3H9SE

The complex between tcr a6 and human class i mhc hla-a2 with the bound tel1p peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
b'NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASRPGLAGGRPEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T cell receptor cross-reactivity directed by antigen-dependent tuning of peptide-MHC molecular flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2009-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9sE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9sE02
1JHTB 1A0QH 3MLTA 3MXVH 5HI4C 5C9JA 1KLGA 1L0YA 3OAUH 5HVFB 2HVJA 2NTFB 4NM8L 4Z95H 1CD1B 5F9WC 5GS0D 1HSAA 1BAFH 1B2WL 3DV4A 2DBLL 1NCNA 3EHBD 3QG6B 4FQLH 4GS7C 5JOPE 3HMXL 3S8WA 3RY6A 4FRWA 5EO1B 3RI5F 2VDKH 4XVJH 1U8QB 3I6KA 1DN0B 4P2OC 4GG8A 3SE3A 1S9YB 4LBEA 1MRCL 3RBGA 4BELD 1P6AB 3MRGB 3PWNB 3EHBC 4LDEB 3S98A 3LB6C 2R8SH 5I1CH 4HBQA 4G42A 3FRPG 1JRHH 2EDDA 2VLJD 2VXUL 4UT9L 2XA8H 5FA4B 1DUZA 1CF8L 1G7JA 4LSSH 1S5HB 2R29L 2VITA 1DLFH 6FABL 3M1BB 3QYCA 2C1OA 4OCWL 4X5XB 4Z7UF 3RTQA 5CLWA 4U0RC 4HUMB 5E99L 4J8RB 1HHIB 4U1HB 4U1LA 5INCA 2CLZA 5GS0L 4WW1A 3V6OC 4QNPF 4PGCA 3D2UB 1JPFA 3ZKXB 5C1MB 1QFUL 3S88L 2ESVD 4YPGA 4OKVA 3UX9B 2HT4C 4LCCB 4LLVA 2C7UA 1CGUA 1FC1A 5HDOA 4MDIA 2Q3ZA 4ODUA 3VFRA 5CEZE 2VIRA 1DBJL 4AIXA 5H35B 5D96C 3GSQA 4JJ5A 2G75A 2HRPH 3CCHA 4RFNB 5F71A 3Q1SL 4J12A 3OHXB 4JQVC 3VXRD 2ZKHH 1DBBH 1IAKA 5D2LE 4DGIL 3RDTD 1N6QH 3GMPB 3RP1A 2ENYA 4XP6H 4PS4L 3RUGE 2DQEH 3BUTA 1INEH 3I02A 1F6LL 1ADQA 2ZNWA 1FLRH 2CRYA 2Y6SC 3L7EB 4YHYB 2EICA 3QRFM 1SY6A 3GIVA 4ZUSB 1Q94A 3RU8L 1I8KB 1BGXL 2AKRA 2OJEA 3MC0A 2YC1B 3PDGA 3U0TB 1TIUA 1NFDE 5C08A 3LPGA 4JFPB 3PL6B 3TLRA 4JZJB 4MNHB 1U8NB 2B0SL 3W39A 3GMLB 2PR4H 2EDRA 1A4JB 1KTKE 1IT9L 3NGBC 5C0CD 1HYSC 5BMFH 1GSMA 4DEPB 2E6PA 5F9JA 1VGEH 4RSVA 3EO9L 3FQRB 4G8GD 1Q72H 5JLZB 2QSQA 5EZIL 4LEOA 3MJ7A 1JUFA 1A6AB 3C5ZA 3KJ4C 5CJOL 3O2DL 1IEAA 5DD1H 3VXNB 3OJVC 3TBTB 1ZGLM 4RAHA 3VW3L 3TCLB 1QBML 5C09D 5L2KE 2ZSWB 1RK1B 1UZ8A 3LQZA 1CCZA 1QRND 4U31A 1JV5A 2WUCH 2ED7A 4PJ5A 3G5ZB 4KRPC 3RWDA 2VDMH 1TVHB 1Y0LA 2APTA 3TBSB 1MQKL 5BVPH 4FQ2L 1K6QL 4AZ8A 4FQ1H 2GTWB 5AYUL 5IG7B 1W72L 5DUMH 1B4RA 2NLJA 3V9FA 2NY1D 5HPMA 4G9FA 4PY7A 2Z91A 1AIFB 3H9SB 3SE4A 1AD0A 3NZ8B 1NGPH 3MFFA 4ZXBD 4AQ1B 2NY1C 4ZTOH 2DLIA 5B38B 3D85D 2XKSA 3GJFH 8FABB 1WIUA 1H3GA 5I1JL 5DZLA 2YA2A 4LVHC 5DT1L 3VD5A 4NZTL 2Q7NA 3BZEA 1BLNB 5JR1H 4ZXBC 1RIUH 3C5SA 5H94B 5IHLB 1MJ7L 3GMQB 1KBGL 5FM8A 1GIGH 5FO7B 2A0LD 3BHBA 5D2NB 1VADB 3T0DA 1UGNA 4HUKB 5JW4M 1HHJB 1IBGL 2SEBA 3MRMB 1FJ1B 1IL1A 4AMKL 1UWXK 5C0AA 4NCC2 4M6MH 5CMAB 4WI2A 3W0WE 4CN1A 4CW1B 3O6FD 3U9UB 4UV7L 4YDLB 4WV1C 5FKAA 4QHUA 2W0KA 5BOPA 3RVUD 5KS9E 5EUOA 2XKNA 2H1PH 1IGTA 4DW2H 1UB6B 3PHOB 2A73B 2C3VB 1NCDH 1XR9B 2NY2D 1A9BB 3VE0B 3EUUA 1RU9L 3QUYA 5E00A 2NY3D 3CNKA 5I1HH 3PGFL 1OSPL 3BGFB 3HI6H 4IOSD 1FFOB 4UINL 2P8PB 1IC5H 3SQOL 3IDJB 2OBGA 1N8ZA 1LO0H 2ADGB 2NY3C 3DGCR 43C9A 1QBAA 2YR3A 4XWOD 4JFOB 4TYUA 4R0LA 2R9HD 1NCUA 4POZD 4OGAC 4UNUA 4QOKB 2NX5B 5E6ID 1G7MA 2AK4A 5DEFA 2Q86A 2AV7A 1N4XL 1Q8MA 2WWMC 4JFQA 5IBLC 2P49B 4G8FA 4PRPE 2BNUB 2ITCA 5ACLA 4GG6A 4S11A 4K7PX 2JJUA 3T2NH 4A6YH 1L9MA 1R5IB 1T7WA 1YDPA 4PLNC 3GKWL 4NNPH 4POUB 3LPWA 4L29B 2IALA 3BDYH 4RGND 2IFFH 3RNKA 3QUXB 5DD5H 3UTQA 1CD0A 5FYLH 3NPSB 5IFAH 1TJHL 3G5VA 4QRPA 4P48A 4NC0B 2I27N 1JPSH 2J6EL 4KU1A 3TC9A 5I1IL 2BNQD 2CK0L 5IT2H 4ORZC 3SO5A 4HT1H 2LU3A 2YD7A 1EZVY 3F5WA 4JM2F 1CDUA 2YMXH 4WFED 5T5FL 3H9HA 4OM0L 2EEBA 3C2AH 2NXYB 2YD1A 4WFFE 5LAXA 4EKXA 2Y7QB 5DK3A 5GRUL 4O5LH 4CAGA 5DA0B 5EU3B 1ED3A 1T6WA 2IQ9L 5DC0A 2AP2A 4P3CL 4WO4A 5FHAH 1PKQB 4OLZL 1JGDB 4Y19B 1CICD 2JJWA 1DEDA 2MWCA 3X13B 2WIMA 4NO5B 4F3FA 3WXWH 5E2TH 2R69H 4QF1B 3ZL4H 2BXZA 4K07A 3TYGL 1CIUA 4FQJH 2KL6A 5B8CB 4DUWA 3WS6C 3TZVA 1V7ML 1CL7H 1GOFA 1R6VA 4QXUH 4RMTA 5A2LH 3O6MH 3BGMB 3O6KH 2C9AA 3ALXA 3H2WA 1LEIB 3P4OB 1MFEH 5IVOA 5HGGS 1IEBA 4IMLA 3SDAD 3VRLE 4BQBA 1ORQB 2CIKB 3O11A 3AVEA 1L0QA 1BJMA 4Y16C 2PTTA 4LPVA 4CBPA 2DMCA 4M4RA 5BO1H 3GI8H 2HFFB 4G6FD 2R0WL 3BVNA 2DWDB 2D9CA 1QKZH 3V6FA 3SDDB 5D1ZA 4ZFGL 1S9WB 3IDMA 1YMMD 4GKSA 1EEYA 2K3TA 3TPUA 1B88A 3BWAB 1XF2A 4ZMAT 5E5MB 3OG4B 1G7HB 4Z8FL 4LHUA 4P9ML 1M05B 2OXHA 1ZSDA 4YXLL 3CLEL 1D9KC 1RZKC 3IDNB 5HGHB 1EXUA 3TJEH 3DTXA 4UIKH 2E6JA 2QADB 2NW2B 5I16A 3BH8B 3DX9B 4JFXA 5J57B 1RJLB 1DE4A 3WFBH 5D1XD 3BW9A 1C12A 3KPRD 2X4SB 4A2LA 1ERNA 2J1KA 4O2CA 3QNZA 1E0OB 3QDMB 3PWVA 5E8PA 4CJ0A 4ELMB 4HH8A 1G1CA 2NZ9D 4LNVA 1WWBX 2YUZA 1YY9D 1YN6B 4IBLT 1S7XA 1GZQA 4HGWA 1RZ7L 4OQTH 4P2YA 5FUCC 4LMQI 4LSPH 1OGTB 1YEDB 1EO8H 4HUUB 3QEQD 2BSTB 5GPRA 2DI9A 1RZKL 2WV3A 1KC5L 3MROB 3MV9A 2DJ4A 3O3DB 3CFKB 3ZE2E 5CZKA 3TWCH 1T7VA 3ULVF 5D71L 1T20B 1NDMB 1KB5L 3FT4A 5D2NE 3MRBB 5LCVH 1H8NA 2QL1A 1I4FB 3I75A 4KDVA 4NKQB 3UAJD 4OSUH 3EDDA 4HJJH 4I48B 1Q9KB 4UILL 1SBSH 1M6OB 4X4XB 3VFMB 4XNMB 1BEYL 1KPRA 4UNVA 4PJHB 4YX2H 4UOW1 1K8DA 3RY6C 1OSZA 3UTTB 2E7HA 2QSCH 5AWNL 3O4OB 3SE3C 5TE6H 1AHWB 4JM2B 5FIEA 3RKPA 1T1XA 4X7SH 3EYSL 1K4DA 4RISH 