3H9SE

The complex between tcr a6 and human class i mhc hla-a2 with the bound tel1p peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASRPGLAGGRPEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T cell receptor cross-reactivity directed by antigen-dependent tuning of peptide-MHC molecular flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2009-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9sE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9sE02
4I3GA 3KPLB 1ND0B 1FZJB 4KUZH 5DF0A 5IHBA 4GAGH 1FHGA 1LP9E 2NYYD 3QUXA 4QTIL 4DVBA 2FIKA 3TA3C 2QTEA 1PD6A 1X5GA 5JW4R 4BM7A 4XXCC 2HRPH 4MWFB 3BP6A 2IPKB 3QIWA 4PRHA 1J1XL 5C0FB 3FMGL 4BYHA 1R5WA 1OP3H 5HYJB 1EO8L 5I71C 1B3JA 3OPZH 2GQHA 2DL2A 3QQ9D 4Q0XL 4G6FD 1G7QB 3G5YB 3BPOB 5LJYH 1WIPA 3B9KA 1NJ9A 3HZKA 4HKJB 5KSAD 3V2AR 4QRQA 4WFGD 4F8TA 4NP4H 3IAPA 3D25A 2Y07H 4PV8B 1AQDB 1U36A 5CJ5A 1GZPA 4OM1L 4MNQB 4ZO7A 1BIHA 2RFXB 4JLRA 1BVLB 5AWNH 1X5HA 3GMQB 1FVDB 4PGEA 5BS0D 2HG5B 4PJ7E 4DN4H 1JN6B 4ZODA 1U8OA 5GGVH 5J0BA 1CCZA 4OLVH 1P4IH 2FX7L 3FCTA 3TBYA 3VWKD 1K2DA 3DECA 1U91B 1AGCB 1OSZB 5ENWA 1TETL 2XN9D 4M6AA 1CLOL 3TIDA 5KVEL 2H2PD 1DE4A 1MCKA 3ZE0E 1HILA 2MHAA 3AMKA 3WXWL 1NC4B 3T65A 5K9KB 2Z35B 3QUYD 4QRPE 4Y4KC 4DZ8A 3PWUB 4E42B 5C3TA 4M7ZB 4YDJB 1MCOL 4RAVA 3MRBA 3BZFA 3MFGB 4LCWA 4Y8AA 4OCXL 4MJ4A 1UGNA 4ZS6C 3DMMD 3KPSE 1U58A 5C0CD 5F7UA 4OLXL 4FFWC 3RQ3A 4LK4A 4PR5B 3QDGD 1IKNC 1K8DB 3VXMA 1UCBL 2EYSA 2PETA 3AB0C 4OB5H 1CL7L 2BERA 2UZYB 5D1QA 5EC1A 4NNPL 5FV1L 1CGSH 1V05A 1B0RB 3LSOA 1BQUA 4U6VL 4XNUH 3VE0A 2BSSB 4QY8B 4KDTA 4AMKL 3U6RA 1LQSR 3P4OA 4L3EB 4XCCH 3EAKA 1PW3A 3STZB 2DQEL 3D3VE 3EYQD 2RIKA 3TYFA 1WCBB 1OT2A 4JPWH 2AK1H 5FOBB 3Q6FA 2XQBL 2GSGB 5TDNA 1E4JA 2YC1B 2FLBT 3UC0L 1MHPH 1INQA 1VGKA 4LIQL 5C6TH 3NAAL 2Y36H 3ROLB 1PG7X 2E8ZA 3ES6A 4GO6B 4PJ5A 2YD3A 5SV4A 1MFBL 4X9BA 2A6JB 4YQXL 2CLRA 4OD2A 2WV3A 3BO8B 2E7HA 3E8UH 4LPCA 4S1DC 3QIUB 5DJCB 4KK6C 4IOFD 1T1ZA 1IEAA 4NN6B 3QEHB 2VLKB 1HCFX 2ZWLT 1A6AA 3KPMA 3HE7C 4G8FB 4OD3L 5B3JE 4G7VH 3BQUA 2D0GA 3AXLB 4TRPH 5KBNC 5E1AB 5FYKU 2VZ1A 5D93B 3O2DA 3BPLB 3MSPA 2Y5EA 5E2VL 2B5IC 2DS4A 4YFDB 4HF5H 3JV6A 1HKLL 1J5OH 3FRPG 2VISA 3HAEH 4KUCF 2AKRB 3OQ3B 3BP7A 3PG2A 4Y1AE 3JWOC 4Y2DD 3V4VL 1RUPH 5E5MA 5ESAA 2VLRA 2GAZA 1OP5K 4FXGA 4JY6B 4B5EA 2LU4A 3SE8H 3WUWA 4M7LL 1MFDH 4HLZG 5IIEA 3WFDH 1CDBA 4UNVA 3QO1A 3E2HC 4LARL 5MEQA 4R7NA 1BZ7A 3AU1A 5GS2H 5DMIL 1BLNA 3VXPA 2CGRH 4RZCA 1AY1L 2NY5H 5SWZB 1I3GL 4ELMA 3D9AL 4PJ9A 4JFQB 1EGJA 3PL6B 1G9MC 3O11B 1X4YA 1UWEL 4NO2A 1RZJH 3WFCL 2J5LB 3QULB 4OV5A 5F7DA 3ARGB 3KXFA 1FNFA 4JANB 2HT2D 2CMRH 5DMKB 1A9BA 3UMTA 2Z91A 4N8VA 4X6CA 1FFQA 4JO2L 2YUXA 5E6ZA 2ZKHH 5IEKA 5HI5C 1T2XA 4NZRH 4PRHE 2R56L 5DMYA 1JGDA 1A4JA 1SEQH 2R0KH 4JM4L 2CXGA 3VXSA 1BGXL 5D7LA 4M8VA 4URTB 1F4YH 1LEIB 4G8EB 1NGZB 1TITA 3BEVA 1JF1A 4P9HL 4R0LB 2I60L 2VLJD 3W0WD 5FA4B 1Z5LB 2IAND 3BD5A 5IV2B 3RKDD 5IW1A 3TJHC 1X7QB 4JGJA 4HH8A 3V7MA 4N0FA 5C07D 3VXUD 4YX2L 5DRZB 5DEGA 1S9YA 4L8BA 3HE6D 5E6YA 3ZYIA 1MJJA 1T83C 3LPWA 3NZHH 1OAZL 1NMAH 5DRWA 3MXWL 1JZ3A 5DHYB 5EU6B 1UB5A 5TF1H 3WN5C 4ZNCD 1D9KB 1YMMA 3DGGA 3T8XB 3TA3A 1D6VH 2VQ1A 5IMKB 3MO1B 4XXCA 3V7AE 3HB3D 1BWWA 4R26H 3RDTB 5IKCA 5C2BL 1JHKL 2HRPL 3GMRA 4RFNB 2HVKB 4YHMH 4F33A 4PJAA 3U79A 5FYLH 3B3IB 4G9FA 5CEYB 1EAJA 1WC7B 1VKXB 2XYCA 4H8WC 3OPZL 1QEWA 3H7LA 4LCWE 4TSBH 3RX7A 3ULVD 3G5XB 1ZHLB 5HI4D 2ZP0T 4Y8DC 1G0DA 2P5WB 1P7QB 3CSPA 3EYUL 3K80A 4PJ8C 4Z7WF 2UY6A 1CIDA 2Y07L 4MJIA 5DK0A 3VXME 3TC9A 3G5VB 1CD0A 2HWZL 4P5KB 5F1OB 4QF1A 3VH8A 4NKDA 3F7YA 3FQRB 3ARZA 2CDGA 3VFNA 3OJMB 2I5YH 1U93A 2YN5A 3KHQA 5DDHB 5LAXB 4F7TB 2H3NB 4JFXA 1ITBB 1S9WB 1ZHBA 4JB9H 4Z5RB 1QNZH 2NZ9D 4JRYA 1M7IB 3MNVB 4ZS7H 2XY2A 5GGVL 2ZG1A 2VNCA 4P5MA 3ETBF 2IQ9L 3DX9B 3BPOC 1RU9H 3KYOA 4Z7NE 4WFED 3PQYD 4Y4KA 5I1IL 4LAQH 3R06B 2P8LA 5I1GL 1MHEA 4PJ5E 3L3JB 3D2UA 1WTGT 5H35B 4NYLA 2VDPH 5SV3A 1G7HB 1RUQH 5CUSL 1T2QL 3O3DA 2R1YB 1J8KA 1SJEB 5A2FA 4FQHA 3RWEA 5FUCE 1P9MC 1KIQA 4FNLH 1ZVHA 3GO1H 4NC1C 5E5RB 4GKNA 3ZMRA 4UIMA 1N5AA 4BH7A 2RHEA 1WAAF 3QXDB 5DJ6B 1Q0YH 4HK3J 5MEPB 3MLYH 1KG0A 3PUCA 4HGKC 1MCRA 1EERB 1NFIA 2A6KB 5HHOA 1BEYL 1GC1C 5HHPB 2VLRE 4G5ZH 4O00A 5D8JH 1ZSDA 3MFFB 3CFKA 5DLMH 4I3SH 4XNUL 1AXSB 5T1LB 4M1CC 1Q1JL 4M7ZC 4DW2L 3L7EA 1MLCA 5B8CB 1TXKA 4M9PA 4NO0B 1JNHA 3O2WH 4JRXD 4JPWL 2AK1L 1V7NH 5JNYA 3SKOA 3FTGA 5J6HB 4JZNB 4KK8D 4Y7MA 2IH3B 2R2HA 1E4XI 4ELME 3C08H 4HLJA 2DQUL 1MHPL 3ULUF 5FGCE 5C6TL 1OSPH 4CRPA 4HCRH 2VSDA 3O3AA 1HHGB 5F1SA 3W11C 2DJSA 1J1OL 1FL3A 2BSTB 5CEZE 5HYIA 2HTLC 3SPVA 3KXFE 4Y2OA 1J0JA 4XC1H 4JE4B 3T77A 2PTVA 3E8UL 1E6OH 1C5DB 1RIVH 3HE7A 4X83A 2MCG1 3UO1H 2KKQA 2VITA 1K4CB 4X6CE 3HNSL 4S10A 3B5GA 2EDDA 3DUUA 1U8MB 3IFPB 2VTFA 1R0AH 3GMNA 3QDMB 3L3DB 4J3WA 3VXSE 1J5OL 4X9GA 4N8PA 5AG8A 5D7LE 1QFWI 2GJZA 3J7HA 4KMTL 1PFCA 2I9LB 3IGAB 5BV7B 1FYHB 2IPUG 4FA8A 1OP9A 4AM0B 3WL9B 3LEXA 1JNNH 3SE8L 4HFUH 4PREA 3WFDL 1W72A 3FT4B 5L2KA 3BZDA 1GZQA 3QIUC 4DVRH 5C0BD 4KVNH 4O51B 4NN6C 1QR1A 4NQVA 5INCB 2CGRL 