP2X 4KNUA 3IN2A 1OE2A 2YARA 5TK4A 4E9QA 2J55A 1SNRA 1A3ZA 1N68A 2E86A 2EINB 3FT0A 1RZQA 6PAZA 3CZUB 2WSDA 1JZFA 4BXSV 1SHXA 1AG6A 2ZXWB 4BWUA 1A8ZA 1ILSA 1NIFA 2UXGA 1RCYA 2RACA 2TSAA 1XB6A 2XWZA 2FJSA 3NP3A 3ZDWA 3CVDA 2FQDA 3MX0B 3KW7A 1PCSA 3CDZA 4K9JA 1BQRA 1NIEA 1PY0A 5I5IA 4E9VA 2XXFA 1ASOA 3PXLA 2DYRB 2OJ1A 3IN0A 1AOZA 1JZEA 3FYIB 3OMAB 4YSSA 2IH9A 3NJGA 3ZBMA 1GY1A 1SF5A 5F7AA 4QKTA 4A2HA 5B7MA 4X4KA 4FA7B 4EF3A 3S8FB 3QJSB 1KBVA 1IC0A 2JKWA 4W9ZA 4CSZA 2BP0B 3FU8A 1NZRA 2DY2A 3D12B 1NIDA 3T6VA 4F2FA 3HEIB 1AZUA 3DTUB 1X9RA 1KDJA 1ZIBA 3T71A 1TU2A 4BDVB 4E9TA 3FPYA 1HFUA 5I28A 1CC3A 3FSZA 3JT2A 3T6XA 4DP0X 2LLNA 1OF0A 2BO0A 1ET5A 3FYEB 1GR7A 4N4YB 4UAHA 2PCFA 4KO7A 4TXVB 2HXAA 4BWWA 3PLYA 1MZYA 2XV0A 2WO2B 5ANHA 3QJRB 2HZHA 2HX9A 1XB8A 1OE1A 3IEAA 2B08A 2CCWA 2VSKB 2BWDA 1AZCA 3UADA 2ZONA 2HLEB 5D4JA 3FU9A 1BYOA 2GC7C 8PAZA 2EIMB 3H4HA 3TA4D 4DP5X 1SJMA 3ABGA 4L0PB 4A2FA 2EILB 4UANA 9PCYA 3GXUB 2H47C 4BK5C 2FNWA 3PAVA 1WA1X 4YSRA 1JOIA 4KOCA 4DPAX 3WI9A 2YXWA 4AKQA 4YSDA 4BDVA 1JZJA 1J9TA 2DWSA 1L9RA 2PPCA 5D4IA 1GS6X 1RZPA 3WIAA 1PNCA 3T6ZA 1L9QA 1L9PA 1JZIA 3EH5B 2GC4C 1JVLA 4YVUA 5PAZA 2OV0A 2XX1A 3OMNB 4DP9X 4HHGA 1ADWA 2AZUA 3QJQB 1PZCA 1E65A 1NIAA 2XVBA 1PAZA 1A4BA 2YAEA 3CDZB 4AI7A 5EHFA 1ZDQA 2FT6A 2TSBA 4KNTA 2YAOA 3PCYA 2UXVA 1EHKB 3V9CA 1AR1B 2CALA 2QDWA 4RH4A 3N2JA 3ASNB 5B7FA 1HAWA 3FQ1A 4E9YA 3T6WA 1AZNA 4HIPA 1NPNA 3SBQA 1V10A 2AZAA 1IBZA 2GSMB 4JHVA 5AZUA 1ASQA 2P80A 3S3CB 4HCIA 2YAFA 1T5KA 3FSAA 4G70B 4MFHA 1NIBA 5B1JC 1W8EA 3NJHA 4E9XA 1SDDB 3OM3B 4E9RA 1GS7A 4YSCA 3AG2B 1BAWA 1AAJA 1NINA 2AVFA 3FQYA 3NJJA 5B1JA 2Q5BA 3X1BA 2BZ7A 2BP0A 2UXFA 5I5JA 3NSDA 3UAEA 5I6PA 2XV2A 4YSEA 2IWFA 1V55B 3QPKA 1XMEB 1AZRA 1J5DA 2XUWA 1ID2A 1EZLA 5I5MA 3IBOA 3WNJA 3FPXA 1GYCA 4A68A 3PAZA 1BYPA 1ET7A 3FSVA 3KW8A 3WKPA 1ET8A 2HRHA 1BQKA 1OOWA 2GIMA 3OQRA 4GP5B 3T9WA 1KGYE 1AACA 2DWTA 1ZDSA 1FFTB 4DPCX 4JHUA 4YSUA 2WO3B 1KDIA 2R7EA 3WG7B 2FT8A 4A67A 6PCYA 2HRGA 2J56A 1ZIAA 2GHZA 3NP4A 3PPSA 1GSKA 4YSOA 3X1NA 3WNIA 1KCWA 1IKOP 1L9SA 1AS8A 3CG8A 4AKOA 4P5RA 3S3BB 2A3TA 1QNIA 2IH8A 3TASA 2VMJA 1URIA 2YQBA 1OCCB 2VN3A 5LDUA 1WA0X 1XB3A 1BXUA 3GYRA 2X87A 2QPEB 1OE3A 3ABMB 4ZK8A 4W1TA 4NAJA 4F2EA 1SHWA 1TEGA 7PAZA 5B7EA 1NTDA 1GS8A 1J5CA 4G7RB 5IY5B 4CSPA 2VW7A 4G7QB 2EIKB 3EHBB 2JFCA 2PP9A 5I6LA 7PCYA 1CURA 2VW4A 3NJKA 4BWTA 2PLTA 3ABKB 5AFAA 3C75A 4DP7X 4HAKA 2N0MA 4AKPA 1JXDA 1AIZA 4Q8BA 4A2DA 5I26A 1QHQA 2BZCA 2VM3A 1WA2X 4GXFA 5AKRA 2R7EB 4BXVA 4DP8X 1FA4A 1HAUA 3QJUB 5D4HA 2IAAC 1SFDA 2FWLB 4M4RB 2J5WA 3NJNA 1JZHA 1E30A 1M57B 2MRYA 5B3SB 2H5UA 3HB3B 2HX8A 2VM4A 3EH4B 2HX7A 4GYBA 4YSQA 1OCRB 1PLCA 1NICA 1FWXA 1UATA 2W88A 1CYWA 4HALA 1W6LA 3IE9A 4PAZA 4PCYA 3V9EA 2CBPA 1SFHA 2IDTA 2XX0A 1L9OA 3AY2A 2PPAA 3QQXA 4GP8B 4DP6X 2PPFA 3TBBA 2BW4A 2FQEA 3QJTB 4JKNA 1VLXA 1ETJA 2W8CA 2BW5A 3U25A 4AX3A 4DP1X 4DP4X 3QJVB 2IDQA 2BHFA 2DV6A 1AANA 2VW6A 1PLAA 2FTAA 2FT7A 3TU6A 1NDTA 3ASOB 3H4FA 1BQ5A 1BXAA 3EF4A 4A2EA 3UABA 1KBWA 1L9TA 3S3DB 2H3XC 4KNSA 1OCZB 2IDSA 2XLLA 1PLBA 2BP8B 1IBYA 4G71B 4WTQA 4QLWA 1OV8A 2XXGA 4ENZA 5I6OA 1CUOA 1N70A 3FU7B 1ZV2A 2GB2A 1PMYA 5F7BA 2Y1AA 1PNDA 2CAKA 1WAEA 3MBWB 4YSAA 1BXVA 2GI0A 1V54B 1F56A 2I7SA 4HCGA 3BQVA 3AG3B 2IDFA 3OMIB 1KYAA 1GW0A 1AS6A 2Q9OA 4A2GA 1OCOB 3CVCA 1AG0A 4KO5A 3N55A 3PAUA 4YSTA 4AZUA 2XU9A 3S8GB 1J9QA 3JTBA 3ZIYA 2PPDA 2MTAA 4HCFA 1M9WA 3X2QB 3NSCA 3NJLA 2FQFA 1QLEB 1ILUA 4F7KA 4M3HA 3H56A 4KO6A 2UXTA 3UAAA 1MDAA 2OCCB 2PP7A 3NSYA 3DIVA 1I53A 4DPBX 3G5WA 5TK2A 2BWIA 3BVDB 2PCYA 2B3IA 1JZGA 3FU7A 1DZ0A 2X88A 1SDDA 2XYBA 5B1AB 3L45A 2BP8A 3NJFA 2P80D 1JERA 3X1GA 1J9RA 4FAAB 2Y69B 1SF3A 1J9SA 3EH3B 4YSPA 5PCYA 2YXVA 1TKWA 2UX6A 3AG1B 3SBRA 2CUAA 1MZZA 3WKQA 1YLBB 4NERA 3AW5A 1WS7A 2PPEA 1R1CA 1WS8A 3NT0A 1ZPUA 4G72B 1JXGA 5I6NA 1A4AA 5A7EA 1W6WA 1MG3C 4UF7C 3RYMA 1PZAA 1CYXA 2YAMA 1TEFA 2AANA 1A4CA 4YVNA 1AQ8A 5B1BB 1BEXA 2YAPA 1IUZA 4E9WA 1NWOA 2CJ3A 2EIJB
chains in the Genus database with same CATH superfamily
2QT6A 4CVXA 3X1EA 1DLHB 4H2AA 5F7MC 1XSIA 2FEEL 2QSCL 2YGPA 4E41D 2R56H 2ITDA 2F74A 2ZOLA 5M95B 5LGKA 4X5XA 2PYEA 4N0CD 5CCKL 3EYFA 4L1HA 2BIHA 2QKIC 3W81A 3D2UB 1PF3A 1WITA 5I15H 1DO5A 1JP5A 2EE2A 1P0SE 3ZXAC 4M1DL 3EUUA 5EIVA 5CN2A 3NSFA 3O9WB 4DT2A 1R5IB 3HVNA 4RGNE 1J0ZA 2RA1A 1D7FA 1BYNA 4FL4B 1RVFH 1UD2A 2YPKB 1OM3H 5KVFL 1A47A 1E6JL 2D3LA 4LCIL 3TH2T 3MUY1 2HMID 3MJ7B 5GISH 2ICEB 2CM6A 5DRWA 1OEZW 4JO4L 1OGAD 2NXYB 2ZXDA 3T5WA 2I85A 4Z0XA 4WHTB 1UYWL 5DDHB 1OP9A 3LRMA 1KCBA 2HFFB 3FS9A 3WEXB 4N28A 2XV3A 1Q94A 1DJXA 3MJ8A 2WZPA 5IEHB 4OF5A 3FQUA 3S88L 1OCWL 2BOCB 4K3JL 5IQMA 1M42A 4PY7A 5E5MA 5A2IH 4YGAB 3UJJL 2J71A 1EEQA 3H6AA 3OKKA 1LDPH 1BOYA 1BM7A 3W9EB 2WC7A 3RY6C 5ID1A 4P5SA 2NTFA 2E4FA 1EANA 2GTWB 4LT7A 3BC9A 5E6ZA 4LBAA 1A4KA 4KUCF 4N2CA 3GBMH 3PDOA 5AWNH 4OGQC 3RWDB 2AI0L 2A0LC 3OLEA 4FABH 5LO7A 2EYSA 1Z66A 3Q8CA 1UJTA 5JPNA 4P4KA 