3RTQD 1FAIL 1F4AA 3DXAB 4B41A 5IWLA 1JWUB 4YHOH 1A14H 1BVKA 2F74A 3NIFF 5I1LA 1RUQL 1S8DA 1TZIA 1Z5LB 1RHHB 3EOAB 3JZ7A 3BT2L 2HLFD 4LSRH 5T3ZH 3U30B 3FOLA 1YQ2A 4YXHL 2CKBB 2MJWA 1AKJA 1XR8A 5GQBA 5IB2A 3MREA 3OGCA 3GGWB 4XMLL 2NX5E 1RUPL 5FXCH 5IHUH 2A6KA 5AYQA 4E42B 1MLBB 5LGHL 2AI0L 4Q9QL 3KDMA 4LLMB 5HHPB 3BP4A 3KPMB 5IHZA 3U7WH 1JGUL 4HIJA 1FGVL 4ETQB 1AE6L 2CLVA 2P8LA 4H20L 3HC3L 2YXFA 4ZG1A 4TUOA 2Y72A 1JGEB 4XNZB 1EH9A 1S7SA 1IARB 4HV8A 1RZFL 1N59A 4LHJB 4X80L 2FEEI 3EYOA 2JIXA 1J1PH 5BJTA 2VXQH 5DJ0B 4L4VA 1U8JA 4IJ3C 4ZODA 1DQMH 2X4RA 1I1YB 1N64L 1DUYB 1T7ZA 4XBGB 4R96A 1QLRB 1KN4H 4F37K 3MV7D 2C3HA 1NDGA 4TPRL 5IQ7L 3O6LL 4M3JA 3QHTC 4NPYB 5JOEA 5D7IF 5T1MB 5I2IB 4QCIA 5DEGB 3DUSB 4APQB 2ZSVB 2OXGA 3FQUA 3MMEA 3ROOA 1TITA 4DN3H 3WE6A 1RVFL 2IG2L 5FYKE 3NACL 3JTSA 4AENA 5K93A 1PKQE 4JFEE 1OP5K 4PJ7F 4MJ6A 5I17A 2E7LA 1UKQA 3RRQA 4OD2B 4GMTH 3SY0B 4XP9L 1ADQL 5F44A 4QRUB 1QHPA 2Z4QB 4KQ3H 1FZKA 1TJIL 2VL5B 1SY6L 3NA9L 3INUL 2BY3A 4KKBC 3T1FA 1RPQA 3FCTA 1WZ1H 4M62H 4UDTA 1HXYA 3C5ZC 2UUDK 3A6BL 3EO1A 2WBJB 3ZYZA 5SWSE 5K9KB 4PJEB 3WIHH 3C60A 1MCWW 5L88L 5ALCL 1J05A 1FV1B 3U9PL 1B0RA 2NY7L 2VQ1A 3MJ9H 3MNZA 1G7IA 4K2UL 4GBXA 3QI9A 1CT8A 3D3VD 2BOBA 4PV8A 5IW6A 3MO1A 3O41B 5ISZE 5DJYA 4M8VA 4NFDA 3H0TB 3WNLA 2FBJL 1FAKT 1FNLA 4G9FD 2FJHB 5JDSB 4MQTB 1S7TB 1UJ3B 5MP6L 5BRZA 1NCBH 4XMPL 2Z31A 3FO2B 3T77A 3T4YB 1T1ZB 3QXAA 3MA7B 2FB4H 4WUUA 4F33A 5JNYA 3SE4C 4RZCB 3MRKB 5IB4B 3V7AE 3L1OL 1WIPA 4OIIH 2V7NA 5I30L 3OXRB 1MCBA 1IGML 3K46A 5EOTA 5CEYB 5D7JC 5I18H 5DD3H 4KVCL 4Z0BH 4QXTB 2DMBA 3H3PL 3H3KA 3MBED 4M93C 3IKKA 4UBDD 1VERA 5EZOL 1C7SA 1ZV5A 1X7QA 4ELME 5F7EH 1IFHL 1ZA6B 4P2RA 2A9MH 2B5IC 1JYVA 5DRXA 5JXEA 4HUVB 4ZPTB 3IKCB 3W11C 3MYJA 5C0AD 2ZCHH 1ND0A 5AG9A 5I15L 3ZYIA 5C0FB 4P2QD 1ZLSH 3K8MA 3MXWL 1HKLL 5IB5A 3B8YA 2BJMH 3C8KB 2F19H 3SE8H 5I76A 5B21A 4NGHL 3ZKXC 1U3JA 4WW2C 3S96B 3T2OA 4HDIA 2ZOKB 5CZVL 2DQCL 2BC4B 5TQ2H 4YDJA 3VXQB 1Y6NR 2QKIB 3NFNB 4BZYA 2YN5A 3MV11 1LDPL 2F9BT 1UZ6F 4FQCH 4K3EH 1E6OH 4UT6L 4NQEA 4L8BA 1WBYB 3L95B 4LSVH 1XH3B 1SYVA 4WTZG 3QUYD 3V79C 4JO2L 1F4XH 2DWEA 3SKJH 2B2XH 2ICWI 5F1IB 3KLHD 5T1KA 2LVEA 1N5AB 3S36H 4WI4A 2YBRA 3E2HB 1D5XA 2DLEA 2E6QA 3STLB 5CGYC 3JWOH 1P4BH 3B43A 3S37L 5D7IB 2HVKA 2K1MA 2QEJA 5E08L 4OCRL 4D9RD 1PAMA 2AK4D 3HCVA 2EXYC 4M7LL 4AIOA 2EH8L 3UTZA 3UZVB 3HHRB 5I19L 1L7IH 1MQ8A 5LBSL 4R0LC 3QO1A 4XNQB 1OY3B 5GJTL 5C0JB 4M6NH 1PZUB 1ZVSB 1W0VA 3SOBH 4O51A 2PXYB 3DROB 1M7DB 1ZTXH 1AQKL 1ZANL 2F8VA 4S2SB 1KYOK 3P30L 1I7RA 3MGOB 1JN6B 3GRWH 4FMKA 4PJGB 2NR6D 1RMFL 1SM3H 3IRZA 1XGQA 4G6KL 4QRPD 2F53A 3D39B 5KVGH 3MYZA 4GRLA 4LSUH 2PYFA 3GNMH 5ICYA 4OF5A 1OTUD 3GJFB 1OF2A 4OAWB 4L4TB 2F54A 2DQDH 2VZ1A 5IJVA 2DIAA 1LEGB 4QXWA 2D7PA 1CFVH 2XQYK 4TULL 2DN7A 2P5EB 4G43A 2OZ4H 3UBXI 3GSUB 1F5WA 4NT6B 1LP9F 1JTOA 2XACC 4LHUG 1FBIH 2XZAL 4QRRD 3DYMA 4WO4D 4TNVK 3V95A 1MFAH 4MB3A 2JJSC 3WLBB 1UM5L 5KSUB 2CR6A 3BRFA 2H9GA 5KW9H 2DBJA 4HSQA 4YHPB 1S9VA 3PHQB 2GY7B 1IM3B 1I9JH 3NZHH 5GGUA 3SE9H 1QO3A 2HJLB 3TZVD 3B9AA 4DKFH 2ICEB 1GZPA 2YKLH 4KK8D 3P9WB 4GAGL 4JN1L 1ZLWK 1FH5L 3C87A 1KEGL 3BPOC 3OQ3B 4HHAA 1QSEA 4KKCC 4XI5D 1ONQB 1QNZL 2G2RB 3BXNB 3W9DA 5HYJE 4NRXA 3L7FA 2DM7A 1RY7B 3U1SH 2X9YA 5IMLA 5INDA 4ZFZA 5HHXL 3S3PA 2XPGB 2XWBB 1DSFL 3RWCA 4XVTL 5D1ZD 1BBDL 3U36B 3LS5H 1N0XH 4GAYA 4OLVL 3N06B 3EYUH 4RFOH 4XCNB 3WUWA 4I0PD 3GB7A 4LHUD 2AGJH 5D1ZC 2FL5B 1NCCL 3OR6B 3SJVE 3RKDD 1T1YA 2LQRA 3DBXB 4ODXB 5C0GA 1YQVH 1Q1JL 1ZS8A 1ZT1B 2FGWL 1NQBA 2N7BA 4RRPG 3B2UD 4NDMA 4XP5L 1ZGLB 3BEWA 3VGAC 2CDEB 3Q0HA 4JQIL 4E41E 1TVDA 3ORJA 3MJ8A 3VXUB 3BWUC 3WSQL 2XG5A 2EDXA 1KFAH 3ZYJA 3LS4H 3EYVA 2KZWA 1T22A 4HIIA 5IESL 1JL8A 3B2UC 4EI5B 3VFVB 3T3MF 3MCLL 4NP4H 1CG9A 3KLDA 4MMZC 4HK0A 1KG0A 3GSNA 4X6DA 4PJ8A 4U1SB 2RFXB 1UACL 4XVSH 2AXHA 2UWEB 1JTTA 1I75A 4KJPC 4Y8DC 3KXFD 5KS9F 1FRGH 3SDYH 3T65B 5F21B 1NGXB 1BQHB 2V6HA 1CQYA 4KFZC 2R4SH 2Q20A 5JA8B 4L3EB 4R2GD 1MI5E 4OFYA 4TTDD 1AXTH 4Y5YB 1S7WB 2RCSL 4WWKA 3RIAF 2KZ1B 3G08B 4DCQB 2V2XA 4HKBB 4ZUWB 1FNGA 1FLTX 2Z9TA 5FECB 4CVUA 1X5HA 2ARJB 2F58H 4PJ7A 4R2GC 1ZHBA 5EUKB 1T0MB 4DVRL 1RIVH 4ZQKB 3QNXB 1KJMB 2PNDA 3HUJA 4NQSB 2FECL 4MAUL 4QYOA 4G9DA 3Q6GL 1ZEAH 3SKNB 3QFDB 4GQ9H 4NQCA 3MRHB 4JB9H 2J2ZA 4ENED 1FQ9C 1W8NA 3IGAB 1HZHL 4RX4D 2YSSB 3LN5B 5I1AB 1LP9B 1FYTE 1MFCH 5E94A 3FB7A 1H0DA 1IAOB 1RZ8A 3FO9B 5F7DB 5IWLC 3MUY1 2DLFH 1AKJD 5IVXE 2EXWC 1G7PA 2VLRE 2CUIA 5MERA 3HR5A 3KNBB 3KPPB 1JFQL 5IBTL 3OTTA 3S4SG 3P0VH 3BESR 2AV1B 2NXYC 4EQ2A 4J23A 4JFFE 1K8IB 5B39A 5IBUB 5DC9B 3KLAB 4H88L 3UYRH 4PJAE 1F90H 1RJZB 2YRLA 3WV0A 4DGYL 1X5IA 5IOPA 4LLDB 4Q6IC 1OPGL 3OKMB 2IEPA 4X6FB 3DVIA 3G6JB 3V0WL 3BX7C 2ZCKH 2WIIB 2K7QA 5IGXH 4G80A 4XNYH 1S7RA 3U46B 5CCKH 1Q9OB 2DYPD 4YZFF 1MJUL 4MD4B 2FJFA 2H2PD 2JIXD 2VH5L 3TBWA 1H15B 3CJJA 4WFHD 4XPGH 1NBVL 5F89B 1R0AH 3EDKA 5BV7C 3V52H 3QDAA 3U6RB 3BZ4A 3E3QC 2OK0L 4YDKL 4P5KA 4U1MA 4N0CC 1NUDA 1KCRL 5LG1A 2Z93A 5C0EB 5J06A 1F4WH 4YO0B 3JV4B 3P77B 4NC1E 4RFEA 3I85A 3E1F1 2BVEA 5DQJA 3QPQC 2BCKB 4Z77A 