3OKOA

Crystal structure of s25-39 in complex with kdo(2.8)kdo(2.4)kdo
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMNCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFALTISSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERANGVLNSWTDQDSKDSTYSMTSTLTLTKDEYERHNSYTCEASHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okoA01
3KPSE 2A9NH 1A21A 4MDIA 5BJTB 5CAYB 5LJYH 5EBLB 2QSVA 5D1XC 3LIZL 2GFBA 5I17A 3BKML 4WUUE 5IG7B 1CGYA 3K3QA 4YHLH 3FL7A 4Z8FH 3UYRH 3ZYZA 4RAVA 4A2MA 3PWVA 4PJGA 4XP4H 4XNUL 5KVFH 1D5XB 1UZ6E 3H9SE 3T77A 3MRDB 3QCVL 4WVRA 1XH3B 3RY5A 2ZCLH 5FO8B 1BFVL 2R4RL 3QIUB 3V79C 5AG8A 4X9BA 2P8LB 5CILL 2AJSL 4OB5L 3HI1B 3DO7B 1L7TH 1BIIA 2A6KA 2KL6A 5LWYL 3B3IA 3IJYA 4H8WL 3DGGB 3DX9B 2DM4A 2UUDK 4YDJB 3RQ3A 4M5ZH 4NJ9L 4YDVA 3QUYD 1A7NH 5DUPH 2H32H 3O3DA 2A38A 2VL5B 3MA9L 3UTPE 3VMPA 2CDEB 2D0GA 4TOYH 1A6VL 5F72S 1MCKA 2EE2A 1OPGH 2WLZA 2X4RB 1F90L 1AHWA 4F9LA 4JANB 4PJIE 1FGVL 3K4DA 4YBLB 5KSBA 5F7MC 4Y16C 1IGJB 2D9QB 1NGWB 3SDXA 5I76B 3CDFA 4Y4HD 1FORL 1UWEH 4PBWD 3RY4A 3QNYB 4FOMA 1TPXB 3OKKA 1KCSL 2AJYL 4D9QD 3NA9L 4XP1H 3UTSD 3UAJC 4WGWB 3JVGC 5F9AC 4UMGA 5HJ3B 1B0RB 2NW3B 1T3FB 3T0VA 2P1YA 4KK6D 2W9EL 3UJIL 4H20H 4XI5C 4D9RD 4UIMA 5E8OB 3EYVB 4ZD3L 1VENA 3VD9A 1T66D 4M43H 3PJSA 5CINH 1RZKH 32C2B 4WI4A 2KH2B 3O2DL 4H25B 5EC1A 2YD2A 5FAAA 4XVUC 5KOMC 4OQTH 3MV8D 5KSBE 5EDXA 1WT5A 4Q7DA 1D9KA 2Z93B 4MHHG 2IH1A 1UM6L 1E4XH 5C3TA 3CVHH 1JZ5A 3UTQB 4XXDA 4Z76A 4FQHB 4LOUD 1F4AA 1A9BB 3NIGF 1TQCB 4ODXB 3OXSB 2FGWL 3O6FB 4MNQB 2DWEA 4XAKE 1RIUL 2DQCL 3VMOA 2R69L 2FL5B 4UBDD 5DWUL 1JHKL 2EE3A 4G9FB 1U95B 4GBXB 3DARA 4NZTH 5F21B 1IM3B 3B9VA 2W0PA 3QZWA 4HD9A 3RWHB 4HXAL 5IW6B 2QSCH 3MXWH 1XZ0A 3GO1H 43C9B 5JNYB 3PWLB 3QXVA 1FYHB 4BZ1H 4WI2A 2JK5A 4XP6H 5EA0H 2K3TA 3BP6B 5CBEB 1JZ6A 1QHPA 2HMID 3DJ9A 5C0FA 1CVSC 4P4RB 3BAEL 3UTTD 2EIDA 3HNVH 1K8IA 3OMZA 2X4TA 4Y7MA 5EU6A 3GSOA 4ODTH 1EFXD 5IVXB 5T1LB 3C5ZB 3H2WA 5I1DA 1QFWH 1QFOA 4LKXA 4F58L 1G7PB 4KTYA 1OAXH 1IKFH 1A6UL 3HI6L 3NTCL 5FF6A 1G7JA 4AEIL 1JWSA 1IAII 4JHBA 4JFQA 2WBJA 3BPLB 1N64H 1RJZA 2DB8A 4H88L 5E00A 1NGXB 4ZFOL 2VTFA 5E9DA 3IJSB 1MCOH 5F97E 1LO3L 2AABH 3CD4A 1FYTD 2CPCA 1ES0B 5EN2B 3MRFB 2FYYB 5GS0L 4DEPB 5F9OH 5FECA 5GS1B 3AAZB 4TVPE 4GMTL 1EHLH 2XWBB 4X7SL 1S3KH 4F9PC 3EFDH 2VXSL 3MJ9A 4K8RL 2ATPB 3RNKB 3HC3L 4P2QD 3UPRA 4RRPG 4DN3L 1MCWW 3LKQA 3AREA 2QBWA 