5HYQB 5CMAB 1VENA 4DKEH 5MHSD 2NY5L 1FH5L 4KKNA 4QHKJ 2NY6D 2VMFA 1F02I 2E8YA 1U8PA 2D4DA 2IGFH 5D93C 4S1RH 3BPLC 4R7DA 1EVUA 1QRNB 3EYVA 5L7XH 1JRHI 4S0TD 3IKKA 3SDDB 2UWEB 4IOIB 4KK5D 4Y4HB 1YMME 2ICEA 3HN3A 4WFFD 1OB1B 2FZ3B 1SY6H 2V7NA 2Q7YB 2CMRL 2CQVA 3MNZA 4MD4B 1ZT7A 3KYNB 1MFAH 5D7IA 1FZOA 2R9HD 1NLDL 3RNKA 2ZKHL 2GCYB 4NZRL 4PJAE 1GXEA 3ILQC 2IAMA 2Q3ZA 2W0LA 4NOFA 4DK6A 4G9FE 1SEQL 4JDVB 1ZA6B 1FNEB 1KGCD 3T0AA 4MA8H 3BAEH 1R3JA 4MS8D 3VD4A 1F4YL 5ID1B 4EUPH 3RFZC 3PL6C 1DVFD 2OL3H 1A6TB 5E9DA 3KPOA 4XH2A 4XNXH 3VRLE 3ULUC 2AV7B 4Q74A 5INDB 5GISH 1QACA 2J5LC 4YHIA 3ARGC 1T4KA 4MJIE 2R1XA 1YPZA 4BQ6A 4NIKB 4C59B 3BKYH 5IFHH 1A1MB 1C08B 1VEMA 1I7UB 4AIZB 5JXAH 1EPFA 2LU7A 1MAML 2Z0BA 4X5LA 4OD1H 2ZSVA 1MJ7H 3EJJX 3LS4H 3C9NB 4RDQF 5KVFH 3OTTA 5I17A 3QDJA 4ZYKB 5KVGH 5T1KB 4EN3D 4ESKA 1A2YB 4JRYE 1DUZA 1NMAL 3DETD 3O8XA 2DBJA 2FL5B 5BMFH 4X4YB 5TE7H 2VR9A 1FIGH 4Z18A 2XZQH 1D6VL 1XF4B 1XZ0A 5CS7A 1A02N 4JFOA 4R0LC 1EEYB 1KPRA 1NGPL 2FJGA 3TGXA 2SEBB 4KROC 4YO0B 4BFGA 4KK9C 4PJXB 3ZKNC 2IADA 4MQTB 4YHML 4HS6B 5FYLL 3TO4C 4JFHE 3RY5A 3D5OF 3T09A 1MHCA 4Z7VB 4TSBL 3SGEI 4OF5A 3KDMA 1WIOA 1BQLH 2BRQA 1UCTA 4PJ8A 2EDEA 1IC1A 1T89C 1PYWB 1UACH 5LQBH 2E9BA 3UJTL 1D9KC 1U3HD 5FO9B 4ODSH 3PGDA 5F97E 1JMXA 5HHOE 1WBXB 4MWFA 3RDTC 3KAAA 2AJVH 3C2SA 4JZJB 4YDLB 4OAWA 4RFNC 5GS0C 2I5YL 1RZIB 4JB9L 1IT9H 1QNZL 2W65B 4NC2B 3G5YA 4ZS7L 4ORZC 4X0KA 4ZDHB 2EDQA 2WNGA 1OVZA 1GL4B 1SEBB 4X9FA 3IAGC 1IGIH 4HKJA 4BFIA 1UZ8A 2DLGA 2XOTA 4I5BB 3RWHB 3WKMH 2NNAA 1L0YA 5MERB 4WVRA 3BISA 1U2HA 4HJ0D 4LAQL 4PV8A 1AQDA 4CGTA 5EUOA 1F00I 1IAII 2VDPL 5F93C 1RUQL 3NIDF 3WNOA 3GMQA 1FVDA 4M6OH 2HG5A 5GSVA 5E08H 3W9EB 1KJ2B 4Q9RH 3F5WB 4HWNA 3F6LA 1XF3B 4KJPD 4FNLL 4OCSH 3GO1L 2NY4D 1N8ZB 2R2CA 1Q0YL 3Q1SH 3QFJB 1U91A 1AGCA 1OSZA 2DICA 1CVRA 5KVMC 2OBGA 3MLYL 1P69B 4M8QB 5GRUH 1FLTX 3MV9D 1CD1A 2X41A 3JTTA 4IMKA 1RUML 1NC4A 2ATKA 3EDEA 5C7XH 2Z35A 3O2VH 3TWCH 3PWUA 3SOBH 3HG1D 4YDJA 5GRWA 3DRQA 5KSBB 2MOVA 5DLML 4NUJB 4NZUL 2AV1B 2PW2B 1QFHA 5I66A 3QWQB 5L2KE 4N8VG 1OAXH 4W6XB 3V0VB 3VI3F 5HDOA 2ENSA 3WXVL 4ZUUB 1G6VK 2FEDD 1AXIB 4HXBH 4OKVA 3S6CA 5CP7B 1ES0A 3C08L 3ZT5A 4PR5A 3I2CH 1HWHB 3H6JA 2UWEF 4NWTH 4KJYB 3LDBB 3S97C 5KN5B 5EU5A 3CK0L 5JR1H 4LL9A 1I7ZA 4G8GB 5L8JB 1B0RA 2XKNA 4XC1L 4XB7A 1GPOH 4ZTPL 3KS0H 1RIVL 1KB5B 4L3EA 4FQCH 3STZA 1CXHA 3BJ91 4RA0C 4G9DB 4XI5D 5D7IE 3V6FB 1WCBA 3G04B 5TQ2H 5EO1A 5FOBA 2GSGA 5B8CC 2YC1A 4NNXB 1R0AL 1IILE 4H25A 1VCAA 4OI9A 3OR7B 2P1YA 1F42A 2ICCA 4PRIA 3MCLH 1AH1A 4WI6A 5CJ8A 5EU3A 2ADFL 2PR4H 1U95B 4U49A 5I6XC 2ZUWA 1U9KA 2FJFA 3S36L 2A6JA 2MSPA 2P49B 3U0PB 5E9DE 2A6IA 3V6BR 3QEQA 3QIUA 1JNNL 3MRKB 4XGZB 1LO3L 4NHCH 5DJCA 3CFJB 2NLJB 4R9HA 4M48L 3L3IB 1YPZE 2VLKA 4IDJH 5IBUG 4MLIA 2DKSA 5I1AA 1M4KA 3AXLA 3B8SA 4C4KT 1YEIL 5E1AA 1NEUA 2JB6B 5HVWA 2WMPA 1TDQA 1OARH 1S78D 2AP2A 1WAAA 3QDJE 1HXMB 2X4QB 1G6RL 2AKRA 1UEYA 5SWSD 3GBMH 4YHZL 5L7XL 3I02A 2YPKB 3MCG1 4OFPA 2A6DB 1IL1B 3L5IA 4R4FL 2OP4L 1MJUL 2YD2A 1M71B 4JG1H 3VXTB 5BV7C 5JQHC 1A3LH 1R6VA 1SY6L 4PJXF 5EG6C 5L6YL 1I3RB 1MFAL 2MQCA 1ZOXA 4OZ4B 3VFRB 3JWDC 2GJ6D 4EI5D 2Q20A 2IJ0C 3KGRA 4LSRH 4Z7VF 5EZJA 5A1AA 5SWZA 5FDWB 1CXLA 2QSQA 3NTCH 4JFQA 4Y89A 3Q2CA 2AVGA 1XGPA 3PL6A 2B4CH 3ARSA 2E3VA 3AS1A 4JPVL 2Z8SA 1VDGA 2IH1B 4WW2A 3QULA 1CICD 4XNXL 2O5ZL 5DUML 3SDDC 2HKHH 4JANA 5GISL 4Y4HC 5DMKA 4MLSA 5IVNA 1GH7A 2BVQB 1Z9SA 3BKYL 4K23H 3WNNA 3ORJA 4BZ1H 5J1TC 3WSQH 4OD1L 1MJ7L 1IC7H 4BH8B 3LS4L 3S5LB 5B39G 5C9KA 2EDJA 5DD5L 4WFHD 4POUB 1JPTH 1NGZA 1GHFH 5BMFL 4NQED 5JORA 3M17B 4PBVC 1FIGL 5FA4A 5TF0A 2XZQL 2F54D 3BFOA 2WM0A 5EUOE 1EX0A 4JDZA 5IV2A 2XZAH 1X7QA 4D0CA 4LPVA 3MOAH 3LPGA 2C1PA 1E27B 1X5ZA 2R2EA 4E41B 3O2DH 1KELH 4RGND 4BFBD 1T89A 5DHYA 4OGXH 1BQLL 1HINL 5EU6A 3GIZL 2C26A 3LQAL 4JAMB 4IIQB 4F3FB 3T8XA 1JGLH 3DPBA 3BHBB 5IMKA 5LQBL 3KPQB 1U41A 3TT1H 4ODSL 3RDTA 1TCRB 2Z8RA 5JW3H 3A6BH 1S7SB 2VB5A 2HVKA 4PJCB 2IMNA 3UYRH 4NZJA 1RJLA 1WC7A 4P2RB 4L4VD 5E6ID 4A6YB 3OR6B 3OB8A 3EGSB 2H9GB 1J10A 5ESVB 5IR1B 1ZLSH 1AD9A 3G5XA 1EGJH 1ZHLA 1F58H 4CJ1A 1MCDA 5CCKH 1DLFH 3TFKD 2P5WA 1IGIL 1Q94B 1UJ3B 4ZOEA 4LLAA 1KTKE 5E00B 3RU8L 3QXUA 3G5VA 5CINH 3V0AC 1DFBH 2R0ZH 3O6FB 3MLXH 1UA6L 3IXAB 3VFUB 4FQIH 2AXJA 3FQRA 4NRYB 5KSVB 3MTRA 5FKAB 5DDHA 3GHEH 5LAXA 5T3ZL 4L3EE 2DRUA 1L0XA 5I8EB 1M7IA 4JZJC 4YDLC 4HULB 4NQXB 3MNVA 3L5JA 3DX9A 4Z7OF 3LKSB 2DTMH 4DFHA 4U1JB 3Q1SL 4NJ9H 4PRIE 4LLWB 1K5NB 3TZVB 1C5BL 1INEH 5GRUL 5IVOA 2L7JA 2D3VA 1MI5D 3L3JA 3ARBA 3G6DH 5C7XL 3SGKC 3O2VL 3SOBL 3NFSH 2R1YA 2X40A 3U2SB 4MXQC 3QEQE 4RMQA 4QHUB 4KKCD 2FH8A 1MHHB 2VLKE 5A2JH 4K94H 5JIKA 4HKBA 5DRNB 3D85B 3HZMA 1OAXL 2LAGB 1NEZA 5DJ6A 1S7TA 4ERSH 4HXBL 4HKXB 5AZEH 3BKMH 4MSWB 2RR3A 5MEPA 1BFOA 1WAAE 2MKLC 3I2CL 2X2YA 4PLKC 4KI5E 1K9TA 2P5EB 2A6KA 2D7NA 4KRLB 1Y6NR 3DWTA 5JR1L 4JFFB 1KPUA 1AXSA 1DDHB 4I2XB 4BK4A 4NO0A 1W0WA 3FO2B 5IEHA 1X4ZA 1MCJA 3ZYZA 1NMBH 2WBJB 2J1KA 5J6HA 4JZNA 2IH3A 4GLRI 5SWZE 4J4PC 2QLVB 4JFDD 2JJWA 4UOJA 4NPYB 1HHGA 4OF8A 2HJLA 5FUOH 3V4PL 2BSTA 