2N1KA 4NN5C 3RNQB 3DV6A 5GGSY 3BJ91 4YQXH 5C7XH 1TXKA 2LU4A 4LASL 1S7VA 1JZ7A 4PJFF 3VRLF 5KN5A 2CPCA 3VMPA 1XGPA 4FQPA 4A6YA 5DYOB 5FCUL 1T3FB 5BV7L 4PRIB 4OF0A 5GS1A 5GSVB 3BDBA 4ZFOB 4JHZA 4DKEL 2YPKB 3CFBB 1B0WA 3QULB 2E7LC 1CLOL 5L7XL 1MHPL 3BPLB 4C59B 2COQA 2EDTA 4P99A 3L9RA 5HBBA 4K94C 5T3XH 2CGRL 5E4EB 4ZSOB 3C60D 1QYGL 5D2LA 1QR4A 4AM0B 1AXSA 1I85A 1G9NH 4GBXD 3CAFA 3QI9D 4HLZH 3HR6A 4K8RD 3WBDA 3OSKA 4FQHA 2EKSA 2QQNL 1NC4A 2JJTA 3L3KA 3C60C 5HY9B 4FQQA 3RUGA 5AG8A 3BE1L 3C5JB 5EOCL 3SDXE 4TUJA 3PWPE 3GIZL 2W0FA 4GBXC 3QI9C 4MDJB 5BRZD 4C56D 3AAZB 2X1QA 2Z31D 5HVHB 4R4BB 2R0KH 1DVFA 3U2SA 2Z35B 3BQUA 4YHNA 2EDNA 4IS6A 4NFBA 3R8BB 4JO1H 5E1AA 1Z9SA 3EFDL 3IDXL 2KQNA 4K71C 2DM3A 4FQXB 4K94L 4NKDB 1G6VK 4JY6A 1A6UL 1S7QB 1NFDA 3MR9B 3MODH 2CLRB 3QCTH 3QIWD 3QO0A 2HLAB 4OUUA 2P44B 2AQ2A 2XN9D 3ZE2F 1YYLH 2RGSA 3LAFA 3VG9C 4NJAL 4FZEL 4HIXL 4IOIB 4I0KA 1C5BH 2PO6D 4EVNB 5IV2B 2OSLA 4FXKA 4P2RD 5ETUB 4WI5A 2NY6D 1EEQA 5FYJE 5JXED 3PGCA 1YN7B 4F9PC 4YE4H 2VLMD 4PGEB 1TETL 3DX7B 3T0BA 1XZ0A 1PSKL 1OWRM 4MJ4A 1HHHA 3OKNB 4BFBD 5JXEC 2PTUA 4O4YL 1GHFH 2VWEC 3MOBH 1QQDA 1OAZH 1XEDA 2FIKB 1UM6H 3DSNA 5E8OB 4LCUA 4M7ZC 4ONGH 4M1CD 5L2KA 1FIEA 1V3MA 3MGAA 4HKJB 1HE7A 4WFGD 2AW2A 4NQED 4D0BA 4M1CC 4KKAD 3CH1A 1T66D 5I75C 4Z6AT 1UT9A 4U7MA 3QDGB 4MJIB 1GC1H 1VFOA 1J8HD 1UWEH 5D7SH 4NKMA 4XC3L 3HPLB 4JFDB 5KSBB 4I4WB 1FVEB 1T66C 4P49A 3TA3A 4P59H 3KYNA 2FCBA 4M8QA 3GMOA 4WU5B 5J6GA 1MFBL 3T04D 4I3GA 1A6VL 2Z8RA 4XAKE 4XXDA 4FTVE 1CTNA 35C8L 4X98A 5AEAA 3RX8A 2BVQA 4F7MA 4ZUTA 2QSVA 4ZD3L 3KGRA 4GOSA 1HI6B 1HQ4B 1BFTA 1RUKH 5F72S 4GSDL 5D93C 1YEGL 4GW1A 4NWUL 4ZFFA 3ARDD 4PJ9B 1UENA 1OAUH 2ZUQC 4LQFH 1JWSA 2HN7A 5A16A 2F53D 4YWGH 1Y6MR 1JHTA 5IF0A 3OKDA 3OMZA 4GRLD 3MBXL 4OLWL 4Z7NF 8CGTA 3QWOA 4G6JH 2DDQL 3G6JE 4X7FC 3KYAA 3FT3B 5KS9A 2GQHA 4H1LB 4YBLC 4YHIB 5T5NF 2WP3T 3MZTA 3NN8A 3K7UA 4GRLC 1OGAB 1A4KB 3K1DA 4LCYB 1X4ZA 3TNNB 5FDWA 2X4UA 3DSFH 4R3SA 3FQNB 5HYIA 5ERWA 3ZDXE 5JA9A 1MCPL 2V17H 3F7YB 3FTGA 4HS6B 2B20A 4WGVB 3MRGA 4DFHA 1SMOA 4PG9B 5C6TL 2WBJC 3ULVC 4Z0XB 5HHNA 1WITA 4N5ED 5FDYA 2YUVA 3GEWB 4Z5RB 3F8UB 1I8MB 1GVIA 1OARL 3QT2A 4K7PL 1V7NL 1S5HA 2MPAL 4HGKC 5I73C 5LGJB 4N5EC 4KPHL 3QCVH 5DJDB 5EPMB 5J12C 4KRLB 3P4NA 5I1CL 5J6HB 2PCPB 1E4JA 3BAEL 3JV5A 3GHBH 1QSED 2PYEE 3IETB 4N9GB 3E6HB 4JFYB 4MXVE 3FB8A 1BPVA 4PRPA 2IGFL 5CIPH 3ULVL 2X40A 4PRIE 4GKOA 5FGBA 2J4WL 1DFBH 2NY5C 1ZWIB 2IAMB 1BIIB 2OMBA 1BOYA 4OZHE 3ARZA 2OS7A 4AJ0A 1IKNA 3THMH 3P9MB 1ITCA 3P3YA 5I1EL 5ACZA 4W81A 3WFZA 1CFSB 3IFNH 2C26A 4K3HA 4OFKA 5H35A 2ESVE 4EEEA 3BISA 4MCYA 3EYQD 1U3HA 4ZSOE 2X1XR 1CBVL 5E8DL 1UB5A 4KROB 3TYFB 3N1PC 1A6TB 3R06A 5CD5D 5JIIA 3KLSA 4POYA 3IFPA 2WINB 1KJVA 3S5LB 4OGZA 1U8PA 2X4TA 4F57L 2XA3A 5TQ0H 2Y5TB 3GSRB 5L8JB 4MX7B 2YPLB 2NY5L 4Y88A 3A6OA 4XCEB 4PJIB 3OXSA 5ESVA 4K3DH 1A1NA 2ZKHL 5L6YH 3UEZA 3CSPA 4EUPH 5I1GL 4OKDA 1KTDB 4KDTA 4OZFA 4NZUH 2FRGP 3E6FB 4PJ8D 4HQQH 2YC1A 3GBMH 4S0SD 3CPLA 3UJTH 4PRDB 5E6ZA 4JFPA 4LP5A 1MPAH 1P7QB 3O2VH 3PL6A 4F7TB 1IQDA 3QCUL 4X99A 5H2BA 5E2VH 4TVPE 3DVGA 3BYYA 1KJ3L 2V2WA 4PJ8C 3IFLL 1JNHA 2A83A 2H45A 3E2HC 3CMOH 1A4JA 3TFKC 3BUYB 4OFYD 2R1WA 3UMTA 4IRJA 1MREL 2AEQL 3GJEB 3FQRA 5FYJH 4L5FL 4WWKD 1MRDH 1W8OA 5TDPB 3ULUH 1MELA 1EMTL 1MUJB 1I8IA 1QHOA 4JRYB 3TN0D 5C0RH 3IU4L 4J6RH 4XMKH 5IHBA 3AB0B 3B2VH 5T1DL 1A6AA 1S3KL 4WWKC 1QR1A 4HFUH 2ATKA 2O5XH 4ODSL 5GS3A 1VACB 1KLUA 3NCCB 2X4PA 3I50H 4NYLA 4P23B 2XZCH 5MEQA 1T80A 1TVBB 4NQCD 5CJ8A 1Q72L 4YEFA 1PQZA 1IZKA 4OZGF 3GSNL 3T0ED 1U6AH 3QA3A 4KK5D 4GLRI 1LK3H 2OLDA 5CSBA 1J5OH 3QJHB 1D5ZB 3SCMB 4HGMA 2NQCA 3TBSA 5DRNB 1C1EL 3VH8G 1KNOA 2GTWA 5IG7A 2J5LC 3ZKNC 2JCCB 3REWA 1QRNE 5ITBL 2OR9H 2DJUA 3QIBC 4NZJA 2OP4L 5KSBE 1KGCE 4LL9A 4NKIH 5EIIB 4WHCA 3QZWG 4URTB 8FABA 5I9QB 4EJ1C 2DICA 4DOHE 4NM8H 4JCLA 1CGYA 3RBSA 4AG4L 4QRQA 4ZS7L 4GKNB 5D5MB 4X8JA 3VFNB 5HGDA 2IPUG 1TENA 1B2WH 3V5DA 3BRGC 4QT5B 2DBLH 2I9LA 4RBPH 5J1TC 2JK5A 4E0RA 5E5RB 4X5WA 3HMXH 1PVHA 3ARBA 2KUTA 1OTSC 1TZGL 5F88A 4ZTOL 1T1WB 2W9LA 3P73A 5D2NA 2QTEA 1MRCH 1RUAL 2H26B 4KV5F 4RDQG 5FAAA 4K23L 4BM7A 5HHQA 4N1HB 2NXZC 1KYOJ 3O8XA 2DM2A 3HC4L 2A6DA 5CMAA 4JHBA 5D4QA 4UT9H 4WHYH 2DRUA 2IH3B 1FG9C 1CF8H 4Z7WF 1QFPA 3OBAA 1YY8B 2R29H 1Q9LB 4FOMA 6FABH 3WNNA 5DR5L 2P7TB 2YD2A 4OCWH 4X6CE 4EN3B 1KT2B 1Y18A 4PRNB 5E99H 5IQ9A 4PJBE 5HYQB 2RJMA 1JPST 2A73A 3TBYA 2ICWB 4WHDA 4Z7VE 4JAMB 1UFUA 5GS0H 1B90A 2EYRA 5DUBB 1RJYB 2VZUA 1HINL 4HH9A 1TZHB 4CUCA 3IRPX 2XICA 2KKQA 3S88H 3D69A 3WO4C 2GAZA 3C6SA 3G04B 3HS0A 3LZFL 2XWJA 2H1PL 1FFOA 1K4CB 2HTLC 4PJXE 1Q0XH 1UXSA 3HAEH 1MSPA 3MNWA 1DBJH 2BSRB 2B4CC 5GHWL 5I1DA 4OD1L 2YUWA 5CEZD 3PV7A 2NX5A 3Q1SH 1HEZB 3HMWL 2ORBL 5GS1C 1EJ6A 5I1HL 2Y06L 4LKCB 4DGIH 3STBA 2HYMA 1C7TA 3L3HA 4UOJA 5DFVC 3VI3F 5JQ6L 4GRWH 5EN2B 2HRLA 4PS4H 3DX6B 5J13B 3NIGE 2PF6A 3BPCA 3DYOA 5BZDA 4PREB 3GMNA 1SYSA 3H9YA 4JHWL 4XBPA 2EE9A 1EO7A 1YPZF 3LV3B 1I85C 2P5WB 2OZ4A 4S1RH 1FFNB 4R4FL 2B4CL 3RU8H 4MQ7B 1H3WM 1BM3L 4LSTL 4YNYB 3IAQA 1DVFD 1BGXH 3U0WH 3LKPA 4A6YL 