4IOIB

Meditope-enabled trastuzumab in complex with cqfdlstrrlkc
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQSPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAIYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Trastuzumab light chain
total genus 51
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ioiB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ioiB01
1Z9LA 1RZGB 4R4BB 1U8HB 1UVQA 1JPGA 2BSTB 2COQA 4MNGB 3BW9A 3VXME 2V2XA 4Q97A 2OZ4H 2UV3A 1G6VK 2DTMH 1B0RB 1DLHA 1NUDA 4Y2DB 1OB1B 3BEVA 2GITB 1NCUA 3CXDL 3LRSA 2PXYC 4TPRL 1TXKA 3QIUB 4KRPB 2I24N 4I9WE 3GMOB 1I1AC 1WIOA 4O9HL 3VG0H 4PRDA 4OFKA 2QR0B 2A38A 3A67H 4FQ1L 4ELMF 3H0TA 1TQBC 3FO1B 1UCBL 3MRBB 4N8PA 3ZTJG 4F80A 3LD8B 4CMMB 3H9SA 2BERA 5IMLA 5E6YA 3WE6B 3QIUC 3U36A 4G8GB 4NCC2 5GZOC 3QHTC 5EG6C 5CD5C 1TZGL 2I26N 3X11B 5D1QD 4DKAA 1JPSH 4I4WB 4WO4B 1L6XA 3DRTB 3DYOA 5B8CC 4G8GA 3U4EA 4OLYH 1P84J 4LLVB 5CJOL 1F13A 3P30L 3RGVD 2GJ6E 4ENEC 3MRKA 5C2BL 1VKXA 4R6UA 4M1CC 1NUNB 3AY4A 5DRZB 3B8YA 3BKMH 4HIXL 3VXUA 1WWAX 4YXLL 4TNWF 4BFIA 3HMWH 3EFDH 2CMRL 1CZ8H 1LP9F 3BWAB 2M8XA 4LSSL 2CKBB 1I8KB 1KENH 3V6OA 5C70A 1HQRB 4LPYA 4DN4H 3BGFC 1MLBB 4N5EC 5JO5A 4I18B 1RUPH 4KHXH 1L9MA 1NFDB 2UYLA 3IDJB 5HD8C 1JGEB 1TPXB 3AS3A 1WCBB 4P2OD 5GGRB 3B43A 1EEZB 3WKML 3NABL 3L5HA 1RZGA 2HYMA 5T3XD 4W6YB 2C5DC 1JNLL 1C1EH 3TLRA 5DVNA 4H25A 4BFGA 5E6IB 4JRXE 3MOAH 3KLHC 3V0WL 4O2CA 2FD6L 4HPOL 4TSCH 4WDIA 3VXMD 4PRID 2VZSA 1IEAA 3ULVH 3V7AE 4FFWC 3O8XD 3PDOB 2G9HA 4C58B 4CJ0A 1MRFL 4ZSOE 1FSKC 1A7QH 2VWEC 3GO1H 4EVNA 1ND0B 3C5JB 1EHAA 2PYED 5IB3B 3VI4F 4P2QA 3GSQB 4YGAB 2HT4D 4AY0A 4QY8B 3P4LA 4KUZL 2HLFD 4PJFA 3JWDL 2G2RA 2P8PA 5EZJA 2VZ1A 3PHQA 3NFPB 4M1DH 4KKLD 3CSYA 4WFFE 3CNKA 4WFHD 1KNOA 1IGYA 4JFDE 4NQCB 3R1GL 1FFQA 5EZOH 4ZQKB 5IFHL 5IV2A 4WI4A 4HCRA 2VN4A 3MJ7B 1ZGLM 3O8XA 1CU4H 4LASL 4NYLB 4Y19A 2E9BA 4F57H 4YO0A 4Z7OE 3QT2A 1FGVL 4IEFB 5DUML 2Q3AA 3ARUA 5I73C 3ZSSA 1FV1B 1SMAA 2R29H 3MRHA 2P8LA 1BZ9B 1UQSA 3PGDA 5J12B 3EYOB 1IGIH 2H45A 3BQUB 1JTTA 3HMXA 2VR5A 4YX2H 4UTBL 4WWKD 5IB2A 3TA3C 3O2VL 3HUJB 5F96H 1A6TA 4LSTL 5E00A 4H1LG 3LRHA 1EHLH 1AFVH 4HLZG 2P45B 4Z7UF 2KPNA 3CMGA 2LU4A 1KN2L 4TRPH 1RUAH 1BREA 2AGJH 3S35X 1R0AL 4M7LH 4OGYL 3C08L 3QISA 3OKYA 4JFQB 3OSKA 2ICEB 5EN2A 4R0LA 4FP8H 2AJUH 4GSDL 1A1MB 5J06A 3HRPA 1FVDB 4XXCC 2OP4H 4E41A 3IB4A 4KUCF 2YS4A 1I1YB 2FHFA 5GS0D 5HGDA 4MJIB 1CFBA 3LOWA 4XNQB 2RIKA 2W0LA 3MRRB 3WNKA 4Z7QE 2J3SA 3QEUA 1MIMH 2BNRA 2CDFA 2RCSH 1LQSR 4POZD 3RJDA 1FE8H 2MSPA 3M8OH 1FGNH 3HC3H 1U8KA 4YLQT 1OP3K 5GS2D 4LQ1A 5E2VH 5L7XL 3RWDB 3WDHA 2Z31C 1RAMA 5DO2C 5DMGD 3VFVA 4PD4J 5K9QG 3UYRL 4UAOB 1AQKL 1HHHB 2F74A 1ZEAH 2P4AB 2Z4QB 3EFDL 4ACPA 3HI6L 4Q6IB 1L7IH 5BVPH 4J3TA 1SYVB 4MSWA 4QHKI 5F72S 4OFDA 4Z7WB 2G60H 2AKRB 1A7RH 4NN5C 3VFNB 1IFHL 3B3IB 1TFHA 2PO6B 4YNYA 3THMH 4BQBA 5I15L 1CGSH 4WEMB 3GHEH 3OKKB 2MCG1 1J8HE 4GXUM 4XRCB 4OCSH 5EFIB 5IUSA 2CLZB 1MJUL 1WK0A 2FD6H 4HPOH 3RGHA 1E4KA 4ZODA 2DN7A 2Y07H 1LEKB 1TZHB 3SJVD 3PUCA 3C8KA 2KQMA 3CZFB 2B1HH 1G7QA 3IKKA 1RJLA 4KMTL 1CWVA 4PGDA 1RIVL 4WHYH 3TBYA 3MGOA 1Q0YL 1T1YA 1P7QB 1YZZA 5FIEA 2Q86A 4U33A 3CFJB 4U0RB 4XPTH 4MD4B 3G6AA 4QXUH 3FN0L 5DD0H 1CR9H 3L5XL 4HLJA 3QUYA 3QUYC 4BSWA 1I4FB 3P9MA 2ZCKH 1X5HA 3MMEA 2PXYA 4Z5RA 4M1DL 5HYJA 1AIFA 1Q9WA 2CPCA 1RZ8A 2HRLA 3BIKA 1IM3B 5IBTH 4AM0A 4RFEA 1KB5B 2YUXA 4OUOA 3BVNA 2GEEA 5E5MA 2YKLL 3PABA 3PWPE 4X7FC 3RI5F 3M07A 1EMTL 4M93C 3BVNB 4LFHD 1JV5B 4K7FA 2HTLC 3TT3L 5JNYA 3WFCL 4LVOC 5DFTA 3X13B 3WDJA 2JIXA 4F33B 4LVEA 4PGEB 3BD4A 3O2VH 3VMNA 1TVHA 2QQKH 2HVJB 1MCHA 3D87B 1VA9A 4FRWA 5EBMB 4R97B 1QO3B 4UOW1 1MFEH 5ID1B 2YUWA 4YWGH 3GMOA 4GG6F 5KTEL 1CLZH 1HINH 5C8JA 3KPTA 4OZHF 4Y16D 2GTWA 1BD2E 3OKLB 2EYRB 1OTSD 5LBSH 5F3HB 3ARRA 4KY1H 3PL6A 2ZCLH 3SE4C 2EKSA 4FP8L 1NJ9B 3V8OA 4QRUB 3M17B 5I8CB 1I1RA 3D39A 1YY9C 5ESVA 3DNKA 5DJZA 1ERNA 3ZMRA 4J3VA 5HJ3B 3QAZC 1MHPL 4HXAH 1Y0LA 3IKCA 3OTTA 2CQVA 3S88L 1LEIA 3ULUL 3SE9L 3IYLW 4WENB 2FCBA 4ZFGH 1R3KA 1YEFL 1QRNA 3NFNA 1HH9B 1S7SB 2OSLB 2F8OA 1CN4A 4R90L 5FK9B 2FX9H 3HHRB 3QUKB 1KIPB 1VESA 4K8RC 1MJJA 1MAJA 3DV6A 4LSQL 1LNUA 1AQKH 1DBAH 1HQRA 4KDTC 3GIZL 2ED9A 4OSUL 1HZHH 3V0VB 1IGFL 3SDDA 5FUOL 5GRUH 4APQC 3TYFB 4MLSA 1S7RB 5IVXA 1IM9A 3WCYA 1U6AL 3SE3C 1AY1L 1CLYH 2QBWA 4R7DB 2CRMA 1AD0B 4XXDB 1K4CB 3SGEH 2HFFA 2VDPL 5TPWL 2J7LA 1GC1L 5D7LA 5I15H 3UYOD 4XH2A 4XPBL 4G7VL 4EDWL 3N50A 5CGMA 3S5LG 5I8OL 1C12A 1DQJA 4RIRB 4MXQD 1UH4A 3WBDA 2E3VA 3X11A 1LHZA 3I6KB 4JZOB 3LZFH 2P42B 4BH7A 1BOYA 3OAYH 5DQDL 1V3LA 2K3TA 4YBLC 4PJFE 4CN6A 3QUMA 5FDWA 5BRZB 1N26A 3RZWA 1A6WH 5D7JB 5KSBE 2F58L 3BZFB 5E8OB 5DD0L 3DI3B 4P4KC 2ATKA 3WL9B 2EE9A 5JPMB 1QBBA 1EUUA 4U3XA 4PJIB 3FFCD 3FT4B 3BEVB 2XZAH 4MX7A 1U8MB 5HHQA 5DLMH 3MLTB 2HJKA 4NN6C 3MOQA 2VDRH 4QXTB 4JRYE 3TESA 1AXSB 1J10A 1NGYB 3B9AA 3QHFL 1JHLH 3OAYK 3PIQA 2YRZA 3KPLB 1J87A 1A9BB 4TUJA 3KR3H 5IBTL 4P2RE 1KXTB 4DVRH 5I73B 3KPRA 2VLKD 1ZA3A 1JNJA 12E8H 3VRIB 5HY9A 1P9MC 1OP9A 4PJXF 2X9YA 4NM8H 2CSPA 1FL6B 2AK4B 