5AYUH 5HYSB 4OBRA 2VN4A 1DQQB 3LDBC 4MA3A 1S7UB 2PTTB 1C5DA 3V0WH 4K7PL 1EEZA 1JI1A 2EIDA 2QQQA 3A6CH 4X6BB 4XCNB 1H5BB 3D0LB 1A6UL 5D2NB 5E56A 3RBGA 2F74A 3L3OB 4IRJD 1MFCH 1CBVL 5E1HB 4UT7H 1OARL 3QDMA 3L3DA 5E0QA 3IU3B 5HGAB 3WFBH 1R3LB 5HPMA 2V2WA 4P2OA 3GBML 4D8PA 3PDDA 4PYHA 1IKFH 4K3DH 4P46A 3SGDI 2IFGA 3FAWA 3NBNA 3KYMA 3WL9A 3BD3A 1ZE3C 3WO4C 4ELKB 3PHQB 5T3XE 4IJ3B 3FT4A 1TJIH 1R3HA 3VRIB 3MACH 2OCFD 2HT3C 4O51A 3ZTJH 1WZMA 5HYQA 4KV5E 3BW9B 4LSRL 2QQKL 1KENH 3DXAD 4AQ1B 1I8MB 3LB6C 5E99L 1KCVH 3NTCL 4FFZH 1KN2L 2B4CL 1SYVB 1QRNA 5EU6E 2UWEA 3B2VH 1IGFL 2XA3A 3DX7B 1X5JA 4GKOA 3UDWA 3BKCH 1OB1A 2FZ3A 5DJDB 2Q7YA 4G43A 4L4TD 1LK3H 3OB0K 3QJHB 3MCKA 2HH0H 2LTQB 2EDBA 4PJCF 3OKEB 3KYNA 3BH9B 4IRSD 4LRNH 2VXQH 4PY7A 4K23L 2GCYA 6CGTA 5F7EH 2QSCH 4LCUA 3MV7D 4MQXD 4XPAH 4BZ1L 2H45A 4XNYL 3VCLB 4PJGB 1IC7L 1QSEA 4JDVA 1ZA6A 3DHJA 1TJGL 3EZ8A 3CMOH 1CQYA 3RWDB 4N0YL 3UTTA 1PGRB 5DT1H 3IRZA 1N6QL 2DLFH 1VFOA 1JPTL 4YXHH 1AIFA 4M03A 1GHFL 1A6TA 3MRMA 1YA5A 3ZHDA 2P5WE 1M7XA 3V4UH 2AV7A 2K3TA 1CLCA 3OWEA 5INDA 3LKPB 2UZXB 3HPJB 2HMIC 4TYUA 3IJYB 1C08A 4OQTA 5MI0C 1BD2D 2GK0B 5D1XB 1MY5A 4UZGA 2XZAL 3GI9L 1U8HA 4NKOB 3D69B 5KW9L 3FZUD 1D5IH 1D5MB 3VI4E 1P5VA 3U4AA 5C0AB 3K3QA 2DLTA 2AK4B 5T1KA 2M2DA 5DC9B 5LG1A 1KELL 3MPCA 5I16A 4WNQB 5JUEL 2AQ1A 3BD4A 2FL5A 3JWOH 2GUOB 4K8RC 5IOPA 5DWUH 1KJVA 1JGLL 1EFXB 3WNLA 4FQ1L 2FB4L 4PJDA 5ITFB 5JO5A 4HWBA 4ISVB 5GHWL 1C5CL 4Z0BH 3AY4A 3TT1L 3UBXG 2PNDA 1KLGB 1PQZA 1QO3B 2AABH 4YO0A 1JHTB 5JW3L 3A6BL 3MX0A 4PJXA 5FO7A 4OZHB 1YYMH 3DIFB 4UB0L 4JJ5A 3RJQB 3MJ7A 4HS6A 3CVHB 3QO0B 4MJ5B 1A3QA 3HKFA 2Z93B 3UYRL 3EZJB 3KPRD 3RTQA 4Z7VA 2R23A 4Y88A 1G9MH 1KYOK 4TNWF 5CHNB 3CX2A 2BNQB 2H8PA 3GUTB 1ZLSL 4F9LC 2X1OA 4PTTB 4AY0A 1F58L 1NAMA 3SKMB 3QXAA 5HD8D 3PWPB 3GJFB 1PYWA 4PJ8B 5IVZA 4IIQC 2HFGH 3VXNA 1I4FB 1FFRA 4PLNC 3RWFB 5E8NB 3OB0H 5CINL 3SKNB 2R0ZL 1WBXA 3PF2A 1ZGLB 3MLXL 5E8PA 5IJVB 3EYOB 1JF5A 3ZT7A 3QUMH 1S7RA 4LOUC 1LE5A 3OJVC 2C3VA 5HHNB 1KTRL 2HN7B 1L0QA 4DFIA 3T0WA 1RZIA 2DDQH 3GHEL 2WAHA 5DHVH 2MFNA 2W65A 2OJEB 4C56D 2DQHH 3MGOB 3EW3B 3VFSB 2RCSL 4ZDHA 1F6AA 1I9IH 1NBYB 3CVIH 2DTML 4OCLC 3NFPB 3U0TB 4MJ2A 3NIGE 4I5BA 3RWHA 4G6FB 5LKNA 4NJ9L 1LEKB 5MERA 3K2UL 5LWYH 1INEL 1UJ3C 3S35X 4P23D 3G6DL 5F6IB 1VSCA 3U7YH 4XP6H 2P42B 3O6FC 4NZDA 3P77A 3NFSL 3QBTB 3BH8A 1Y0LB 2OTPA 3WDHA 1CDCA 1X5YA 2AXHA 2FGWH 3QNYA 3W9EA 2VZ3A 1KJ2A 4U1LA 1MCBA 1FNLA 1MELA 1XF3A 4K94L 1H8SA 4XPBL 4AEHH 4XZUB 3BUYB 4PG9B 5BS0B 1UXSB 3IF1A 1NANH 4J2XA 3QFJA 2X89A 4UV4L 5AZEL 3BKML 3QDME 4M62H 1NBVH 3L7FB 3MMEA 2X9YA 4DGYH 4FXLA 2V9TA 3AC0A 3QCUH 4YEFA 3TZVC 4WWID 5IHUL 5KSBA 5F8RC 5L88H 3NPZB 4NUJA 4JO4H 5DJ0A 4H8WH 3SDXA 2PW2A 4EIGB 4ZUTB 4W4OA 3WS3A 1VFAB 1ZMYA 2RJMA 4X6DB 1NDGB 2AJXH 3V0VA 5EUKB 3R0NA 1G7IA 5T5FH 4Y19D 1TIUA 3ESUF 4RRPG 5CP7A 1ZT1B 3Q3GB 3RX5A 2WIMA 3DTXA 1F11B 3HMXA 2KL6A 4K07A 1CFVH 1QRNE 4KJYA 2UWEE 4XAWH 4OT1H 4G8GA 2V17H 1LO0L 2FO4B 1TVHB 1AXTH 4ENED 2FR4B 5EFIA 3BEWB 3MLWH 1KB5A 3V0WL 5FXCH 1UXWB 4X9HA 3G04A 4PJGF 3FOMB 2BOBA 1X6LA 1YUHB 2J3SA 4UV7H 1XCTB 3NACL 5FECB 1HEZA 4NNXA 4UT7L 1QSEE 2APTA 1NBZA 3OR7A 3SO5A 2WBJC 4XNMB 1ONQA 4JQVC 2NTFB 3WFBL 3UTTE 2ARWA 5T33H 4WU5B 5KTEL 4YWGH 4QGTA 4NSKB 2OZ4A 1UKQA 4WO4D 1S9XB 2E6PA 2V5SA 3MRKA 3V5DA 1NCAL 5ANMA 2NLJA 3M45A 3L3IA 3RIFK 1QPPA 1TJIL 5I8CB 4WV1C 5CZXC 4NQDA 2IEPA 2KPNA 3IFNH 4ODUA 3QPQD 3MV8D 3IDXH 1H5BC 3F7VB 2EDNA 5D2NC 1KENL 5KSUB 4LPTA 5E2JA 4HH9B 1HXMA 1KCVL 2Y72A 2Q6WB 2CUMA 1HZHH 2EC9T 2YPKA 2A6DA 1GC1H 3T2QA 1KSRA 3MJGX 3OSKA 5C0GB 5A2LH 2VOTA 3QNZA 3TBVA 4DOHB 1M71A 1Q72H 4PJDE 3VXTA 3BKCL 1EO7A 4ZFOB 3JV4A 1DBBH 2G2RB 4OZHF 2WWKT 1LK3L 4R3SB 5F9JA 3N1MC 4M93C 4X6FA 4LRNL 3VFRA 4OZ4A 4PJXE 2VXQL 2FX9H 2GY5A 4IJ3C 5F88B 4D0BA 2UZIL 1AP2B 4QRUB 2QSCL 4XPAL 4HWEH 2YRZA 1DEEB 3OHXB 3O6KH 1EBAA 1PY9A 5F1NB 3RAJH 2ED8A 4GRMB 2FJHB 2VWEC 4Z7VE 5E8OB 1NGWA 1QHPA 4I0PB 2DLFL 4YXHL 4H5SA 1FFNB 2XRAL 3ZTNL 4WCYH 2W60B 1X6NA 4NM4H 4OGAC 1A64A 3V4UL 4NT6A 1T7ZA 1NCUA 1WBZB 2XKUA 1JVKA 1P1ZB 4Q58C 4GXVH 5EU7C 2LTQC 4QXTB 5SX4I 1OTTC 5GS2D 3P11L 4HFWA 4NNYA 4BH8A 5EBMB 3S5LA 4DZBB 1D5IL 3ZSSA 4RX4D 1UB6B 5J9PB 3C60D 4WENB 3KJ6H 1JE6A 3HI5H 4LSDA 4YHOH 3JTSB 3C5SB 3JWOL 5EZLB 3KYAA 3U82B 3KPNB 2OSLB 2A73B 4OLYH 5DWUL 4M6ML 3M17A 1NEZG 4EDWH 4N9OB 4KHXH 1OL0A 3HFMH 4PY8I 2CRYA 1EEUA 2E6QA 3JWNC 5F7LB 3C87A 1ETZB 2VLJB 1X5FA 1YYML 4X7SH 4PGBA 3KNBB 4I4WA 1CL7I 1ZWIB 2IANB 4JVPA 4K3EH 5D1XC 2DI9A 4WEBL 1E27A 2YWZA 4F9LA 5ISZD 3D1MC 3DBXA 1L7IH 3AREB 3I50H 1I8KB 1UM6H 4JAMA 5C07B 1S7VB 4I0CC 4IIQA 4F3FA 3HE6B 3E0GA 1NC2D 4XVSH 2EO9A 3OG4B 3BHBA 3QFJE 3U7AA 5C71A 3KPQA 4YFLI 2W38A 1TTUA 3ROOB 3GMOB 1TCRA 4QHMA 2W0PA 1S7SA 3UJIH 2JCCF 4MDJA 4PJCA 3SO3C 3QUML 2APWA 5KSBE 1MSPA 2NW2B 3FN3A 4U6XA 4P2RA 2ZCHH 3QCVH 4P2QD 4X6DF 5E70A 3SDXE 3OR6A 4A6YA 1KJ3H 2H9GA 5ESVA 3HNTH 3T3MF 2DQHL 1ZANH 2YMXH 3L1OL 3SY0B 3CVIL 2OI9B 5FUZL 2QHRH 2C7UB 3DOSA 4P3CH 1Q94A 4G6AD 5GRVL 1KIUA 3IDGB 3H7BB 3FT2B 1XH3B 4R2GD 2KBGA 4S1SH 2FRGP 1JWUB 4Q9BA 