1UM6L 4P2QB 3E6FB 1A14L 2WUBL 1LXMA 1A8ZA 3C5JB 2UUDK 4NPJA 1RCYA 3GSWA 1I9RH 4XNMA 1W72H 3ZHFA 4OCLC 2O5YL 4GMTH 2D7TL 2UWEA 4LVHC 2F7RA 3DVGB 2GHWB 3OC8A 4MMXB 4E9VA 4G6AD 3SPVA 4OZHF 5EFIA 5T5FH 2JI3A 5B8CA 1FNSL 4EI5B 4QKXB 5BVPL 2PTUA 1MAML 3QIBC 3E6HA 4Y2OA 5GRJH 3RPIA 1UURA 1HNYA 3OMAB 1MJUH 5IKCA 1P69B 1H3VA 4XR8C 2ZCKH 3ZYIA 1UWGL 4JFTA 3GHEL 4XCFL 5I1EL 2CGRL 4I3SL 3VB9A 4IIZA 4OLEA 1NL0H 3ABZA 3S96B 4X4KA 1ZXKA 4FA7B 4IKLA 4EF3A 2OXGB 4RFOH 4X0KA 2FX9H 2WM0A 3O0RH 2HLFD 2A6DA 2DF3A 4UB0L 1B0RB 5CSZB 1OGSA 2C26A 2DM7A 2OS7A 3Q8BA 4X6BA 1UM5L 4F2FA 3GHBH 4RQQA 4LOUD 3SDCB 2ZF9A 1IAIL 3UBXI 3T71A 5JPMA 1NUNB 2BVPA 1RVFL 2F8VA 5I1IH 1KXVC 1CFMA 1A3RH 4KKCC 2VXUL 5D7JC 4ZBJA 1ADQA 5MENB 3TIDB 3HG5A 2HLAA 1R5IA 1RV6X 4Z3JA 2WAHA 5I75B 1V5JA 3K6NA 2WVTA 3LIUA 1TQSA 5DSCA 5K9KB 1OGAE 3EOBA 3EYVB 3O6LH 4P5MB 1KXHA 4A7QA 4WUUB 3RX5A 2Y24A 1INEL 1CFTB 1YEDA 3QA3B 3HE7D 2ZONA 5FYJE 3SY0A 4DP5X 1FBIH 1FFNB 4YAQB 4GW4A 3GXMA 4PY7B 5E5MB 4Y19D 5FGBC 5IFJB 1JOIA 1BJ8A 4XPBH 1BMZA 3O8XC 4P3CH 2YXWA 1KJ3H 4WFFE 5I8EB 4OT1L 4YBHA 1AE6H 2Q86B 3ZTJG 2Y7NA 1UKTA 4OLVL 3UBXG 1DL7H 1P2CB 3WIAA 4CUCA 3GIZH 4KTEH 3DETC 1OVZA 3G7TA 1URZA 1JZ6A 3QJFA 4EZMA 1KFGA 3IKCA 1NAML 4D0DB 5DK2A 2ZXCA 2QZ5A 3SDAB 2QKIA 5PAZA 2EYRB 5DXWA 2WUCH 3AACA 3B9KB 2HCZX 4QO1B 1S7QA 2ODHA 5EZLB 4FP8H 3PV6A 4M8QB 1NIAA 2VTFA 3DVNA 1QLFB 1PG7L 2E8ZA 3ETBF 2YAOA 5JHBA 2J6EL 4QRUA 4HIIA 5CJXA 2VMFA 5C9JA 3NFNA 3PJSB 4CN1A 4XAWL 1C5BL 1YY9C 4JFFA 2OP4L 3H9SE 4M5TA 2V2XB 2X4QA 3VRJA 3ZDZE 3IPEA 3LX9A 3N44F 4P2RD 1F18A 5JOPE 5JW5A 1GL4B 3KPOB 1HS6A 3QR2A 2ZYSA 5KSBA 3ARBA 1SDDB 1GGUA 5EUOA 3KLAB 1UT9A 4GW1B 1DR9A 3IKCB 3K8KA 3OWEA 4N8CL 3LH9A 4L37A 4N0YH 4CW1B 3C8DA 3NSDA 4NQCD 4ZUVA 3D0LA 3QIWC 4G8FB 5CEXA 2XV2A 4OW6A 5DQJA 3NZSA 1FZKB 4XVTL 4E41B 1T7VA 2WGXA 3NK3A 2WSKA 4OJDH 2JKTM 1ET7A 4OUUB 4XN2A 1MFDL 4NM8H 3VTTA 1YN7A 2WV3A 2J4WL 2XY1A 3N43B 1OOWA 3BIBX 4TUOA 5C7ZA 1TMCB 2DWDA 1X5GA 4ILDA 4RGND 5GSRB 4B6ZA 3D4CA 1P7HL 5DA0B 5E2TL 2XFGB 3ZT7A 2Q1EA 4N6RA 5E1AA 1QI5A 2BK8A 1J1PL 3HNSH 1X44A 4CILA 4EUPG 2VDKB 1T3FB 2Z1PA 4PSPA 2LTQC 4UDUB 3WG7B 3HPJA 3QWQB 5EO1B 4EI5A 1GPOH 3AU0A 3ATBA 2WBWB 3CPLB 4NZJA 5D6DC 2WZAA 1NM4A 3UJIL 4Z7QE 4AVJA 3QXAB 3POHA 1CE6B 4P2YA 5BS0A 2A3TA 4TUJB 2ZX5A 4PV8B 3GGWB 3VFPA 3Q05A 3QUMA 1OWWA 4MS8D 1GGIH 2AEIT 2EKSA 3HPLB 3RZCC 3PIQA 5C9KA 3ULUL 1KGCE 4D9RE 4Y8DC 1QBLH 1RZ7H 3WKYA 3ZT5A 2IALA 4NAJA 5DJCB 4I1NB 2WN2A 4QTFA 1P2CA 4J8QA 4PR5B 3ZR6A 1J5CA 3X3FL 1L4IA 2O6EA 4G7QB 4E9LA 2NYYD 4QRAA 2VW4A 4BV1A 2VN7A 2E4TA 3C9NB 3RFZB 2J1XA 4AEFA 4S2SB 4NNPL 4AGMA 1N6UA 4Y4KC 2Y06L 4R2GB 3SGEH 4HOZA 3QEQE 4FFWC 5DEGA 3EYSL 3WNLA 4OZGB 5CS7A 5T5NG 3HAEB 1SQMA 3IKKA 2V7HB 3QH3A 4LCWE 2DEYX 3VRLE 2XTJE 2GJ6D 4ZPTB 5DFVC 3ESPA 3RUGF 2AQ1A 4PJIE 1FPTL 3FC8A 1H3XA 2G0KA 1YYLL 4K5LA 3QEGL 2P3YA 3D3VB 4KH9A 3PIQB 4XP6L 1A9EB 3PJNA 4W9LC 2EEAA 2FWLB 3VYOA 1L6ZA 2EEBA 4Q6IB 4KROB 2AQRA 2WXKA 1KB3A 3TYFA 4M5SA 1VRSA 5BMFH 4IMLA 4BUGA 2WPGA 5HYJE 1N5AA 4LB8A 1MWAA 2ZNXA 4PRDB 3F6JA 1KYFA 1FVDB 5F8QC 3I2CH 2MQ3A 4QRBA 2ICWI 3IAGC 4NJAL 4EI0A 2JQMA 3NGBC 5SX4H 3Q48A 4ZMZA 5CIPA 3MOBL 1ORQB 4K5OA 1NC4A 3HAEA 2BW4A 3CDGA 3FN3A 1BGXH 3QYMA 3V6ZB 3MJGX 4QTIH 3GBEA 4OLZL 2BVEA 2P45B 2RJMA 3JWDL 2VDRB 2VMCA 2AV1B 4A2MA 4X8JA 2N1KA 2DV6A 2HFFA 5JXED 4KITB 3P77A 5L2KD 3RWGA 2KZBA 5JOFA 1Z0MA 2ENPA 5ESQB 1MHHB 2NCMA 4N2LA 3TYFB 3HZVB 3AU1A 4PRID 3MXWH 1R3LA 1T2XA 4FOMA 3HC3L 4QT5A 5DEFA 3S3DB 1N5AB 1I3RA 3T0BA 3CFUA 2EVGA 2X2YA 2XLLA 1I9IL 3GI9L 1OP3K 3SKJL 1EJ8A 4GW5B 4D7PA 4JQIH 5L4MA 1IGFH 2OYKA 1DO6A 4KI5E 5DI8B 2NXYC 3QDGD 1AVAA 3H2PA 3L5HA 2IV8A 3P0VL 3DGGB 3L13A 2R8SL 2I7SA 4HCGA 5ETUB 1MW3A 3ATAA 2X4NB 4H0GA 4A2GA 4ZAKC 3U6RA 3PXJA 4X5XB 1PBYA 5EU6A 3T77A 5J9PB 2EO7A 2P5EB 1EAQA 1WC7A 2I26N 5DZLA 1J12A 2E6JA 4TQIA 4WWKD 2HPTA 1N6QH 2JF1A 4OZ4A 4NRZB 5JLZA 1DQKA 2AQPA 3KHOA 1HINL 3K8MA 1YEGL 4NSKB 3Q8EA 2E9IA 4YXHL 1A2YB 1QO3A 2K70A 3L3IB 4XP9L 4ENED 4H2CA 2AXFB 2Q76B 4FRWA 4DVRL 3UC0L 4ZW7A 1JYXA 3QNFA 3D6GA 3NTCH 5ALCH 4U6XB 4FG6C 2AQ3A 1P9MC 5SX4I 4FF9A 4M1DH 2P8LA 1QBBA 2DL2A 5DI8A 5EOCH 5GRUH 4NN5C 3DV4B 4Q6IA 4F9PA 4B0MB 2B0SH 4NI6A 4AJWA 2NY7H 4GRMA 1KELL 4WU7A 1PEWA 2XZCL 1FO0H 5HJGA 1JERA 5J12B 2VZVA 1ML0A 5HY9A 1U8OA 2PXYA 3BKMH 5BZWA 4N2MA 4YSPA 3HN3A 4P9HL 12E8L 5DMIH 3EOAB 3NRPA 4I3RL 4MNQB 3SBRA 1YLBB 2R0KL 4P5TA 2AJSH 3JBG7 1AGDA 3L4VA 3CBKB 4XCEB 3FUHA 2R83A 4FI6A 4AQ1A 3MRIA 2F8OA 1ZT7B 3MYZA 5EEUA 3V6ZA 2EYSB 3APDA 4S2SA 5C0JB 3UJJH 5MI0B 4Z3TA 5ITBH 3Q44A 3P4NA 3R8BB 4UM9A 3BQUA 1OM9A 4NGHL 1RUPH 2G3ZA 4UDTB 3W0WB 5BXFB 1NWOA 5I23A 4DVBA 1G7QB 1PY4A 1MF2L 4N0FB 3PWLB 4P2QE 1O6TA 2P24B 2BOBA 3FUDA 4DW2H 4LCVA 1PIFA 1RH8A 2MMXA 4NBXB 1S5HA 2IWKA 1FH5L 3KPRD 2A6IA 4RISH 1E28A 1Y6KR 4ABQA 5IM7B 3U2SA 3W1ZA 1KYDA 4G2AA 4B96A 1H8OA 3D0VA 3SBPA 3VWKB 3OD3A 5E0FA 2VO5A 4MJ4A 1H3GA 3KMDA 3AB0B 3ZE2F 4ODBD 5TQ0H 3IDMA 3JTTA 5AOIA 