1TIUA 4HIJA 4NRZA 1KLGB 1T04B 4NWTL 1OQXA 1G9MH 3OR7B 4XNZC 3EJJX 4OZHB 3U30C 2BFVH 3NTCL 5JXEC 1YY8B 3T3ME 1BAFL 4AEFA 4GBXA 4JPVH 1HK6A 3UTSD 5FF6B 2LVCA 4NFCA 3TH3T 3VXUE 3U79A 3FT2B 5BRZD 3WEXA 4X9HA 3AGVA 3MYJB 4PRHB 2R9HC 4EN3D 3LPGA 1Z0MA 4JFQA 3S37X 2GY7B 3C2AH 3HI5L 3BKJH 3O45B 2YXMA 4HEME 4DW2H 1LWRA 4LEOA 4PLJD 1RQ5A 2ICWJ 1NUGA 1RZIB 2X6MA 3WFZA 3TFKC 1LO4H 3DGGB 5FUCE 4PJXA 4HEPG 3DVIA 2WMPA 3ZTNH 3OL2A 5D5MB 3SDAC 4ZFGL 5DRWA 2R8SH 2OJZL 5HGBB 3GSNH 5D72H 2R56L 5I74B 2ZUTA 5IB2B 4NBXB 2NY0D 1PYWB 3D18B 4R90H 1S9KC 4PS4H 4K2UH 1FL6A 1NEZB 3PHOA 1V7NH 3TPUA 1IVLA 1NCCL 4DAGH 4L5FH 1P5VA 3U0WL 4NO0A 4U1NB 3D48R 3MUJA 3OKOA 2BOCB 1T7VA 4LHJB 4HSQA 1UEMA 2V2TA 4C57C 2F8VA 3BJLA 2PW1B 4F7CA 4XNMA 1KSRA 4PLNC 1NBZB 3ESVF 5LCVL 1QSVA 4J2XA 1N8ZB 1P7HL 3PP4H 1U3JA 1C5CH 1BVLB 3CSYB 1EPFA 4FZEL 1XGPB 3D69B 4PD4K 4RMUA 1D5BA 3EDJA 1PZ5A 2W92A 2FATL 2ICWB 3QEUB 2J2ZA 1AP2A 5F7FA 4Q2ZB 1ZT4B 3QCUH 2W60B 4LLQB 1T21A 3NA9H 5DJZB 2DI9A 5DFVC 3SGDI 3ZE2F 1HYSD 5HHPA 4PJHB 5FAAA 4RZCA 4Z7WF 1NCNA 2IAND 3FKUS 4XBGB 4NN6B 5AD0A 3NIGF 5E94A 5I1IH 1X44A 1FLRH 3QEHB 5ESAA 4HUNB 5D7IF 2D31A 4JE4B 4XMKH 2WANA 4FABH 3QUMH 4Z0BL 1XF5A 2W9LA 3TNMB 5C07A 1A22B 1GIGL 5KVGH 4PB0H 2QTEA 4IIQB 4JANA 1VCAA 1CFNA 1U8HA 1UVQB 4NWUL 5EIVA 3S96B 1T0MB 5E8DL 4XB7A 3PP3K 4P2YA 4X9BA 1ZHLA 5IGXL 4LGSB 5FM4A 1INEL 4OD2B 2EZ0C 5JNYB 4Z76A 5B22A 3GUTB 3PE9A 4ODBD 4ONOA 4OV5B 2X42A 2J8UA 5ADOH 4HUWA 4QRQB 5KVMC 1IAIM 3AREA 3RTQA 2ZOKB 5FKPB 1OAXH 3IRPX 4QO1A 1T66D 3WO3B 5A2KH 2QQLL 3FB6A 1QZ1A 3T0EA 5GGTA 2F53D 4LLYA 5IFAH 5L8LB 4POYA 3TYGL 1XR8A 4NQSA 3RIFF 1EJ6A 1JF1B 3BDBA 4LSRL 1DBBH 2HKFH 4OLXL 3TN0C 5TE4H 5TQ2H 2DLTA 1BQLL 3O6LH 4WO4A 1ETZA 1S7TB 4UT6L 2NZIA 4PP1D 1XGPA 2EECA 3WE6A 2OBGA 5HHXL 1P7QA 3DECA 4NKMA 4XP1H 3GSOA 4JR9H 5CSBA 5DGRA 5ANMA 2H32H 2JTDA 3PWPB 4KMQA 5F1SA 5IMKA 3WHXA 4PREB 3BP5A 4PY7B 2J1KA 2NY1D 1IKFH 2IPKB 5TJWK 1U9KA 2DWDA 3G08B 2ZSVA 1DQTA 3VRLF 1BF8A 2AJXL 2VAAA 3QG6B 4UDUB 1KJVA 4MNHA 4XPGH 1S78C 1IC7L 3T0XA 4BZ1H 3NCMA 2XACC 4M43H 4JQVC 1TNMA 1Q94A 4WI3A 5CJXC 5TF0A 5FCUH 3QCTH 5LVEA 1VSCA 2ZUUA 3MA7B 2J12B 4QKXB 4U3CA 2VITA 2VLMD 3ZYJA 4EEEA 3G5XB 3VE0A 3RNKB 2GCYA 4LSPH 2N7BA 5IIEB 5T3XH 1BX2A 4J6RL 4N1EA 3SO3B 1AXTL 4F9PC 2CKBL 1I8LA 2WQ8A 5E8NA 1E27B 5E1AA 3MR9B 4I3RL 4GAJL 4TVPD 2BY3A 3BN3B 3MRKB 4LLQA 5HI4C 1XIWB 3NZHL 3D9AH 4MD0A 3VWKB 4NKOA 1N0LA 4XWOC 2AP2A 2CDFB 4Y0GA 5IB1A 4UIMB 2P24A 1MHEA 3L5WB 4LCCB 1HHIA 2ADIA 4WU7B 4LVHB 2Q86B 5CS7A 4OZHE 1KCKA 2WZPD 4FQCH 5HDOA 2QSCL 4YPJA 2NX5E 3RZCB 2VLRA 5EA0H 1DVFB 1ZT7A 5CWSA 4QRTB 3RWHB 2ZJSL 3VWKC 2FECL 3DWTA 2HG5A 1A6AA 1S9XB 1W72B 3QI9D 2RAMA 1OF2A 4U7MA 3W39B 2APBA 1JZ2A 5AG9A 4O5LL 3K4AA 4OFIA 3CVHA 4LKXB 2ILLA 3WIFA 2XTLA 2VN7A 3SKJH 4NO5A 3TC9A 2V9QA 4WNQB 5GS3A 3U30B 3HMXL 5IGXH 1S9WB 2EXYC 1AO7D 5BV7H 4NM4H 1MIEH 4LARH 4HFWA 4OLEA 3MCG1 4Z6AT 1F11A 5FA3B 3QDJA 4WGWB 5KVEH 4L29A 3DO7A 5KSBB 1IGCL 2G5RA 4QRPA 3GHBH 1JK8B 3DLQR 1WFOA 3BZFA 5BMFH 1ZT4A 2YPLB 3WNMA 3MYJA 4PJ5B 4PRHA 4HQQL 3KHOA 3H3PL 3BP4B 2EEDA 1TZGH 2HKFL 2VISA 3SDCA 3QYCA 2FGWH 5E2TH 1SBSL 1TCMA 4F8TA 2FEDC 2DM2A 5T5FH 2VE6A 2BCKB 5D7JD 4GW4A 2WUCL 2WINA 3CZJA 1JP5A 5HHXH 3EO0A 4L3EA 4ELKA 3FOLA 5CJQH 1WBZB 5C0IB 3UTTA 1QFPA 2W9EL 1ZWIB 3IU3B 4QXGH 3RVTD 1LE9A 3BKCH 3QIWB 1AGCB 3H9ZA 1QOKA 1IEAB 1JL8A 4QCIB 4WY7L 1NH6A 2XZCL 5HY9B 1U58A 3KLAA 1T20B 3QHZL 2FZ3B 3LS5L 4ZO9A 4CW1B 1EERB 2VDLH 1PD6A 5IESL 1NPUA 2D03L 4YHIA 1S7VA 4R9HA 1KIRA 4KGLA 1HYSC 3ZT5A 1A9BA 3QCVH 3C2SA 4YEEA 3HPJB 4X9IA 1RUQL 3QNXB 2ESVE 1W0WA 1D9KA 1LO3L 2NTFA 5MERB 1RUKL 1L6ZA 1CF8L 4R26H 1A7OL 1GGIH 2GK0B 3C5SA 4U4BA 4B7LA 5IQ9B 3EZJB 3UTZA 5E5RB 2ATKB 4P9HH 4PFEA 3IXTA 1NCWL 2YD8A 5FB8A 3B6SB 1J0IA 3MV9E 3TVMD 4BQ6A 2C7UB 2PYEA 4FFZH 4H26B 1JE6A 3QUZA 3QUXB 4KJQC 4TVPH 2V2WB 3DXAE 3DVNB 4BH7B 2ADFL 4JG1L 5EORH 4IHOB 4RWYH 3ULUC 4R0LC 3MLYH 5HYIA 1K8DB 1T0NB 5I0ZA 3L95A 2GHWB 2J6EL 2NW2A 2NY3D 4Q9RH 1XF3B 4O2EB 5JOEA 4DZBA 1QEWB 4LF3A 5DZNA 1F4YL 5LQBH 3UTSB 5HGHB 3U9PH 2CLVA 4I13B 4Q6YA 3QQ9D 4S10A 1RY7B 4U6TA 5MEQB 1T2QH 2H9GB 5DTFA 5F7KC 2OJEA 4NQCE 4CNIB 5LJYH 3RZCC 2F53B 4F57L 5IVXB 1QACA 4U1IB 4EI5D 1BJMA 4PV8B 3E2HC 3LB6D 4UT9L 2I07A 4PJFF 5HI3C 1FLTX 3QIBD 3KPOA 3B8SA 1OSZA 4LPTA 2HFGH 4N8VG 2NXYD 1FNGB 1KIPA 3F7VB 3JV5A 4ZFZA 3P4NB 3LAFA 4UQ3B 1B0RA 2RJMA 4UDUA 2PYFA 2Z91A 2E7LA 5ENWB 5I1EL 3BW9B 1UT9A 1KPVB 5IROC 2LTQC 1I3GH 3VWJB 1CE1H 5ALCL 2GSIB 2BVQB 1NBVH 3GSRB 4JFZH 3EZ8A 5LXGL 1AFVL 3VGHA 1CT8A 1K5NB 3QUYD 2FH6A 4JO2H 3EOBA 4PRPE 1IGCH 4PJHA 1JZ8A 4XAWL 1HOCB 5SX4I 3SGJA 4LLWB 5C0JB 2J8OA 2GTWB 2VKWA 2MWCA 2ICWA 1SYSB 2R1XB 5D7KD 2VL4A 1AO7B 1A4KA 1N3NB 3LKOA 1KBGH 2XWJA 1MIML 3MO1B 2VXUL 3TZVC 3T4YB 4PP2B 4KVNL 3O11B 5GGUA 5C0DA 3GMNB 3FO0H 4MHHI 3ULSB 1U8PB 1UADC 3OX8A 1MI5D 4PJ7A 5DUPL 4GLRH 1QBLH 2I07B 1X6NA 2R1YB 3BKCL 1KB9K 5AUMA 3QIUA 2YN3A 3RWFB 3V6FA 2XN9B 3BP6A 3EBAA 2J4WL 1TJHH 3G5YA 4CVXA 3LN4A 3KVQA 5EWIH 3JTSB 4M62H 3LSOA 1CXEA 1MCPH 1NGXB 1RZ8B 2MHAB 3BIKB 4KRPD 5D1QB 