1T04B 4PB0L 4L8DA 1AY1L 4U6HA 2HT3D 4RGNE 4OZGB 5J1SC 4JVWA 3UBXB 5DVOA 3F7PC 3VMNA 5F7YC 1N6VA 4WJ5A 2B0SH 4NO3A 1DVFC 3BQUC 2ZP0T 5DMIL 5CEZL 2L7JA 4IMKA 5FGCB 1WWAX 1IT9H 1YA5A 3N9GL 4HAFA 2BNQE 5HSFA 3QJFB 3EO9H 4Y1AB 1CU4L 4Y5XC 3CFEB 1JNLL 3Q5OA 1AGBA 1FC2D 1PKQA 5FF6B 4JFEA 5JIPA 5EZIH 3TNMA 1S9KC 4GLRH 2IF7A 3CZFB 5CJOH 3O2DH 5FK9B 1MCKA 1PG7W 1QUNA 4NKIL 2R4RL 3O45A 4ZUVB 3M07A 3O9WA 5F9OL 4CNIB 4LLWA 5IMMA 3D9AL 3VW3H 5I6XC 2W91A 3QUKA 3IT8D 5C0DA 1QBMH 5ESQA 2IMNA 4MNQB 3WHXB 4HIHB 4JRXD 3MRLA 3P4OA 5SWSA 1AXIB 2UYLB 3WIIL 1MQKH 5FYKU 2G9HA 4FQ2H 1K6QH 1CFTB 3VFUB 3X11A 1NEZA 5AYUH 1ORQA 1RSFA 4U7KA 1P84K 1W72H 3ARGA 1ZGLP 3CDGB 5BZWA 2Q87A 5ISZA 5JPNA 3MRFB 3TIEA 4H8WC 4YHMH 1FZMB 3O6ML 5L2JB 3O6KL 1K2DB 4XWGL 2IADB 5IVXF 4Z7WB 3DX8B 1S9WA 4MQXC 1MWAA 1UXWA 2GITA 1G7HA 3DRQB 2YRPA 1JCKA 3TO2B 3WL9B 2IPTL 2G5BA 5I1JH 4BFIB 3UTSB 5DT1H 2LAAA 4JFHD 4YIQB 4GXUN 5EZLB 4PJAF 1I3GL 2NY0C 4AH2A 2MTPA 3IDNA 2X1WL 2AJVL 2EIZB 3U82B 5J11B 5IW1A 2NYYD 2CQVA 4HMEA 3TA3C 4H0GA 1MJ7H 2NW2A 4YFEA 2GW5A 1KBGH 2XY1A 5HGAA 1QBBA 4RMUA 1NGYB 1QPXA 3BJLA 1ZAGA 2X41A 2R2HA 4H8WL 1IBGH 1S78C 4ELMA 4AMKH 4C54A 4PG2C 3TJEL 7FABL 1YN6A 3V5HB 5IMKB 3LCYA 4PJDE 4UV7H 1HXMB 1NBZA 4DQOL 3TJHD 1JK8B 2GFBA 5IFHL 4HUUA 1R3KA 5D5ME 4BA8A 3WEXB 1Q9WA 1BOGB 3QR2A 4YFLI 4M61A 3TJHC 5CJQL 1KELL 5F8RC 2VDRL 1ZHNA 2I9TB 2Y9RT 3MRBA 3BMWA 3QEQE 3LEXB 1N3NB 2NPLX 1I4FA 4CVXB 1RU9H 1YPZB 3A0OA 1Q9KA 1TCMA 1XF1A 3PGFH 2IJ0C 1DJSA 1OSPH 1ZHKB 4ZO6A 4Z7OE 1YYML 2BNRB 1AO7B 4UINH 3SQOH 2X89A 4QKXB 3FFDB 1BFSA 4NN7C 1HDMA 5CBAB 3EZ8A 3RHWF 3VFSA 2FLBT 1N4XH 2VRAA 4CADB 3BH9A 3SDCA 3L3IB 5DJ6A 4PR5B 2DI8A 4RMVA 4X9FA 3RVXC 2Q6WB 1U58B 2Q76B 2Z8WC 5C2BL 1EVTC 4RQQB 3GKWH 1G84A 1LILA 3KYOB 5I66A 4JE4B 5FUZL 4PGBA 5SX5H 4RISL 2IFGA 3ZTNL 1TJHH 1XMWA 3U4AA 2R56L 3QFJB 4HAGA 3C6LA 1UJTA 2J6EH 5T1LA 5AD0B 4ZS6D 5I1IH 3F7QA 4R90L 2E9WA 4HPOL 3ARPA 4OCSL 4LLMA 3OAYH 4OI9A 2CK0H 4Z18A 1Z0NA 2E7BA 5EBLB 2BY1A 1IKNC 5E03A 3RGVB 4D0DA 3B9DA 3BDXA 4RAVB 3RWJB 4ONOA 5GIRB 1MHCB 1T5XA 3L3JB 4OM0H 4ZS6C 4U1IB 5HXMA 1ZMYA 4AL8H 2RAMA 1FL3A 1U3HC 3BKML 5GRUH 3WDIA 4LFHD 3C9NB 1E4WL 5AZEL 5IHUL 1AFVH 4WFFD 2IQ9H 4X7TA 4P3CH 5IB1B 1KPUA 4F9LC 5D7LB 4OLZH 4HJGB 4RCAA 1R3JA 4ZNEE 1I1YA 4I2XE 1QLRA 1YC8A 3OJMB 4OB5H 3TYGH 5FB8B 3PL6D 4NPYA 3TBVA 3FFCE 1HH6B 1V7MH 5J1AB 1I3RB 3VFTA 4LGSB 1HILB 4MJ5A 4MMXC 3MV7E 4QGYA 5B38G 1XIWB 2FX8L 5I74C 2A9NH 2D7NA 1KN4L 2ZUSA 2ZPKL 4NUJA 2X7LA 4XRCB 5HYJA 1FO0B 4N0UB 4NNYB 1A6PA 5KOVC 2R0WH 2JB6B 1U2CA 4Z76B 4IRJC 4O2FA 1CE6B 4ZFGH 2R2BB 1DL7L 3CU1A 4DN3L 3C09B 4Z8FH 4I9WE 5TH2A 4MNQE 4P9MH 4YXLH 3CLEH 3VWKB 4BZ1L 1XFPA 5IB3B 3LKQB 5F7FA 12E8L 2BX5A 1A7NH 1FV1A 5A2IH 4P5MB 3SJVA 2H2SD 3MV8E 1FCGA 1KEML 1NJ9A 4L8SB 4KJWD 3O41A 4R7DB 2HP4A 3GUTB 2FYYA 1SMAA 5EBMA 3VJ6B 4LRIC 5CIPB 1IC7L 3CFDB 1UJ3A 4E41A 1U8MB 2NNAB 1HHGB 3QQ4A 4GW5B 2L0DA 4YUEH 3D3VE 4GKZB 5DVLA 1RZ7H 4M1DL 5HHOB 4JPKL 4XNUL 5KSAC 4B0MM 4U1JB 4LVNB 1DBML 4RZCA 1QTYT 4QO1A 5CEXB 3KPQB 4HW6A 1RZKH 5E9DB 2O5ZL 5ILTL 4NNXA 2XWTA 5A2FA 2VDQL 4FG6D 1R24B 5CEYA 4DWHA 5D71H 4QXTA 3GM0A 5DI8B 4BQ9A 5CD3B 1KB5H 3UO1L 1LO5A 3ARBD 4S10A 43CAB 1WTLA 1BWWA 1MI5A 2WWKT 1VFMA 4UILH 4K7FA 4EBQL 3V4PL 1BEYH 1ZHLB 4HWBA 3ZDZE 3QWQB 3ARBC 5EULV 3MPCA 3DIFB 5AWNH 4TNWK 1DLHB 5C0FA 2VZOA 4HS3B 1AGFB 3V8OA 1QZ1A 3KPSB 4ZOAA 4EUPB 4GXUM 3QDHA 3O8XC 4IRSA 3EYSH 2A9ML 2XV6B 1FAIH 4HWZA 4P2QE 3GJFK 1QEWA 3VRJB 1A21A 1AD9B 1IGIL 1RUQH 4OM1L 1SEQL 1MCCA 4YXKL 3D48R 1FL5A 1MVUB 4M5ZL 3L95A 5K9JL 1FYTA 3BT2H 4HXBH 1RZIB 5BXFB 5EBWB 1CE1L 4WI3A 4YXHH 1MCOL 5F1IA 4PB9L 4KI5E 4LNRB 4K7PY 1T7XA 2H8PB 1YEHL 3SO3B 5IVXA 3UC0L 2VLRA 3EJYC 1RUPH 3OKEB 5HHMB 4Y4FA 3HE6B 4Q9QH 4XP4L 2HH0L 2AI0H 1NGWA 5JW5B 2B1AL 4QOKD 2WBWB 2NX5D 2XFXA 4KZEH 4IIQA 4JFFA 2VE6B 1MRFL 1F6FB 3P0YL 3WFDL 3KWWA 4PJAA 1BQUA 3T0XA 4YBQD 4G8EA 2XTJB 1JGUH 1FGVH 4LQ1A 3S36L 3K80A 1B0GA 1AE6H 4H20H 1MCEA 1FG2A 3HC3H 5C0JA 5EWIL 4JVUA 3IXTB 4E5XB 3RGHA 3DRTA 1ES0B 1IGJB 4ERSL 4WHTB 1RZFH 3LRSB 4X80H 2BP3A 1A9EB 3MGTB 3QUXD 1P6FA 5LXGL 1LE5B 2VABB 5F6IB 3EKCA 1N64H 3KPLB 3VFPB 2EDEA 3RZCB 1BD2B 1ZA3A 3BPNC 4F58L 1DCLA 4TPRH 5IQ7H 3O6LH 2APWA 3IVKB 3DGGB 5I0ZA 4ODBD 1N2RB 2KQMA 25C8L 3CFCL 3RWFB 1WK0A 1QA9A 1K3IA 3VWJA 5CP3A 5TDNB 1MHHA 1LEGA 2DTSA 3AREB 5GZOD 1RVFH 2IG2H 3OX8B 4JY5L 1BZ7A 5KSVB 2EC9U 3NACH 3CVIL 4PY8J 5KVGL 2AK1L 1J7VR 5E0QA 2GTZA 2XZQL 4JHAL 5L0QB 1XGRB 4IMKC 3O4LE 4NO0B 3WLBA 2AJUL 4OLUL 5KSUA 4J4PA 4JFED 4Y19D 4XP9H 5EO0A 1ADQH 3QSKB 3IJSA 3ARTA 2HMID 4YHPA 4D2NA 4ELKB 3Q3GB 1U3ZA 4XVUD 4QRRE 2OZ4L 4Q58C 1IM3A 4WTXA 2R39A 1TJIH 3INUH 3NA9H 1SY6H 3V6BR 1W2KT 4TRPL 3PQYE 4CJ1A 1JE6A 3ALWA 4UIMB 4LRNH 5F9WB 4IOFC 3A6BH 5CKGA 2CIIA 5FO8B 4XVUC 5EU6B 3TCXA 1AGCB 5L88H 4LOUD 5ALCH 3O9WC 3U9PH 3F12B 5SWSD 1ZVHA 3ZE1E 1ONQA 3WHE1 2NY7H 3WMSA 1T2XA 5C0IB 4K2UH 3BXNA 4GS7B 2XYCA 3PJSA 4GW4A 1X5GA 3RFZC 4P2OB 3ARGD 2R2EB 4ODWB 3BMVA 4LOUC 2FBJH 3QAZC 3AU1A 3BIBX 3MNVB 1BQSA 4XXCA 5MP6H 3UROR 1HOCB 5FYKL 3SDDD 3SDXA 3U36A 3WIFA 5T33L 4XMPH 