1S7XA 1EK3A 1QSFA 3P4MA 4BQ8A 2O5XH 3KYKL 4G8GE 3U7YL 5IROC 4NRYA 5KSVA 5FYLD 2X9XA 2NYYC 1T7WA 1FO0B 4NQXA 3TO2B 4AEHL 1LGVA 4FQLL 4PJFB 4XBEL 1JPGB 4U1JA 3HI1B 5C0IB 1N7MH 4M62L 4XWGL 1HK6A 4LLWA 2VZUA 1AGDB 4LPWA 1K5NA 1SYSA 5GIRB 2Q87A 1OGAA 2FECL 4LHJB 3SE4C 3U2SA 3PQYB 1RIHH 1E4WH 5F6IC 1MCPH 3WNPA 4JO4L 4BKLB 1MHHA 4HIEB 5F21B 2FSEA 3GHBL 3HZYB 3BESR 5DRNA 3D85A 4NQDE 4K2UH 2AJSL 3LRSB 3ILPB 1X5XA 1EHNA 4XTRC 5T5FL 3IVKB 1MCSA 4HKXA 1PY4A 2I07B 5F3BB 3BGAA 1KTDB 3FQNA 4MCYA 1T80A 5KZCD 3TBTA 2X4PB 3QI9D 4XMLH 4YBHA 2GTWB 1CFVL 2P5EA 4POYA 2ARJQ 4OT1L 3ZDYF 5I9QB 4JFFA 1ZLWK 2V17L 4RFOH 1AXTL 3GJEB 1DDHA 5GS0H 1Q9KB 2BNUB 1Q0XL 2DMBA 3MLWL 3GMMB 3TF7C 3S8WA 3FO2A 4QXGH 4HGWB 4ZAKB 3MLUH 5IF0B 1T5WB 2V9RA 5T5NG 4JQVA 1FE8H 3B43A 2G60H 2Y4SA 3O3UN 5DFVD 2VKWA 6FABH 1U3JA 3S37H 1DN0B 8FABB 3MUZ1 3OKNB 1MF2L 1VGEH 3TN0A 3SDCD 5T33L 4OCRH 1R5VB 4YWGL 3VD7A 4GRWB 1H15B 5FDYA 4J3SA 1EHAA 4Z7UA 5HYSA 2GTZA 1U3YA 4K7FA 4MB4A 3CFBA 1Z0MA 1DQQA 4GW1B 4NGHH 4EQ2A 7FABH 2WLYA 5D5MB 4HZLB 1KCSH 4PRNB 5IG7B 4X6BA 4XCNA 3U4BH 1A6WH 3SDYH 5D2NA 3L3OA 3IFNL 2DQIH 3IDXL 4GQPH 5I73B 5EBGA 2BRRH 4EBQL 3BGMA 3IU3A 5HGAA 2V6HA 1M7DB 3C6LC 5F6HI 3DJ9A 1R3LA 3EYQC 1U3ZA 4LPYA 4N90E 3IDMA 1GC1L 2Z31D 3ARDB 2BK8A 2J4WH 3KS0J 4DTGH 1TJHH 1Q72L 4QOKB 4LP5A 1Z6JT 4ELKA 3PHQA 5CJBA 4DKAA 1K6QH 1DBBL 4Q2ZB 5TE6L 4FZEH 3FT3B 2EXWC 4RFEB 4GS7B 4AEEA 5GGVY 1LO4L 3EJZD 4HWEL 4PJIF 3P0VH 3O6KL 4U1MB 4IOFC 5C0BB 1SYVA 3MJ9L 1DBML 4JHAH 4LVNB 5CFHA 5JPMB 2NY6B 4YR6B 3GSNB 4WCYL 4KDVA 4ODBD 2Q8AH 1ZLWH 5DJDA 5JPNB 4JHBA 1DEDA 3OBAA 3OKEA 4OUOA 5FYJH 5DD0H 4R8WH 1OW0C 2CUHA 1A8JH 1BBJB 4GXVL 2NTSP 5K9QI 5TPWH 1DBAH 1YEFL 2Z4QB 4PJCE 4JVUA 4AH2B 4MDIB 3FB6B 3VCLA 4F7CB 1F8TL 1YEHH 3NZ8B 4P2RE 4YZFF 1EVTC 3RWDA 4QT5B 2YHGA 3KJ6L 5DVLA 1HQ4B 3HI5L 1R24B 2EICA 2EZ0D 5GGQH 4OLZL 4OLYL 1MCWM 4ZFZB 1U0QA 4I0PC 4NDMA 4OLUH 1BM3H 4EDWL 4GG6A 2C4FU 3LKPA 1AE6L 3MBED 2PKDA 3GK8H 2EC8A 3DYOA 4M4PA 1QSFE 5ADPH 2GK0A 3RGVB 5J57B 5D1XA 2A83B 4X7SL 4WDIA 1NKOA 3D69A 4XNZB 5C0EB 2FYYB 3OJ2C 3R4DA 1D5MA 4K3EL 5C0AA 2FEEL 3LKNB 1DSFH 4G7YL 5D1ZD 1WZKA 5IJKC 1L7IL 4WNQA 4PJFF 3UYPA 3I50L 4X7TB 1T22A 4H20H 4HS3B 1OGTB 4XVSL 1G9NC 5ITFA 3HLAB 4ISVA 5BV7H 2GHWB 2GK2A 1SBSH 1CS6A 1KLGA 3CU7A 4TUOB 3ZKMC 3GB7B 1G7LB 3UJIL 5CGYD 4OZHA 3DIFA 3JWDH 1OGAE 4MHHI 4MZ2A 3H8NA 3QO0A 1KIPB 5IBLC 4H1LB 4ALAH 5E94B 1EIBA 5AZ2H 2ZCHL 1I1CA 1D7FA 1ORSA 3HA0A 4LLVB 3NGBB 2NY2D 2CKNA 5CHNA 1I7TB 1KJ3L 1UVQA 1LILA 2ERJC 4NJAH 5EIVA 1HH6B 1ZANL 2YMXL 4HIXL 4LCYA 2R2BB 2JJTC 3AREC 5F7NC 3PWPA 1U92B 3EO1A 3ULUL 3QYCA 3HE6C 1I4FA 3B6SB 2YPLA 3RWFA 4HT1H 4P59H 5HJ3A 2P5EE 5F3HB 4S1SL 5CJXC 1ZGLA 2WINA 4PJBA 5IROA 4YHNB 5IJVA 3EYOA 1IC4H 2AI0H 2O5XL 4JFFE 1U3HB 4TULL 4PIRF 4QRRD 1FV1B 3FB5B 5DVKA 35C8L 2IALB 3KPSD 4OFYD 3FO1B 4I48B 3HB3C 25C8H 1KN4L 2OJEA 3P9LB 4F2MB 3T1WA 1IC5H 3FQXA 3VFSA 5ADOH 3S36X 4GMTH 4YDIH 5ALBL 4XP9H 4KVCH 1Y18A 1MUJB 2AJUH 1WSST 2OR9H 1N7ML 5DS8B 3WUZA 2OI9C 5E2TH 5JMOC 4B7LA 5I74B 4QHNB 2ILLA 4Z7UE 5KSAA 4CVZB 5D5MF 4OQTH 4PG2A 4YJZL 1RIHL 1E4WL 1MCPL 1NCCH 4KAQH 4U6YB 1YJDL 3E6HB 3NN8B 4V1DD 5D2NE 4XZUA 3BUYA 1D5XA 4K2UL 2ADGA 4I1NB 5L2JB 5BS0A 1T20B 1UXSA 3LN4A 3PIQB 1BOGB 3F12B 2E6JA 3L7FA 4XMLL 3FFCD 5CKGA 3C8DA 1RIUH 3VWKA 3HUJB 1Q38A 2XN9A 1OAUH 3SJVD 1XGRA 4RFOL 1MRDH 1GGCL 3T2OA 1CLZL 1F3RB 2QQNH 3QUYA 3FRUB 5T3ZD 5HHME 4QGYA 5A2IH 1VFAA 4NN7B 1LEGB 4QXGL 3W39A 1NDGA 3MLUL 5CBAB 2FIRT 2VWEE 1FE8L 4EZMA 1ZT1A 4L8CA 2G60L 2DJ4A 3X3GH 1JP5A 4KKAD 1F11A 3DMMA 6FABL 5TDPB 5C0CA 2XTJD 4ODXB 1UWGH 1FCCA 1RK1B 1EV2E 3NCMA 4JM2D 2VAAB 4OCRL 3VGBA 2X1WL 3WLBB 1GYAA 3X13B 4W6YB 4BUGA 4ODHH 2FO4A 1TVHA 5A40E 3N85H 3QDGA 2FR4A 3BEWA 4NGHL 2RAMA 3B9DA 5I9QC 3RIAK 5EU7E 1UXWA 5K59F 1KCSL 2QKIB 1OWWA 3U4BL 4OFVA 3SDYL 1CI5A 1XCTA 5FECA 1HIMH 4Y5VB 1NPUA 4ZAKC 3C09B 1FC2D 2BRRL 4XNMA 3MREA 5B38G 4LBEB 4UT6H 3O41B 4WU5A 2BVPB 4K55A 1A7OH 5LVEA 4Z78B 1TZIA 2ZPKH 4HAGA 2J4WL 4MQ7B 2R29H 2P24A 4YGVB 1P7HL 5BQ7B 4GG6E 2VRAA 1TJHL 5KOVC 1FBIH 3IJHB 1K6QL 4FXKB 5ICYA 4FZEL 1XIWD 4Y5XA 3QNXB 1JCKA 3VXRD 5JOFB 2IQAA 2Y25A 2B1HL 1KJ2H 3P9MB 5EWIH 1FGVH 3F7VA 4CMMA 1RY7B 1CG9B 3P0VL 1CDUA 3H9HB 4UILL 4GW4A 4OCYH 5C0AE 4HH9A 2DQTH 1BZQK 5BVPH 2GITA 5I73C 3WFEH 3L3GA 4JHAL 3SCMD 3X11A 3ARRA 2X09A 2EE9A 4JPIB 3OV6A 1DL7H 4LSUH 5EA0H 2Q8AL 1LO5B 4ZXBB 3ARDC 5SWSB 2G2RA 4R3SA 2WP3O 1RZFH 1D3CA 4FMFA 4UDTB 1QQDB 3UBXI 5FYJL 2ZJSH 4R8WL 1EJOL 1XR9B 3EDKA 4S0SD 4OZHE 3VFMB 2X70A 1FYTD 5E8DL 5TPWL 4QRUA 1AP2A 1DBAL 5C1MB 5GZNC 2PYFB 1DEEA 4GS7C 4L29B 5F1NA 3D3VB 1WZ1H 3BUTA 1JZ7A 1YEHL 1LNUB 4GRMA 2FJHA 5IB1B 4EI5B 3TLRA 1F4AA 5CKAA 1NCTA 5I8KL 1BX2B 1FFNA 1QKZH 3HMXH 3U4EB 4NKIH 4GBXD 4CU6A 5EPMB 2BY3A 2WQ8A 1A6VH 2WWMD 3PWPE 43C9B 4LVNC 4OLUL 4WUKH 1BM3L 1P6AB 2NY6C 4KXZI 3IKCB 5EOTB 1WBZA 2YPLE 5FYKE 2BXZA 4IMLB 5KANG 5JW5B 4HWUA 5AEAA 3FL7A 4PJBE 1CICB 4IHOA 1KB5H 4QXTA 5EBMA 2YPVH 4DZBA 3GMLB 1UB6A 5K93A 3VGDA 1DSFL 2YBRB 4MCZB 3UTOA 4HPYH 1C12B 3H9YA 3QEUB 3U83A 3C5SA 1RZKL 5EZLA 4NCC2 3KPNA 