4NUGH 1BQSA 5CP3H 5FGSA 2OQJB 4OFYA 3T08A 2P5WD 1QLEH 5DS8A 1A7OH 1GGIL 4DFHA 4YEFA 1SVZA 4IJ3B 4XI5C 5AYUH 4PJCE 1JGUL 5J8OA 2NCMA 4BK5A 2AJVH 4Z8FL 1CIUA 1QRND 2DM7A 1RJYB 3ELAT 3O4OC 4LMQI 3STLB 2LAAA 4NNXB 5M94B 4O02L 1RJLB 3CC5A 1XH3B 1RZJH 2XQYK 3O6FC 1EEYB 2GIYA 5EOCH 4F9LA 4Q58C 3OJMB 5KSUA 3RL1A 4PJ9B 1ORQB 4JG1H 2A9ML 4HT1L 3AXLA 1C7SA 3P40A 5FOJA 3C6SB 5IT2L 3C9NB 2PNDA 5EO9A 1U92B 3IRZA 3S5LA 5CIPH 4NO3A 3T04D 3CH8A 1FN4A 3QDGE 4WFED 1F3DH 4RMVA 1KPRA 2AKRA 3F7QA 1S7QB 3TPUB 4JQXC 4W81A 4CVUA 3W39A 4UBDD 4PJ7E 5DWUH 4RWHA 1ZHKB 5IBLC 3CX2A 1UWGL 3HCVA 3ARDD 4Y19B 4AT6B 2X4SB 2DF3A 3DX9B 5ALBL 3RVUC 3HZYB 1FO0A 4IOIB 3U4BL 3SJVB 3RWDA 1XIWC 3M1BB 2XG5A 4X6DE 2XQYG 3B2VL 5FGBA 5CMAA 1VDGA 4RFOH 1EUTA 1I3GL 4KFZC 1IZKA 2FDBP 3QQ3B 4Y4HB 1NC4D 4HJ0C 5KTEH 5IB1B 1NBYA 4IOFC 4DGVH 1RZKH 2P5EE 4JO2L 5F6IC 2ICES 5E8OA 4J7RA 5LBSL 3A67L 4FQ1H 4YHKL 5KSUB 1KYOK 4HKXA 1LDPH 4KAQH 4XBEH 1BFTA 4M3JA 4TSBH 5CBEA 5HVHC 5I1GL 2FWOA 1PW3A 3OXSB 1JPFB 4MA1B 1ZLSH 4Y4KB 4P9HC 4M6NL 2OTWB 4HXAL 1AGDB 5C0ND 3WSQL 4H20L 1JMXA 3EDKA 4KK6D 1FAKT 3OKMA 4OM0L 5FA4A 1BEYH 3LEYH 4KVNH 4NOFA 4OCRH 1T1ZB 5H35B 4CUCA 3VFTA 2BRQA 2CR3A 5CZVL 4NFDA 3BPOB 1YNTB 1HH6A 3HG1D 3FJTA 5IM7B 3HMWL 3L7FA 1BOGB 3BQUD 3HCVB 5D71L 1FVCB 2MJWA 1KC5H 4MNHB 3QQNA 4OZ4B 4GBXD 3AS2A 5DDHA 3FO9A 3SDDB 3IF1A 3GNMH 1IGTA 1SHMA 2F74B 3V0VA 5CP7A 5JZ7D 4G5ZH 4CDHA 4PJIF 5DVOA 5E08L 2KL6A 3X12B 4KXZI 1I1AB 2X7LB 4XCNB 4E42A 3ECBB 3R8QA 2B0SL 4FQIL 2VDNH 2R0ZL 2VSCA 5I1AA 1JJUA 3TP4A 3LQZB 4P3CH 1OGAD 2OI9C 2VABA 2WP3O 4CN4A 4P5TD 3GSXB 2BY1A 4M6OL 4FXKA 2VZVA 5JUEH 1I1YA 1X5GA 4EIGB 2DQUL 4F15C 2CIIB 4AEIL 1FFPB 1UACH 1A7NL 5E8EA 1MFDH 4IJ3C 2AXGB 1FNEB 4NPYA 1G0DA 2MPAL 1IEHA 5AZEL 1B4JL 1I7TB 5EOCL 5F70A 2NY1B 4JQXA 5TDOA 1T3FA 4OI9A 4PY8J 3MXWH 4G8GD 2EDDA 4DK3A 5C0CB 2APVA 3SN6N 3VGGA 3B5HA 3WN5A 4ZD3H 2VJXA 2M26A 2HVJA 2EC9T 3RVVD 5CZXC 5INDB 3GJFK 43C9A 5GGRA 2UYLB 3IDJA 3OJDB 4O9HH 4M7KH 2D9QB 3VG0L 3KR3L 4PV8A 5FYLD 4GO6B 2WQRA 2Z92B 2FIKB 3BO8A 5D1QC 4L3EE 4NN7C 1K6QL 4M6AA 1F8TL 1YN7A 2XWTA 1FYHB 2AVGA 5JIHA 3UPRA 4U1KB 3RWEA 4JZNA 1MUJB 1VERA 4LCWB 4JDZB 2R1YA 4M1CD 4WU5B 1CDJA 1HH9A 2AJYL 3TZVB 2WAHA 3PGCB 2QV2A 4S1QL 2XXCB 2ZG1A 1KCRH 5INDA 1MHCA 3B2VH 1NMAH 2D3VA 4BZ2H 1G9MC 4QOKB 1BAFH 4P2QB 4LLVA 3BHBA 3MBEC 4HIXH 5IB3A 3NMEA 5LWYL 1XR8B 4DGVL 3BP7A 5GRVL 3VXSB 4G3YH 2FIKA 3QDME 3BD3A 4MD4A 4OD3L 3B2UC 4LPUA 1UM5H 1DQQA 2AGJL 3EKCA 4OGYH 2UVFA 1HI6B 4MHHG 3K8KA 3H9SB 1FNFA 1DFBL 2R1WB 3BKJL 4W70A 3F62A 3V95A 5ACLA 5C6TL 3IJHA 1DVFD 3MRQB 3R06B 1OPGH 2QQNL 5I8EA 4GW5B 1W0WB 5EU6E 2W65A 1YEGH 3DVGB 2CK2A 2C1OA 2RCSL 1HHKB 3ILQD 4PJEF 1T1WA 5D72L 3ZHKA 4EOWH 4PB9L 2EH7H 4X6EB 5ADPH 3LQMA 1KJ2A 2MKWA 1GXEA 3U6RB 3Q1SL 4JM2A 1CFTB 4TTDD 5T1LD 1BBDH 3LCYA 2B4CL 1DEDA 4JDTL 1HWHB 1V7NL 3QEHA 5ESAB 1GSMA 2NX5A 2AXFB 1NCCH 4DAGL 4Q6IA 1MRFH 1WTGT 3IDXL 3TN0D 1FNHA 2NY4B 2HKHL 4YXHL 1IFHH 2VZTA 4GRLD 5DVLA 3MACH 5IOPB 3NBNA 4LCUB 3WNLA 4UV7L 5FGCE 5FYLE 1EO8L 1FIGL 4UU9B 4HWZA 5IG7B 1L7TL 2D2OA 1QLRB 4Z78B 1WZMA 2NY1C 4PJ5D 4NKDA 4CKVX 3QQ4A 4UB0L 1D5BB 4LCWE 5JUEL 2FSEB 5IF0B 3WFDH 3VGDA 4L9LC 1S78D 5D7LD 3OJ2C 4K9EL 3ARDC 2YEZB 5JORA 1CU4L 5KJRH 5J6GA 1YEHH 5DUMH 5CD3B 4TVPE 1H3GA 2R29L 3P73A 2A74A 3IFLH 3O0RH 1KN4L 1B4JH 1ZHNA 3BZDA 4FTVD 5CEZL 5C0CA 4NZJA 4FFYH 5I1IL 4F7PA 4YR6B 1I8MB 3QDGD 4WFEE 5KS9E 4ZUTB 2BVOB 1YQ2A 3ULUF 1KB9J 1NFKA 3UC0L 1GIGH 4PTUB 1JMZA 1U93A 4ZTOH 5I2IB 3QNYA 4E5XB 4P4KB 3C8HA 4TRPL 4NQEA 3VXQA 1R0AH 4DUXA 3WIFB 2QKIA 2HVKA 2GQHA 4ONHB 2QL1A 4OJFL 4FG6D 1DLFL 1G7JB 3MCKB 4TYUA 1IAMA 3O6KL 4GRMB 5K9OB 3QEQE 5C0EB 4MNQA 1P6AB 5C0CD 3GIVB 4HKJA 4UDTB 5ICZA 4ZFFA 4ODHL 2VXVH 4OCWH 1BPVA 3S4SG 3EDEA 2D0GA 5HI5D 1OLLA 3DMMC 3VCLB 1XZ0A 5C1MB 1OAYH 1LGVA 4MNQE 1WAAE 2WINB 2CJUL 3QUMB 4F37F 5DVMA 3G9AB 3OF6A 5E2VL 1KTKE 2CRIA 5L7XH 4QHMA 4RFNC 1HKLH 3SE3A 5ERWB 1AGBA 1QQDA 5B39A 5J9PB 3CVIL 3DYMA 1KCVL 2JJUA 1UJTA 2YPLA 1YMME 5FKAA 4K23L 3MR9A 4WW1A 1YEEH 3VFGL 1FCGA 1X7QB 4AH2B 2VE6B 5I0DA 2DLHA 5GGQH 3TV3H 1YEGL 1NAKH 1G0XA 1MELA 3OB0K 5GGSY 5DJXB 1V3KA 4S1SL 5C07E 1RJZB 5E9DE 3VG9C 4ZXBC 3QJFA 3U6RA 4LLAA 2HT2D 5E70A 1Z5LB 3H9HA 3UO1L 3S7GA 3GK8H 2PTVA 1DBAL 4XTRC 4YE4L 2P8MA 1ADQL 4EN3B 1SJEB 5KG9A 3RWFA 1G7IA 4PJDB 5A2IH 3H7BA 5FO7B 2ADJA 2GJZA 4LKCA 2HKHH 4G42B 4M61B 4XC3H 5DUBA 4YXHH 5TQ0H 1N6VA 4KJPC 3KJ4C 4LQFL 3S34L 5I8CA 2BNQB 4GG8A 4N9OB 4UV7H 3ROOA 4NKQB 2X4NB 5I1DA 3TCLB 2PUQT 4LVOB 4PP2A 5F97E 2VUOA 3P9LB 3F5WB 4YHYC 5I8KL 5HYSB 1UG9A 4UB0H 5IK3B 1JPTL 3DRTA 4XCCH 4PJ8A 4I4WA 4RGNB 4BH8B 2XA8H 4NKOB 1G6RA 2VO5A 3HZMB 4P99A 1S5HA 3EAKA 1KULA 1I1CA 1I7RA 2AABH 5T1MA 2R2EB 1U3HD 3PP3H 4GRWE 3F65A 2NXZB 4G43A 3H42L 1KN4H 4AIXA 1XF2A 3RP1A 3C6LA 5EU6A 1M05A 3T0WA 4X7TA 3VXRE 4PV9B 3MBED 2PO6C 1FZJA 5F89A 4OUUA 1RIHL 2Y1VA 2EIBA 3TJHD 1D5MB 2DMCA 3RVWC 3VWJA 4UV4H 4QRSB 4WV1B 2FJGB 1TLKA 3VDCA 1B3JA 1C5BH 4AM0B 2X09A 2FJGA 3ROLB 1NFIA 3TNMA 5I75B 1NC4A 1CFNB 1SEBA 5E4IA 4JFFD 3MXVH 1KLUA 1BX2B 3RKDD 5BV7L 4FTVB 