3RL1B 3PWPA 5EC2B 3ARGC 4MCZA 3UJJL 3HAEB 4NC2B 4XCNA 3RL2B 2IPKA 5JQHC 3SKMB 5FO9B 4F15C 5B3NA 3L1OH 4BSJA 2EDJA 2VLJB 5I30H 3MRPB 5DQ9B 1IGMH 1SEBA 4U0RB 1KJ2A 2QADD 4KVCH 3H3PH 2GUOB 3LS5L 5JW3L 1ZT1A 1OAKL 2DS4A 4AK1A 4U6XA 5IKCA 3QIUA 4GRWB 5EZOH 2CDEA 3CVHH 1IFHH 3SPVB 3QDMD 3WD5L 4EN3C 1BVZA 2XKUA 4NRZA 3QEHA 5DK2B 3L6FA 1U36A 1T21A 1UA6L 4EI5A 5I15H 3VFVA 1P4IL 4R9HA 4FXGA 5MENE 3JBG7 4ZTPH 3MXWH 4U1SA 1U93A 5D96B 4MXWL 4Q0XL 4KKLC 1E4KA 4NGHH 5ID1A 1MWAL 1CVRA 3FO1B 5CZVH 2DQCH 1D5IL 1NGXA 4X6CF 1LD9B 4V1DE 2X4NA 1AGEB 2M2DA 1LDPH 4P3DB 3RWIA 1E4XL 2MSPA 2ZOLA 5GGRA 4UT6H 3IAGC 4ZPVA 1YNTA 1VSCA 3KXFE 3JV6A 1OT1A 1DTUA 4HKBA 4JO2H 3VGDA 5F3BA 3MRJB 5FYJU 1U8IB 4U6YB 3BP7B 3UTTD 3LEYL 2X89D 1F11B 4PJXF 4KRMB 1INQA 1FNEA 3VFWB 3S37H 1OP3K 1AXTL 1XGUA 1Z3GL 4UI2A 3SKNA 5E08H 4JM2D 3Q5TA 4JY4B 2Q8AL 4OCRH 3G5YB 4M7LH 1M4KA 2EH8H 4O00A 2YS4A 5DGQA 5I19H 1O5DT 3IGAA 3DO7B 3ILPB 4KMTL 2N4IA 5LBSH 3SGKC 3D1MC 3SDCD 3O2WL 4OF7A 4FTVA 1YEEL 2AEPL 5GJTH 5LKNA 1IGFL 3NGBB 3BD5A 2FECI 3T2QA 1UEYA 3BIKB 4GXVL 4OGXL 3NAAL 5H37H 1AQKH 3RA7L 1ZANH 4GQ9L 4O9HL 3ZHDA 4Z78A 3SDCC 2WQ8A 3P30H 1IM9B 4JRWA 4N1CA 5C0CB 32C2A 5CINL 1RMFH 3B6SA 3KNBA 4G6KH 3T3PE 2OTWA 3VFOB 2EYTA 3KJ4B 2AV1A 3C6LD 4J7RA 3MRCA 1OM3L 2HWZL 4LARL 5IMOB 1U8LA 2HA1A 3DOSA 4WDIA 1CFNA 3ILQD 3TIDA 5CUSH 4F7PA 4OJFL 3VDBA 2XTJE 4RMQA 1CFQA 1HHKB 2PW1B 3Q6FB 3C6LC 1MVFA 4FNLL 4KRPB 3FQTB 4N0FB 4XPBH 3IJHB 4X6FA 3G6JA 1NFIA 5DJCA 3DVFA 4ONFL 5DFTA 4TULH 3LN4B 3T4AB 5F7NC 5C09B 4NHCL 2EC8A 2D31A 1T5WA 2XZAH 4KXZI 1QVOB 4OFPA 3IU3A 3L3OB 3IF1B 4MD4A 4OT1L 3X3GL 4HCRA 3ROLB 3MLYL 3EBAA 2GJZA 1B6DA 5J4MA 1UWXH 2V5TA 4PV9A 1NLDL 4M6OL 4U7SA 1E6JL 5KVDL 2FJGA 4LPUA 1MIEL 2NY1B 4ISVB 2ATPB 5E7FA 4Q9CA 4QTHA 4PRAB 3OKOB 2UY7A 4O02L 4P4KC 1F58L 5HHVL 4GAGH 4LVHB 4JN1H 4U6VL 4OV6F 5C07B 4WFHE 1FH5H 1KEGH 1SJEA 2IBZX 4ZXBB 1V5JA 3N1QC 3D85B 1GGIL 1QNZH 1KN2L 5DQDL 1F02I 2EZ0C 1YEJL 2PYEA 2LTQC 2EIBA 4CVZB 3NIDE 5HYJD 3CH8A 4Y5VA 3DVNB 5IM7B 5HHXH 1RZJL 1DSFH 4PRIA 3HI5L 4XVTH 1BBJB 5F8QC 1BBDH 1ZT4B 3N1FC 1VFAB 4ZFOA 4OZHA 4UDUB 4JG1L 5DEZA 3B9KA 1IRAY 1QP1A 3VRIA 5DHVH 4WV1B 3GMMA 5DO2C 1T4KA 2ESVA 4Q9RL 1A02N 1NCCH 3GKZA 5FGRA 4ZSOA 3ARQA 3SJVD 1Q1JH 2W60B 4HD9A 2FGWH 4PJCE 1IVLA 5FKPA 4HX1A 2A77L 4XP5H 5LVEA 4BSWA 1IAIL 1P84J 4KH2A 2W07A 4JQIH 1YMHA 1G1YA 1ZT7B 1U8HB 3WSQH 3H3BC 2X42A 4MDJA 3BO8B 5IESH 3RDTA 4I18A 4OV5B 2FR4A 2AJZA 4GAJL 3FB6A 1DQQA 3MCLH 1TPXC 3HZMB 4R4BA 4AY0A 1C8PA 1H9VA 1BF8A 1UCBL 2NY3B 4PJDF 5CKAA 1UACH 2XOTA 1P5UA 1J0ZA 3FT2B 1XCTA 4PRBB 2ZG1A 1I1AC 3MR9A 3OB0K 4C56E 3ZTJG 4BSVB 2BFVL 2WW8A 1F4YL 4GMSL 3VXSB 1R5WB 2XNAA 1MLCA 5HDQL 3PNWB 2RCSH 2A74A 3AUVA 2GCYB 1MI5D 3FRUB 4NUGL 5ETUA 2MHAB 5GGSB 2XN9E 1LEKA 3MODL 1G7LB 4HC1A 3U4EB 4G3YL 2IQAB 4Z7OF 4QLRA 3BP5B 4NHUB 4AT6B 1EAPB 3DX7A 2Z92B 5JOFB 2IANE 4MAUH 3OKNA 5CJXA 3Q6GH 2V2TA 3D18B 3KPNA 2VZ3A 4CMHC 3OJDA 4QHLB 4QY8A 2BK8A 1ACYL 3MRDA 2VLME 1HZHH 3PP4L 4HK3J 2WLYA 3V6ZB 1KACB 2ADFL 2O26U 5IK3B 4OUOA 3QXDA 2GT9B 4IRSC 1EUTA 2A6IB 3QH3A 3ZZ1A 1I7TB 4JZOB 5F9DC 1GC1C 1X4YA 2NW3A 2D0GA 2APXA 3L5XL 4YDIL 5FUOL 4OF6A 3MOBL 4Y2DA 5DLML 2EC9T 2Y25A 3F62A 4U1KB 3VI4E 4W6YB 4V2BA 1QLEL 1QRNA 2JKXA 2DQGL 1JFQH 5IBTH 3BN9C 3VCLA 4YDVA 2VLRD 4JDVB 4HWBL 5KSBA 1FN4A 1KF9B 4KZDL 4NRYB 4TUKL 3SBWA 2BMKA 4H88H 4PTTA 2QQKL 2FLRT 3HRZA 4WU5A 4JFFD 3MCKA 1EZVX 4DGYH 4XB7A 3CX5K 4MZ2A 1OPGH 4Y4FC 1J8HE 4HUXB 3V0WH 1D6EB 3I6GA 2FX7L 5ANME 4IIQC 1UKTA 3QHZL 5CP7B 1MCLA 4TQEL 2PXYD 1HI6A 1HQ4A 3OR7A 1MJUH 1QACA 4Y16B 3U48A 5KJRH 3EOBB 5GGTA 4HBCL 2VH5H 1LE9A 2BOCB 3WLWD 2VISB 2VSDA 1DQJA 1N6UA 1NBVH 2CDFB 1OVZA 5DMKA 1YC7A 5EH1A 1QLFB 2DQJL 2OK0H 1D5MA 4YDKH 1GGUA 1KCRH 4LSQL 4AEEA 4UB0L 5CS7A 3WLWC 1NUGA 4L4TD 4M4PA 4IDJL 3RVTC 1C08B 1YMMB 5DZNA 1D9KB 4H1LA 4YHIA 3CC5A 2I07B 4X6CA 1IQWL 1LK2B 2Z8SA 2VAAB 3TV3L 3VA2C 1MH5B 2E3VA 4PJBA 2P5ED 3GBNL 4HFWA 3O6FA 1XCQB 5KAQG 5ESAA 4LASH 4Z7VA 4MSWB 3QQ9C 1KB5B 4LPCA 5E1HB 4OD3L 3VWJC 3G5XB 4NC1C 4U1GC 5CLTA 1SJHB 5FCUH 5DRZB 5BV7H 2AJSL 3W2DL 4HWUA 1UQSA 2HJKA 2APVA 4DKEH 2GK0A 5D1XB 5BQ7A 3KPRB 4BH7A 4PJXA 3BZDA 1CLOH 5L7XH 1MHPH 1WJ3A 3G9VA 4MXQD 5C07E 4OGYH 4J4PC 4WI7A 4D8PB 3LKNB 4MD5B 3ZE0E 2CGRH 3MLTB 1QYGH 5HI5C 2QQLL 4G6AD 5C9JB 4N9GA 1KLGB 3SGJA 2HVJB 5E2UL 5TF1L 1JF6A 1JWMA 1L4IA 3EFFA 3QEUA 2QQNH 1HSAB 4N8VA 3IS0X 3B83A 4YC2C 3DV4B 5E6IA 1CK0L 3BE1H 2UZIL 1NSNL 5EOCH 3VXMB 1C5CL 2E8ZA 3GIZH 5KG9A 2PW2B 1JRHI 3FONA 3PWPD 3I6KB 4GG8B 4LVOC 2VJXA 4LBEB 2KPNA 4WY7L 3RX7A 3EFDH 2RR3A 3IDXH 3I3EA 3PWJA 3QDJB 4G42B 1CXHA 1A6UH 1CGXA 3TYFA 4NO2B 4PGDA 4QHMB 4JKLA 1DFBL 2VR4A 2WINA 1DUZB 2CDGA 2G60L 2VITB 4M03A 1EV2E 2Z0BA 4NJAH 4KK6D 3EYFA 4FZEH 2C1OB 3IFNL 4HIXH 1MCJA 4MX7A 4Y4KC 2K7PA 4YAQA 1CXKA 4R26L 2BNQA 5ENWB 3VXUD 4AQOA 1GPOH 5INCB 2CLZB 3AS1A 3QIUC 3ZDZF 4EI5D 1EBPA 1KXTB 1TETH 1XGTA 4PGCB 4F80A 3E6FA 4YPGB 4OKVB 5D6DA 4EI6A 4WIQA 4L3AA 2HG5A 4O4YH 3B3IB 1FFPB 4HIEA 2VZVA 5D8JH 4MDIB 4ODUB 4LF3A 4JO4H 2VIRB 4P2CG 2X10A 2CXGA 1QBLL 1E4KC 4JJ5B 4L3ED 2G75B 2DIJA 