2OSLA 1MCNA 2A73A 1KFAH 2GT9B 1FAKT 2W92A 2NX5D 4KH2A 3OG6B 2OZ4H 3LRGA 5IWLA 1SBSL 3PWNB 4NQEB 3REWA 1C8PA 4HUUB 1JMZA 2VLJA 3W0WA 4AIOA 2A74B 4CBPA 4WFGE 3JWDL 4EVNB 3C5ZB 3WCYA 3IRPX 5CAYB 4LKCB 1ZEAL 2IANA 3RGVC 5GGTH 1QRKA 4V2BA 4IDLA 3FQWB 4C57C 2VIRB 1WVZA 3MRJA 4XNZC 3Q5YA 4C58B 1BJMA 1I8KA 5C07A 3VXUA 1S7VA 2ITDA 4KTDH 2PO6D 1KUMA 3MLZH 5BS0E 3HE6A 1S8DB 3SE3C 4Z77B 4HD9A 1B88A 3I9GH 3B5HA 5CJXA 5IB2A 3HUJF 2MWCA 4WU7B 2JIXD 3ROOA 3WE6B 4F15B 4N5UA 1BBDL 2R0WL 4OZFG 4P59L 3DETC 1URLA 2NXYD 4QCIA 1BQHA 2CPCA 4CDHA 2XN9E 4LQFL 2AI0L 5DXWA 1SJVA 2FIKB 4JHZA 2NW2A 4J23A 1UZ6E 3W5MA 4P57B 3ARWA 25C8L 4S2SB 2RB8A 1IC5L 1R5WB 3WDJA 2WK2A 5ADOL 3NGBC 4GMTL 4YDIL 4XP9L 4KVCL 5GGRB 4L4VB 1U8LA 5B21A 3T3ME 3QG7L 2OR9L 3IDGA 1P4LA 3H7BA 1B0WA 5I30H 4XWOD 1A3RH 3FT2A 4K7PX 5C0CE 3OKKA 1XH3A 1YDPA 3B9KB 1S5IH 1JWUA 3RA7L 3HZKB 3NIFE 5BCAA 3D25B 3QDGE 4LP4A 4OQTL 4LU5H 1RVFL 4NO3A 1GZPB 2VXUL 1IQDB 2J12B 3ECBA 4KAQL 1U3HC 4LHUG 2BFVH 3IT8D 4PJ7F 4XNQB 2ZUTA 3TO2A 3ARPA 4XMKH 1JI2A 4O4YL 4PGEB 4FMKA 4K8RH 3GBLA 3I84A 1JPGA 1VEPA 3HI1A 5F7KC 5C0IA 4KJWD 1U8OB 3ET9F 1AGDA 4MQSB 3HC3H 2ESVB 5GIRA 3TCLB 4D94A 4TUKH 2CKBB 2O5YH 1F3DJ 3TBYB 3ZE0F 1HDMB 1RIUL 5ENWB 5E5UB 1OAUL 5MEOB 3M8OH 4QEGA 3PQYA 5ERWA 1MRDL 4N5EC 5I74C 2Q86B 2MHAB 4WIQA 1GJIA 2PXYD 4BKLA 5DUPL 3UP1A 4ZUWA 1MI5B 4PLJD 4HIEA 2QQNL 3EJYD 4HJ0C 1TVDA 4JKPH 5HGGS 3EOAB 5J3HC 4CJ0A 1M6OB 4RAVB 5E4IA 3ILPA 1HI6A 4WTXA 3WIHL 1ZAGA 2I07A 5F3BA 5BZWB 12E8H 3EO9H 2X4PA 5F1KC 5KVDH 2GTWA 3RBSA 2I9TB 1UWGL 1KCRH 3ESVF 4G80A 1FNAA 2JF1A 2XIDA 3CLFL 4DOHE 1T0MB 1Q9KA 2BNUA 3H9SD 5D1QB 3H3BC 3QWRD 2B2XH 2XACC 3GMMA 3OX8B 1WV7T 1T5WA 3CFCL 4A6YH 2CLVB 4NN7C 2Y5TA 2CO7B 4A2MA 1HE7A 2D7TH 1DN0A 1P7KA 1Q9LA 4JRXA 4UT6L 1FNGA 5TDNB 3MUY1 1R5VA 1H15A 1A7OL 3SKJH 5ETUB 2ZPKL 4HWZB 1H3PH 3VFTA 2R29L 4GW1A 4CN4A 2QADB 4QWWD 3ZT6A 5CGMA 4HZLA 2CLRB 1JPSL 2CJUH 3L5HA 2IPTH 4DGIL 1KJ2L 3MXVH 3I6LD 1EUTA 1RUKL 5B3JF 2YD1A 4L4JA 1KEML 4RMWA 1IEAB 3WNKA 1XF5A 1CF8H 1A6AB 3KPMB 3ZHLA 4OCYL 2BVUA 1M7DA 1Z3GH 2DQTL 3BQUB 4Y5VC 1FL6B 3BRFA 3NVQA 3RVTC 4PJEB 4XI5C 4B50A 2E27L 3ARDA 2EYTB 1L9NA 2VISB 5C8JA 1LDPH 1CR9H 2OM5A 1DL7L 3BP7B 4J3OC 1RZFL 5ESAB 3FT3A 2VLRB 4MVBD 4Y4FD 4OSUH 2ZJSL 4RFEA 3W0WE 2VLJE 2VL5A 2ARJB 2D0FA 2FATH 2WW8A 5DTFA 1A0QH 5JW4Q 2DIJA 2IANE 1QLEH 3QO1B 4DN3L 1WZ1L 4R7NB 4U1MA 1J11A 3DX6B 5CP3A 5C0BA 3S96B 3VGEA 5C07E 3VXUE 4RIRA 4ELMB 3DLQR 1QKZL 4PJ9B 4NKIL 1H3UA 5FGCB 1A6VL 2D9CA 4J3TA 5JPNA 1IEBB 3QZWA 4KKBD 3D2UD 4Q6YA 1IMHC 3X12A 3WMSA 5F7DB 4ZXBC 1ZGLM 1HHJB 4JFHD 4HX1B 4ZS6D 4AH2A 4L1DA 1A9BB 4MDIA 3FB6A 1REIA 4N8VB 1BQSA 4FFWD 4X6CB 4JN2B 4IRSB 3NZ8A 4ZOCA 3S4SA 4QT5A 4BSWA 1I3UA 1DJSA 1HQ4A 5DSCA 1JGDB 1A4JB 5J06A 1HHKB 5CD5D 4EI5C 1UADC 4OJFH 3T0ED 1P5UA 2H1PH 5JLZA 5FM4A 2X10A 2OZ4L 4D9LH 3ULVE 2X6MA 3HPLA 1DVFA 2CRIA 1NL0H 2IBZX 3BEVB 3KR3H 1OQXA 3CIQA 1TFHA 1DQDH 1FNHA 1MCLA 2OQJB 1CDGA 3LRHA 1EHLH 1CICC 5C0EA 3T4YA 3CAFA 5GGTL 3RVVC 5GRZA 5DD6A 3U9UB 5IW1B 4O58H 3SE3A 3QRFM 2XZCH 4R6UA 3JVGC 4X7TA 1QFWM 1S9YB 3MLZL 1MJJB 3MRLB 2N56A 4J12A 3G5ZB 2P44B 3HLAA 3I9GL 3OF6D 4O2CA 4NCC1 3GB7A 1UB5B 1T1XB 4K7PY 4K9EL 1YMMB 3RVUC 3OJDA 5IMOA 2VQ1B 2JTDA 3BE1H 3BDBA 3CMGA 1RD6A 2V2TA 4WFEE 3PQYE 1KIPA 5IBUB 5DVOA 1GIGH 5IW6A 3C5ZC 3WJLC 3GMRB 4LLVA 4XPHH 3LKRA 5FIEA 2D03L 4G9FB 1HH6A 3ZKXB 3FRPA 2BOCA 3DRTA 4HJGA 3GSWA 1U92A 1QEWB 4OGYH 2NZIA 3BZEA 4JVWA 5I30L 3B6SA 1A3RL 1WJ3A 5F3HA 1YYLH 1S5IL 1YNTA 1WUNT 4NQTA 4F15C 3TESA 2VXTH 1U3HA 2YEZB 4LMQI 1FV1A 3QHFH 3FB5A 5F7WC 3DSFL 4LU5L 4WHYH 2IALA 4NRXB 4I48A 2BFVL 4QF1B 4F2MA 4NKDB 3MOBH 4XMKL 2LQRA 2XWTA 4JFXB 1ZHBB 2ADIA 4JRYB 3EFDH 4UDUB 2J88L 5DS8A 4C56B 5IBTH 4JRXE 5C0RH 3HC3L 3K8KA 4MD5B 1T03L 4Z7NF 4TUKL 4QHNA 2O5YL 4GRWE 3VMPA 5C08B 4CVZA 1DCLA 3B9KC 4PTUB 3P4NA 5HI5D 4YDVA 3TFKC 5DVNA 4E9LA 1MHEB 5DGRA 4U6YA 4GG8A 4P23B 5E03A 3E6HA 5I1DB 1QFUH 4JKPL 3O3DB 1QHOA 5FO8A 2WUCH 5L2JA 4O2EA 1A7RH 1T20A 3MJ6A 1J87A 1PZ5B 3PIQA 2F5AL 4PJEF 3F12A 4PB9L 3T1FB 12E8L 2FBOJ 3EO9L 5KVDL 4UIMB 1N5AB 1OHQA 4CADB 1CTOA 1KCRL 3HUJA 5ILTL 2AQ3A 4E0RA 5BOZG 3TJHD 2EECA 1KG0B 3MV9A 4LSVH 3U36B 1NFIB 3X3FH 4HAFA 2B2XL 1FSKB 3CVHH 3FRUA 4NQCD 3HG1A 5HSFA 1AHWA 1WTLA 1ZSDB 3CFKB 1NLBH 1J9CT 2PUQT 2GY7B 2AEPH 3L7EB 1JNLH 1MLCB 3K7UA 4XB8A 2MJWA 2D7TL 4ELMF 5C0BE 1VEOA 4KUCD 1Q8MA 4ODXA 5JNYB 1K4DA 3DX8B 3GJFH 5MHSE 2BNRD 2D7QA 2VAAA 5EIQA 3X13A 2XWJA 2AERT 5FYKH 4D2NA 3SKJL 3U0WH 1DTUA 3MROB 5IGXH 1H3PL 4N1CA 4IRZH 1GGYA 4JDTL 3V95A 4WWKD 5JW4N 3O3AB 1OOAA 5BRZD 5DURD 1ZLUH 1FL3B 5CGTA 2XQYK 4X6CF 3T77B 5D1QC 1E4XH 2CJUL 5JOEA 1MQKH 3ZL4H 2IPTL 4P99A 3MXVL 2VITB 3V5HB 1CF8L 4M3KB 4KDTC 2ED7A 4LBEA 3WJJA 2BVPA 5J56B 3T08A 4Z78A 4LRIA 4MQ7A 4YGVA 1IAIM 1KGCE 5BQ7A 1LDPL 2GJZB 1GGUA 3IJHA 5GS1B 1H3GA 4WTWA 4WO4B 4NKMA 3ISWA 2QADC 3S3PA 4OSUL 5DHXB 5HYJD 3UEZA 3P9MA 2MKWA 3JBG7 3UTPD 1BQHG 1IGCH 1W72B 1CG9A 7CGTA 5L2KB 1N5YL 1QFWH 5CJQL 4QNPE 2OJZH 1ED3A 1JYVA 1CYGA 2D0HA 4ONFH 3BQUC 4MA7H 3QRGL 3ZSTA 1CDJA 1U8PB 4ZMAT 4M02A 2EEAA 4LGRB 