2DI8A 1MIEL 5L6YH 2DIAA 5C09E 4WI8A 4P5KA 2Q87A 4PJBF 1UEYA 4ZUVA 3ZO0A 3GJFA 4PR5A 1G7PB 4MD5B 3TO4B 5DJ6A 1MLCB 1N6QH 1LEGA 4BM7A 4K94H 4Q2ZA 3NTCH 3NCEB 4JJHA 1DSFL 4Y5VA 3EOAB 4PRPA 4QNPE 1QR4A 4EKXA 4XP5L 2FX9L 3A6BH 5CEYA 5D2NB 3RWJA 3GSVB 5C0AE 1VEOA 5F1NA 3X14A 4HHAB 1NMCC 5J6HB 4WTWA 4JKWA 4XRCA 1FAIL 3MREA 3MA9L 4DGIH 3L9RB 5FUOH 5GRUL 4GRLC 3HI5H 1T03H 3O4LB 4GKZB 2Q7YB 4WI7A 3O11A 1BVKA 5GGUB 4YDLB 5LAXB 3LKOB 1N3NA 1XGQB 3OKDB 2VDPH 5TPWH 4AQ1B 2VDOL 1F4HA 4HPYH 5HYEA 5DD6B 4NRYA 1R3IL 2R56H 3U4AA 4OD2A 5H94A 1IGJB 4Y4FD 4CU6A 4PJDF 2C3WA 1QNZH 2I27N 1T22B 3P4MB 2AEPH 4BQ8A 5CEXA 4LKCB 2VDKH 3NH7L 4C56D 4TVSa 4JZJA 5J1AB 2OMBA 2GSIA 3MFGB 4MJ4A 2A6KA 4HCRH 4W4OA 1KPUB 1MH5B 2ENYA 1CQYA 3C5SB 5DJ8B 1MCWW 4OIBA 5DD1L 3VH8B 1EX0A 4JFPA 3IS1X 3PQYD 3SCMA 3BGMB 4KRLB 4LQFH 4LU5H 2VXTL 4JRYB 5LCVH 5F6HJ 1X5LA 4L4TE 2ICEA 3RVXC 4F2MB 4PGBA 3WMSA 3TA3A 2ZKHL 2OL3B 4D9QD 1YPZF 2JELL 3UP1A 1CXLA 5J89A 1R3JA 4LHUB 3QA3B 4WJ5B 3V5DA 5BOZG 4NP4H 5D9SB 1CE6A 1KACB 3MLYL 2YD5A 4NPYB 2F53E 5B3NA 1XF2B 3ALWA 4XVJH 5EH1A 3DROA 2F9BT 5GS0L 5TE6H 4NWTH 5AEAA 5TDNB 3H3KA 5J13B 1UXSB 2EDFA 4DQOH 2N56A 2DQCL 2AK4A 2YC1A 4NRZB 3BGFB 3O8XB 4NYLA 3T0ED 1T7XA 4FZ8H 4X6BA 1F6LL 5DHYB 5KZCD 3CFKB 4ETQA 4ODWA 5C0AA 2W1NA 1NC2D 3DBXB 4PG2C 4JREB 5FYLL 3VFUA 1D5ZA 2X4QA 4XVTH 4HDIA 1YJDL 3LN5B 2GJZB 2XIDA 1F6FB 5D2LE 4R4NC 3L3KA 3N1QC 4X6DF 5A43C 5IJVB 3PQYB 1RI8A 4L9LA 5HHOB 1TJIL 3KDMA 2V17L 1JPFA 5C0GB 2XICA 2BHUA 5DEGB 2NLJB 5BS0B 4PYGA 1RK1A 3L3DB 1T6VN 5ILTH 2YSSB 4PLKD 2E6JA 4F7TB 1BM3L 2AV7B 3NZ8B 1AKJB 3LKNA 2P44B 4O58L 1QSFE 1J1OL 1KXVC 3HPLB 5DYOA 1QYGL 1RULL 3A6OA 4HIIB 5KAQF 3ARXA 3MRMB 4JY6B 4DKFH 4NKDB 4ZUTA 2P5ED 4XP5H 1J88A 4UBDC 1R3HA 5HGGS 3MRIA 4GT7A 1NEUA 3V4VH 5IBLD 5FKAB 1WJ3A 1V05A 2P46B 3BI9X 4DGIL 4XNXH 4ONFH 2FX7L 1CDCA 4LEOB 1QD0A 5C07D 1SJHA 3WHE0 5DUPH 3QIBB 4XP1L 4N0CD 1M7IA 4NUJA 4PJBE 5C7XH 1BZ9A 3ES6A 2ADIB 4M7ZC 4WU7A 1BLNA 3ARGA 1AJ7H 3TPKA 1WF5A 4J1UB 2UZIH 3LQAH 2BVYA 4XNZB 2A0LD 4AK1A 1KIUA 1QVOA 2O93L 3CJJA 3GIVA 5KSVB 4XCYB 3PJSB 4OZHA 3NIDE 4OM1L 4J3XA 2VDKL 3NH7H 5DEGA 1T2XA 2H8PB 1HNFA 2R15A 2DL2A 5B3JF 5FYKD 2G75A 1A3LH 2VZOA 5MENA 1A6ZA 2D7MA 3G5ZB 5BO1H 2B2XL 2AJVL 3PWJA 4HULB 5F7HA 5L9DL 1F42A 4XNYL 1RUMH 1JYNA 3VFMA 2C1OB 2B1AL 5D93C 5FYKH 4KK8D 2ZZUT 1OGTA 2Z0BA 2QHRL 5IMMB 4N1HB 4K8RL 1GC1C 3QG6A 2VAAB 4XPAH 1PG7X 4RA0C 4PJ9A 5D2NE 1WZLA 4HGMA 2A9MH 4KDVA 5D1XA 4MQTB 1I3RB 3OG6B 4L9DA 1M7XA 4JFHE 1MFAL 2Z91B 4O2FA 2F5AL 4HBQA 3RGVB 3RWEB 4HS8L 1AH1A 4ODXB 1IQWH 2DDQL 4TUKH 3OKNB 4YPGB 1YMMA 2BHZA 2MMXA 4WUKL 2VDQL 3FQTB 2GAZA 3UTQA 2QQLH 3WN5C 2DYPB 1OTUD 5DWUL 1BIHA 5L88L 4X4XB 5DJDB 4PJGB 2OX5A 2H9GA 2OQJA 2BY2A 5CJ8A 4LSRH 2DM4A 4OTXH 5FYLH 3W9DA 4U2YA 2NTSP 2NR6D 5FM8A 4JZNB 3O4OB 4QT5A 5T5NG 1ZANL 4GAGH 3I6LD 3N85H 5JR1H 4NQXA 3MMEB 2ZUYA 5CIPB 5DMYA 1CBVL 5EU3A 2V17H 1F90L 3U36B 5KANG 2APTA 1Y0LB 3IKCB 3V7AG 1E6OL 3FQXB 3D3VA 4UMGA 3RVVC 5MEPA 2D4DA 3UTPE 1MQKL 3FQNA 1I8IA 1I9RH 4R8WH 4DGYH 5GIRB 2EKSB 5FK9A 3DX7A 1MVUB 4ORGB 1HILB 2XWJB 4M43L 2APWA 2B7DT 2CLZA 2ARWA 3EYVB 3GMRA 1W2KT 3MLSH 4XVUD 1T3FB 3ZYOA 3E6HB 3Q6FB 3IU4H 3EYVA 3GMRB 4MA7H 5D8JL 4XCNA 3ULVF 4NKMB 3HC4H 3MNVA 3MRQA 5KS9A 1YPZE 4MDJA 5MEPB 4CVZB 4V1DB 4H1LH 2VLRD 4R4BA 4XNMB 4Y19E 3RHWF 4YDKH 4HGWB 3KPOB 4R97C 1T21B 3X13A 1HHJB 4KJWC 3QI9A 2DI7A 5K9JL 4U6HA 5I1LB 2FZ3A 4S0TD 1GGBL 2SEBA 4RISH 1TENA 3U7YH 4TN9A 1MAMH 4WGVB 3PGCA 3QO1B 3SO5A 5IESH 1OTSC 4LCWA 3NGBC 1NGQH 5DD3H 4MD5A 2IG2L 1A14L 1RUQH 2X5PA 3I02A 5D2LB 1FQ9C 1UJ3B 3TBTA 1JGLL 1VEMA 4M61A 3K0WA 2NY5L 1C8PA 1KOAA 3P4OB 1RURL 2YD9A 3HI1A 2D7PA 5DJYB 2D9CA 8CGTA 4HKXB 3MLVL 2NY7L 4ERSL 4G80A 1PG7L 2FBJH 3MRRA 4OIIL 1NUFA 1RUML 1OAKH 3HUJE 1ZHBA 3KPQB 3VRJA 3O45A 4M1GH 2H6PB 4JRXA 5DJAB 1WBXB 5EU4B 1GGUA 2QHRH 3HE7C 4YC2B 1UA6H 2HRPL 4FQ2L 1X5FA 3KPSB 4I0PB 4HAGA 4M4PA 3ET9F 2Y72A 3ARFB 3NPSB 4DN3H 5CKAA 5SV3A 4DZ8B 1IBGH 5I75C 2J6EH 3MRMA 4Q9RL 4XPHL 1V3JA 1WISA 3WFBL 3U9PL 4Y5YA 4OZFA 3H3BC 2CGRH 1C16A 3MFFB 2PO6A 1AR1D 5F93C 3RJQB 3FFCE 2BMKB 1U0QA 3L6FB 5IQ9A 4WUUB 1ZOXA 3V5KB 4XP9H 1K6QH 3I6GA 2G75B 3UJIL 4JJ5B 5GZNC 3M1BA 1B9ZA 5C0FA 2X1OA 2DD8L 3MNWA 3PHQB 4LDLB 4D9LL 3L3KB 5C3TA 4XWGH 3GI8L 2AEQH 5BZWA 3MNWB 3UJJH 4X6FB 3CX5K 1BQHG 5JOPD 2ED7A 2WIIB 4M5ZH 3QZWA 1BOGA 1MCSA 3H9SE 5ALCH 3SBWA 3QEGL 5J1SC 2BVUA 1Q8MA 1DN2A 4J4PC 3QRGL 4OLVL 3IF1B 1XH3A 1CI5A 4G3YL 1MCNA 3WKNA 4WCYL 1ND0A 3FRPA 5IM7A 4PUBH 4XAWH 3VFVB 4JPWH 3DROB 5EC2A 4ODVH 5GQBA 5E2WL 5IB4A 2Q76B 3MBXL 4HIEB 2M2DA 2X2YA 1IKNC 2FYYA 2QSTA 4NO2A 2QQNH 3MRIB 1JPSL 4QHNB 1VFUA 4P23A 4HC1L 1AGDA 2FX8H 3V0AC 1ZGLP 1NL0H 3LSOB 4OGXL 1FRGH 4TTGA 3RU8H 3SKMA 1QSFB 2BSSA 3TJEL 1IMHC 4HG4K 5I76B 3NCBB 1ZKAA 1WZ1L 4YDKL 3OB0H 4UTAL 4XAKE 5GXBB 1I75A 1MCWM 4JRYA 4ZPTA 2CMRH 5J1TC 2Y23A 5HHOD 4L9LB 2W0KA 3PQYA 5JO5B 2X9WA 5CIPA 2IFFL 3RQ3A 3GSUA 3MROA 5LG1A 4ZOEA 5I1JH 2X4OB 4PG2A 3Q3GB 2YD7A 4B41A 2IPTH 4KHXL 2DICA 4ZFFB 4NIKB 3BT2H 1PVHA 2L4OA 1A14H 4PTTA 4RWYL 2VQTA 3EDDA 3RRQA 3T3PF 