1KJMA 1F8TL 5H4YA 4GO9A 5L9DL 3BRFA 3FO2A 3OKOA 4UAOC 3FFCE 5EZLA 3ULVF 4XWGH 2ADGB 3MV8D 2P5PA 4P04A 1CZ8H 1NGPL 3GUTB 5DTFB 1N64L 2K6YA 3SOBH 3DRTB 2YSSB 1QLRB 1BLIA 2YOCA 3HNTL 4YFDB 1JXFA 4MB5A 4ZZKA 4JFDB 2OMXB 4ZMVA 1IX2A 2XKNA 1GY2A 3EOYG 1E28B 4ZFGL 1P84K 1WV7T 1RUKH 1FL6A 5MEPB 3VXTB 3LRLA 4A63A 5TF1H 1U91B 2APFA 2NYKA 4IJ3B 5BO1L 2UY6A 4AT6A 1BBDL 2V3EA 3MBXL 2YA1A 2VXUH 4ZW3A 1D5IH 4UOJA 1MJ7L 3ABLB 4YHZH 3IS0X 1BVKB 1TVHA 2X2JA 2CR3A 3FUKA 3MLRL 4PGJA 4GJTB 3BT2H 2ZCHL 2WSDA 1JK8B 5HJBA 5DUPH 2FHCA 1JBJA 2ADGA 4LVNC 2BSED 4ZO7A 5GIRA 1MFCH 2HTKC 1QFWM 4NC2B 4ZDHA 1XB6A 5BZWB 3TV3H 5I18H 4Y4HD 3SDYL 1FO0B 5IIEA 1YNTB 3MX0B 3BN3B 5DMGC 4UILH 3GUFA 2WJ5A 1VGKB 5CJOH 4Z0BH 5FYJL 5I8CB 5KBKA 1AD0B 1NAKL 2HJLA 3BO8A 3WV0A 2ATAA 2EVHA 3NBNA 4DZ8B 4XMUA 3MYJB 3SCMA 4PIBA 4LEXL 4EI6A 2IOIA 3LPFA 4KKAD 4HBCL 4ICXA 5IFHH 3RU8L 4L8SB 2JB6A 3EHBD 2UZXB 3KWWA 3WSQL 5B7MA 3GRWA 5BXFA 3AJ7A 7FABL 1YY8B 4Y9CA 3W39A 5CMAA 4QPEA 4XO9A 1A5FL 4GKZB 1JHKH 3SJVA 1UG9A 3FZUD 4Y5VC 1NIDA 3T6VA 3OLGA 2ATKA 3FT2B 4XNZB 4XWOD 3QCVL 5GPRA 4XXDA 5IBLC 1UOVA 2Z31A 5I6XB 1HHJA 4EIGB 5T1JA 4HWZB 4UT7L 4RZCB 5KVEH 4G6ML 5ID0A 3ATEA 1CF1A 3Q8FA 3H2WA 4LCWA 1AQMA 1HL8A 5FHBL 5KVGL 1HH9A 4MWFA 4XNUH 4FG2A 4E5XG 1WAAE 1QLEH 4QHMA 5E24E 5AYUL 1Z32X 2HTKD 1DBBL 3PNWA 2X4SA 3AMLA 4XAWH 4M43H 1C5BH 4TXVB 4X6DF 1CFSB 5KVMC 1QW8A 4FNUA 3D87B 4FS0A 1CVRA 5I71C 1IGJB 2VMEA 4ISVA 4FQIL 2HG5B 5HJDA 4FFVD 2ISDA 3KWTA 2RTTA 2GIYA 3FCGA 3F00A 4BSVB 4PJGE 3TFKC 4KV5E 3BEWA 1YJDH 4XVSL 2HLEB 1FFPA 4FNTA 2GC7C 4YDLC 2EIMB 4EXKA 5CBAA 3UBHA 4OVUA 3BGAA 2QQQA 1KIQA 4ZS7L 4UQBA 4D7BA 1FVEA 1U91A 4M7ZC 4BK5C 4HSCX 2H3NB 4TYUA 4Y1AD 5AW6B 1RUAH 4QRRB 5C0CB 2G3XA 2J8UE 4RMVA 4HX1A 4OCYL 5F1NB 3L1FA 5EF1A 5DJZB 2XVGA 3RDTD 4B95C 4F5CE 1RZPA 3VXSD 1T7WA 1L9PA 2DH3A 1HJBC 5DD0H 5EO0B 1A6UL 3DX1A 4ZMYA 1MVUA 4RGOH 2ZP9A 2W9DH 4XXCC 4L29A 4FXKB 5FOBB 4TN9A 5BOJA 4PREA 2A4CA 2Y5TA 3ZKXB 1PX8A 5D1QB 1A4BA 4NPYA 3B37A 1G7PB 5ERWA 4KNTA 4GO8A 2B59A 4HJJH 1BFOA 4ZD3L 1TG8A 5JHDD 3GMQB 4JANB 4YBLB 2QDWA 1EMTL 3DI3B 3OVUB 1O5PA 4HKJB 2EXSA 3WOVA 2ALWA 3FQ1A 5SWSE 1FORH 1T80A 2RAMA 1CLOH 3QDJE 4JDZA 3H53A 2AZAA 3GMNA 2CRZA 3LKSA 4ZQKA 3P2DA 4QD2E 5FK9A 3UAJA 1C08A 1CD9B 2EIZB 2RCSH 3HHSA 4UT7H 5KVEL 2KMWA 2ZSVB 2VDRH 2A6KA 1NINA 1BQHA 4R26L 4A6YL 2UXFA 1FQ9C 1IGIL 4LIQE 4L29B 5ESVB 3DRQB 2C4FU 1K85A 3IT8D 1A6AA 4H1LB 1TVHB 2XUWA 2Q8BL 1NEZA 3WN5B 1NDMB 4LSTH 5JHLA 5CJXC 4Z7OE 4ZFQA 5EO9A 4HP5A 3PAZA 3KDMB 2CBQA 4HJ0D 4BZ1H 1N0LB 2NY5C 3GPSA 4KK9D 1MI5A 1SZNA 1NCAL 1XF2B 1IM9D 3ARVA 3P4LA 3T9WA 2DS4A 3C2SA 1FO0A 1YRKA 4J12A 4LPCA 5IIEB 3OF6D 3HI5L 4X6FB 3UOAB 4AW4A 3VWJA 1EWHA 4GMSL 1UM5H 2AQSA 3H54A 5GGVH 4QHKI 5GGSB 4WTXA 4NUJB 2F53D 1BA9A 3LQAL 5H35B 4DGUA 2W80C 4QRPA 5C0EB 3B3IA 4F7TA 2R23A 4ZI8A 1L9SA 3GTTA 4I5BB 1OAUH 3ZUCA 3S3BB 4IGBA 2IH8A 3MTRA 2D2CC 3SO5A 1GSMA 3FFDA 1URIA 4RESB 2VN3A 3LKPB 1WA0X 2JKSA 3OWRA 4F80A 3V5DB 3ULVE 4ODXA 3QZMA 5BUGA 1ZSHA 1D5XB 2FLMA 5IMOA 2NY5H 1MIML 3DURA 2I07A 4MNHB 1S7TB 1CDGA 1UWYA 4RGNC 3U48A 2DDQL 3QUXA 3SE3C 3NJKA 4RX4D 4JJ5B 3MV9B 5LNGA 4OCNC 4J8RA 3THMH 1KTBA 5ABAA 1CGVA 5EZOH 2G2PA 4ODWB 5ANMA 2GW5A 1BAFH 2PLTA 1QSEA 2JKXA 5FO8A 4IS6B 4GKLA 1EUTA 1DVXA 3ISWA 3IXTB 5C0JA 1TJIH 3HVDA 1EZVY 1SHSA 4JCLA 5CGYD 4IGBB 1ZTXE 4QYAA 2J5LC 4GUPB 4R7NA 2HG5A 3SKJH 1IVLA 2D31A 1TFPA 5ENWA 4XXWC 4KKBC 1KULA 5AZ2L 1IGIH 1G1KA 4HQQL 4N1HB 3DWTA 4KVCH 5IB3B 3WTTA 1BVLA 2EXYC 1XX9C 1UCBL 2BHUA 1U21A 2GTQA 2MRYA 2HWZL 3BAKA 4XTRD 3WFZA 1LEIB 4FFTA 4JFHD 2DRUA 4R3SB 4ZMTA 4UQIM 1UJ3B 5L6YL 4G8GD 5KVDL 2J1WA 1PZ5A 3FO9A 3VSQA 3R06B 5C08E 2YZ8A 4HALA 1CYWA 2GITB 1Q90A 3GRBA 4R97C 3V0FA 2QLYA 2QLVB 3V9EA 5EPMB 3MLTA 4OZGE 4H1LA 5ACMA 4NENB 1NDMA 1TPXC 2NY6B 43CAB 4WY7L 1B4RA 4NO2A 5HHMD 2WK2A 4H8PA 2W8CA 3MLWH 2XZAL 4J4PD 4B9YA 2GUOB 5E9DE 1O7SA 1ZTMA 5BQ7B 3QUZD 5DUJA 1AIFA 4U1LB 1U36A 4D0BA 2XSKA 4IBWA 1RZJH 3OKKB 4KVNH 3U9WA 4AYGA 1E7VA 3UG3A 5A2FA 4OLWH 5J6HA 1KWGA 5KOVC 2EZ0C 2W07A 3GBLA 5JHDA 2Z4QB 1AXTH 3QR1A 3H4FA 3LV3B 3QEHB 4N0YL 2DEWX 3II1A 4WO4A 5C8JA 4U2ZA 2E59A 1PZDA 4NQED 3RFZC 3V6FB 1ZHLB 2NQCA 1P7KA 1Q9KA 3AUVA 1NCTA 2H3XC 4G1MA 3MNVA 4TL5A 2EH8L 1Q9LA 1V3MA 3DUUB 3MFFA 4QAMB 2QVTA 3ILEA 1WT5C 1IGYB 1DJHA 4N0CC 2XXGA 4I0PD 5E70A 3CK0L 5B39B 4K3HA 3I3DA 4XB8A 4OV5B 3NRFA 4JPSA 3BAEL 4KKRA 4OZFB 5EOCJ 1F56A 5AW8B 4JRYD 4U1KB 2XWEA 4NC0B 2NSMA 1OOAA 3KM1A 1X3DA 4KAQL 1HILA 1SN0A 3SDXB 1JI1A 2O5ZL 5KW9H 1BQSA 1CBVH 4MDIA 3ZPDA 5BV7L 4P5KA 4A6YA 2HTLC 3B5GA 4N8PA 2Z4QA 4LAQL 4B9ZA 2VERA 3MU3A 3N1GC 3S35H 3VD1A 4M62L 4DCQB 3GJFH 3QPQC 3T3ME 4MA8L 1Q9OA 1IE4A 4N22A 3L4ZA 1ILUA 3CVIL 3NA9L 5FCUL 2IPTL 4KVCL 2WWMC 1IAOA 2NUTB 2WLNA 1FGNL 4XX5A 3SCMB 3DXAA 3DX6A 1F90L 4IRSB 4PHXA 1WZLA 4PGEA 5FAAA 4YQXL 4MA3A 2RALA 2HLFC 3G5WA 1U95A 4P4RB 3UX9B 4WVRA 3NEXA 3BRGC 3BVDB 2QQLH 2B3IA 4EDWH 1LMIA 2OMVA 2X2UA 1IB5A 2C4XA 2FECI 5T3XL 