3CCHB 1LO4L 3O3UN 3VA6A 3VGBA 5IBUG 1KJ2L 3I6LE 1G9EA 3WS3A 3HE6C 4HKZA 5HYFA 1IAKB 3SGEI 5EUOF 3U79A 3VXOB 4MS8D 1SHMA 4IJ3B 3PDOA 4N0YL 3I02B 1R5VA 1MJ8L 1UG9A 4RMWA 3TH3T 4XC3H 3EJZD 4HEME 5CBEA 2C1PB 1WWCA 4P23A 3SDAA 3CK0L 2ZUTA 1D6VL 3AXLA 5JXAL 3JUYA 1GRWA 1MFBH 3MUZ1 3GIVB 1A6VH 2UUDH 1Q94B 1Z6JT 4KHTL 2AKRB 2OJEB 5IFJA 1A1MA 4XAKD 4LLYB 5F6HI 4ZD3H 5C08B 5DRNA 2O61A 5LQBL 4HKXA 1S9XA 5JO5B 3I50L 3O0RL 5A3ID 3T0EE 1M7XA 4UTAL 3WFHA 4GSDH 1YEGH 2GJ6E 4NWUH 2IH1A 2EEDA 5EU7E 1J87A 3DMMA 3P9LB 1XGYL 3LKOB 4LPWA 5IR1B 3I84A 4GG6F 4HJ0D 1WBXA 5A3IC 1DANU 5EIIA 2GSGB 1QFOA 4K3GA 1KIRA 3MBXH 4P3WA 1F97A 4OLWH 4RWYL 5F96L 2J7LA 1NMBL 2DDQH 5D5MA 3MJ7B 1JUFB 3C5ZB 1X5KA 2GJJA 1I9RL 1IEAB 1KPVA 1FNFA 4TSAL 4JO3L 1F2XK 1X5FA 2FX9L 1MCPH 1A3LL 2XTLA 3LQZB 1UZ8B 1FIGL 1JV5B 2H26A 2X70B 4PJ5B 3QEQA 4WEMB 4G7VL 3BSZL 1FGNL 3RWDB 5C6TH 1WT5A 1BP3B 3NCMA 1Y0LB 4JKWA 4OZIB 3CMGA 3M8OL 2ZWLT 2AVGA 1OARH 4K7PH 1V7NH 3ES6A 2NLJB 1YY8A 5HPMB 1Q9LA 4G9FB 2MPAH 3EIFA 1OAYL 2W92A 5GS0C 4KDWA 1Z9MA 1AD0B 4BKLA 4KPHH 3MFFB 1U95B 1L6XA 3QBTB 1X5LA 5IVZA 2GKIA 3BAEH 1KIPA 2BVOA 1EFXB 3W9EA 5D7JB 3CSGA 3O3EA 4AEHH 3PP3K 1RJYA 3HNTL 1TZHA 4M93B 3RAJL 2IGFH 2PYED 5KZCD 3BZEB 3FOMA 2HKFL 1A3RL 1J0JA 3ULVH 1U8KA 4I1NB 3C5SB 3ISWA 5FM5M 1I8LC 2B5IB 2J4WH 1VCAA 3G04A 4BH8A 4PLOB 4PRID 2VR5A 4C55A 1JZ3A 2B7DT 2HT2D 3TM6A 3D25B 4GT7A 5I1EH 3BHBB 4HCRL 1LNUA 2JJVA 4AIZA 2BSRA 4Y5VC 3B9KD 5DD6B 3IFOA 4OZ4A 2OL3A 2SEBB 3VD9A 1IL1B 1F42A 2IBBA 1CBVH 5E8DH 2LFGA 4WW2B 2D0HA 1WC7B 5BS0E 2D7QA 1UVQA 3B9KC 4ZO8A 2JELL 5TFSL 5EN2A 2Q3AA 3HZKA 1Q0XL 5FKAB 4G5ZH 4F57H 4QHUB 3LVEA 9CGTA 1KXVC 3RWGA 1N0LA 1IGTB 2NY5H 1KIQA 1TQCC 3MRNB 5TGBA 3LV3A 2NZIA 4MGXA 4PYHA 4YR6B 3CSBA 5I1GH 1Y6KR 4MQ7A 1QSFE 5E00B 2QHRH 4ZNEA 1SBBA 2AJXL 2BSSA 4I2XA 3DYPA 3UDWC 2K9UA 4ZFOL 5F3HB 3RDTC 3SGEH 4I18C 3QCUH 4DUXA 4QEGA 2V5MA 3FFCA 1KJ3H 1N8ZB 3V4VL 3IFLH 43C9B 4S1RL 4TVPD 4ORGB 3NBNA 4R0LB 3HNSL 3LD8C 4TSCL 1H3PL 1G7MB 2M26A 2AK4B 3U0WL 1MREH 2AEQH 1IC4L 3MV7A 4L5FH 2AV7B 3R0NA 4UMGA 5C3LD 3JSSA 1EMTH 1MFNA 3RWEA 4G8FB 3IU4H 2E27H 2ITCB 4IRZL 4Q2ZA 5FF6A 5F7UA 1F4HA 4QTIL 5T1DH 5AUMA 1S3KH 1YDPB 4ODSH 2VN7A 1PEZA 3GM8A 3RVVD 3RNKB 4J1UB 4O2EA 3UTQB 1OB1A 4FFWD 3HG1B 3NABL 2GYSA 2CUMA 3GSNH 3G5VB 4MNQA 1ZLWH 5CGMA 3WHXA 4HIHA 1EBAA 1G6RA 2YA0A 5CJXC 1BWMA 1U8OA 1CFTA 1C1EH 5MHSE 3HRPA 3EDJA 3REVA 3F5WB 4TVPL 2V7HA 3MV8A 1JZ8A 2BVPA 3H9HB 5ITBH 4Y2DD 3TVMA 1J0IA 5JIKA 4JRXE 4H1LG 4V2CB 1EA9C 3MRFA 2H3NA 3S35X 4CMMA 5LAXB 2OP4H 1WCBA 2FH6A 3QDGD 1C5DA 2DD8L 4MJID 4OLYL 1ED3B 3CVHA 4EZMA 4Y2DC 1KGCD 2JB5L 3D3VA 4HC1L 4GFTB 5SWZB 2R0ZL 1EHAA 4JPIA 4N68A 2V5SA 5EZLA 4ZS7H 4AG4H 1CL7I 5DHYB 5LGKA 4F3FB 1RD6A 3NFPA 4YHML 4X4YB 3BPOB 5F7HA 2DF3A 3WN5A 4B50A 1U2HA 4N0RA 4R7NB 2E9IA 3TZVB 1TZGH 4J2XA 1NGYA 4JFHE 4Z7UB 4WI8A 4BQ8A 1RUAH 4K23H 5DGRA 2EDLA 4PJ9D 3P4MA 2DAVA 3HC4H 4IMLB 5K59E 3BRDA 2PTTB 1AC6A 3MBEA 4NQXA 5MEPA 4H5SA 1DQLL 4N8VG 5DR5H 3BVNB 2C4XA 1BOGA 3V6FB 1VFBA 1MHEA 5D1ZB 1FZJA 2J8UE 3IDMB 3MZGB 3U7AA 4GKSB 1EEYB 1CYGA 2DQFB 3TPUB 1P7KA 1JI1A 3I2CL 1A7OL 5HDBE 2A0LC 4P2QA 1HINH 1ZSDB 5I8CA 3KYMA 3PABB 2AJ3A 3DECA 3NA4A 4LU5L 3VGAB 1EXUB 3PWLA 3DTXB 3NIDF 3LZFH 1UKSA 5I16B 3O6FC 4JFXB 3S5LG 1FNSL 5GGTL 5GZND 1DE4B 2DL2A 3L3DA 3BW9B 1C12B 5GHWH 1P2CA 3RVUC 4OD1H 4O2CB 3I9GL 3QNZB 3MCG1 4WGWB 5E8PB 3ZT6A 4ZAKA 3HMWH 2BVTA 3QUMB 2ORBH 5GZNC 2Y06H 4LLQA 4PLJD 2ARWA 2VMFA 1S7XB 4FN0A 1GZQB 4HGWB 1FPTL 2XI9A 1WZMA 2NY2C 4DZBA 5JQ6H 2WK2A 2CSPA 3FB5A 2Q6WA 3QRGL 1RI8A 2Q76A 4Z7QE 15C8L 4PJCF 4RQQA 3KYOA 3MV9B 4JHWH 2EO1A 3JTTA 4M02A 1S7UA 4TOYL 1ZK9A 2IAMD 3SGJC 3X3FL 4LEXL 4R2GB 3FT4B 5IW3A 4R4FH 4XWOC 2B4CH 2C3WA 1BM3H 3JWDL 2R9HC 3I75B 4LSTH 4POZC 5E6IC 4ACPA 4PB0H 5HYEA 1AY1H 3MLZL 4M6AA 1KPRB 2WANA 3CDFA 5EBLA 1K8DB 4LLUB 2B8OT 1XF4A 4RAVA 2QQQA 5GRVK 2VUYA 5DMIH 4F37F 5CEZH 4U1IA 4XNXL 2W9DL 3N9GH 1CD8A 4RGNC 4D3CL 1K4DB 2QHLA 3LSOB 1CU4H 2YPLD 1BVKB 4HPYL 5F93C 3QWRD 4X4ZA 2DLTA 4WTZA 4X6BA 1JNLH 5DDHB 2BVYA 2F74B 1WBZA 1QFHA 2YD4A 5DK0B 1TZIB 1S8DB 3O4LA 2FWOB 3LQAC 3KAAA 3LDBC 4AL8L 2R4RH 3FOLB 4X0KA 5F9OH 1TMCB 3D9AH 4EDWL 1P7QD 1AFVL 4MA7L 3MRQA 4QRRA 1IMHC 1XR8B 3PQYA 4DGVL 3MREB 5EZJA 5IB2B 1ITBB 2HFEA 5D6DC 3D87B 4Q6IB 7CGTA 4U3XA 2A6KB 2F5BL 5DHVA 3WIIH 1X5YA 1YEFL 1WAAE 3JWNC 1QD0A 1XIWA 4RNRB 1IKFL 4OB5L 4Q74A 3BP4B 3QXVA 4I5BA 1FO0A 4MA3B 5IEHA 1CICC 2MCPL 5IHZB 2CLVB 2P8LB 1P4LA 2R23A 3LQAL 2CO6B 1UH2A 4XWGH 2DLHA 3WNPA 2R2BA 4TUOB 5BV7B 2E7CA 2FH8A 1S7SB 4HV8B 4QHKI 1N59B 5DRWA 3ULSA 3HG1E 5A40E 2A9NL 3EYOB 4P23D 2JIXB 5BJTB 2IPTH 4L4VB 1U8JB 3X14A 3QUZA 2ITDB 2X4RB 1D5BA 1I3GH 4JCMA 4X9IA 3N1GC 2AJVH 2VAJA 4R96B 3QP3A 3SDAC 1NDGB 4NN5B 4BJLA 2G5RA 3WFCL 3MLWL 2DLGA 1FORL 4LCWB 3K4ZA 4I0PA 4YGVA 3GUTA 3V5KA 5HGBB 3NVQA 4HUWA 4H8WH 3UTPE 4XX1G 3KPTA 3FQUB 3MMEB 3ROOB 3DMMD 1XF5B 1U8MA 2WP3O 1U42A 5KANI 1CLYL 7FABH 2AQ1A 3JTSB 1A7NL 3V4UL 3WFEL 4AENB 3CFIC 4RAUA 5SWZE 4DQOH 1XF3A 4XHJD 5IFHH 4NQDB 4MJ6B 4XP1L 5I17B 1KTLB 4RIRB 5DURD 5ID0A 1C16A 3DMMC 2I25N 5CEXA 