4I3GA 1T89A 4EI6A 4QY8A 2CDGA 4KI5C 3DXAB 3MOAL 3IAGC 3QWRD 1DL7L 3KPRD 4OZFH 5DRXA 5DI8A 4OF6A 3J8F7 3VFWB 3F12B 1VHPA 3VG9B 3EGSA 1OM3H 3GMNA 3ULSA 2RB8A 5IR1B 3QB7C 5HHNA 2R0KH 1FORH 3CMOH 3BPLC 2D7NA 3BESR 3G6DH 5FYKU 2P24B 4XPFH 1R3JB 1I3RA 4LHUA 4FFYL 5KAQG 1EEYA 2DTML 5IVXE 3C6SA 2GITA 3ZDXF 2EDNA 4FQ2H 4OZIA 3IDIA 4IBLT 4MA8H 5F1NB 4F7PB 1I1AD 4LLWA 1CTOA 1MVUA 1N64L 1YA5A 4KUZH 1JNHB 1IEBB 4LSVL 4KJPD 1JNNL 2IBGA 4ZDHB 1VFBA 5EU7C 1MHHB 4ZG1A 4QGYA 4JFZL 4OKVA 5AWNL 5A1AA 1DR9A 3HR5A 4HWNA 5GGSB 1HSAA 5DMIL 1JPGB 3B9DA 1JPST 1FGVH 3F58L 3C60C 4K71C 3QFDA 3ZDYE 1T5XA 4RIRA 2E7MA 3P4NA 4PJAA 2IANB 3GI8H 3QWQB 1T22A 5SX4H 3MODH 2H3NB 1U3HA 1VFBB 3UJJL 1QFWI 4WHTA 4M5ZL 4KTDL 4QYOA 4G9FA 4RFOL 5EO0A 2OMNA 4Y8DC 4X8JA 3S37H 3QUXA 2I25N 1J5OH 3QRGH 4OLVH 1CIDA 1S8DA 4V2BA 2VDMH 5I9QB 5I1HL 4M7LL 2EYSA 4LF3B 1KCVH 3QUKA 1IKNA 3QDAA 1NANI 3RGVA 4Z0XA 1KENL 1QRNB 2XTJC 1LDPL 4XBEL 3MREB 3AB0C 3L9RA 3S3JA 4PJGF 1YEEL 3PWUA 3EDFA 1UKSA 3FN3A 5E56A 5EOQH 3X14B 2EZ0D 1A6VL 4M6NH 5FYJE 3VXRB 2Z8RA 4C4KO 2NW3B 3UJTH 5IVOA 3WKMH 3PWLA 3I3EA 4BH8A 5KVFL 2AXJA 1KEMH 1PZUB 1F3JB 4H0HB 4JDVB 5FECB 1UB5B 1TETH 1NJ9A 1CFVL 1FCCA 4V1DE 2HAZA 4YHIB 2FR4A 1CGYA 3G5ZA 4XHJC 1NLDH 3ZKND 4TULL 5AYUL 4XHQA 1OW0A 3KLAB 1KYOJ 3GJFB 4LEXL 4H0IA 4Z8FH 3GSUB 5DHXB 2IC2A 3S36L 1QFWM 1OTTD 5C0GA 1UENA 5FUCC 3HNTH 2DS4A 1DQDH 3SE8H 4XC3L 1FPTL 2AK4D 4Z9KB 4IMLB 4BFEA 2VC2H 4NQTA 1HSBA 1JRHL 3T4AA 4ZPVB 2A83A 4JANB 5JMOC 2DKUA 4Y1AB 3LN5A 4C56E 1QPXA 3X12A 4U1KA 2B0SH 3KYMB 3O41A 2VLME 3IFNL 2LE9A 4HK3N 4NC0B 1T1XB 3HFML 4M6MH 3CX5J 1KFAH 5C08D 3R1GH 4NO2B 4Z7WA 4XCCL 5KBNC 4O51A 1YMHB 5DR5H 2NYYD 3O4LE 5F71A 1I7ZA 1DBMH 5IB4B 3TWCL 1IGML 3P3YA 4KV5E 5T3XE 4WWKC 1IAOA 5F1IA 5DHVH 2IBZY 3PWVB 5E9DD 4ESKA 3OHXB 1EGJH 4LVNC 4QHUB 3W11D 3P0YL 3LKSA 5ALBH 2X89A 4S11A 4HFUH 4ZUSB 3SDXF 5DXWA 3L5XH 5EO1B 5BZDB 4U49A 1U8LB 2BHYA 3O6MH 4MA1C 4QF1A 4JKKA 3QJHA 3D0LA 3HC0B 2EDWA 3RKPA 2X4OA 4PGDB 4L29B 1TJGL 4FXGA 2YSSA 5HYSG 4MAYD 4HZLB 2V2TB 1ZSDA 4QHLA 3OKOB 3NPSC 3QPXL 2R2HA 3NOIA 2P8LB 4YK4B 1QG3A 3G5VA 3I6GB 2YKLH 3PNWA 3FT4A 4PJHE 1FL5A 2VIRB 4D0CA 5L6YL 1E28B 5IJKA 4V1DD 3OKKA 3BJ91 1Q72L 4XCYA 3UX9B 5GS1C 3MUHL 2VLKA 1EHXA 4E41E 2VZ3A 1IGYB 4OQTL 2NY3B 1JWMA 1KCRL 3VXMB 4P4RB 3LEYL 5DMGC 5CP3A 2HJFA 4P59L 2EC8A 3L3JA 4JO1L 3IU3A 2EDKA 5CZVH 3GSQA 1YYLL 3EHBC 2VDML 1T83C 3KLSA 1CDHA 3FB8B 3A6CL 3JVGC 4MXVE 1I8MA 2WWKT 3MA9H 2ZUQC 4D94A 2DQFA 4ODSL 3KPQA 1FN4B 3VRJB 3EJYC 1F00I 4NQCA 1T03L 5DRNA 4D3CL 4JPKL 2DQFB 4YXKH 5C08E 3QXDA 5J6GB 1NLBH 3V5HA 4I0KA 4RA3A 2ED8A 1AD9B 4WI6A 4HMDA 2HLAA 5IHUL 1MWAA 1ZGLB 2LABA 5CSZB 2Q6WB 1MPAH 2VDNL 4FQIH 4H25B 3LV3B 1BZ7B 2OR9L 1R3IH 1ZS8A 2X1XR 4P3CL 2VQ1B 3BSZH 5F7LB 35C8H 4PJ5A 1XGUA 4AG4H 2IPUG 4KJYA 4MA3A 4LLDA 2IMNA 2YXFA 4TULH 4L8CB 1QPPA 5ACMA 4MMZC 2B1HL 3MV9A 2D0FA 2XY2A 4ZS6D 5AZ2L 1CD1B 3QQ3A 3VMOA 1F5WA 3ZE0E 4CMHB 4KMLB 1BFVL 4XPTL 3Q48A 2NX5B 1KT2B 1AY1H 1CLYL 2ZSWB 2VC2L 1KJ3H 3RL2A 1BD2B 4G6FD 3ZT6A 3KPNA 1NFIB 3RDTC 2CXGA 4ZNEE 1N2RA 1EJOH 2PETA 3RHWK 1L7TH 4MJID 2EYRA 4JVUA 2ZKHH 3MLTA 3VXPB 3JZ7A 4KKNA 1N4XH 1BGXH 4GMSL 3BXNB 3O9WB 4YAQB 3HZVB 4P2OB 4HLZH 4M7KL 4RMTA 4WO4D 1UB6B 1CICA 3DVGA 1JZ4A 4HIHB 2R4SL 4NP4L 5EZIL 2B4CC 3MV9D 5HHNB 4GRWH 3MUGA 3P73B 5L2JA 3FQNB 1CE6B 2HFFB 5IEHA 1XGYL 1UZ6E 3B9KB 4XVJL 2RQ8A 1HI6A 5GS1B 4J8RA 2MCPL 3RA7H 3IXAA 4P46A 4QYOB 4G8FB 2H2PD 1ZHLB 2A1WL 2VLJA 5EC1B 5DK3A 4BELD 1OP5K 2QQKL 1NMAL 4RNRA 4XCEA 3HZVA 4P2OA 3LRSB 4HWBL 3T0VA 2Z9TA 3SEPA 4AIOA 2OL3H 5F1OB 3WD5H 4ZTOL 1H3WM 1DQLL 3ROOB 3OGCA 5DJ8A 1LP9E 3RBSA 4PRIA 3E0GA 4X83A 4KK8C 4L4TD 2GJ6A 4F9LC 4KJQD 3K7UA 4OJFH 1UH3A 1VFMA 2EH8L 3WUWG 4GRWF 12E8L 1T5XB 2ORBL 1RU9H 4I2XA 1XMWA 7FABH 2P8MB 1PEZA 3MV11 1MHPH 4ODHH 2UZYB 3MLXH 3SE9H 4P3WA 5CJOH 2W60A 1UM4L 2KBGA 4EUPB 2DTSA 4EOWL 5CD5D 4P59H 1J0ZA 1CL7L 1XEDA 5IKCA 3RIAF 5ADPL 3JUZA 2W65B 4GLRI 1N5YL 4PV9A 3PWPA 1FFOB 4OZFG 5EUKB 5AUMB 5KSAC 4LSQH 1T5WB 4LP4A 1B88A 3O4LA 3UTPD 4Z95L 1CTNA 1CZ8L 4IRZL 2NXYC 4WWID 3TIEB 4U1JA 1ZMYA 3IDXH 4GW1A 4D3CH 4DN4L 5EULV 1NDMB 1S5HB 3CD4A 1NKRA 4JFDD 1ZA6A 4Y89A 4LPWA 1VGEH 1JF1A 4JO3H 3U4EB 1TVBB 3O6FB 3M45A 4Z7UB 3UZVB 4YFDB 4KZDH 2ITCB 1IE5A 1C5DB 1REIA 4ODTH 2OJZH 4NQDD 5HDBF 5C08B 5A2JH 1ZVSB 3MGTB 1NFDF 1OCWL 2AAVA 3MV7B 3LS4H 4OV5A 4YJZL 3TZVA 1H8SA 1M6OA 5K9QI 1W72H 3B6SA 4MAUL 4YHZH 3EFFB 4YE4H 3BZEB 4XVUC 3HAEA 5GZOD 2BVQA 3GSRA 4KZEH 3QG7H 1NCDH 4L5FL 5C6PB 3V9FA 3SDCD 1CK0H 4BQ9A 5C86A 2EIZB 3KNBB 4J12A 3RGVC 4ONHA 3BKYL 2B2XH 1FZKA 3D5OF 4RRPA 4ZFZB 2JIXD 3O4LD 2EDTA 1QR1A 4L8SC 2I9LB 4DVBA 4LIQL 3P9MB 4ZDHA 4HKBB 1T4KB 5DK0B 3BDYH 3MJ8A 4WI5A 3SKMB 5C07B 1ACZA 4OCXH 5HDQL 1G9NL 3T09A 4L8DB 5ELIA 1B0WA 5T1MB 1UC6A 3LHPL 4KKAD 1A1OB 1T1YB 5DT1L 4C56B 4AIZA 3DYPA 1KLGA 3ARBC 4LSUH 4PIRF 3C60A 3U7WL 2BNRE 1IQWL 2DDQH 4TUKL 4OCWL 1SM3H 4PJAE 4A2MA 1OGAB 3NIFE 1IC1A 1S7WB 2CJUH 4TUJB 1SVCP 3QXDB 3CGTA 1XT5A 4PRAA 3LEXA 2FJHB 5JOFB 4UU9A 5D7SH 4PTTB 4JJ5A 3VFUB 3VDBA 2XG4A 4LCUA 5D7KE 1NGPL 