4OM1H 4P3WA 4ZUWB 1E50A 3MNWA 4GBXB 5JHMA 3B1UA 4B50A 2BP8A 3ARYA 5EUKA 2WVSA 4K3EL 2APSA 3QYCA 2HT2C 1MVFA 4PWGA 4HG4K 3WIFB 4DPRA 5HHPA 3WKQA 1OGTB 1NOFA 1DQJA 1A6PA 3GXNA 2V5SA 5D96B 3QG6A 2PPEA 2WIIA 5E03A 1ZPUA 4OI7A 5IK3A 1WWAX 4EZKA 2XTJB 4KZDH 2B1OA 1PZUB 5A7EA 3FOMB 1WIOA 1ZHNB 4PP2B 5IQ7L 2F5AH 1F0LA 3HB3C 4ZMXA 2ZYIA 2CKNA 5HPMB 5ANMB 3UTTD 2F5BH 3VXME 2GY7B 3CNKA 2ZKXA 4A04A 3CHPA 2HA1A 2EIJB 1J1XH 2VISB 3CTTA 3DMMA 4LARH 4WEBL 2A1WH 1AO7D 4DN3L 2Z8WC 1F1AA 3T1WA 1DEEA 2FJGB 3UTQA 3V0WH 5FIEA 2WYIA 1RIVH 3FCTA 1G7IA 3QRGH 4UWQB 1BZ9A 4ZFZB 3K1DA 2W9EL 2EKJA 5KUKA 3II3A 2PWDA 3OTTA 4NKOB 3DJSA 4UTAH 1BGXL 5ICYB 2EUZA 15C8H 1P5UA 3WHE1 2AFNA 5I0WA 4AMKH 1IM3B 4IBLT 4LCYB 3GB7A 4JQIA 1A02N 1EXUB 4HIIB 3U6XA 1DQVA 3CVBA 1L7IL 1ZK9A 1JGUL 5I1GH 1N5YL 3A23A 2B3RA 4BE5A 5F7EL 3GSVB 4LPVA 5DHVH 3W11D 4KROC 5DRXA 1UZGA 1MCIA 3NJIA 2QPSA 3NDZE 4U1MA 4YZFE 5EZPA 5C3LD 5SV3A 3ESNA 3FSWA 4FTVD 3DETD 4ZUTB 4YDKH 4XPTL 2OJEA 3WFCL 3HC3H 2K6ZA 2BNQD 4TLTA 1ZTXH 5E5RB 3RWJA 4G42A 1BZ9B 1SEBB 1TFHA 4U7MA 4EDWL 4LFHG 1Z1WA 1IGFL 3GI8H 1NAMB 2N1TE 1PJ9A 2DBLL 4U33A 2PW1A 4WFEE 3OZ9L 1U6AL 4YAQA 3UMNA 4HS3A 1LK2A 3GSRB 1D5BA 4JFOA 4G80B 4V2CB 4YDMA 3WIIH 5E9AA 5AVXB 5LCVA 4L8CB 5AG9A 2D7NA 3UCQA 4EKJA 1F1GA 5D1QC 4Z7UF 2QV2A 2EDLA 3TBSA 1IGYA 3VUAA 5B39A 4Q56A 3SCMD 1I8MB 4PJFB 2UXGA 1GKEA 3GXFA 1T89C 3KPRA 4BCZA 2ODIA 1QFHA 1Q0EA 2CKBB 4Y9GA 5KANG 5LVEA 5EG6C 4K8RD 4KGLA 4XVUC 4LESA 5BPPA 4X4ME 4YN3A 1CG9A 2ZUQB 5EU4A 5FYLD 3R4DA 2OJ1A 1MW1A 1LQSR 1T1ZB 1G6VK 2CRYA 1HQ4B 2EYTA 2CJUL 5DZJA 5F7YC 2RFXB 3FO1B 4BFFA 2IH9A 1IGTA 3SKNA 2W9EH 3W9EA 4G80A 2CMRL 3S8FB 4NCDA 4AXWA 1XTLA 3LQZA 1AKPA 5EMYA 3FT3B 5DQDH 4QRFA 3DX6B 4IRSA 1J9CT 4P9HH 2D7MA 1T5XA 3AABA 3QIBD 1NUDA 3F7PC 5DZVA 2X2IA 2IFFH 1KGUA 2YD4A 4AYMC 3MLUH 4Q97A 3JV6A 1H8SA 2DWEA 2XHNA 1DTUA 3GXTA 3S37L 4ZX3A 4EVNB 3MLSL 4EOWH 3GBNH 4U3XA 3BAIA 3Q2WA 4JUTA 1OF0A 2BO0A 2EDFA 2IPKA 4XHJC 4DKEH 1HHKA 1E6OH 3EJRA 1X5IA 5DJ6B 5F7UA 1DVYA 4AJ0A 5AOKA 1XWVA 2HXAA 1RULH 3FQNA 3GSNA 3P4MB 3CVHL 4AYBA 4PJAA 5DS2A 1RHHA 1DUZB 4X9FA 1UUNA 4RGMC 3CFJB 2C9QA 3IMUA 3MRGA 2P48B 1A6WH 3WLWD 4EBQH 1TETH 4MKMA 1KXVA 4QEGA 4FQLH 3OAWA 5GS2H 1KBGH 2F1EA 2FX8H 4LF3B 3FU9A 1BYOA 5E00B 4IKJA 4XPGL 4KJWC 4AW7A 5IQNA 1RURH 1DQML 3QUXD 3GSXB 1DVQA 5IOPB 4KOCA 6FABL 2Q8BH 2APBA 3BHBA 3K74B 2KKQA 3IMSA 3KPSD 4E36A 3GK8L 3LKOA 3UTQB 2HJKB 2VDOB 3P4OB 4NQEA 2ESVE 4R8WL 3HE6B 1JZIA 1TTGA 1NBZA 2R56L 1MLCB 5CLZA 2A7BA 5FFGA 3WTUA 4J5VA 1HWWA 2X38A 2W5PA 1X5ZA 2QSQA 1PY9A 4IRZA 2GUYA 3PL6C 4IGBD 5HXMA 3VXUB 2VXTH 4OLYH 3UTOA 3O81A 1N7MH 2PTTB 4QHPA 1RJZB 1E65A 3QI9C 4M3KB 5FYLE 3MUJA 3A22A 5EUOB 3PY9A 5BVJA 2UXVA 5EOTB 2Y36H 4KJWD 1AR1B 5EU4B 5JR1L 5E56A 5LBGA 1T2QH 4UQDA 5FA4A 4AQZA 2NYZA 1K5NB 4F3FA 3QXTA 3K4DA 3PDDA 1NPNA 2APXA 1ITCA 2PXYD 3I75B 5JXEC 1J86A 5AZUA 3EOTL 3P3TA 2CDFA 4HIHA 4V1DB 4NUMA 3TURA 4X9HA 3H2QA 1ZLDA 3F6IA 4XMWA 2Y1YA 3MMEA 3HE6A 5KYYB 1PAMA 3U0WH 5B1JA 3DTXA 3AGVA 1OP5K 4TMPA 5FUZH 3LJ3A 2DDQH 1A9BB 1ZE3H 1CGUA 4YK4C 3R8QA 2FX9L 3RDJA 3BYTA 4X7EC 2CO7B 1U8LB 5FDWB 2QKIB 1GHFL 5LAPA 1UXWA 4HJTA 1MCJA 2FATH 3MACL 1OM3L 3TYGL 5CD3A 1Q8MA 3FUNA 2Z34A 5BW7A 3SE8L 1Q72H 3L3IA 4YJZL 4HIJB 2GCYA 3BDBA 1X9QA 1QSED 2APVA 5D7IE 1AOHA 5A7BA 5C0DB 2X42A 1XHHA 1L0YA 3G04B 3QIUC 5EBGA 1K8IB 1H9VA 1BFVL 1YQ2A 3QIUB 3O2DH 2XDHA 3P11H 4XPGH 2EKSB 5LGYA 4YSUA 4ZPVB 1RP9A 1XMWA 5CEYB 3FFCD 3O3UN 2R7EA 5IVXF 1QSEE 1RL1A 2W0LA 4KXDA 4GRWB 4FDWA 1R4XA 1RZKC 3L3OC 5C08B 1YEKH 2MQGA 3DUSB 3QDGA 4GOSA 4W68A 5HVHB 4NQXB 2PYEB 4I0CC 1SEQL 4M1CC 1MFEH 1U41A 3NK4A 4S0SD 5HVHC 4KJPD 4EKXA 1CXKA 1I1AB 4MAYA 4XNUL 3IMRA 4X4XB 5DFAA 4Y89A 4K2UH 2PO6C 5KUMA 5C3IA 1CU4L 4FZEL 3QEHA 4WO4B 3BUDA 5D7JA 3U9UA 4N26A 3ZE2B 4HAFA 3QDMB 3HG1B 5IY5B 3MV8E 3D39A 5DWPA 4MYWB 4MMYA 3TM6A 5C07B 3M45A 3OF6A 7PCYA 2KL6A 4ZAKD 5A2LH 4F8OA 1W0WB 2JI1A 2Q7YA 1TQCB 4PFEA 2FWOA 3OAYK 2A83B 2OX5A 2XWCA 3LS5L 3PL6A 4L05A 5IK3B 1KN2L 1RLWA 4PHZA 2BHZA 3O6FC 2I60L 4HAKA 1RZIB 3K1KC 2FEDD 3OGOE 4ZOAA 5J11C 4EN3B 1A7RH 4G6FD 5L8KB 5I1EH 4Q8BA 4W9IC 1VB9A 3QDHA 1JNNH 1EXGA 2AJ3B 2JIXD 3RIAF 1KCVL 1X7TA 1K5NA 5AKRA 1MI5E 5B21A 3MOAL 3V10A 3WTVA 1HAUA 2RH0A 1OSPH 4RWHA 2N7AA 4FQXB 4HW6A 3MRRB 4PJ7F 4B97A 5DJ0B 5E51A 3MBEA 3GJEA 4LLDA 3RDTB 5KYXB 4PIRF 3C60C 4K94L 4BFEA 1DQDH 4O51B 1R3HA 5AVWB 4ZFZA 3MACH 5F21B 3WCYA 1LHZA 4UT6H 3WD5L 4C56D 3BH8B 1NMBH 3C5JA 4HUKB 3HA0A 4NQCA 2WOBA 3NPSB 3T0EB 1DCEA 4F58H 2NUPB 4G43B 2KZWA 2YBRB 3RG1C 1A7OH 3MKGA 3UG5A 5C09A 1K8DB 5INCA 4XC3H 2DI8A 1KV3A 5JQIB 3B5TA 2XICA 4N5ED 2X7LA 1JWMA 4DK5A 3T4AC 1GYVA 1I9EA 2BMKA 4JPVL 3T4AB 2QMJA 3SPIA 4CC4A 1M1XB 1EHLL 3UPRB 3W11C 4XNYH 4XOEA 1JYWA 5EN3A 1FYTE 4TNGA 1PG7H 1N59B 4KXZI 4YHMH 3RWJB 4NXSA 5F7HA 4OM1L 1OSZB 4MMZC 3OG6B 1BP3B 2K9UA 3PJSA 4K3EH 4E0RB 1CO1A 3B9DA 4TLSA 1WISA 4R90H 1B0WA 5GS1A 3W9DB 4ALAC 3NACH 1U3ZA 1U8QB 2FEDC 2DLIA 3O3DA 