4RAUA 1B9ZA 4FFYH 4YAQA 5SWSA 1CD9B 4JO3L 4MNQD 4UDTA 2M8XA 1QQDA 2QL1A 3U7WH 3VXQB 2OLDA 2ICEB 2IBZY 5IESL 1J0IA 1KNOB 3KG5A 4J6RL 5D6DC 2DN7A 4PRPD 2XG4A 2V7NB 1GGIL 2PYFA 1TQCB 4L29A 3MNZB 1ZT7B 3EIFA 4XC3H 4U4BA 5D7IB 4P2YA 4TVPH 1JRHH 2GJ6A 4EI5A 1IEHA 1QVOA 2IAMB 2IC2A 2F5BH 4EI6B 1BX2A 2JLLA 1YNKH 3U4EA 1BECA 5EPMA 2X7LB 4OJFL 5TDOA 2H1PL 43C9A 3WHXA 1G0XA 4PJ9C 2YRPA 3BP4B 5EOTA 3VRLF 2V5MA 5CSZB 4M1CD 1NL0L 1CICA 3KPOB 3KR3L 5E9DB 1DQDL 1L6ZA 1ZT4B 1IGYA 3IYLW 3NMEA 4CU8A 1EHLL 1D5ZB 2R1XB 1YPZB 2MPAL 3O6LH 3O4OB 3MYJA 2QR0B 3BDYH 2YBRA 1C12A 3BDXA 3QEUA 4IRSC 2R4SH 4WGVB 5D7SH 2ZSVB 4O58L 2XZCL 4ZUSB 5GRXG 1V3LA 2GT9A 3LIZH 1ORQB 5FCUH 3B9EA 4O02L 3W11D 3O81A 1DUZB 5DD3H 3O8XB 3PWNA 4NQEA 2YOCA 4HUUA 2A74A 1PLGH 1H8OA 2F54A 1XZ0B 4L3ED 4U2YA 4JFOB 2YR3A 4HGMA 1ZHKB 4YHYB 1F4XH 4XP4H 3CX5K 4ZG1A 2IADB 4XPHL 2PTUA 1VA9A 4YHPB 5AD0B 4DUXA 5DA4A 1QLRB 2CDFA 3VU2A 1S8DA 5EO9A 3CSBA 1MHCB 5ISZB 4OGYL 4Z77A 1NGXA 3KDMB 4WUUD 4ZO6A 4PB0H 1AFVH 2CO6B 3DVGB 2OMBA 2FLRT 1JZ8A 5L8KB 2HLFC 4YHLL 3BRGC 4LF3B 2ZNWA 1G7MA 4MJ6B 1YYLL 1NC2B 2O26U 3HUJE 2XT1B 1EZVY 3AMLA 3KLAB 3STLA 4BUHA 3PGDB 3QHFL 3DHMA 3MV9E 3GKWH 1PJ9A 4L5FH 3FB7A 4P57A 3HG1E 1QLFA 4S2SA 4JGUA 3MOBL 2GKIA 4OAWB 5CIPB 5GGRA 5E6IA 4L4VA 3ZYJA 3KPTA 4BSJA 3ZKXC 5JTWA 3EFDL 3SE9L 4OF3A 1INDH 5IBTL 5B3NA 4U2ZA 4X0KB 5EOCJ 2V5RA 3RNQB 4BFIB 1UZ8B 1MWAL 3O3BB 5SWQA 4C83B 4U1KB 2WZPD 2NNAB 4DKDC 1UQSB 4N68A 4R2GB 5EUOB 3SBWA 1IQDA 1O5DT 4XNQA 1I75A 1LE9B 1JK8A 1F4WH 2R69H 5SWZD 1AGBA 3PXJA 2YZ1A 5DJXA 4LLYB 5GSVB 2VUOA 1G9NH 2Y6SC 5IT2L 3ALXA 3ULUD 1K3ZA 2ESVA 1I9RH 2CK0H 2ICWI 2VYRE 3CLEH 3MLSH 4XVJH 3TCLA 3ARGD 4RWHA 2CKBA 5EBLA 1OAKH 1HDMA 1KLUA 3KJ4B 1CFTA 5MEOA 2Q86A 4L8DB 4YBQD 5JIIA 1X5KA 1CD1B 1MI5A 3JTTB 1ZTXH 4FFVD 3QZWG 3PXHA 2ATKB 2YXFA 3CVHL 3EOAA 3DRQB 1M6OA 4I13B 4GQ9L 4P23C 1RUAH 1NLBL 2AEPL 5I66B 5BZWA 1JNLL 1B2WH 4JFZL 4HUVB 3S4SG 2NXZC 2I9TA 4Z7QF 4FQJH 4OKVB 1F4HA 2ZUQB 1ES0B 4KROD 3B5TA 1UYWL 3UBXB 2NCMA 3PGFH 4ZPVA 4P5TD 3U0WL 1XGTB 1T0MA 5IGXL 4TSAL 5SWSE 1N3NB 3TO4D 2DMCA 4WY7H 5EU5B 1I7RB 2D7OA 3DV6A 1I7ZB 3KPPA 2EXYC 3OX8A 3Q6GH 2XKNB 1E4XL 1FSKC 4GXUN 5D7IF 1MQKL 1Y6KR 2CLVA 3EDJA 2HLAA 3ZL4L 1TENA 4R97B 5HVGB 2YRLA 4XPTL 3TNMB 2GJ6E 1A7PH 5EO1B 1NFDB 2DI8A 1BPVA 3GSUB 4DUVA 1D9KD 1NDMA 4H25B 3ULSA 3ULVH 5I18H 3U30B 4YUEL 4Y16D 5ETUA 4HWZA 4PRIB 4JFDA 4OBSA 5EU3B 4I77H 3SDCB 4I8DA 2FJFB 4H0GA 3UAJD 4RSVA 1S3KL 5KANI 3QCTH 1YPZF 3MA9H 2A6IB 1FO0H 3QEQB 3FO0L 5K33A 3TBSA 4CL7A 2VC2H 5JMRA 1ITCA 1V7MH 5H37G 4ENEC 5A2KH 1HOCB 3KVQA 3WHE0 5I1AB 1FL6A 2OJZL 4IRJA 3BZ4B 4HMEA 4PJEA 4XVUC 1P7QD 3MRNB 4ONFL 4MA7L 5AAWA 2EYTA 2YZ8A 4FFYL 2ZUUA 4LSPL 4WFHE 2BVTA 3I02B 5D6DA 1PVHA 3U7WL 4NQEE 1QUNA 4HS8L 2EDXA 3GRWL 2ARJA 5GS1C 5J6GB 2J8HA 4Q9QH 3L5WB 1N0XH 2X4OA 2F54E 5DYOB 5F7FA 4WO4C 1ACYH 4N0CD 5GPRA 1NUFA 2AXFB 3S96A 3DX6A 4TVPL 3GEWB 2VLLB 1FZKB 1MFEH 2F5BL 4HV8A 5EZJB 3LEVH 3DXAA 1BFTA 4EDXB 2LAAA 1XGPB 4RGNE 1C7TA 5E2UH 2GIYA 2YD8A 1IEBA 2ZSWB 5F96H 5DI8B 4JREB 1XF2B 4WW2B 5ELIA 1HYSD 2IWGA 2HFEB 4NFCA 2X9WA 3NH7L 4RMSA 1HHJA 1JUFA 4HX1A 1DANU 3SQOH 4L4TA 4JRWA 2VDQH 2BY1A 1GGBH 4JN2A 3O6LL 4IRSA 4CDGC 4K71B 4OF6A 1TQCC 1QG3A 2FECI 4G6MH 5D71H 3MV7A 2R4SL 5D7SL 1HHKA 1I3VA 4NWUH 3T4AB 4L4VE 3LIZL 2IAMC 2YUWA 5FCUL 1E28B 4XAKD 5D70H 4GRWH 5FHBH 1LHZA 1G6RB 5DD3L 5JORB 2I24N 5B4MD 4X6EB 2KZWA 4UTBL 5FYJD 1PLGL 3A0OA 2OQJA 5T1LD 5EUOF 2E7LC 4E5XB 2NPLX 4G8IB 4JG0H 4JY4B 3U9UA 3MGAA 4JDZB 1F4XL 1BD2A 4XP4L 4DCQB 3HRZB 4D0CB 5GZOC 5IM7B 4F57H 5FKPB 3O4OC 2WLZA 4JFED 3WIIL 2C1PB 3MRLA 2R2EB 3G5ZA 1WITA 1KCKA 2K7PA 3ARTA 3UTZB 3ZDXE 3T3PE 2ESVE 2OR7A 1T1XA 2B1AH 1YC7A 1MIMH 4ZFOL 3O8XC 4KUZL 3QQ4B 1OP5H 1FN4A 4GAGL 4NHUA 5LBSH 4ZNEA 5D6CB 1UKTA 1DLHB 1PKQA 1MI5E 1YEDA 3GKWL 4L5FL 2UUDK 3T0BA 4YHYC 4DJMA 4I9WD 3KHOA 3QDMD 1RJLB 4U1GB 2BP3A 5JIHA 3KPRA 1QOKA 4XPGH 5DJZB 4B53A 3GSNH 1INDL 1AD9B 4TVSa 2QHLA 5GJTH 5T1MB 1KPVB 3Q5TA 4O9HH 3EHBC 2VJXA 4NP4L 1MCCA 2N4IA 1KLFA 1RFDH 4LCCB 2YEZA 1V3MA 4P0DA 4D9RE 1I8LC 3I6KB 3INUH 5C6PB 2EH8H 1FGNH 4NRXA 4HSQA 3K2MC 1J05B 1CFNB 2IF7A 5AWNL 1VPOH 4DN4L 1NFDF 1G9NL 4UDUA 2Z8VC 4MX7A 4C56A 3SDDD 1I9RL 3MLSL 1T1YB 4OLVL 3CLEL 1P4IL 4Y4HD 4MD5A 4ETYA 4PGJA 4Q9CA 1PX3A 2KZ1B 4G6JH 1OAKL 5C08A 5HPOA 4PTUA 4JFDE 3TP4A 5EBWA 4G6AC 1CDIA 4YNYA 3SHSA 3ARBB 4P23A 3RIFF 3GFUA 5GS3A 5I1DA 4R2GC 1IM9B 5B39A 4PV9A 1JNJA 5JZ7C 3G6AB 1RUAL 2FHBA 1KCUH 4WI5A 1PZ5A 3CFIC 3T1FA 1MCEA 4V1DB 4L3AA 4HKBB 3HZMB 1RZ7H 4POZC 1EHXA 4PJEE 1NEZB 4CADA 3DO3A 2LV4A 4FQJL 1S7TB 4FRWA 1MIEH 4KI5F 1BFOB 4QHLB 3PGFL 4M7LT 4MB3A 3KJ4C 1BP3B 5TGBB 3U36A 3FFCB 4OB5L 3WD5H 3UROR 4UI2A 4WY7L 4H1LH 1Q9WB 1CGSL 3R1GH 3SJVB 1KPUB 1UT9A 3Q6GL 4IMKC 4F7PA 1M1SA 2UVEA 5GRYA 4PS4H 5T1KD 4JPKH 1J86A 4XCCL 2O61A 5C0DB 1W0WB 5IEHB 3SDAB 3G9VA 1OT1A 1A7PL 3D39D 3DX8A 1RJZA 1XT5A 4Y19A 1GRWA 4I0KA 3DXAE 5I18L 2FEEI 1ZA3A 3MROA 4KPHH 4LIQE 2Y36L 4WW2F 2ICES 2ZUQC 3CDGB 5IVXA 4LLUA 4I77L 4HLZH 2DM7A 2HJLB 2FDBP 5HYEA 5ALCH 5JXED 1WT5C 3PHSA 3BSZH 4JN1H 4HXAH 