5CINL 3SJVA 2V9RA 3IXTB 4PJFB 3C08H 1MI5A 2PW1A 1EFXB 3C2AL 3QUZD 2GJ6D 5JPMA 2VIRA 3ZDXE 4JRYD 2P49B 3T8XB 5C0RL 1WEJH 7FABL 2BSRB 1OHQA 3PDDA 1SJHB 2Z8WC 4CVZA 1P4IH 2HLFC 1S7QA 1A64A 1IARB 4P0DA 3PIQB 4FQHB 4TNWK 3D0VB 1UM4H 1U8KB 4UIKL 5MP6L 3GSNL 3N06B 3D18A 4QHKJ 3QO0A 1X5JA 1F02I 2QLVB 3CSBA 1U8QA 4NNPH 4YR6A 1KLFA 2R2BB 4K2UL 3UO1H 4Y4KA 3AXLB 2FIRT 1ZEAL 5JW4M 4CADA 3T0BA 1W72A 2IWGA 3HI6H 2FHBA 4ZNCD 1NC2B 4IM8A 5F7YC 1FVDA 4E41B 2C9AA 2XA3A 4MCZA 4Y5VC 4FXGB 3ME0A 2V5YA 3VI4E 1TNNA 2X05A 3CC5B 1YNKH 3RDTD 5IF0A 1J8KA 3P4OA 5CBAB 5EB9A 3GKWL 3FFCB 4EBQH 3THML 4LCCC 5FHBL 5DMJB 4HPYL 1WICA 4RISL 1MJ7H 3PP4L 4L3ED 4NSKA 4YDJB 2HT3C 1FG2A 2YA1A 4JFXB 4R3SB 4U1HB 4B50A 1BQHA 1M6OB 2VR9A 3P4MA 2FATH 4LP5A 5DFVD 5DD3L 5EOTB 3GZKA 3KAAA 4ZOBA 5DHYA 3QDJB 1HIMH 1E4XL 4UOJA 1WWBX 4MAUH 1IAIL 4U05A 5FCSH 1JFQL 1RV6X 5DMKB 3RNKA 4H5SA 3MRDA 4CN1A 4Q9CA 3C5JA 1G7LB 3QNYB 4OF7A 5JW5A 4Y16B 3CCHA 1S7UB 3UDWC 4NQUA 2CDEB 3WLBB 1J1XL 1ZXQA 4N68A 4LU5L 4J6RH 1UWEH 4PLOB 3QR2A 2Q7YA 4GKZA 4YHPB 5J0BA 3NCFB 1RIHH 1JGVL 1AXTH 2H1PH 4WFGD 3W2DH 4XMKL 4L3AA 43C9B 4U7SA 4Q9QL 1ACYL 4WEBH 4Y4HD 4MJ6B 5JLZA 1F3JA 4JDVA 1J11A 2JCCF 3SDDD 1L4IA 3GMLB 4HUXB 5HGAB 4OLZH 5DJ2B 4FN0A 4UT7L 3U0PB 4PRPB 4MNGE 1G7MA 4HUVA 2H26B 4PREA 1INEH 1OB1A 3D3VB 1G0YR 1EMTH 5C9KA 4OCNC 3O9WC 1DQML 2VH5H 1UZ6F 4ISVA 2ICCA 2F5BH 1BP3B 5TE6L 1PY9A 3P11L 2BOBA 5HYJD 4BKLA 5FDWB 1FFPA 4G8GE 2C3VB 2MQ0A 1I7UB 3BZEA 3VWKA 5E99L 2R0LL 3IDUA 3JV0A 2B20A 4HXBL 1LP9A 5IWLA 3SDYH 1K4CA 1N7MH 2NZ9D 3DIFA 1DBBL 1NFDA 3DX6A 1A7BA 1LP9B 1X5AA 3KPMA 4IRSC 4PJAB 1JYWA 5CINH 4XP6H 2GCYB 4YDJA 1FNGA 3F7VA 3IVKB 5F3BB 3BX7C 2P5WB 2VLJE 4ZXBA 2ADGB 3GGWA 1BIIB 2MKLC 1EO7A 5F3BA 4PY8I 3QDGB 4FNLL 25C8H 3ETBF 4JR9L 1E4KC 1F97A 1HYRC 3TBVB 4FQXD 3L3GB 1RVFL 4TSAH 4O2FB 3ZKMC 2VDOH 5CZXD 3HB3C 1A6UL 3B9KA 2R39A 1FDLH 3ZYZA 4IS6B 2OTPA 4BSWB 5C0DB 4JN2A 5D2NC 1T5WA 1RULH 1S7SA 1XF3A 2JF1A 3MBXH 5CEYB 1R3HB 3OB8A 3BH9B 3L95B 1BD2D 1H15B 4N1CA 5FCUL 5JHDD 1MRDL 4FMKA 2HTLD 5ICXA 3GB7A 4LVHC 4WHCA 1BBJA 3VJ6B 2X4RA 2QADB 32C2B 2AXGA 5C3LD 4MQXD 4GXVH 3MNZA 3B3IA 5JPNB 3DMMA 3BP7B 3U0TA 5C6WH 2V6HA 3RWIB 4LSPL 5DRXB 3DX8A 3JXAA 3HNSL 1J0HA 2CKBH 1EFQA 1JHTB 1VEPA 4EN3A 3LQZA 3QHZH 3CLFL 4JFHD 2OR7A 1Q9OB 2YUVA 2XI9A 1MAKA 4Y2DA 5EOTA 4NQXB 1TITA 4I0CC 1KCUH 3D9AL 3REVB 1J0YA 2UZXB 5D7IA 4L8CA 1MNUL 1W0VA 1C08A 5DK2A 3TN0A 1E4XH 3LMJL 1GCFA 2J8UB 1A5FL 3DUUB 3QDMB 1YPZA 3WFEL 4NO0B 4U1NA 5HVFB 2CO6B 2CDGB 2WV3A 4PGZA 3T0EC 1XF1A 5HTSA 1E0OB 1NEZA 2YD1A 2CLVB 3IJSB 1UWEL 3BN9D 2FJFA 3I6LE 3WN5B 4X0KA 3RNQA 3QIBA 1H3XA 3F8UB 3MJ6A 5BW7C 1AIFB 1Q9WB 4GG6E 3CMOL 4O5LH 4EQ3A 3TO2A 4XPFL 4Q0XH 3QUZC 3G6AB 4K8RH 3LEVL 3D85D 1Q0XH 4Z18A 4MA8L 2XOTA 2NMSA 3WNOA 5FO9B 4X6CA 1N64H 4HK0A 4PLKC 4UQ2B 4NM4L 2A73A 1JNNH 4ZMAT 1MCOL 2C1PB 4YUEH 3IJYA 5B38B 5LQBL 3PG2A 5AWNH 4UDTA 1Y18A 2F5BL 1OAUH 3BD5A 4PRNB 5TDPA 3V6ZB 3EYFA 2EDYA 1TQCB 4X6CF 3UBXI 3FHQA 4TOYH 2Z93A 3D39E 3INUH 3OXRA 3ARGD 4KROD 1NBYB 3FN9A 2VDQH 5E7FA 4QHNA 1J1OH 3CPLB 4NNYB 2MFNA 2RHEA 4HWEL 2DBLH 4HDIB 4QEGA 2NTFB 2WBJC 3QNXA 4OV6F 3SDYL 3HTLX 1S9WA 5F9AC 4JM2C 1HWGB 1RZ7L 3GBLA 2VLLB 1HEZA 1F58L 4JAMB 4Y2OA 3GBML 2P43B 5JR1L 1HCFX 3LDBB 4XNXL 2F54A 3ARDA 3EJZD 3FQWA 3IDMB 1PLGL 1P53A 2R9HD 2NXZD 2ITDA 3QIWA 1J5OL 4DOHE 3LY6A 1J0JA 3ZTJH 2P1YA 3LKSB 3RAJL 5FDYA 4K07A 4TSAL 5C0IA 5H37G 2Z4QA 4WY7H 3NAAL 4HGWA 5CD3A 1EVTC 1MJ8H 2R8SL 2R0WL 4RAUA 4LMQE 3MJ9L 1MFNA 2D03H 5E8PB 1ZLVK 1LD9A 4Z7WE 1F4XL 4MJIA 4XNQA 2WWMD 5CBEB 5L2KB 4I48A 1ZT1A 3VXTB 3SKOA 3UMTA 4HX1A 2FEEI 1WCBA 2Q8AH 5MI0B 3E3QC 1GGCL 1JBJA 4PJEA 1WFNA 5AAWA 4C56A 3ZE1F 2OR8A 5IP4A 1ZLUK 4YH6A 3FO0L 5DSCB 1VPOL 1FL3A 4NDMA 1TTFA 3SDAA 3E6FA 3DMMD 4Y4HC 4D0CB 4P23D 5FO9A 5JHLL 3AUVA 4OGZA 3BUYB 5K9JH 4D0BA 3G5VB 4RDQF 4FTVA 3K1DA 1MAML 5IJVA 3DSFL 1QBAA 4JRXD 4P46D 1YY8A 3HNTL 4XBPB 1ZV5A 5D1QA 1TJHL 3MV7A 2W38A 1U93B 2R69L 5I2IA 2H6PA 1AE6L 2NY3C 5EWIL 3CAFA 4Z7QF 1RMFH 4LSDA 1MY5A 3FOMB 1J8HA 4I3SH 2EIEA 4PJBA 1WUNT 1DE4A 1I1FB 2YD6A 3S36X 2OCFD 2Y7QB 3WFEH 1KF9B 3HFMH 4NQED 2NY5H 4D8PB 4X7TB 2WM0A 5A16B 4BZYA 4HS8H 4Y5XA 3TBTB 4OQTA 4JFEB 3SDAD 4JN2B 5AYQA 1KELL 2X9XA 3O3DB 3PWUB 5EZJB 8FABB 4JM4L 4QRRE 1IGMH 4GAFB 3LN9A 1Q1JH 4LAQL 1G9EA 4YIQA 5KS9B 1OAKL 3DTXB 2HT2C 2HMID 2E9WA 5GHWH 1C5DA 3T4YA 1H3PH 1ORQA 2HFGL 1CICB 2LQRA 1MFBH 4OTXL 4XTRD 4L4VA 5D1XB 4N0YH 1Q0XL 1L0QA 4PPTA 4E41D 2ENSA 4HT1H 4QTHB 4RQQB 5D6CA 4ORGA 5I1DB 4DN3L 4LNRA 1FJ1A 3WIHA 1NBVL 4AEEA 3MRCA 2YZ8A 3UTSE 1RD6A 4HC1A 5DJ6B 5FKPA 4TOYL 1X5IA 3RTQB 4IDLA 1CT8B 1K5NA 1V7ML 3KWWB 4PJDA 5E95B 2BRRH 2VITB 1KPUA 1HSAB 3SGEI 1NGXA 4HH8A 4W6XB 1R5WB 3OJDA 3DJ9A 3EO1B 4JKMA 5C0BA 5INCB 2L0DA 1S7XB 3HS0B 2VOTA 4KJWD 5E9DB 5LKNA 2F53A 3SQOH 3RPIB 4GUPB 2YK1L 1C7TA 5FHAH 4OZIB 3BP5B 3GI9H 4PY7A 4P48A 4KKBD 3TJHC 3RVWD 4QXWA 1AGCA 2EDJA 1I9EA 1ULVA 2VERN 4OFPA 1I7RB 4YZFE 4YHPA 4O2EA 4WCYH 5FYJL 4DZBB 4KHTL 4QOKE 4RZCB 4K55A 1TMCB 1P6FA 5E2WH 2EDLA 3QPQC 3UROR 1A3QA 3BPNC 4L4TA 1GL4B 4L1DA 