4OGYL 4MZIA 3JWOC 2ROYA 2XWJB 4ALAH 3CBRA 1E4WH 1CF8H 3EFFA 3MRNA 2V2TB 4BHUA 3FO0L 2EEXA 1RI8A 1T1YB 4LSUL 2IDFA 3PDOB 5JNYB 1GGIL 3LDBC 4OQ1A 1AS6A 3LS5H 4Y19A 1K2DA 1T4KA 4JG0H 3N55A 4K23L 5C07A 1NMCB 3Q6GL 1FZKA 1UB6B 4YSTA 1IL1B 2TRHA 3WMSA 5AOLA 2VLKD 2A1WL 3TONA 1NGXB 2HB0A 2MCMA 1L6XA 4QOKA 5E2VL 4LFHD 4ATWA 1MQKH 4I9XA 4PTUA 3KVDD 4KO6A 2VRQA 2VLRA 2KLSA 4H8QA 5FM5M 4HULB 4FLSA 2DQFB 2OCCB 5CGTA 3B2DC 1HI6A 3CSYB 4P46D 2VSCA 4AGOA 5J6GB 1EAPB 3FK3A 1JZ2A 3D34A 5KTEH 5JXAH 3PGDB 2WNXA 4JFWA 1AHWC 1RZFL 4HXAL 5DO8A 5E5LA 4L4VB 1AGDB 4XCEA 5CAYB 4L3ED 3HE6C 5INDB 2B1AH 2OZ4H 4Q7DA 4H88L 3GLDA 1MWAB 4ZYKB 3ZDXE 4OJCA 4OZHE 1UWEH 1KEMH 3CCHA 4KKCD 5EU3B 4WKZB 3HI1B 1Z6JT 3DIFA 3N5AA 4XN1A 5LG1A 1AI1H 5F7NC 5C09E 3B8SA 4Y4HC 3NT0A 2ZXEB 2OR7A 4LO9A 3I9IA 4YNYA 1XH3A 2CD0A 4H0LC 3L9EA 3CSYA 3WS6A 3EHBC 5GS2D 4KZEH 4P57A 3I9AA 3LRSA 4YVNA 1P5UC 2OJZL 3GSNH 1BEXA 4P2OA 3QR0A 4WI0B 1YDPB 5AW5B 1OP5H 4O2CB 1XCTA 3DK0A 4F7PA 2NMSA 2XIIA 4PRPE 1GAFL 2VLJB 1MEXL 1MWAL 1HOCB 2IMNA 3ERXA 5ICXA 2NY6C 3D0LB 2WHVA 1IMHC 2C9UA 3PG2A 4UZUA 5IHUH 2RFXA 4P4KD 4TVPL 4L4TB 5FLVA 1F1DA 4IU3A 4Y88A 2XZAH 2X53A 2X05A 3HFFA 3DRTA 3SDXF 3UBXA 4OCSL 5AAMC 1NCHA 4CNIB 3VACA 1ZD6A 3S4SA 4MAZA 5IV2A 1JRHI 3EJJX 4B7IA 3FTUA 4JFYA 1U93A 4ELKA 4L3CB 1HSAA 1J18A 2O6PA 4AEIL 1DJWA 3K4ZA 4K3GA 5DYOB 1ZVSB 3UCRA 4JQVC 5JW4R 1M2VB 2BSRB 2VAAA 4J28A 3KH4A 1T3FA 4EVNA 3U7AA 4KU1A 3OLIA 5ICZB 2X4PA 3Q8AA 4AH2B 2CMRH 3GD1C 4URKA 3NYKA 3QUYD 5FW8A 2I5YH 4MAUL 1NBYB 3GMRB 4JZNA 4OY9A 4R0LB 4K7PL 1NGXA 4PMFA 2IXQA 3QI9D 1MPAL 1PQZA 2UX7A 4WWKA 4XPHH 5FW7A 3V4VL 3D30A 1H3UA 2P9RA 4CVZA 1XF4A 5GRZA 3EDFA 3ZKXC 5JW3L 3V9FA 3O3AB 4XN7A 3TA3D 1F4XL 1MFMA 2H41A 4K15A 3HFML 3TO2B 5I6MA 4UU9B 5AVVB 4N5UA 1HXYB 2BSTA 2SODB 2N01B 1N26A 1IILE 1YNKH 2F8IA 2PXYC 2NZ9C 3LHAA 4G7YH 4MGXA 4PG9A 3V6OE 3QNXB 1KPUB 3MXWL 2EXYD 3M1OA 3MLXH 3MFGB 3ZR5A 4HUNB 1IQWH 3PREA 3ZRCC 5HY9B 1SUHA 1KXQE 6PAZA 3QDJD 1SHXA 3SSGA 3QQ9D 1MFBH 5TDNA 1ZGLP 2Y7OA 3PF2A 4JY5L 4F8NA 3PJLA 4OLUH 4LVHB 4A39A 1ZJAA 4DFIA 3EO0B 2FD6L 2FQDA 3NGBB 3NJVA 2Y5TB 5D2NB 1P53A 2YEQA 4XCCH 3UTZA 1T6BX 1PSKL 4PY8I 4CC0A 5E8EB 4BQ8A 1OAKH 3AXIA 1LO0L 2DWDB 4EDXB 5I1CH 1HQRA 1LO3L 3RVVC 4KI5F 2B4CL 1UOKA 3X11B 3TO2A 5CEYA 2HKHH 3RGHA 5ID0B 1R17A 4GQ9H 1ERNA 3D4YA 4G9DA 4KK6D 5F7AA 2H2PD 3UP1A 3ZL4L 4NRZA 3SGDI 1PDKA 4YDVB 2D3JA 5E6IC 1CGTA 1S5HB 4B53A 3L48A 3RIFF 2BP0B 3KGUA 2R1WA 3HEIB 4XBPA 1VADB 1AZUA 4A55A 4EIBA 4S1DD 3VSVA 3T2NL 4NZUL 3FQ4A 2DQJH 5LB1A 4FQJL 1DVSA 4XVUD 3NCJL 3MBWA 4NFCA 5CR8A 3S4SB 1RU9H 4NIKB 2HJFA 4KO7A 1T2QL 4QHNB 4ZMQA 5F9OL 5IW1B 3LNFA 4BWWA 3V79C 1WAAF 1N6QL 5GRVK 2WWNA 3IJHA 3JWOH 5ANHA 4UT6A 1MXDA 2HX9A 1MPAH 3OG4B 2QGCA 5K59E 32C2B 4MQ7A 3D0AA 4R7XA 3H3PL 2P5EE 1KN4H 4Y19E 5C6TL 5CKGA 2XBDA 2BWDA 4G59C 4Y1AE 4JE0A 1B4JL 4LLUB 2V37A 3SQBB 2FSEA 5GGSA 4F8LA 2NY1C 4MX7B 1RJYA 3ATDA 4PJGA 4L0PB 3DX9B 2IQAA 2VKWA 1FL3B 1ND0B 4IOFD 3GJFK 1G7HA 1OANA 3MLXL 5T1MB 2FNWA 2HVKB 4NGHH 1UM4H 2HFGH 3LIZA 1G6RL 3ZHDA 2XZQL 1JGUH 2R4SH 4I18B 5I1GL 4RZCA 1M6UA 1UZ8A 4ZFGH 1N2RB 4O9HH 1RUKL 1HOCA 3QORB 2PPCA 1Q72L 3S7GA 3BQUC 1EDYA 1B0GB 1WTGT 1MQ8A 3C6LC 2ZXGA 1TTBA 1WAAA 4BK4A 3LH2L 1KIUA 1GZQB 4JDVA 3FBQA 7CGTA 5GGUB 3VNZA 3KGSA 3IJEB 4NYLB 4A7GF 1S7TA 1TZHA 4JDZB 1MJJB 4RAUB 4Z95H 1HIML 4OCMC 4PRHD 2R9HD 1E9OB 3L5WB 4G8IA 1DUYA 4S1QL 2LGNA 4WLCA 2FSEB 3QUXC 4OZIA 4GQQA 1M2OA 5D2NA 4OF7A 1WHPA 3QUKA 5C0NC 4WUUA 1I8AA 1BPLB 1U6AH 4ZOEA 1ZVSA 1FYHB 3ZGIA 2E3VA 2ZCLH 5EEVA 3N2JA 3OAUL 4J23A 1Y0LA 4MZ3A 4M4RA 5C2BL 35C8L 1BF2A 2RIKA 2WGNB 1LDSA 4J6RL 4V11A 4QRSB 3OGCB 4UQ9A 1BF5A 1T5KA 1FH5H 1W8EA 5D70L 3CX5K 3F58H 1KTLA 3HUJA 4O2EA 4WNSA 2A74A 3MBED 1LYQA 4TNVK 1IC7H 3QJXA 1E3XA 1F11A 4WDIB 5I5JA 1FL6B 4TV3A 2AMGA 2ZUTA 2R1WB 4NN6B 2WUBH 3FHEA 4MNGA 5IMKA 5AVTB 1PKOA 2OR9H 2XPGB 4PGBA 3VXQA 1F13A 1D5IL 3AVEA 2ED9A 5DS8B 5TQ0L 5JMOC 3HZYB 3BYYA 4IK6A 3MLTB 5CLXA 2XA8H 1FNSH 1FV1A 1MAMH 1YMMA 2NYYC 1UD5A 2YXMA 1UB6A 5H94A 5GGRY 5EU6B 3L7EA 4ZAKA 2P8MB 1DSFL 1CD1B 5IW6B 3SDYH 3KD4A 3CN4A 3FU0A 3U79A 2HRGA 3EF7A 3O0RL 5I0ZA 4X5QA 3X1NA 5L0QC 1VEPA 5D1XC 1SY6A 3X17A 4A38A 3NIGF 3DO4A 4AIEA 1NANH 4EUPA 5TGBB 8CGTA 2WBJA 2AAAA 3T4AA 5E94A 1LE9B 5KSVA 3C6SB 1DDTA 2WQXA 1FG2B 4YHIA 1NMCC 2F08A 3KJ4B 1JJUA 1BECA 5KEZA 3SJVB 2P7TA 2HTLD 3Q0HA 1FLRL 3O3EB 1N0LA 2CXKA 1JHLH 4XMTA 3TO4A 1RZGA 1TETL 3CC1A 5IQOA 4XNXL 5LWYL 2EICA 3SDXA 1NC2D 3AQZA 1A7QL 4HWZA 5E99H 1SLWA 5KVFE 1NANI 3IDJB 5TE4L 3KYAA 1NBVL 2EUVA 2VIRA 2OTPA 4Y16C 5K39B 1WJ3A 2WLYA 1P4BL 1ZRUA 3AS2A 1OHZA 3FU5A 3U0PB 4ABWA 4M43L 3BDYH 3G6DH 5C0IB 4P3CL 3BT0A 4WHCA 2X44D 4LLUA 1CFQA 4OIFA 3VFTA 4QRSA 4X6DE 5FLUA 5B3SB 4N2HA 1EXUA 2DWXA 2ARJB 3JWNE 3MRCB 5F3FA 3HB3B 3JXAA 3WJLC 4LLMB 3O9WA 3ARBD 1PKQA 2VXTL 4ERSH 1KACB 3SYOA 4PI2A 1RUML 1XH2A 3QXDA 1NICA 4TUKH 5D1QE 3W38A 3MXVH 4P2RA 3CFQA 4Q2ZA 2X6CA 5BJTA 5AYUH 3RL2A 4WFGE 4IU2A 3MV7D 