4MA3B 3OAYK 1FO0L 4L4TE 1Z9LA 5F71A 2VC2L 1EEZB 1V7ML 3V5HA 4NRZA 3TNNB 2HJFB 4G7VL 4R97C 3RZWA 4TRPL 3MV7E 1EO5A 2F74B 3CU1A 2W59A 4JKMA 2F53D 3EDFA 4LVEA 3GSQA 4HF5L 4M6NH 1T21A 3CFDA 4P4KD 4WEMB 2UYLB 3U30C 5HPMB 2V2WB 4P2OB 2EIZB 4D8PB 5GS1A 4O2FB 5BJTA 3KLSA 2BSRB 1RUPL 3BN3B 4P46B 4WO4A 3SDCC 3S34H 4BFEA 3KYMB 4OFIA 1MFDL 3T2NH 1I1RA 1ACYL 4XRCB 5IFAH 4HG4K 15C8H 1R3HB 32C2A 4KV5F 2APVA 3TVMD 5D4QA 1BD2E 3JUYA 3MV8A 1MFEL 3LV3A 4R96A 3WFHA 3RP1A 3SGDH 3LEVL 4NCDA 3K1KC 5E2WH 1F6LL 3UCRA 5M95B 5F96L 4OFKA 4MXQD 1S7QA 5IUSA 1RZJL 3VXQA 3BYYA 5TFSH 1J1PH 4KI5C 4LLQB 1BZ9B 1KNOA 3AVEA 2BJMH 1N64H 4KDWA 4G43B 1E0OB 4ZNEE 1D5BB 3MCKB 1KXTB 1PKQE 4CNIA 4PY7B 3B83A 4LCUB 5D71L 5GSRA 5FF6B 1KJMB 4PLKD 4TNVK 3VFGH 4EI6A 3CZJA 2CK2A 1QSEB 2R0KL 1AJ7H 4NWUL 4PRAB 5F70A 2X7LA 3IDJB 3KPRE 3UTTB 3P0YH 4YXLH 1RMFH 2FWOA 3HAEA 2Q1EA 5D70L 5CLTA 4ZD3H 3BP4A 1CGUA 1AIFB 2AJZA 5CSZA 2E7LA 3MRMB 3CSGA 2XY1A 4JREC 4WW2C 1NQBA 4WTZG 1ZT4A 3GSRB 3OAYH 1OTSD 1D5ZA 2DQDH 2JJVA 3U48A 4JG0L 3T0XA 2QR0A 4J4PD 2GYSA 4J1UA 3VI4F 4HC1H 1HH9B 1NFKA 4K71C 4ZSOB 4F57L 1U8HB 3RL2B 4ZUSA 1KOAA 4RX4A 1ORQA 2Q8BH 3NZHL 3C60A 1SJHB 3O9WD 5I16B 4C56E 5CILH 1NCNA 2B1AL 5TF1L 1U42A 5IOPB 3O6MH 3MODH 1VADB 3NFNA 1KJVB 5C08E 4X98B 4OCNC 4PJDB 4IM8A 1BVKB 5JO5B 1IE5A 2VQTA 5LBSL 4F7MA 1PQZB 1RK0B 1ZHKA 4R26L 1UM5H 5FO7B 3QPXH 3HRPA 1LK2A 4JJ5B 3DV4A 3MJ7B 4MB5A 2CRZA 4X5WA 1CXFA 3PV6A 4YHPA 1JL8A 5AD0A 4F7EA 1QLRA 2VXSH 2DMKA 4RQQB 3RTQB 5ISZA 4LCIH 2ZG3A 2R23B 3LMJH 2XNAA 4MXWH 2H8PB 3DVGA 3GSNL 2LVCA 2PO6B 4LF3A 1NAMB 4C4KO 4MJ6A 5FHAH 1NC2A 3QXAB 2IPUK 4QTHB 2CIIB 1I8LA 4O9HL 5IVZB 3KLAA 2HT3D 4AL8H 4JY5H 1RFDL 3VXNB 2JIXB 1CK0H 2EDKA 2YD9A 3PP4H 2R8SL 1FRGH 5E8PB 3HS0B 3VFVB 2EH8L 3LB6D 2VDOH 3C8HA 1S7RB 3NABH 1LE5B 4KZEH 2C3VB 1CGXA 5CIPA 5CZKA 1S7WB 4P2QA 5F9WB 3UJJH 4NM8H 4M5YH 4U1GC 1VHPA 3NIGF 4KJQC 3RUGB 1F6AB 3ARFD 3BOVA 3ZYOA 2Y9RT 2BCKB 4Y19E 3RNQA 1RU9L 3O3BA 4C83A 1CXEA 4U1KA 5GXBB 2X4SA 4XHJC 1WWBX 1BVZA 1UQSA 1JTPA 3K8LA 5IVXE 2AQ2A 2P47B 1ADQH 1M05B 1MRFH 1WICA 1QD0A 4LCCC 2VKXA 3VJ6A 4GKZB 1LE9A 1KTLB 3P77B 1UFUA 3BH8B 1UENA 1JGUH 4TTDC 4LLYA 3QNYB 5BO1H 4YLQT 2NY3B 1KCUL 4U1LB 3RWGA 4U6HB 2DKUA 1C1EH 4I3RH 4FTVD 4HMDA 4KZDH 4GRLB 2HMID 1J12A 3NCEB 3IF1B 3S88H 1MIEL 3MV11 3OGCA 1RJYB 4LSTH 1U8IB 3LPFA 3LQAC 3MMEB 4OIBA 4L8DA 4NN5B 2DLHA 4XCYB 3LOWA 2VLMD 4ODVH 4U7MA 1QZ1A 4U1HB 4G5ZL 5D8JL 3ARBC 2J8UA 4I3SL 5E7FA 3HI6H 5J4MA 5DJ0B 3SDXB 3V8CA 4JPKL 2AW2A 3WS3B 4N90D 3O2WL 4HUVA 1H3XA 1V7NL 5JOPD 1ZVYA 1G7IB 5JDJA 3MV8E 3QJFA 3UBXA 3DTXB 4OTXH 3H3PH 4Z7QE 5DQDH 1XGTA 4KPHL 5CLWA 3QI9A 1WT5A 1A4KB 5IB4A 1OSPL 4HCRL 1ZVSB 1N3NA 5FGBA 4EXKA 4CVUA 3KLDA 5ALCL 1I7RA 3BSZL 4JN1L 3RVWD 1H3VA 1F3JB 4HXAL 1IBGH 5EFIB 1E6OL 2PF6A 4KRPD 5DEZA 3UO1L 3AS3A 4E41D 3TNMA 3W2DH 2O93L 3F65A 2BOBB 1NFDA 4DQOH 3DARA 3GSUA 1A5FH 1HEZB 3ZDZE 3SDAC 4UU9B 1NBZB 3GSXB 1ONQB 3VD9A 4M6NL 5LGJB 3SDCA 3I3EA 4OFDA 2H2SC 1N6VA 5EIIA 4OZIA 1OQOA 2E5EA 5FM5M 5C70A 3S34L 1AC6A 4FQPA 1F5WA 4HFUL 3V5DB 4P2RD 5ANMB 3IFOB 3MA7B 5T5NF 1WEJH 3RGHA 5IFAL 1HOCA 1CLYH 1K8IA 1DUYB 3TJEH 4DVRL 4BZYA 4NQDB 2NY1D 4KVNL 5CSGA 1S9KC 3MQIA 3BZ4A 4ODUB 4GH7B 4DKEL 5ID0A 2GFBA 3MRNA 3FN0H 2X1XR 4OLEA 3OKMB 2AEQH 2IGFL 3NCYS 4S1RL 4M7JH 2CKBH 2ZUSA 3O6FD 3QUZB 3BP5B 1U8JB 4PJDF 4AENB 4X7DC 1XGYH 2Z31A 5TFSL 1J1PL 1I1FA 4H0HB 4P2OC 3QNZB 3TBVB 5J6GA 3S9DB 3L5WA 2BJML 4OF0A 4LNRA 4U31A 1N64L 5DYOA 4P46C 3JV4B 1NUNB 5F9JB 1NCDH 3HZVB 3CDYA 4A2LA 4Y4FB 4X6FB 2AXFA 4IEFB 3V6ZA 1DQJB 1HYRC 1EO8H 4UNUA 4D0BB 4G42B 2VLLA 1FZKA 4X99B 3VFGL 1U8NB 1FG2B 2LE9A 1AJ7L 1FL5A 4L9LB 4EDXA 5ISZE 1NGWB 3TZVD 3TBWA 1N0LA 3P0YL 1RMFL 3FONB 4ZD3L 4YXLL 2ZSWA 4MA8L 1BWMA 3BAEL 3O45A 1OLLA 5DI8A 4H5SB 1XF2A 1QA9A 2HFEA 2OL3L 3OAZK 1P6FA 1VFUA 2X42A 4NQUA 2QV2A 2C4FT 4NT6B 2WIIA 4PD4K 1SMAA 2BY0A 4OM1H 3RVXC 3UDWC 2DQDL 3VWJD 1RSFA 1TVBB 3R0MA 5IFHL 3D85D 1OCWH 5JXAL 4JCMA 4RRPA 1AQKH 4HC1L 4HFWB 4NNYB 3VGAB 3T4AA 1WBYA 5KVFL 1TTFA 4P2QE 3TV3H 3CDCA 1E28A 2XPGB 3K46A 3RUGF 5KVGL 2NMSA 3RHWK 1G6RA 1H3WM 1TETH 4RMTA 5TE7L 4X6EA 3O6ML 5SX4H 3MODL 3T0EB 2X4UB 2R15A 3WXWH 4E5XA 3PABA 2KQNA 3MBEA 1CFQB 2WWMC 1SY6A 5IP4A 4G8IA 4JY4A 1BIIB 5DQ9A 1MCOH 3L6FA 2V9QA 3QPXL 4D9QD 2WBJD 3F58H 4DCQA 3HRZA 4PGBB 5IM7A 2W0FA 5FKPA 1EH9A 3RPIA 2DOCA 2ICWB 4I4WB 3UTSD 3EUUA 5HYFA 3JUZA 5B38B 3RZCD 3D48R 4B0MM 4LCIL 5D1ZA 1XFPA 3FN9A 3DBXB 3UTZA 4HIJA 4BK5A 2CLZB 3I3DA 5TQ0H 1ZHNB 5FHAL 1A7BA 4U1IB 1UCBH 3QQ4A 1UACL 4WI2A 1CL7H 4AL8L 4JY5L 5D6CA 4EIZC 1CK0L 4XBPA 3BN9D 1DLHA 5K9QG 4QHMB 5KSBF 1FRGL 3AY4C 4HKZB 4MDJB 5C09D 2VDOL 2W91A 3SDXF 2J2ZA 3NABL 5ICXB 2EDTA 2AJVL 4KZEL 2DQEH 2J8UE 1OTUC 4U6XB 4X4ZA 2EE3A 3DROA 5DJZA 2XQBH 2COQA 1IT9L 4M5YL 1VERA 2M26A 4TOYH 3RTQC 3LKQB 4LLMB 4LIQH 3NAAH 3Q0HA 2CD0A 4JCLA 5T1MA 1KPVA 3WKML 5CEZH 1D6EB 4LCCA 4YQXH 1ADQL 3I6KA 4MA1B 2ZOLA 1IFHH 1MRFL 3RIAF 1S7XB 1QSFB 3P4MB 1YN6B 1J05A 2YSSB 1CFNA 4FN0A 4QRRA 4M6OL 3S35H 4P3WA 4OFYA 5E08L 5BO1L 4Q9RL 4TSCH 4OGAD 3G6JB 4NBXB 4OCSL 2G75B 5GQBA 1NFDE 