5MENA 3KPQA 3H9SE 2E7MA 4JKMA 4P5TA 4MAYA 2VDNL 3CX5J 4KK9D 1FZKB 4GJTB 1R24A 2ZG3A 3CSYA 5CJQH 1KELH 5CGTA 1M71A 2VDRH 5CD3A 3T1FB 3BYTA 4V1DA 1YUHA 1NUFA 4YUEL 5D1XC 3FCTB 1NEUA 3O3BA 4UDTB 1HXYB 1A3QA 3EO1B 2VNCA 5DSCA 1MNUL 1VEOA 2NZ9C 2X1PA 3C60B 2OTUB 1J05B 3KXFA 1YY9C 3IDGA 3NCJL 1B0RB 1WZLA 2VQ1B 4OQ1A 4QWWD 3MNZB 1G7IB 1YYMH 1ZVYA 4GBXB 3QI9B 2HJFA 5IW6B 4PV8B 3MO1B 4MLIA 1J8KA 1H5BA 1DLHA 5CHNA 5DJYB 4LAJH 3PWUB 5M94B 4NZDA 5E5UB 3QG7H 2DM4A 1LWRA 5IEKA 4M43L 4K71B 5BRZB 4KTDL 3I3DA 3T77B 3QXAB 2FO4A 4WUUB 1U91B 3AMLA 4H25A 2XXMB 5JNYB 4EXPX 3UAJC 3VG9B 3FZUD 1AD9A 3P40A 2V7NB 1CFBA 2BZDA 5C2BH 4RRPA 4NBYB 5D1QA 1MIML 1CD9B 3UBXG 1VGKA 1M7IA 2D7TL 5EOTB 4RBPK 5TE4L 5FUZH 4U2ZA 2YD3A 2UY6A 2LV4A 1VKXB 4P57A 3ZTNH 4RX4A 2R56H 3CUPA 3BZFA 1X7QB 4P2RB 4L8CB 1G7QA 4R90H 5DRXB 4HPOH 4OCSH 1KCUL 3RTQC 1I7ZB 4HXBL 2OCFD 3MYJB 4XAWL 1ORSB 3BKCL 1ND0B 2YRZA 2O93L 4L1DA 3R1GL 2DTML 4M7ZB 5IB5B 1RUML 5FM5O 4JR9L 5MI0C 2BDNL 5I76B 3BKMH 2HLFC 2EDWA 3BFOA 2WMPA 4QOKE 4RGOH 4HDIB 4BUGA 5I8EA 3WKNA 1E4WH 5F1SA 5AZEH 4MA8L 1ES0A 1IGJA 2VZTA 4R8WL 4WHTA 4KUZL 4YDJB 4KZEL 1ZE3C 4IHOA 3TH2T 5I75B 2VABA 4NQEB 4L8BB 5DVMA 2DQIL 4TNVF 5C9KA 1SYVB 2DWEB 2GSIA 1NCAL 5T1KB 5B3JF 3IVKA 4PUBL 4LKXA 3KHOA 1J12A 2DYPA 3FJTA 1T03L 2YBRB 1D5XB 1GAFL 4HMDA 2OL3L 4P4RA 3FFCD 1OTTD 3AC0A 2YD5A 4JLRA 5CJ5A 3AREA 5HYSB 1CZ8L 2A1WL 2HVKB 2NY4D 5KSVA 2FX8H 2YEZA 4X6DF 3HCVB 1NCTA 1BFOA 2ZPKH 3UTZB 3EGSB 1EEZA 4L9LA 5D93B 3QO1B 5KBNC 2NY4C 1WFTA 3NTCL 2ZUQB 4XB8A 2H41A 3IXAA 2VLKB 1W0VB 4O51B 1DL7H 3S4SA 3PDDA 4X9GA 1JGVL 4MB4A 1GGBL 4UIMA 1EERB 3ARFA 4OZFH 3BP6A 4Y19E 4I9WD 4DK6A 4BZ1H 4MNQD 3PIQA 1T2QL 4YBLB 12E8H 4PP2B 4PTUA 5C2UB 4GRLB 4ETYA 2EE6A 3HUJF 5ICYB 1MF2L 1DDHA 1KEMH 1ZLUK 1WFNA 3VGFA 1OF2B 2F54B 3MV8D 4PJCA 5ICXA 4XGZB 3LOWA 3FN3A 3TVMD 4LRNL 4M7KL 1IC7H 4XZUA 5F7WC 1MCHA 1ODAA 4G43B 4QXGL 3E3QE 2X5PA 3IDYC 1KTRL 1NCWL 4M1DH 5CILL 4JPKH 4X6EA 4XNUH 3RWHA 3TVMC 1U3YA 2P8MA 5I73B 1A7RL 1DBMH 1PD6A 5FO9A 2Q8BL 2CMRL 3A67L 4MWFA 3UTSD 5GJSL 1F3JA 2O5ZH 2BSED 5D9SA 5ILTH 3HKFA 4OI7A 5J12B 1PX4A 1QSZA 1S9VB 2FIRT 2VDQH 1A64A 4WU7B 4I3SL 2YWZA 4NKOA 3N50A 5T3XD 4NBXB 4C56A 1I7UB 5GGUB 2GUOA 4YEEA 4LCWE 1QO3B 3UO1H 3D0VA 1GZPB 5GRJL 5CSGA 4M7LT 5GGRY 1H3UA 2Q7YA 1G6RL 3SPVA 3RQ3A 4EBQH 4HHAB 3V4PH 1QSEB 3WN5C 4DAGL 3VXPA 3N85L 4K3JL 5DWUL 3QIWA 2UZYB 3W9DB 1RZGA 1T7YA 2OTPA 3L7FB 4NQDE 4X9BA 2XN9A 4YFDB 1AR2A 4ZFZB 3QQNA 2IANA 2PO6A 3QDME 4FZ8L 1NAMA 2VDPL 3CVHL 3RWCB 3P4LA 4UT7L 2I60L 1TTFA 4GAYB 2C3GA 4KAQL 1LD9A 3MBEC 5TDOA 4UBDC 4P3DA 4EOWL 3WUWB 3GB7B 4OM1H 1IGIH 1SEQH 4ZTPL 4YXKH 2CR3A 4M5ZH 5K9JH 1R3LA 3G6AA 1BFVL 5EA0L 1CE1H 1T1YB 3WUZA 4JEGB 1MCOH 3MRJA 4PB9H 5C0GB 4OCYL 3IDIA 1ZS8B 2VDLL 4JPWL 1BX2A 4KI5D 1YEHH 1U92B 4NDMB 1BZQK 1F11A 3UC0H 5C6WH 2YN3A 5DTFA 4FQIL 4J3XA 1MCFA 4UQ2A 3MJ8B 4XP4H 1WF5A 2HH0H 3VGEA 1OAQL 2B1AH 3PGDA 3PV6A 4ZAKD 1OAXL 4PJHE 1MRFH 1T22B 4HIIB 3P0YH 4KI5C 3AMKA 3NH7L 3WFDH 3UTTE 3MFGB 5F9AC 1S5IL 2DQHL 3SQBA 4HK0B 1KG0B 3GSNB 3JUZA 4X6DB 4PJ8B 5IVNA 5EWIH 5DJ8B 4ZAKC 1J8HA 3RPIA 3QUYC 1DN2A 3BIKA 2OI9C 4KUCD 3KLHC 5ANMA 4ERSH 1WV7T 5D72L 3DXAE 2XZZA 5LXGH 1Z0MA 1IM9A 3GSVA 1N7MH 3Q48A 5D2LF 1FL6B 1HSBB 3OKKA 3QFJD 4GRMA 4LCIL 4WWKB 2V2XB 2YD6A 2VWEE 1FNGB 4F58H 2HTKD 4PJ7B 5FCSH 3RUGF 1ZHBB 3TT1L 1HHKA 25C8H 3CFCH 4H26A 3ARDA 3FMGL 1JF1A 3DJ9A 4G9DB 4QYOB 4JY5H 4NQCB 3CLFL 5FFLA 3LN4A 4NM4L 5DS8A 3CVIH 5ICZA 1FYHB 2AK1H 5CSZA 2J5LB 1NGQL 3L3OA 3IF1A 3ETBF 5EU5A 2XZQH 4JHAH 1GCFA 2NR6C 5CUSL 1NFDF 4R4ND 5SX4I 2AJUH 4OLUH 3WO3B 2R1XA 3QIBB 5GRXG 4OCLC 3FB7B 3DNKA 3O4LD 3KJ6L 4XPBL 1H0DB 3B9EA 2Z8VC 4EDXA 1FHGA 4U3CA 2LAGB 1IEHA 3G6DL 5C0BB 1OTUC 4TRPH 3OKOA 5J89A 2P42B 4PGJA 4Y89A 1G7PB 4UAOC 3M17B 3HR5B 1QG3A 2X2YA 5C07A 1HCVA 3DPBA 2GI7A 3PQYD 2W65A 3BKJL 5B39B 3OAYK 2EDBA 4UTBL 5TJWK 1A22B 1XIWD 4WO4C 1A6WL 1TQBC 2ZUXA 4MNGB 2QR0A 5IOPB 5HTSA 3DVNA 2VLKE 4DKAA 2NXZB 3B8SA 2EIEA 1K5NB 5C8JB 2L4OA 5FYKH 4G80B 5JTWA 1ZT4A 4ONHA 5T33H 2ID5A 1S7RB 5E95B 3D0LA 2P43B 4OFDA 3TEUA 2FJFB 3TZVC 3UJJH 4KK8C 4R97C 3ECBB 3TBWB 4JM4L 1J18A 3PHSA 3QUZD 1E28A 1YECL 1AP2B 5FHBL 4XI5C 1F45A 3BZ4B 4Y4HA 2QBWA 2PKDA 4U1MB 1R3HA 5DJXA 5JW3H 5B4MD 1UYWL 1OAKH 4P9HC 2XXCB 1U41A 4EUPG 3QUZC 2EE2A 3SGDI 3PF2A 4QRTA 4WI6A 5DQJB 5JPMA 4PJEE 2X4OB 3ZKQD 4Z77B 3WD5H 2FZ3A 1G0DA 3MUGB 4ZOCA 3WO4B 1A7PL 4ZDHA 4D0CB 1G9MC 4X4ME 3MLXL 1FO0L 1UA6H 1S7VB 1P4IH 5K59F 1YEKL 1DQDL 4I0PC 4XCYA 4DZ8A 1IAII 5MEND 4MXWH 2EO9A 4Q0XH 3FT2A 4A6YB 3GBLA 5E9DD 1MWAH 3RKDC 4PP1D 1R3IL 3QXUA 1D5IH 2BERA 4X83A 5GS1B 4P5TD 4MAYD 5GRVL 5AZ2L 4UQ3A 2HFGL 4ODTL 4BSVA 3WJLA 1PYWB 2C5DC 4P9HL 1BVLB 4V1DD 1E4XH 2AEIT 4NQTA 3L9RB 2HKHL 3C08L 4XPFL 1KB9K 3FQXA 4P5TC 4MAYC 2PN5A 4TSBL 3HN3A 5EO9A 4QGTA 1G9ML 3EO0A 5FA3A 1AXSB 4KHXL 2BXYA 5E8NB 2IQAA 4FQHB 5E70A 3LEYH 3C8HA 2EKSB 1NC4B 4EXKA 5F1NB 4FQQB 1PG7X 3DETD 3RUGB 1VDGA 5GGQL 3DUHA 1Z3GH 4TUJB 2AXJA 2Q8AH 4P46A 1IAIM 1H5BC 1CLCA 5CWSA 4Q9BA 3TN0A 1DVFB 3U2SB 5EFIA 4KMTH 3DETC 3BQUB 4YHNB 4F7CA 2D7MA 4TTDC 3O2WH 1WGOA 