4R7DB 2PWGA 3F7KA 5GSVA 3LZOA 2Z6FA 4GP8B 1QTSA 4CBZA 2BRQA 2BNUB 4PJ9A 4CN6A 3N50A 1ACCA 1VFBA 4GKNA 5E2WL 5MENE 1SEBA 4JFPB 1JK9B 4JRXB 1QR4A 3QUYB 5AOJA 5J57B 5IEHA 2CCLA 4UI2A 2VDOL 1TJGL 4WUUE 4PVLA 3VXRB 5E5UB 5ICZA 3S5LG 1VCBC 1YCSA 1U92A 3ASOB 3VXOA 3W39B 1HC1A 1CI3M 2G4GA 5FUZL 4ABUA 2CQVA 1BFSA 4M6NL 1TVBB 3S35X 2B1AL 2OZ4L 4QRPB 4XAKD 4ZXBA 4LLMA 2BLFA 1EDHA 1PEZA 2B16A 4PGCB 4M7LH 3UABA 1I1YB 4KNSA 4I2XE 2EH7L 1FNGA 3ZN6A 5CGBA 3UYRH 5KZCD 3BESR 3ARGB 4Z8FH 1XT5A 1JZ8A 3J7HA 2XQYK 1MJ8L 5FKAA 4FERA 3WENA 3U4AA 5ESAB 4NKOA 5ICYA 2F2HA 5F93C 4EI5C 3PP3H 1V54B 3G6JF 1OP3H 3H9HA 3HBGA 4EMZA 4DSYA 1D9KA 3ULVH 4PJBF 2Q9OA 2Q3XA 2XFXB 5TDNB 1A7NL 5GS3A 3OB0K 1XCQA 2XTSA 3MV9A 1A1MB 3RTLA 4KO5A 5DJYA 5D7LB 3FL7A 4DKFL 5IB5A 1V3JA 5FYKL 1U95B 1XTMA 4P4RA 3HIZA 1KZYA 4ZT1A 1TYEB 3LB6D 3ZHNA 4IS6A 5IWLC 3GRGA 4HCFA 1XGQB 1KGJA 1GAFH 4I2XA 3X2QB 3QO1A 4IHBA 2ZTBA 2Y25A 1QLEB 2R69L 4YHKL 1HQRB 3UAAA 1RFDH 3SDCC 5AD0A 1OGAA 1PU0A 5DZOA 4F7EB 1SYVA 1VZGA 1EHNA 2P5WE 1Z0NA 1PFOA 2ITCB 5IG7B 5HHPB 1BVLB 2G9KA 1JZGA 3QG6B 1YO4A 1RUMH 1T7XA 3GEFA 5HDOA 4MZRA 4TUKL 4MDRA 3B1TA 5T3ZL 2X4TA 4YFLF 2XYBA 2A2QT 4FNLH 5LQBL 5TGBA 4L3EB 5D2LF 2V5MA 3ES6B 2WQ8A 3VW3L 3HRZB 3AXLB 5FM4A 1JPTL 4FXKA 2PYED 5FOBA 4QXUH 1KPVA 3TBWB 2ZUUA 1F42A 3VGHA 5FO9A 1A6VH 2WCGA 2C3XA 1S78C 2BSTB 4ZSOE 3EGDB 5HYJA 4Z76A 1VFMA 2BS9A 5E6RB 4DGIH 3VH8B 1NEUA 2EACA 3I50L 1SXAA 4WZ9A 3S5LA 1S2EA 3VWJC 3O8XB 2QGBA 4DJMA 3DBSA 3GLEA 1CTMA 4XZUB 1PZAA 1XGRA 1WIUA 5D71H 3RWEA 2NR6C 2P43B 3PHOA 1J8SA 4HKZA 1WBYB 4PJXB 4E9WA 5BRZD 4ODWA 4P59H 4GSRA 3GHBL 2OTWA 1L7TH 2J3SA 4K7PY 2MNJB 3CLFH 1NMBL 3T0XA 4F7CB 5F3BA 3BVXA 2JKRM 2OAAA 4YHOH 3CZGA 4R96B 1Z3GL 5DRXB 2NX5E 1H0DB 3CWGA 3EJTA 5FB8B 3L17A 4JKPL 1KXQA 3BMVA 5JZ7D 1AFVL 3ULVL 4P2QD 5AZ2H 1NWPA 2ZWYA 4HQQH 4L4JA 1E5UI 1MRDH 5EOQL 4Z76B 5D7HA 4QYOA 2A4ZA 3LEYH 3LIZH 2WZPD 3IXAA 1PD1A 2FQGA 2G30A 2F7OA 3BLKA 1M9SA 1M53A 3OR6A 3M88A 4JB9L 3EGXA 3CK0H 4YHYC 3UGEA 5EZOL 3OKNB 5C9JB 4NB7A 4NNYB 3LD8C 4HJ0C 4V2BA 2H9GA 3FJTA 4JS7A 3ROLB 4H20L 4HJEA 2KLRA 3ULUC 1E5YA 1A3LL 4CMMB 3L5WA 4Y5XC 4JM2F 5A2AA 4MJ6A 4PJHA 4EQ3A 2WVUA 2Y1VA 1P6AB 1JK9A 3FCUB 4Y7MA 2VWEE 3MUHL 2VDKH 3IMTA 1XF3A 4W9CC 4BH7B 4LHUG 4UIMB 3L3GA 5D1ZD 1WWBX 2F74B 1QD0A 2EDHA 4PLOB 2Q3ZA 3BQUB 2OMYA 3BH9A 1QASA 1SHMA 3QPXL 4IBZA 4KVNL 5AD0B 4FA6A 4R84A 3CDFA 3RX9A 1DL7L 3IGAA 1VSCA 2JK5B 1F4YH 3V7MA 1QKZH 4JM2B 2I7OA 1A1NB 3BHBB 1FGNH 3Q6FB 3WJLA 2VR7A 3IN2A 1OE2A 5FA3A 2VDNL 3WLBA 4JFQA 3WKMH 3T1FA 3V4PH 3TCLA 5FKAB 3PWNB 3FO1A 1BZ7B 5FYLH 2JH2A 3IBEA 1RIHH 2IAMA 5AAWA 2VDML 4JMXA 1M3JA 3NP3A 1INQA 1KENL 4J3OD 2AW2A 3ZKSD 1CN4A 2NCEA 2J8OA 4FULA 3N6YA 5ES4B 4HC1H 4J7RA 1PY0A 3R4RA 4YK4B 3TZVC 2XXFA 3JUYA 1G7LA 5BVJB 1NEPA 5KTEL 1C7SA 1EFXA 4LLVB 4XWOC 3CC5B 3IJEA 4PJCB 4YSSA 1QR1B 2JI2A 1Z9PA 5IW6A 1RLBA 4XO8A 2NXZB 4WK4B 3RJDA 4MA7L 1MREL 4U2YA 3HNVH 4I4WA 3QDMD 1QI3A 4PJ8D 4Y5VB 1R6VA 5IUSA 1E4XH 1IC0A 2G5RA 1D5BB 1JPSH 3EJQA 4JFOB 4CSZA 4Z6AT 1JGDA 4TF4A 2Y7MA 3K0WA 3CSTA 3VG0H 4HKXB 1X9RA 1DLFL 4ZTPH 3C5SB 3TFKD 2GITA 4FFZH 1GJIA 2J4WH 3K0YA 1RPUA 3L3OB 2C7UA 4DP0X 4F8PA 1LO4L 3GJFB 3WBDA 4OZFG 1ET5A 2QJDA 5T3XE 4MMXA 3CXHK 4M56A 2I69A 3QZWB 5E00A 3IXAB 1ZXQA 2GABA 2ZOWA 4PRAB 2ZCLL 4X7SH 1SOSA 4NXKA 1WGVA 4K7FA 2VDKL 3BEVA 2WO2B 1E27A 3BZEA 3QIUD 2HZHA 1XB8A 4PGZA 2ADIB 3CVIH 2FJFA 3KEDA 5D70H 1CXHA 5DRNA 5KYXA 4YZWA 1U58B 1AP2B 3NCCB 5MEOA 1WFIA 5D4JA 1RK0B 3QEQB 4DQAA 3B7YA 2OMTB 5GZOD 1QBLL 3IFPB 3IWUA 1GOHA 3M8OH 5JPMB 4PJ8C 3W5NA 3QIWD 2D7PA 4DPAX 1WA1X 3QBTB 1X7QA 2J6EH 1LK2B 4MJHA 1YY8A 4XN8A 3ILDA 1SOQA 1JZJA 5LJYH 2J43A 4HS6A 5J1AA 2GSGA 1U8CB 3EGSB 3ZTJH 2VDMH 1BMWA 1MKFA 4ZUSA 1MHPH 3EH5B 2J44A 2X7LB 1KENH 3F7VB 1UENA 3HR5B 1K72A 4V1DD 1TR7A 3HOGA 2X1PA 1CZ8L 4IU2B 3IDYB 5AZEH 3FMGL 4YUEH 4Q58C 1BW8A 5LN4A 2XVBA 4G6KH 3VI4F 1FG2A 4YHIB 1AR1D 2X4RA 3QNYB 1YEEH 3WUZA 1H6EA 3HNVL 5D7SH 1WFMA 4JL1A 2OSLA 3BRDA 3HAEH 1WWCA 4UOW1 3HE7C 3HR6A 5BO1H 2G0LA 1W9XA 2LE9A 1RIUL 2R1XA 2CO6A 3J27A 2OMUB 4LQ1A 4PS8A 5DD1H 4GXVH 4WV1B 4HLEA 1L0PA 3D69B 3LKQB 4RWYH 1FC1A 1QRNA 3C6LA 4JZOB 2WZ0A 4GBXA 4FFZL 1YNLH 5HYQB 2FH8A 3D05A 4ELMB 3U0PA 2ZCHH 3HRZC 1B0RA 1NLDH 1KBPA 5D5MB 4XNXH 1ZHKA 5LWYH 2H2SD 4OGXL 5IEKB 3I74A 2AJYH 1NAMA 1YPZB 4HKXA 3V52H 1FAKT 1VEMA 2PW1B 4X4ZA 1G9MH 1MUJB 1OW0C 2E8YA 2NY1D 1XSKA 5F7EH 3ZZLA 3B34A 1CDHA 3AAZB 1LO3H 4JREC 2B4CH 3HLAA 3F12B 1K8DA 3JSSA 4G3YL 4FYRA 4U1KA 3WKPA 4FA8A 1MOEA 2ID5A 4QHLA 5JW4N 1KFAL 4EOWL 2C3HA 4GP5B 1C16A 5E9DD 1ZLWK 4D8PA 2ARJQ 1DJYA 2OMUA 5FA4B 2EE0A 4EJ1C 4GAFB 3FQTB 4EZJA 2VCOA 4CDHA 4I77H 3OV6A 5DHYA 7FABH 3HN5A 1ODUA 4KTYA 1DFBH 2VLLB 3S98A 3CVHH 1XZ0B 2ENYA 2VC2B 3FT4A 5DLLA 2MNUA 5IQ9B 1ZS8B 4EBQL 1PFCA 2EDNA 1X5KA 4NZDA 4PRNB 4QGYA 2X41A 2Y72A 4OCXH 2CJUH 5FUOH 5LDUA 3VFOB 1G7JB 2VJ8A 1FNLA 2I24N 2NOYA 4HJGB 4ONFH 2Y1ZA 3MC0A 3AMKA 1U8IB 2J25A 1IBDA 4OZGF 4W1TA 1S3RA 