5HJ3A 5EU7E 2YHGA 4NUGL 2I9TB 4NZUH 4ZYKB 1A7PH 1DDHB 1R3LB 3DHMA 1QLEL 2OR9H 3W81A 1EO5A 3I2CH 2EYTA 1URLA 4YBLB 2XTJB 3QEQD 5JXAL 4CMMA 1JI2A 5T3ZH 3UPRB 43CAA 3QP3A 5BQ7B 3OKLA 1E28A 3P0VL 4ZUVB 1RIUH 5KN5A 1LEKA 1QKZH 4MNQD 1AO7E 4HFWB 2WLYA 3KDMB 3LH2L 3DSFH 2DMKA 5IMMA 3GNML 4FQXB 1RZJL 4I3RH 5IEKB 1A9EA 4WIQA 3KPSE 3TGXA 1JIBA 4X9FA 3O3AB 5T1LA 1TVDA 2P5EB 1DE4B 2ZUSA 4HGKC 5FV1L 1AGEA 3BT2L 3LIZL 4OBRA 4C59B 4DKEL 2OS7A 2BVOA 5IVNA 5MEQA 1ONQB 1CGVA 1BGXL 4P23B 1NGZA 4WW1B 2XWBB 2JJSA 5EA0L 4M6OH 5DA4A 5L2KA 1P1ZB 3PWNA 4CMHC 1FFNB 4PRBA 3W0WE 2WBJD 4TUOA 1LD9B 3DV4A 3V6OE 1RZIA 3S4SB 1CLOL 2WLZA 2XY1A 3EGSB 2AQ3A 2Z31B 3LKRB 3QAZB 3BWUC 4NHUA 1UWGH 3TBSB 1BQHB 3JV4B 1MFBL 5C09D 4YX2L 2DQGL 1DBKH 3ARPA 1MHEB 3RA7L 2NNAB 1Z0NA 3Q5YA 2BY0A 3IDMA 1UZ8B 4KQ3L 4J3OC 5ICZB 1OT1A 3SY0A 1O5DT 3Q3GA 2VKXA 4RSVA 4F7TA 4PBWD 4FFVC 3DO7B 3D25B 2XYCA 4YGVB 4OBSA 3HNVL 2OK0H 5C0AD 2ZG2A 5SV4A 5BOPA 4JO4L 4GRWB 4NNYA 3VXQB 3F58H 1MH5A 1ZSDB 3IETB 4R96A 4Y4FB 4ODVL 5E5UB 4NBZB 3BDXA 1EA9C 3VRIA 3V4UL 3H3PH 4HQQH 4BUGA 4HJGA 4PTUA 2IGFL 4A2LA 5JW4Q 5E4EB 3CDCA 3NFSH 2EDOA 3GJEB 3AU1B 3MODL 4HC1H 4M7JL 1MCRA 3D2UA 4C83B 1RZKC 4YHOL 2DOCA 4OM0H 4PJ8C 3W9EB 4J3SA 4ZUUB 4YBHA 4L8BA 5J3HD 1CL7H 4RMWA 1CXKA 4WRLA 1FNLA 2AJSL 3RX5A 3S37L 1ZWIA 3QFJE 4X9GA 1FNAA 3OHXA 4QHUA 4QRTA 3RWHA 2ZSVB 4AH2A 4OD3H 3TBWA 3FCTA 1UM5L 3BPCB 5FYJH 2PCPA 3RIFK 3MZGB 1Z3GL 5F9OH 4CVWA 1BWMA 2EYSB 2IFFH 5CLWA 1U8LA 1EXUA 1OP5H 3WFHB 3WXWL 3JBG7 2E6PA 3KGRA 4LHUD 5E08H 3MBEB 2IADA 4K3GA 5JXEA 3UJTL 1NDGB 2Z31A 3FB7A 5E8NB 4F7MB 2X4SA 3S3PA 1MJUH 4AT6A 1OCWH 3MGTA 5I1CL 2X4UB 3QIWC 2H2SD 3ARYA 5D2LF 4JFFB 4HIJB 4HUWB 4GXUN 4QRQA 3DURA 4G9DA 4L8DA 2C26A 4EJ1C 1OSPL 3G9VA 5E9DA 4JFEE 4OCMC 4XXCA 2WK2A 5DEZA 4CBPA 4XX1G 3SE8L 2FEDD 4GKNB 4FS0A 3FN0H 1QBMH 5EUOB 5T1KD 3ZKXC 4ONGH 5B4MD 4LL9A 3MACL 1U92A 3RWGA 3DV6B 4GMTL 1FZKB 1J05A 4LIQH 3QSKB 5FYKE 3BYYA 5A3IC 3IDIB 2AEIT 4RGMB 3OPZH 4MWFB 1U8MA 1MRCH 1AO7A 1KFAL 3E6HA 3Q6FA 4R4FL 3ULUD 4OCXL 1I8KA 5JHDB 5HDQH 1INDH 2PTUA 1G9NH 5LAXA 2DWEA 4GKSB 3TWCH 3CDGA 5TH2A 5J12C 1ZHNB 2E7LC 3DMMB 3D3VE 4D0DB 4UT9H 4MQ7A 5HHPB 5DJ0B 5BRZA 4LLMA 3BGAA 5H94B 3VGFA 3TT3H 3HA0A 3P0YH 3S35H 3MV8A 3MLWL 1WZKA 1X6LA 3I6KA 4JZOA 4KDWA 2CKNA 5JQHC 5HI3D 1MEXH 3QIBC 3ULVE 3EYSL 2ADGA 3GGWB 1BECA 4BZ2L 3OGCB 3DRQB 1CE1L 2V5TA 3RUGA 1T89C 3C5ZC 2FB4H 4OZIF 1LEGB 4QOKA 5D7LB 5EBMA 4O4YH 5F8QC 2GW5A 3LKPB 3CK0L 5F9DC 3MRBA 2CLRB 1AD0A 2VL5A 2GK2A 1GPOL 3DIFB 4BK4A 4M8QB 3CDYA 3GM0A 3SDDC 3UXFA 5E24E 2B39A 4M9PA 4K7PH 1MUJA 4OI7A 3NCYS 4NO0D 2HWZL 5IBUG 2W59A 5C6TH 1QSEB 3ZE2E 5DC0A 1UJ3C 5C0RH 3ILQC 3VXUD 5EOQL 1AQDA 4XP4H 5C0BE 3UAJD 1JYXA 5JDSA 3MUGB 4Y2DC 3ARWA 1W0VB 3ROLA 5L2JB 4MCYB 5DURD 4M7JH 2HA1A 2BC4A 1CLCA 3D2UD 3ZKNC 1T0NA 2VTFA 5MP6H 4Y1AD 2V5MA 4MMXC 3VI3F 1VFOA 4G8IB 4PB9H 3TM6A 1G7MB 2AJSH 5DJXA 3AS0A 2LAGB 3RZCD 1HXYA 4NNPL 4ENED 4HUXA 3K4DA 3WLWD 2IBBA 2NY2D 3SE4A 4OLWH 4U1MA 4OKVB 5TDOB 4LGRB 4LSSH 1ETZB 1IEBA 3ARFC 1CCZA 4U6VL 1U36A 1DQDL 4Q6IC 3LKQB 3GM8A 4JPIB 1JRHH 3DUSA 4M62L 4OF0A 4HX1B 2NY4C 1FIGH 1QFHA 3NABH 5E2JA 3T0EB 4Q74A 3E8UL 2NYYC 1JNLH 2VABB 2X4UA 2Y36L 1DJSA 3ZKMD 1OOAA 4AMKH 3FO1A 5I1AB 5ETUA 1KTLA 5KZCB 3O3DA 5DC9B 8FABA 3E2HB 4NC2B 4KK5D 4Y7MA 3GUTA 1QSEA 3L3GA 5DQDH 4G6AD 5E6IC 1JGDA 1GZQA 4P2QD 3MLUH 3HZMA 5KJRL 1ADQH 3FQTA 3VFNA 2LV4A 1XGRB 5EIIA 4NT6A 1X9QA 1YNTA 3C6LD 2CO7B 1BHGA 3GO1L 3TZVD 3QWOB 5TQ0L 1LO0L 1JZ7A 4OZ4A 4JHBA 4ONGL 5SWZD 4HFUL 1RSFA 3BPCA 5B3JE 1AI1L 5DLML 5IT2H 4JFOA 4MAYC 4Q9QH 3NIDF 4DCQA 4HS6A 3VMPA 1QSEE 5A2LH 2FYYB 3SCMD 1F4AA 4RGOH 2HJKB 4HUMB 4XNUL 3QUZB 2XKUA 5FA4B 4P5MA 5EZOL 1Q9LA 4UT7H 4DVRL 4D0DA 1GOGA 1PGRB 1P2CB 3KJ6L 4KTEL 1IAKB 2BNUA 4E0RB 1QSFA 2MOVA 2VSDA 5I16A 5ABDE 1OARL 2BNQD 1FBIL 5J3HC 3MRLA 1VB9A 5F1KC 3WHE1 4HS6B 3MUY1 5F96L 1YN6A 2IEPA 2HH0H 3EHBD 1A4JB 5D2LA 3MLRH 4N0FA 4M93B 2UWEE 3WJLA 3FZUD 2XNAA 1EH9A 2CRYA 3MGAA 5C0FB 4E42B 1RZKL 1IL1B 3KPPA 5F9JB 5I30L 4LFHG 3ZHDA 2W9DL 4YBQC 4M00A 3CCHB 2BSRA 4LCYA 4KWUA 3T77B 2YC1B 3QZWB 4KAQL 4MVBD 1LK2B 2F54E 3SPVB 1I85A 4AENB 1L0XA 1NLBL 4XP4L 1ZLSL 5IHBA 4X4ZA 2BJML 4LHUG 2VAJA 1FNSH 1I3VA 1LO4L 1P7KB 2YRPA 3AC0A 3MRJA 3TV3L 5DZLA 2GTZA 4KPHL 2XKNA 2E9IA 2DQIH 2H2SC 1X5XA 2OSLA 4BJLA 1NAML 2VYRE 3L5WA 3BSZL 4LCCA 4PJXB 4RAVB 4UZGA 4NSKB 3B5GA 5D1XD 1PBYA 4XCFL 1G7JA 4A6YA 3IT8D 2EEBA 1JVKA 5SWZE 1CD9B 1UCTA 1Y18B 5TDPB 4S0SD 1N59B 4KI5E 4IRZH 1L7IL 4K71B 3SKUD 1F6AB 2CK0L 4WV1C 4Y8AA 2EDHA 4Y4KC 3U0WH 4JCLA 5FEBA 1A7RL 1T80A 2HTKC 3RUGF 2GKIA 3EYUL 3RBGA 3C5ZA 1X4XA 2D4FA 3VH8A 5BRZE 2O5YL 4R2GD 1KJMA 3HNSH 2F8XC 4KZDL 5KANI 2NXZC 1EJOL 1LE5B 4IOFD 2R0ZH 4NO5B 1FHGA 1H9VA 3N1FC 3T2QA 3OR7A 3ILPA 4L3CA 3G5YB 4CVXB 1VENA 5LGHH 2DLFL 3QO1A 3HG1E 1LO5A 3LMJH 3GMQB 2JB5H 4UUJA 4YHYB 3MLUL 4YHZL 1FV1A 4GS7C 3NA9L 1A7NH 1UQSB 1MFDL 5GRJH 3TT1L 4NBYB 2EIZA 1YPZB 2PO6D 4JKPL 1ITBB 1IJ9A 1JWUA 1U8IA 2CLRA 5FOBB 5J4MA 4YHLL 3G6JA 3I50H 4XZUA 3C5ZD 3T1FA 4PG9A 3WV0A 3NFPA 3KPMB 3TCXA 1A4KB 2FECI 1W8NA 