4IS6B 4W6XB 1O7SA 1YEEH 2AEPH 2H6PA 5E1AB 1IGFH 1T2JA 3C8DA 4JZOA 1NGZA 4GXVH 4OGXH 2Y4SA 1NFDB 5D1QD 3NAAH 3RA7H 3QO0B 5M95B 1PJ9A 4OUUB 4O9HH 4Y5XB 2UV3A 4U1KA 4CKVX 3ULUD 3T0EA 4JQXA 1CLZL 5CINH 1EK3A 3MLSL 2GJ6A 3DUUA 5D1QC 4FXKB 4GUPA 3LHPL 1OM3H 2HWZH 4LARH 2N7AA 5HHMD 4NRYA 5GGVL 5I6XB 4ENEC 3OJ2C 3PGCB 4OJFH 4NZRL 2C3XA 2Y07L 2DI7A 3B5HA 4PLKD 5SX4H 3VDCA 5E8EB 3SEPA 3TO4A 3UPCA 1XZ0B 2XTJD 4FNLH 1T0NA 1UWGL 4HUXA 1HHHB 4ONFH 5D7IE 2VC2L 1QQDB 4WHYG 2IPUK 4NHCH 3BIAX 3UXFA 4XH2A 2GIYA 4LCUB 4OT1H 5EB9A 2ICCA 4MA1B 3X3GH 5L2KB 4UUJA 3MLYH 2BOCA 1I1RA 1JPGA 4WNQA 1NLDH 3GI9L 4M6OH 1E6JH 5KVDH 1MIEH 4D0BB 4OF3A 1QLFA 4ZUUA 4YHZH 4KVNL 1W0WA 1X5ZA 3CH1B 1NL0L 3MLVL 4O02H 1F58H 5HHVH 3GO1L 5KJRL 1MEXL 1RURL 4KMLB 4U6VH 4PJGE 3CXHK 2NY0B 3QQ3B 4JN2B 1D9KA 3JVGA 1VEMA 2I07A 3MRRA 4NKMB 1LK2A 3D39E 1GGIH 4NSKA 3ARED 3TA3B 5ADPL 1MH5A 1KN2H 2P1YA 3KYNB 5DQDH 3PG2A 5CFHA 3O3AA 4M8QB 2MKWA 3GMOB 5J6GB 1YEJH 1L0XA 2H2PC 3HAEG 3CX2A 4XXDB 3VH8A 1J86A 2VKXA 4L4TE 3IJYA 2GY5A 1H3XA 2Y5EA 3G5XA 4X98B 2BVQB 1HH9A 4NO0D 4F7MB 3DI3B 1RZJH 3FO0L 4ZUTB 3HI5H 3L3GB 3ZKSD 2P5EE 3STZB 5C0BE 4JG1H 1UH4A 3RIFK 4L9LC 4DVBA 5FEBA 5HI4D 4GW1B 3SGDH 4ZFFB 2MKLC 3QZWA 4U33A 3CZJA 4CU7A 4WVRA 4Q9RH 3ARFD 2DKSA 1JWSB 2HN7B 5A16B 5KVFL 1NANH 1N5YL 5IF0B 3OKDB 5BS0A 5GS2D 4ODHL 1FVCA 3W82A 3W0WB 4MNGE 4ZYKA 3ARFC 1F6AA 2A77H 3QWOB 1KCSL 4CDGC 1IAIH 4P2OD 1F8TL 4OGYL 5KS9B 1WFUA 3NN8B 4JDTL 2VDOL 3VXMA 3HE7A 1KLFA 4JG0L 2YOCA 2X4UB 1H8SA 3LB6D 5FDWB 4DTGL 5EU4A 2BHYA 4R3SB 2PW2A 4YHKL 5ERWB 5A2JH 4GAJH 1DBKL 2R1YA 1BJ8A 3FTGB 1UCBH 3CDCA 3KR3L 4OLXL 2GHWB 1MCRA 5C3TA 1QSFA 4L4JA 5TPWH 4NN7B 2WWKO 5HHNB 3B5TA 1NKOA 1ETZA 3QDJA 1RFDL 5DUPH 4NO2A 5F7LB 4QHMA 4O58L 2YPVL 2ADJA 2ZCLL 2BFVH 4UU9A 4K8RC 1F4YH 4GMSH 3OKLA 5HDQH 3H7BA 2R0LL 3BD4A 4NUGH 3GSWA 1MY7A 1AGDA 3P4NB 3VXTA 5ENWA 1UZ6E 2HT4D 5FGSA 3KS0J 2Z31C 4I3RL 2ILLA 3CDYA 3FB8B 4QRSA 4PRPB 4G3YH 5ECJE 3ARXA 4JPVL 2WAHA 3MX0A 3DURA 2YD8A 3VXUE 2IAND 3QIWC 1P53A 3B3IA 1FFPA 5D6CA 2A6JA 1ACYH 1GPOL 4K8RL 5ACZB 5FYLE 5I8OL 1CR9L 3S35L 3PP4H 2ADFH 2PO6C 4MCYB 1PZ5A 1U3HB 2UWEE 1UB5B 3F7VA 2NY6C 3L5XH 3R06B 1T89A 4YDIH 5FUOH 5HVGB 3IFPB 3VXOA 5DLMH 2Y6SD 1KJVB 4HZLA 5D8JL 1JHLL 2ZNXA 1U8PB 1QLEH 2X4TB 2DQGH 4L3EE 4JO4L 4N1EA 4JRXA 3GMRB 4ODVL 2VXSL 2AXFA 1MAML 4K9EC 4HWBH 3HPJB 4W4NA 4TUKH 4KZDH 1HWHB 2C1PA 3OXSB 5ESVB 2QQKH 1A1NB 1NBYB 1NC2A 4F7EA 1A2YA 5J9PA 1A5FL 1AR1D 4OZFB 1NAML 3CPLB 1J0HA 4LLYA 2FX7H 1HYSD 3QXTA 5DJAA 2EH7L 3QHZH 5I74B 1IQDB 4X99B 5JO5A 5H2BB 4KKAC 4TQEH 3DVGB 3ABZA 1DQTA 1AR1C 3S6CA 2V2WB 4HBCH 1JNHB 2A83B 4JANA 3U4BL 3EDFA 1IM9D 3P9LA 4G8IA 1CTOA 1LP9E 4ZO9A 2R1WB 3LKOA 4K9EL 4IRJB 4NJ9L 5DJ2A 5IR1A 3ZMRA 2DQJH 4PJFB 2GSGA 3EAKA 3ZTJH 1X5XA 1I8IB 4LSQH 4UB0H 4PBWD 1IGYB 4ZO7A 4BFGA 4IDJH 2H32A 1QR1B 2ATKB 1KLUB 1IQWH 1BQLL 2X4PB 4KRPD 2AABL 2J8UA 4NYLB 2FATL 3TV3H 3ZKMD 1X4XA 2MNUA 3GBNH 3HI1A 5MEQB 1MJJA 2P24B 2F8XC 3CGTA 1PQZB 3ARDC 4OD3H 3QA3B 5F70A 1JJUA 2X70A 2IBZY 2PTVA 2NTFA 4PRHB 1CD1A 1WEJL 4LPYA 3ZKMC 4M1GL 1CGVA 2AJSH 4OZIA 1FVDB 3W2DH 1MOEA 1B3JA 1KNOB 2BVUA 3QG6A 3REWB 4L9DA 5L8LB 5KSAB 1II4E 2FSEB 5EO1A 2ENSA 1U8QA 1EX0A 1DN0A 1TNMA 1S9YA 4Y0GA 5C07D 1U95A 3PWNA 4C57C 1KUMA 1EFXA 2CRMA 4MJ2A 2QQLH 5D7JA 3QEGL 5E2UH 3TESA 5FA4A 5TF1H 1TCRB 5CP3H 5DA4A 4QRQB 2EDOA 4X8JB 3M1BA 5HGDB 1CK0H 3V5DB 2UZIH 1NSNH 3HB3D 2I9LB 1U9KA 2JK5B 4X5XA 1C5CH 4XC1L 4E0RB 4X5WB 3ARBB 2VB5A 3D25A 4J8RA 5F88B 1P1ZB 1HHIA 4MHHI 4U1HA 3P73B 4AEHL 3GHEL 3X12B 5DD6A 5K9QI 5HHQB 4N8CL 1I1FB 3HB3C 4WY7H 2JTDA 5JZ7D 3O8XB 1T83A 3D2UA 2ERJC 3T3ME 4WW2A 1PBYA 1WC7A 2A6DB 3WDJA 4LCCA 4WEBL 4Y4HD 2P47B 2G60H 1LVEA 3EZJB 1KENL 5JZ7C 1JMZA 3H7LA 4BZ2L 3KPOB 4I77L 1Y18B 1E27B 4Y4HC 5IQ9B 4R26H 3MRNA 4HULB 3OHXA 3TBYB 2EYRB 4JDZB 4YR6A 4HH9B 3GMPA 1L6ZA 3EYQC 4OLEA 4G5ZL 2F5AL 3D69B 4I8DA 1ZLVH 2GAZB 3C6SB 3QB7C 3HS0B 4OGAD 3RI5K 2XWJB 5F3HA 5CD5C 3ZYOA 5T3ZE 2VLLB 5B22A 1BIHA 4DFIA 1LHZA 4ELMF 1UXSB 3L7EA 2WWMD 3MNWB 5JDJA 5CJBA 5IBLD 5I1DB 4ORGA 4ZUSA 1QBLH 4WRLA 5SV4A 3VXSD 1I8KA 1LO4H 4RMSA 1KJ2H 1PLGL 1MCIA 2QHRL 3U0TA 1WAAA 3H9ZA 3LKSB 3L3HB 3I6LD 3WJLC 1J0YA 4JZJA 4HG4K 2EIDA 4I0CC 4MNHA 1CDHA 1U8NA 2CKNA 3CFJB 1UADC 3GMLA 3BPCB 4N0YH 1CDBA 5BZDB 1CDJA 1MJ8H 4G6MH 3GMNB 1SYSB 4XBPB 1DR9A 3BPNB 3CK0H 4J1UA 1D6VH 1FDLL 4P46D 4DN4L 5JXAH 5JLZA 3HG1A 1NLBL 5EOQL 3UPAA 1GGYA 4PJHF 4KHTH 2E27L 2V9RA 3LKPB 2N56A 2X9XA 3OB8A 2EKJA 4L8DB 1RAMA 4U6HB 4P46C 1RQ5A 3VXNA 3MLRL 5LQBH 3TBTA 3O0RH 4WJ5B 3TN0C 4NO3B 5IUSA 4UTAH 3TCLA 3NFSL 2JJSA 2ZSWA 2FDBP 1RK1A 2XQBL 2WLZA 3G5ZA 2GJ6D 1NMCC 1XGYH 2J8OA 2LE9A 4YZFE 1TVHA 4FFYL 3TT3L 4JKPL 4KJQD 2DKMA 6CGTA 5I71C 3WNMA 3T0EC 1X5JA 4JQXC 1AGBB 5SWZA 4KK5C 4JFEB 4RWYH 5F96H 4HS8L 3TNMB 1NMBH 5EU7C 3ARSA 4KTEL 5DHYA 4D9QD 1I9RH 3QDGE 1AIFA 4MJIE 3H9SA 4KJQC 3TO4D 1LQSR 4X4YA 2WSKA 3NZ8A 3O45B 1CWVA 3O9WB 4TSAH 4JFDE 4LLWB 5GRWA 5IMMB 4U2YA 4JO3H 4R7NA 2FX9H 3L5WB 3QUKB 4BYHA 2VN4A 5C0DB 1YEIL 4XBEL 5B38A 5ESQB 1A3LH 2JLLA 4Z7UA 1FIGH 3MA9L 4Y16D 3TO4C 4G7VH 3MRLB