5G4NA 4Y2NA 1SHWA 1BMGA 3GS4A 4N6QA 1RZIA 4GSQA 2AV7B 2P28B 1FZJA 1I1CA 1J0IA 1J05A 1P4LB 3IS1X 4G7RB 4JRYE 4KK6C 5I1KL 1WP6A 4TSCL 3TEXA 1DP0A 3CQQA 3NZHH 5C2UB 4TSAL 3O41A 3BWAA 2WQUA 1I7TB 3QFGA 4S1DC 1FDLH 4NO5A 5F9JA 4H4NA 3VFNB 3AREC 2XWBA 4GXVL 5C0FA 3L2MA 4Q0XH 4URTB 3D18A 4CAGA 4TUJA 4KRPB 4YX2L 5I75C 4O9HL 1PYWB 5EU7E 2NNXA 3QUMB 4JFHE 4KI5C 4PM1A 3QJUB 5C0AD 2Y36L 2O6FA 1SFDA 2FUQA 2J8UB 4P99A 1H5BC 4IKKA 3CV5A 4JRYB 3BD5A 2DQCL 2DW5A 1Y1UA 2MHAB 4WNQA 4M48H 1B4LA 2YLKA 4HWEL 4QHKJ 3UJTL 4L4VA 1PZ2A 2VUOA 2HX8A 2ITDB 4JFYB 5FUCE 5HDWA 1QSZA 1IBFA 3CN3A 4GAJL 1WCBB 4MLIA 5IJDC 1TQBC 4P5MA 1G7IB 5DC9B 3EBAA 3GSQA 1GC1H 3U0TA 4DKFH 1BWMA 3DSFH 4JK0D 1W6LA 4LIQL 2WNKA 4FI7A 3JWDC 4WWKC 1G4MA 3W57A 4DFHA 1WT5A 2UV3A 2IBZX 1RULL 2PPAA 4JNXA 2GCYB 4KQ4L 5ITBL 5EDXA 1G9MC 3CFCH 3PV7A 2D7OA 4IJ3C 3EXJA 2BY2A 1B2WH 2BFVH 4AYDC 4HK3J 3HLAB 1RFDL 4J6RH 4JQIL 4MCYB 4B9FA 5ACZA 1VIWA 1MLCA 2YN3A 2YUWA 4GEIA 4WJ5A 4BHUI 1HKLH 1GIGL 3MA9L 3MGOA 5IHZA 4MJ6B 5I8EA 1A8JH 3HZKB 1XAUA 3UG4A 2X1WL 3ALPA 3GMOA 5HHME 4RISL 1ZS2A 4AXWB 1S7SB 1BXAA 1Q0YH 4KJYA 4M6MH 3KDPB 1TIUA 5KAQG 3VMOA 4RDQF 2DIEA 4I48B 3NUKA 3SOTA 1NGYB 1F02I 3BGFB 1XIWA 1ESOA 4FQ1H 1I1AA 1BOGB 3AXHA 4G8GB 1U8HB 1T6VN 2HKAA 4XE5B 1UD4A 3D69A 1CGSH 5IB3A 1L9NA 4XMKL 2JWYA 3ETTA 3OXSB 5I73C 3BPOC 2J20A 3QZWG 1PNDA 5FA3B 3HS0C 2X3CA 3FQXB 1IBGH 5MP6L 4HOWA 3I50H 1TNMA 1X5AA 1WGOA 2JQZA 2PCFB 3OSKA 3P0YL 1EFQA 4M8VA 4ODHL 3TIDA 3BWZA 1BCIA 1TYRA 3S36L 2FEEI 3MRPB 1AG0A 3GM0A 3KCPA 5CBEA 3UO8B 5GZOA 4HPHA 1HE7A 3HMWH 2NQ3A 3PL6B 3F7RA 2P52A 3FQRB 1KELH 1J5IA 3KPLB 3TTSA 5DEGB 1EEZA 4GW1A 2UZXA 1TZOA 4BM7A 1E6JH 4OF3A 4LLVA 5J3HD 1V3LA 2ITEA 4XHQA 1MJ7H 1T1ZA 3N44B 4YHZL 1AKJB 2OSXA 2ETWA 5IOPA 1P5VA 1XF1A 5DJ8A 5IP4A 5IZ7A 1IVTA 4O02L 3FB8B 3N1QC 3BW9B 4RVBA 3WAKA 2JVUA 1HX0A 2WNWA 4FNSA 3FU7A 3MRFA 2MHAA 4GBXD 3NIFE 3CVHB 5C86A 5HHQB 4F15B 1MAJA 3BZ4A 1E8YA 3VI4E 4JDEA 4NQXA 5F88A 3CXDH 4FAAB 1GYUA 4K94H 3EH3B 1RJZA 3NIDF 4IRSD 3WMPA 1S7QB 1MH5A 4WI8A 2AJZA 1MFUA 3DVNB 2CLRA 5KJRL 2IPKB 4ZFOL 4PJFF 3RGVD 3VQMA 4X50A 4N2IA 1ZSDB 4Z78A 2V2WB 1W6WA 5ICXB 3O11A 1AO7E 2JTYA 1TQTA 4XI5C 4MBRA 1G9NC 1Z9SA 2IOMA 3ECWA 5DVPA 1CDIA 2NW2B 4HPOL 2Y0SA 3VRIA 2DLFH 1WF5A 4X6DA 5JA8B 5JIKA 3EW3B 5IT2H 2I60H 1CQYA 1KC5H 1JF6A 2XBTA 4FYQA 4MJIB 4ETYA 2H0FA 2XG4B 3RY5A 3FT1A 1NGPH 1JTPA 3CMGA 5L6YH 4GAGL 5K1NA 5FFOA 1FFNA 4W6XB 4UNTA 3MSPA 5DYOA 3UTSE 3IGKA 4OI8A 3O3DB 1ANUA 1UWGH 1UKQA 1DQQA 5HDQL 2NNCA 5F7LB 5E2WH 4YEEA 3WY3A 1JN6B 1INDH 3UBGA 2XBZA 4HJSA 4KZCA 4IOIB 4NJ9H 4A66A 5K59F 1QA9A 5D7IB 3U1PA 3N85H 2Q2EB 2CO4A 1SM3L 4APQB 3B9KA 3HG4A 3FTYA 3GMQA 3IF1A 3BMWA 2BOLA 3AZUA 2H0PA 2BVPB 5CINH 4H0HB 3BWUC 4M7LL 3N0AA 5I8KL 1JZ5A 2VXVL 3GKZA 1E4JA 5LDSA 2Q0ZX 4JG0L 4Z7VB 1KPUA 5D1ZC 2YMOA 1JPSL 1MIEH 3FFOA 5DFVD 3VFSA 5E6UB 2NNFA 4ZSOB 4NO0A 1FJ1B 1NL0L 2OI9B 2E6QA 2BMKB 3GZKA 3KNBB 1QFPA 1N67A 3SE4A 4DOHB 2YO3A 5D55A 3OX8A 3HZYA 1OTTC 5EC2A 3GTNA 3VD0A 1ORQA 3EO1B 3CAFA 5HI5D 4E9QA 1G6RB 1VPOL 1QWHA 3QDMA 2J55A 1SNRA 2Z7WA 2Z92B 4LEOB 3CZUB 1JZFA 4BXSV 2H32H 5KW9L 1XD0A 1YEFH 3PGFH 3DV6B 1THCA 3PGCB 5IESL 3KPQB 4LSPL 1MCWW 1SLUA 1CLYH 1S46A 4MD0B 4UTAA 2AQ2A 1U42A 3BISA 3T4YB 3HBPA 5E2JA 1DJSA 3CDZA 3GSVA 4LSUH 2SEBB 1IRAY 4NHCL 4U7SA 4ZW8A 2WBXA 3PXLA 4P5TD 1PG7X 5BVPH 4DIXA 1JPEA 5DK2B 2E7LC 4KRMB 2UY6B 4AT6B 3VDBA 5EUOF 1ZEAH 1AXIB 3GLZA 4M8QA 5D2LB 1UWFA 4IQHA 2GBUA 1F2XK 4ZMPA 3TT3H 4C4KO 4W81A 4W9JC 1EAOA 1AQDA 3MJ8B 2Q87A 3O3EA 3MRBB 4GFTB 2P24A 4WEMB 4FQIH 3FQUB 4GRLB 4HUMB 4UQ2B 1MHEB 3IFNH 3T77B 3ZTDC 2Z8RA 1ZLSL 2NUPA 3IETB 1OF2B 3N85L 1UFUA 3FPYA 3IU3A 1M6OA 5JW4Q 4O02A 5ICUA 2LLNA 3WLWC 1MW0A 4OZIE 3QJHB 4H25A 4AUYA 3T4YA 4ANXA 4JZJA 3ZJAA 4N87A 1QWUA 2Z3FA 3EO0A 3P3UA 4L2LA 5D7JB 4AEEA 5LNEA 4YXLH 4NQDA 2IANA 5KANI 1DSWA 4RGMB 3F65A 2OQJB 3IMVA 4X9IA 4TKWA 3L08A 3SGKA 2Q8AH 5E8EA 4XMXA 1MIEL 3EFOB 3SKUD 1MQKL 5FM8A 1CFQB 1HEZA 3C09C 4ELDA 3RI5K 1A64A 3TOPA 4HMDA 1Z3GH 2J1ZA 4O58H 3P77B 1AZCA 2XPZA 4I9WE 2VL5B 4RGOL 5DD5H 1I31A 3W2DL 1NGWA 3P9LB 1SJMA 3QP3A 4EN3A 2AJXH 1T1XB 2R59A 3LNHA 1YUHA 3QXWA 3S37X 3BAYA 4Z7AA 3LRSB 3T65A 4I9WD 4PSRA 5J1TC 4MJIA 4HJIA 3TZVB 3FT3A 5GQBA 3IJ7A 5A3IC 1CLYL 3BVTA 5I74C 1VJSA 1BAFL 1AI1L 3L3DA 2OV0A 2DLTA 2WUCL 4YDKL 5CWSB 5D5ME 5KVEE 4TVPE 3MCLH 3RNKB 3K2IA 1CL7L 2ICES 3V4PA 1EJOH 2HKFL 2NW3B 1UQSB 2OK0H 5E1QA 3FQNB 5HYJD 5I19H 5FO7A 1TZGL 1A0QH 3E8UL 1ZPLA 3FRUA 4OCXL 2OL3A 2ZAHA 1NEZG 5D1QD 3WTXA 1FFRA 5I82A 5JO5B 5LHDA 1M3IA 3G08B 2DBLH 3CD4A 5F6IC 2MEJB 4IBYA 1SBBA 3L9BA 5D7LD 1CFNB 2GSMB 4Y7OC 4O5LH 3JT0A 5CEZD 1UC6A 3FSAA 4LMQI 4JVUA 2ZG1A 1F2QA 4QTHA 1ZLSH 4OZGA 3V4PL 4J3SA 5IHUL 1Q4NX 5C0FB 1K5WA 2X4UA 2BIPA 3D18B 4XI5D 4Z23A 1YZZA 2ATKB 3FT2A 4N25A 4XP6H 2IWFA 4PCTA 2VDPB 1DHKA 3B43A 3CU1A 1J88A 3FSOA 1OF2A 3TESA 2D4DA 1GTFA 4Q2ZB 5BJTB 4KDTC 1GYCA 5JIQA 5DURB 4KX7A 4NUGH 2CIKA 2ICWA 4TNFA 4L0YA 5DO2D 