1T1YA 5F9WC 1DN2A 2VZSA 4AJ0A 5F7HA 4FP8H 4KZDL 3CH8A 3S88L 4LSTL 3V4VH 5KJRH 1T7XA 1GSMA 1OTTD 1SYSB 3IAQA 4MHHG 4M7LH 1OGAB 4OZIE 1GOGA 4ODVL 1IM9A 3TWCL 3HCVB 4PFEA 4N0RA 4LARH 3G6AA 4PBXA 4RNRB 4P2CG 3OL2A 5DMIH 2FSEB 1OP3K 4V1DA 3RWIB 5H94A 43CAA 4HUWA 5BVJA 3D9AH 2NY3C 3IJSA 1H0DB 2DF3A 2JJUA 3FQNB 3FQUA 4MCYB 4QHLA 3AS0A 3TBTB 4OUUB 3H3PL 4GRLC 5DQDL 1XCQA 4NWTL 5TGBA 3UZEA 3FFCA 3HAEG 3ZO0A 4M00A 4KTEH 2F8XC 1CDHA 1AR2A 5C2UB 4NN5C 1Q9WA 3SJVA 3PHOB 1MCQA 1IBGL 1GPOL 2AK4D 3MRCB 5A16A 2P46B 4FQCL 2NY0D 1MRCH 2R56H 4WI4A 3TEUA 3W2DL 4L3CB 5DVMA 3CC5B 5C0DA 3SDAA 5TQ2L 1RPQA 3QA3B 1A5FL 3EJYC 4W4OC 1EFXD 2Z92A 3U1SH 4RGMB 1CGWA 3VFWB 2DQGH 3NA4A 3MCLL 4OZFB 3CDGA 5J11B 2PR4L 3C2AH 3TN0B 2ENYA 1AGEB 2I60H 4JM2A 3VGHA 1G1CA 4Z7UB 3CX5J 2GTZB 1EXUB 4K7FB 1CU4H 3CFBB 1L4IA 1YEKH 4WWKB 3RJDA 4P4RA 4NHCL 3GBNH 2DQCH 1W8OA 1PX4A 1T6VN 4U3XA 5DURB 4R4NC 3FFDA 4IDJL 2E9JA 1CLYL 2BNQD 3TNNA 2HJFA 4X7EC 4HEPG 4YX2H 5KG9A 1IGJB 1FJ1B 2Z9TA 4LGPB 1AKJD 3FN0L 2YUVA 3BGMB 1X5AA 5HTSA 1OY3B 2VZTA 2UYLA 1IQWH 3RKPA 2H32B 2EIZA 3GIVA 4O2FA 1C16B 3IDMB 2BSRA 1JZ6A 1XGYL 1G7PB 5C2BH 4JG1L 1JHKH 4LHUB 1A3LL 1T0NB 4XRCA 1NCDL 2AS5M 1XIWA 5HHMB 5ECJE 4CAGA 3VXRA 4QWWC 5B22A 1SVCP 3FKUS 2YD6A 1OD7A 3LN5B 1JV5A 1YY9C 3MRRB 4U1NA 1TZGH 3CCHA 5DMGD 3SCMA 1JZ5A 1V3JA 3EYUH 1T1WB 4LLQA 1BZ9A 3QUZC 2CXKA 3NCCB 2HKHL 2HWZH 1C7SA 4P3DB 1D5BA 3DVFA 3RX8A 1XR8B 4XTRD 1VFMA 1OCWL 1FYTA 2EDYA 1I85A 4PRPB 1P2CA 2RQ8A 4KU1A 4MVBC 5DJ8A 1AQKL 4Y4FC 1KJMA 5FF6A 4CMHB 3WSQL 5EC2A 4ODWB 4PRAA 3F6IA 3IDJA 5CSBA 4FG6D 1XGQA 3TV3L 2IQ9H 2EE6A 3CUPB 2E7BA 3QIBD 4L9LC 4H26B 1T3FA 4GBXA 4KKLC 2EDFA 4MXVE 5I1IH 2BDNH 3WKNA 4NDMB 5I1GH 4GG6B 5BZDB 3GMPA 3LQZB 3AM8A 3GSRA 4HUMB 4AK1A 1U8KB 5CUSH 1T2QH 4KKBC 5ESQB 3F58L 4MNGA 1HH9A 1GAFH 4TVPD 4ZSOA 4WDIB 3RL2A 1EMTH 4U0RB 4QRRE 3MOAL 2ED9A 3G6JF 3N1FC 5FAAA 3O2DL 1SJHA 3VGAC 3OGOE 2G9HA 1KC5H 4OGXL 4YE4H 1T22B 3K81A 5TQ0L 1QBAA 1RV6X 2ITCB 1VADA 3BWAA 1OM3H 2NX5A 4X98A 1T5XB 5E7BA 1BVKA 2BMKB 5CD5C 1BEYH 5HVFB 4Z7WB 3T0EC 3MGTB 3L95B 1RK0A 4ONGH 3KLHC 3VXOB 3QXVA 4PRDA 1W72H 4QHKI 3IDYB 1Q1JH 3C6LD 4DW2H 2VDLH 1QSVA 3LD8B 3MLRH 4RQQA 2DWDB 4JR9H 1ORSB 4FZ8H 1QPXA 4V1DE 1UVQB 1P53A 2DQUH 4TOYL 2PO6A 1EGJL 2NY7H 5BOPA 4LCYB 4ZQKB 5CCKL 1DLFL 3QHZH 4QTHA 1A6ZB 2CIIA 1UEMA 3EO1B 2EXWD 1IZJA 5F9OH 4WUUB 1T66C 5CEZL 1JWMB 3CZFB 2JIXA 1J1OH 2YPLB 4FQXD 3MRIB 5HJ3B 1DFBL 3FFCE 2WINB 3PWVB 1IFHL 4PJBB 3HS0A 3VFVA 4UT9H 4FQIL 1F3DH 3SJVE 3HNSH 1HHHB 3BKJH 4X7FC 1JYXA 4F9PC 1MVUA 5A3IC 3S35L 4H1LG 1S7WA 5JHLH 5T3ZE 2WWKO 5IQ9A 5IB3A 1QBBA 2A38A 3FQXB 4TSCL 4UAOB 4XBGB 1N4XH 5DEFA 3RUGA 3DUSB 5F44A 4N0UB 4FP8L 3Q5OA 2BCKA 1Y18B 3IXTB 3TPUB 4KMTH 1BAFH 4H88H 5KJRL 2XICA 3UYOD 4Z7UF 1FLRH 1M05A 2XTJE 2X1QA 5J1AA 5KSAB 4GKZA 2XFXA 1KTLA 4MA1C 5FA3A 4WI7A 1LDSA 4GFTB 1EBPA 3QQNA 5DRXB 4JO1H 4U6HA 5ACMA 4I0PD 1FH5H 1D5XB 4NFDA 2ADGB 1CXKA 5IFJB 4GRLA 2L0DA 4GT7A 5D7KD 5DGQA 4ERSL 3RPKA 2VABB 4UBDC 2PW1A 1RJYA 3LN4B 1U8IA 1A1OA 2PYED 4Y5YB 1A6PA 3W9DA 2DM3A 2UVFA 3ZE2F 2CIKB 3VWKB 2HAZA 4KTEL 4XCYA 4U1HA 2XN9B 1XGRB 1HXYB 2PXYA 1NLDH 1XGUA 3FB8B 3QUYB 1MRCL 5HDQH 1NMCB 1XEDA 1IZKA 4YPGA 5DJYB 3RI5K 3VXRE 3W39B 5DO2C 5DZOA 3CGTA 1NMBL 3ZKMD 4Z95H 3D18B 4L8CB 3U1SL 4OCWH 3DMMB 2DQGL 5IMMB 5C0CB 1A4KA 4MMZC 2A0LC 2EKSB 1ZVSA 1T0PB 3C2AL 1CDYA 3QWOA 5IBLD 2E9WA 5FUOL 2HRLA 4KROB 5AYUL 1F3JA 4KQ3H 4P5TB 1CU4L 1I1AD 3QDGB 3QSKB 3MRDB 4UUJB 1YEKL 3H9SA 3TO4B 3GBNL 2DQCL 3QWRA 1MAMH 2EIEA 3ARED 3A6CL 1NCWH 5CIPH 1MLBB 4LPUA 2ZCLH 1FYTE 4RMRA 2BVEA 1MFCL 1P84K 4UU9A 5DUBA 4MAYD 5IMLB 3GSXA 1KXQE 3MREB 3W82A 1E4KC 4AG4H 4OQ1A 5LGJA 1IQWL 4RGMC 5MEND 2DL9A 3BPCB 3IS0X 4GG6F 4LMQE 4YK4B 1IKFL 1TZIB 4K3DL 5J11C 4Y16B 3N9GH 3TN0C 3OXRB 2P24B 1NGPH 4EUPG 1II4E 1V3KA 3IFOA 3MA7A 5E4EB 3VGGA 5EO0A 5ICYB 5F72S 4OIIH 1DUYA 4WWKC 4Y5XB 1JJUA 4D0DA 2IFFH 3MACL 2IQAB 3QHTC 1BOYA 3BGFB 4MNGE 4ZSOE 1S5HA 4CMMB 3M1BB 3OKMA 4P9MH 4GW4B 3VG9B 5FOJA 2AJYH 5C9JB 5JW4M 4FFZL 3D87B 2D9QB 2GITB 3L3GB 1TZGL 3QUZA 3BP5A 1AD0A 1U8JA 3X11B 4AENA 3B2VL 3UJTH 1HSAA 2NX5E 3H0TB 4APQD 4Y2DB 2I27N 2P8PA 2HH0L 3HZVA 1F13A 1SJXA 3VMOA 1LMKA 1JWSA 4Y4FA 4FOMA 5HGDB 1DQJA 4UOW0 2X70B 1TMCB 4G42A 5F7EL 4X99A 3VRJA 1U8NA 1FG2A 3MRQB 4ZOBA 4L9LA 3CMOL 3RWCB 5DT1L 3FONA 3F7PC 4ORGA 3PWLB 4MZ3A 3TH3T 1PG7W 2X4RB 2BDNL 1OWRM 4PJBF 4TTGA 3QG6B 5D2LB 2ZOKB 1TVBA 5AG9A 3W5NA 3IDUA 4IHOB 2XG5A 1JGVH 4RMVA 1GAFL 1EMTL 1UWXK 3MV01 5ITBH 1RHFA 2XPGA 1FNSH 4KXZH 4HK3N 4CMHC 1RI8A 1YZZA 4UNTA 4WI9A 1IKNA 1KC5L 4KMLB 1X3DA 1J8HD 4YE4L 3RUGE 5CEXB 1WWAX 3LZFH 1A9EB 4GMSH 2X4TB 3T0EA 2P43B 1OM3L 2X4UA 1A14H 5HDLA 1N59A 1RUMH 4Z0BL 1CFQA 3KWWB 4ONGL 3REWB 1BIIA 5JHDD 1FC1A 2AABL 4ZAKD 3DO7B 3W0WB 2Q76B 3RL1B 4NZUH 1JGEA 1W72L 2VDLL 2ICWA 3MLRL 5B38A 4WGWB 4JR9L 1FZMA 3MRJB 3WXVH 4U0RC 1G9ML 4FZ8L 2CLZA 3VXUB 2ITDB 5EN2B 4JFEB 5I6XB 5L9DH 3WS6C 2NY7L 1ZHNA 3MRFA 5EULV 4U1IA 5AAMA 3QHZL 5F9OL 3OF6A 5IB2B 2HT4C 2HFGL 3CK0H 1FP5A 3VDCA 4HKZA 4F9PA 4ZTPH 4UT9L 3PNWA 4QCIB 1BQHB 3LH2H 5ICXA 1UZ6F