4PJIA 4GQ9H 3O2DA 2ZCKL 5DRZA 4S1RH 2EEAA 3WD5L 4RGOL 1G6RL 3MO1A 1WGOA 5C92A 3U0TB 4HKZB 1CVRA 1DBJL 4OI8A 4RBPK 3B9EA 2AXHA 4YHMH 3FT3A 3NVQA 4YUEL 1MCQA 1QP1A 1DANU 1QFWH 3H2WA 3T2PA 4LNVA 3U7WH 2EXWC 1A1NB 1G7PA 2V7HA 5CUSH 5H2BA 3IDNA 4U1MB 1AC6A 4RGMC 3MLXL 3KJ4B 4D9RD 3ZKXB 1QO3A 2DQCH 3FAXA 3KWWA 4Y5XC 2HH0L 3ALXA 4CAGA 1JI1A 3KXFB 1MQ8A 3MLRL 2DBLL 2NY2C 1MFEL 4YWGL 4XC1L 1KCSH 2OTUB 4H1LB 1OSZB 1XGTA 3ECBA 4BUHA 3WXVH 4DUVA 3FQXA 3U82B 4N5UA 5HDLA 1S9VA 3P2TA 5TE4L 4MDIA 4QGTA 3FFDB 1MCDA 3QDGA 3O3UN 1A02N 4OQ1A 1WT5C 4FHBD 4MB4A 1YMMB 1FP5A 1YN7B 2XWTB 1U91B 4I2XB 2AJZB 4ZXBB 1FZJB 1PLGH 3IVKA 4HF5H 1MWAL 5SWQB 1WBZA 3NPZB 1KB5A 1YEKL 4G6ML 3EO0B 5HYJB 3S88H 3EO9H 2R2EA 3AROA 4KPHH 4IHOA 1PFCA 4JN1L 3MJ9H 1QYGH 4OZGF 4QTHA 1NGWA 1VACA 2ITCA 4JGUA 5CHNB 3CFCH 4YDVA 1RHFA 3QDMD 4RNRB 4XCEB 3HUJF 1K3IA 3PV6B 3D69A 3GIZH 4M8VA 1BBDL 2Q8AL 4R7NB 2B4CH 4JDTH 3WIHL 1JK8A 4KZEL 3VW3H 4ONFL 5D5ME 3NZ8A 4HCRL 3R0NA 1KCLA 5DD1H 3U0PA 3UTZB 4FQJL 1N0XH 2X1PA 3P0GB 3JWOH 3T3MF 3QNZB 4ZFOA 3EOBB 2FNBA 2GT9A 4Z7VF 4FXKB 5EU6D 5F9WB 2VXTH 4G42A 1ZTXH 3DI2B 5EFIA 3B5TA 1DEEA 3DETD 3LPFA 1A47A 4XWOD 1P9MA 4ORZC 3W9EA 3PJSA 4MWFA 2W0PA 3BDYL 1KPVA 4KKAC 1IRAY 4Z7NE 3NACL 4RMSA 3PV7A 1WAAF 3MOBL 2CUMA 5LGHL 4M48L 3LZFL 4MCYA 1P7KA 1N5AB 4OF8A 1KGCD 4N0UB 5IR1A 4K9EH 4OM1H 3LHPH 1JZ3A 4X98B 3RY4A 4D9RE 1GAFH 1JWUB 1U8IB 3L7EA 2A6DA 2ZSWA 3S6CA 1CFQB 3EIFA 4LSUL 5C9JA 1F45A 1H0DA 1PKQB 3IFLL 5TDNA 4CW1A 1CFSB 2Q76A 4HIEA 4HG4J 1HHHA 1A3RL 5BO1L 3PGFL 4JM4H 2EDRA 5BJTA 3K81A 1WFTA 2AI0L 5DRNB 5F6HI 4K7PX 3MZTA 2VLJD 5JQ6L 2VDRL 3OQ3B 2P8PB 1H3PL 3GSWB 3UC0H 3QHFH 3GMMA 4K3DL 4TTDC 1TQBB 1S7WA 3VRLE 1OTTC 2YD4A 1YJDH 3I9GH 4ZS7L 5KVDL 2Q6WA 1LK3L 1M7IB 4NUJB 3VI3E 2HFEA 2V2WA 1I9IH 4HJJH 1PAMA 1WAAA 5GRYA 1EV2E 4L8SB 1O7SA 3K4ZA 4NQVB 3C60B 4UINL 1R5IA 1YNLH 1QFWL 4LRNL 3BH8B 1TZHA 4CADB 2YMXH 5CUSL 3IDGB 5HHOA 1PSKH 1PKOA 3TH2T 3CPLA 4KK9C 1V7MH 1BM3H 2VXVL 1G7IB 1WWCA 5CGYD 1ED3B 1A6TB 2FO1A 4NQEE 4I9WD 1XCTA 3D0VA 3QH3B 2RR3A 4P4KA 1KCSL 5D7JC 2I9LA 3AMLA 3WXVL 3X3GL 4KDTA 4IMKC 1MFCH 5CZKA 1K2DA 2XPGA 4QRRB 2DRUA 1U2CA 5K9KB 3BPLB 3T8XA 2WUCH 3RVTC 4HWBA 1JZ6A 4YQXL 3VWJD 4NT6B 5D96C 3HRZB 2DB8A 4EN3C 1J1PL 4DW2L 5C0CE 4MQSB 5IV2B 3MRGA 4JRXB 1MCCA 2R2HB 1QSZA 3FOLB 3EO9L 2A74B 5GGQL 5BZWB 4TQEH 2XZCH 3PWVA 5HSFA 4PLJC 4KJYB 4WJ5A 3V5DB 3LS5H 3N9GL 1ZT1B 2Q8BL 4OCLC 4R7NA 4L4TB 5EO1A 1MRDH 5BZDA 5DQJB 3TIDB 1HIML 4OLUL 4XT1C 2QEJA 3VFPB 1IAII 2NY0C 2O5XL 1ZA6B 3WFHA 3HC4L 4HWZB 4H0GA 5IG7A 5KS9F 3FQRA 5DEFA 1IC4L 5T3ZL 5HI5C 4FQJH 3E1F1 3TVMC 2ESVA 4ZPVA 2PTTA 3FB8A 5CKGA 3N1GC 3MCKA 4X80H 3ARDB 1FFNA 4JFFE 4PRBB 3WDIA 5I71B 1HXMA 2ID5A 3MJ8B 4DCQB 3CLFH 2EICA 5INCA 2XPGB 4QRRA 4L8BB 1E4JA 3STBA 1N5AA 5I8KH 1C08B 1MY7A 5T3ZE 1A9EB 5HPOA 1X4YA 3OKEA 2ADFH 1AGEB 5JMRA 2A83B 1RFDL 4DKEH 2A6KB 5IMOB 3GEWB 5JIPA 3S8WA 3U46B 1JGLH 2F5AH 1IQDB 4JHAL 4YFLI 5BS0D 3H42H 5EU6B 3KYNB 3MJGX 4KI1A 2J88L 2XQBH 4QNPF 4ALAH 5DS8B 3DX7B 1KNOB 4MS8D 5GIRA 4BFIB 5F8RC 5F7DB 3PGFH 1TDQA 2G5BA 1A0QH 2J5LB 4PYHA 4ZAKB 1OAZH 5TGBB 5JPNA 1CLOH 3CH1A 4FABL 3QUML 4Z0BH 1EIBA 2IQAB 1MREL 1C5BL 5F88A 1CG9B 2ZUQB 4ZTPH 5IVZA 2Z8SA 2EDXA 1DDHA 1R3LA 5DZOA 3O6FA 4HKZA 3VXSE 1UA6L 2YA2A 1B0GB 4OFYD 4P46B 1YEJH 3MX0A 1G1CA 1ZANH 4GAGL 3MXVL 4NGHH 1FFRA 1N8ZA 2ICWI 5I1EH 4QT5B 2G9HB 3HG1B 4HK3J 4LLMB 1EVUA 4F58H 5LXGH 5K59F 4ZAKA 2JIXB 4WDIB 1DUZA 2JK5B 1HHGB 4I1NB 3FB6B 3RKDC 1B4RA 2CXKA 5ADOL 4OZGB 2O5ZL 1A8JH 4L1HA 4S1DD 5A3ID 3INUL 2ADJB 4PGCA 3RX7A 1OP3H 2A6DB 4YFEA 3HLAA 1SJEA 3EOAA 1O0VA 1I9RL 4MB5A 4DGYL 1MCJA 1J8HB 5CSGA 3O41B 3V4PL 3FFDA 2UVEA 2DD8H 2MNUA 4MJ5A 4D9LH 1MLBA 3KPNB 2AJ3A 4OLYL 4N90D 1BQLH 3F7PC 4UT6H 5ID0B 2HN7B 3S3SA 3O3BA 4GXVL 1I9JL 3QFDB 4ODUA 1X7QA 5ESVB 1NC4B 1SEBB 4ZAKD 3P9WB 1GZPB 1KJMB 2DLIA 3MNZB 4PRIE 5DSCA 2N4IA 3DHJA 4N5ED 3FT3B 4E9LA 1GOFA 4PUBL 5B8CB 2DMBA 4KRPC 1XGUB 2Q8BH 4ZYKA 4W6WB 1QNZL 4G8FA 4WW2F 2DYPA 2AEPL 4YK4C 3KLHD 3LD8C 2E8ZA 3BE1H 3CH1B 2XT1B 4X6CE 1EFXD 4L4VB 1QRKA 5DHVB 1MCBA 5IEHB 3V0WH 4YNYB 1R24A 5ITBH 5IQ7H 4UTAH 2XZQH 2NY7H 2EO9A 2FBJL 3VXSD 3ULVL 1BIIA 4NJ9H 3FQWB 3MROB 4KVCH 3VFWA 3QBTB 2P5WA 2A9NL 2VXQH 1P4BL 1OSPH 4NQDE 3K74B 3RPIA 3FO2A 1EBPA 1FVCA 1OGTB 3OKEB 3RWCB 2KH2B 3QFJD 3MRFB 3WS6A 3UBXG 3NZHH 2OTUA 1H8NA 2ARJB 4H1LA 1HCVA 2DLGA 4MYWB 1KT2A 3V6BR 2APFA 3L5JA 5GS0C 4DTGH 4P2RB 4GMTH 5D70L 5GSRA 1HN1A 4KK9D 3JWDH 3Q6GL 3HE6D 1VGKB 1XFPA 2D31B 1YC7A 3IGAB 2ZJSH 3NGBB 5E0QA 2V7NB 3RTQC 4LPVA 4XB8A 5GZND 4H8WC 5F21B 5BV7C 2N7AA 4F3FB 2GY5A 3VWKD 5GHWL 5DQJA 5FXCH 3TIDA 1BZ7A 3D0LB 3EOYG 3HC0A 1CYGA 3LV3A 4N8CL 5DJ2A 2UY6A 4H8WL 5IB5A 1IGIL 3PHSA 2VQUA 2FL5A 2APXA 3U9UA 1J0KA 1UZ8A 1LVEA 1RZ7H 4RAUB 1CDGA 5F7MC 1WFUA 4V2CB 4U6XA 3EYSH 5IW6B 5A40E 3VXOB 5IHZA 3UZEA 5CMAB 2PCPB 2BNQE 2ZNXA 3MV01 3QXAA 3LEXB 1XF4A 2EDEA 5EUOE 3RVXD 5ERWA 3BZ4A 2A77H 1S5IH 2IQ9L 1ZLWK 1SBBA 2I60H 2HVKB 5A16A 3DUUA 1MJ8L 2KZ1B 4CJ1A 1EGJA 2HJFB 2YOCA 2JE8A 2OI9B 4KI5F 5SWSE 4M3KB 1M71A 4JY6A 3O3EA 1T1XA