4LSSH 4IHOA 2VM9A 2WMPA 2B5IC 3FNKA 4LSRH 4FFYA 5TD4A 3U2IA 3V7AE 1T0NB 2FLRT 2UY7B 3EKCA 5EC1B 3FW6A 4NJAH 3VXRD 2F54E 5D2LE 2MCG1 3BD4A 3SDXE 3W2DH 4OLUL 3J07A 3HPJB 2IBZY 3C6SA 4XPHL 4PJXF 3V4VH 2F1BA 5AVZB 2EIZA 3HHSB 4UINL 4A67A 4H0IA 3F85A 4F15C 4TOYL 3UTZB 3VMNA 3I6GB 4JKLA 2XWDA 4BRJA 3ZKQD 4XGZB 4D2NA 3HCVB 2CO1A 5CZXD 4CVUA 2HKHL 3V0IA 3I9GH 2AERT 1M7IB 5KVGE 3MLSH 3CQPA 3GYRA 3CX5J 2FO4B 5FW6A 3QAQA 3WU1A 2DYPA 4P2AA 1Q38A 1S7SA 3SD5A 4F2EA 2WLIA 2ADYA 1MELA 5T5NF 1EJ6A 3WL9B 3HB3D 4YE0A 5B7EA 2ZXQA 1XGUA 4PS3A 2CBOA 2VW7A 3L3KA 2HKFH 1I9IH 2MQCA 4CGTA 3IU3B 2QGDA 2XNAB 4FG6D 4L8DA 4NNPH 3F62A 2WWOA 4HGKC 4KK9C 5HYFA 1VZHA 2AJZB 2BH0A 2W38A 1ZK5A 4IM8A 2AEWA 3KLQA 3GHPA 1NCJA 5I1CL 5G55A 2KERA 2YD3A 3ULSA 4AVIA 4CVZB 3BZDA 4KUZL 3F04A 4HEPA 2DJMA 3EJPA 3SQOH 4NWTH 3QXDB 3RWCB 4WY7H 1WA2X 4RA3A 3ZQXA 4LHQB 2WQSA 32C2A 1JZHA 4MQ7B 2BSBA 3LKSB 4ZQKB 4Z7WB 3QDGB 2ZOTA 4QHMB 2VXSL 5CO1A 5BNXD 1WFUA 2V9UA 1YVLA 2YRBA 4LP5A 2C34A 3N1PC 5H37A 1IBHA 4KI1A 5KYUB 1KCUL 1JN6A 5F6HJ 3JV4A 1DZBA 4XPAL 1UH2A 4L2YA 1UD8A 2CBPA 1IAKA 5EOCL 5GRUL 2FDBP 1TDQA 1WRFA 3E9TA 3ZTNH 5AW4B 5F9OH 1CXEA 3QB7C 5D1XE 3HW7A 1JWSA 2FQEA 3QJTB 4GUQA 4BH7A 2UZIH 3ELAT 4IK7A 2BVQB 4TNWK 3OMZA 5DD1L 5CP3H 2R2HB 2YD8A 4AX3A 3SDDD 1HSBB 3P3SA 3X11A 3UIYA 1MNNA 2V3FA 1YEGH 4YXHH 3OXRA 4JEGB 4J39A 4LK4A 2ARWA 5K1VA 1IT9H 1K4DB 2FT7A 1XL4A 1RIVL 3QRGL 4OH2A 1QYGH 2YMTA 2ZX8A 4NM4H 5D8JH 4AV4A 4BKLB 4MVBC 4HEMA 1LEIA 4JFDE 1YPZF 5E08L 4TQPA 5B38A 1UJ3A 2HRLA 1XF5A 4RMTA 2H0EA 4UIKL 2K7QA 5KSAD 1UXMA 5E94B 5I66B 1IBYA 1G5AA 1JGLL 1OV8A 2DMGA 2BWQA 5I1AA 4G3YH 2DMKA 4XOBA 2Y6TE 4OKDA 1K4CB 5M94B 5DC0A 4L1DA 3LRGA 4I8DA 1WAEA 1J10A 2WLHA 3HHMA 3JZYA 3KPRB 3MRMA 1QFUH 2WJ7A 1RP8A 4KRPC 4X83A 1RERA 3VMPA 2WWKO 3WY1A 4JANA 4LRNH 4NZRL 3GSUB 3MLYL 4S0HA 2Q10A 2V0AA 3IDNA 5I16A 4Y1AA 2Z65C 3AS3A 1H5BB 3TN0C 4JM2C 4AYEC 1R9FA 1BX2A 5F89A 1U0QA 1MCLA 5K39A 1OB1A 5IT2L 3CHXA 2NSQA 4IHOB 3ZDYF 3O6FD 4Q9RL 1ZAGA 3NSCA 3WS3B 4AK1A 5JORA 3BPNC 3RY4A 4NFDA 1JGEA 5ISZD 5C2BH 1F8TH 4HG4J 4DZ8A 3LQZB 2VLMD 4F2ME 5CKAA 4MNQD 5HSFA 1F3RB 5A43C 1JZ7A 1X4YA 2WBJC 4G1EA 5HDQH 4I18A 4D0CA 4XMVA 3VXSE 4PLJC 2DM4A 2Q7NA 1BPVA 4G9DB 1IKNA 1U4FA 4AQ8A 5HYIA 4KKAC 3CN0A 2EDRA 2O4EA 2H4EA 1HWHB 3W9DA 3D33A 4FYTA 1OPGL 4KY1L 2P80D 2QQKL 1U8QA 1KG0A 3QXUA 2Y69B 4LARL 2XWJA 4WEBH 1BZ8A 5PCYA 2A9ML 2VH5L 3MODH 5B3JF 1MZZA 5TJWK 4NERA 5L9DH 3NIGE 3EO1A 2K8MA 4F7MB 1KCSH 1K3IA 2Q6WB 4E5XB 2VQUA 2H1PH 5I6NA 3QO1B 2VABA 2ZG3A 4D94A 5HVWA 2YS4A 1GCYA 5IFAL 1RK1B 5FB8A 4R7LA 4RGNB 4UTBH 5LAXA 3QDJB 4UAOB 2HT3D 3VG9C 1AQ8A 3EG9B 5DYFA 1OAYL 1B2YA 4N0RA 3OZLA 5JIDA 1HE8A 3PWLA 1MF2H 2C7FA 4RFNC 5HGBB 4ZZFA 4JN1H 1QZ1A 2QQNH 4U1JB 1WVZA 2WCSA 3DI2B 2J88L 3OJDA 3VI3F 2E75C 5KVDE 3TF4A 3PDGA 4Y4HA 1MDTA 2NY0B 4UT6L 1SXZA 4JHWH 3ZL2A 1HEHC 2WXFA 1L3WA 5GGQH 4Z7VA 3MJ7A 4ZNCD 5CLYA 3HMXL 4LEXH 4BBWA 5D6CA 3ENEA 4HH8A 3V55A 4OFVA 4EI6B 1WIPA 3V95A 3JVFC 3QXVA 2DLGA 3VFTB 4YC2C 4BINA 4HWBL 3LPWA 4OZFA 3GMMA 2E74C 3PUCA 1NKGA 3CFNA 5TE4H 3MJ9A 2XV6B 3L6FB 3MGAA 3WXWL 4D3CL 3D39E 2H45A 3BP7A 2NNRA 1I8KB 1KBGL 2IDUA 3NOIA 1AR2A 1CD1A 5FX3A 2CM5A 2IH1B 5HGBA 1UQSA 3WJJA 4FQCL 1A1NA 1PZBA 4DQOL 4B9GA 1M56B 4ZG1A 5A6MA 4GY4A 2NW3A 2IWEA 4NFBA 1VFBB 2J8HA 2MFNA 3RQ3A 4FZ8H 4X0NA 5JYLA 2DQDL 2QGEA 3QG7L 2JSFA 4F7EA 2TRYA 2GKIA 4LU5L 2R0LH 2VDOH 4NQVB 3K8LA 4ZO9A 2YAHA 2C9RA 3DIDA 4HFWB 1XCTB 4ALAL 1AH1A 1C08B 4Q89A 1DYZA 3ZHKA 1BBJA 1E2ZA 4HUVB 1YJDL 4YHNA 3V4VA 2BS71 4IOSD 4J4PC 2HH0L 2E86A 4JG5A 4O2EB 1G7LB 2X89A 2EIDA 3LH8A 5T1KD 1U8KA 1ULVA 2JKIS 3CFIC 1Q1PA 4GI9A 1AR1C 2E9WA 3A21A 1BM3L 2IH1A 4OF0A 1X5JA 3FTGB 3HKFA 3ZDWA 2GJ6E 1I1RA 1USZA 3GMLB 4ZPVA 1YA5A 4L3CA 1JV2B 3D1MC 1ZS8A 5DUML 3B6SA 1EH9A 4YR6B 4P2OD 1NAKH 5EC1A 3D3VE 4PJHF 2G3MA 1QACA 4NN7B 1ODAA 2YFOA 3KYOA 4HZLA 4WU5A 4ZJ9A 2F1AA 1O75A 4DKEL 1WZMA 1VFOA 3RNKA 1JNHA 3ZRSA 2APWA 1E9PA 1NOLA 4W6YB 3WNOA 4P2CG 5F2FA 3VX1A 3DNKA 1A5FH 4H88H 2QVIA 4HGWA 3WFBL 2EUWA 4OSUH 3QCVH 4OZHB 2APTA 4QUOA 4P59L 3ZQWA 4M02A 3SDCD 1S4IA 4P46B 1CLOL 6TAAA 3I85A 1MRFL 4ODUA 5DD3L 3UXFA 3LHPL 3T6XA 3JT2A 4HLZG 1GJWA 3NIGB 3PU7A 4ZMOA 1NFIB 1U8MA 1VAHA 4Y9BA 5KOMC 2DLHA 5EBLB 2OK0L 3DPBB 3FH8A 2KC0A 4EN3C 5ITFA 1TZGH 4X7TB 1A0QL 1YYMH 2B20A 3Q3GA 1HQ4A 2EYTB 1ZVHA 3VYPA 3TS8A 3BIKB 2XV0A 3IDYC 5C07E 5HI5C 1OE1A 2XYCA 5L7XH 5E8NA 3V8CA 2A6JB 4QOKD 3ULSB 4MSWA 1D9KD 2ZP0T 1ES0A 4QCIB 4ZUWA 3H7LA 4ZUUA 3RFRA 3LV3A 1GGYA 1M71B 3QCTH 1PCXA 2VLLA 1A3LH 3RWHB 4GPVA 3CSGA 4ES8A 3KGRA 1T83C 4BZ2H 2UZYA 5DR5H 4Z7IA 4IRJB 2XI9A 5DLMH 4Y5YC 2BY0A 1TZ8A 1E7UA 4J27A 5C6WH 1QQDA 2O72A 1S9VA 1YEIH 5JR1H 2JB6B 1CXIA 1GS6X 1DBJL 1T7ZA 2DBJA 3KH3A 4D9LH 4M7KH 2JQAA 4QXUL 3WE1A 4KTDL 1NDGA 3ILPA 4DEPC 4YVUA 1GTNA 1KB9J 1PG7W 3Q2CA 5EPMA 5IFHL 2E56A 4P2RB 1HESA 1XZWA 3BUIA 3LEVH 3UBFA 3RL2B 2WN3A 3RBGA 2XN9E 2V9TA 2ATPB 5G4MA 1TXKA 3VJ6A 1VENA 5HYQA 4QRQB 2X0VA 2YKL