5D72L 3ZL4L 4ZPTA 5ANMA 5D1QB 3VGAB 4EDXB 3O6KL 4JN1L 5F7DA 2GHWB 4H1LG 2Z35A 1J05B 4YBQC 4HCRH 1J1XL 4PV9A 4EN3C 2YEZB 4XVJH 3OKOA 1QKZH 3KPOA 2VQ1A 4MQ7A 2UVFA 3V5HA 1MI5A 4JKWA 4LSVH 4UB0H 1RURH 4MLSA 3WIFB 2BNQD 1BAFH 3SDXF 5IFJA 3WO4C 3SPVB 4PJFE 2XRAL 4CVWA 4TTDC 3V2AR 3OKMA 3GMLB 1J1PH 4ZXBC 4BQ9A 3MCG1 1P1ZA 2BCKB 3D18B 4Q0XL 1GH7A 4JM2D 1RULH 4D3CL 4ODWB 1O7VA 5FYKL 3SKJL 2FEDD 1NEZA 1EBPA 1TCMA 4NUGL 3D1MC 1EK3A 1OTSD 4MJ5B 3CZJA 4LPTA 4GRWE 3EYQC 4OLUH 1ZHNB 4UDUB 1XR8B 3O81A 3RP1A 1G9ML 5T1KD 2J7LA 3IS1X 1FRGL 1MIEL 4ISVB 4F7PB 3ULSB 4BFIB 1K4DA 5CEXB 3UBXI 1MQKL 3BGMB 1DUZB 2GSGA 3RKDD 3T2QA 4ZNCD 3B2UD 2B1HH 4PB9H 2E6PA 2JB6B 1DL7H 5DI8A 4JO3L 5GS3A 2Y06L 3M07A 1KTDB 3BZEB 1BJMA 4OD1L 3AS1A 4PJDE 1YMHB 4ODUA 1AR1D 4Y4FD 5GS2D 1WITA 4N0FB 1Q72H 3MJ8B 2AXJA 5D7KE 1LP9A 1PKQE 1MF2H 4ZSOE 1JGVH 3VWKD 4XNZB 5KG9A 4NBXB 4X6BA 1NANH 2G9HA 5D71L 4WRLA 1NSNH 5DQJB 4XNYH 4OUUB 5CFHA 2HTKC 4JN2A 5JW3H 2BNUA 2H3NB 4JM4H 3FO2B 1UXWA 4YHLL 4Z8FL 3HUJE 2EXWC 3UYRL 1H3TA 1UEYA 3O9WD 4JRYE 2NY3C 5LAXA 3QPQD 3F7PC 3BZFB 3HZVB 5KVFL 4C4KO 4HPYH 2ZCLL 2Y25A 3HPJB 2GAZA 4Y16A 1EGJH 3O3BA 1DLFH 4HUKB 1T1WB 2APVA 4IM8A 4N8VB 4NKDB 4Z78A 4XCEB 2C4FT 4OGZA 2VE6B 3VDAA 1AXTL 2X70B 4F7MA 1L7TL 5ITFB 1YEIH 2CDFA 5A43C 4G7VH 2LTQB 1ZT4B 5JIIA 5D7JB 2R4SH 3RL1B 1HE7A 1A7NL 2IPKA 3JVGA 4J23A 5DUPL 5IIEA 2Q76B 4TOYL 3QP3A 1GSMA 3LN5A 5E4EC 1F8TH 5C1MB 7FABH 3O41B 1OPGL 2IPUG 3TN0C 4MXWH 3DGCR 5K33A 2XFXA 1OGTA 4G6AC 1Z9LA 3FT3B 4XCCH 2ERJC 1A2YB 1UWEL 2W91A 5DC0A 1W0WA 4HMCA 2H2PC 2FNBA 2HJFB 1H3UA 4QHKI 4XP1L 4TSAH 5F8QC 2GW5A 4ZUSA 2IBZX 1I3GH 2W9DL 4OCXH 1JFQH 1EX0A 3N06B 1P4IH 3D0VA 4OFIA 5HSFA 3E0GA 4IRJB 2E9BA 4H20L 1NGYA 2P48B 1IKNC 2XQYK 2IAMD 1J8HA 3MJ6A 3BUYB 4KVCH 4RMSA 2XTJB 4ZAKC 1QHOA 1OOAA 4M43L 5CINL 1RZKL 5HGGS 3QRFM 3VDBA 1PX3A 3O45A 3WSQH 1L0XA 5TDNB 3QUXC 3BN3B 4N9GB 4HZLB 4OQTL 2ZCHH 4XCNB 4HC1A 4QHMA 4QRSA 4CN4A 1E4XL 1KTLA 3BD5A 4L4VD 3SKOB 3I6LD 1JPSH 2GUOB 4FQPA 3DVGA 4JO2H 4X4YB 4JY6B 4YR6A 4L8DA 4O2CB 5MENA 2EEBA 5AWNH 1KCRH 3R06A 3SE9H 4WWKC 3PQYD 4OLZH 1R5IB 3BKCL 5EPMB 3IDMB 4XP9H 1AGCA 1NCWH 43CAB 1KIUA 3FN0H 4OIIH 4U1LB 5CP3A 2Q7YB 1OP3H 3MFFA 2BX5A 4YDIH 5MP6H 5H2BB 3OAUH 4NZTL 1D6EA 4JKPH 2MMXA 3W0WB 1NKRA 3D25B 3CFKB 2QSCL 3Q5OA 4NCC2 4P23B 4L29A 3DECA 3MXWL 4EXPX 3GO1L 3IDNB 3T1FA 2VLRB 1SBBA 1UM4H 4X9HA 3QJFB 4RGOL 4PRIB 5IK3B 3V9FA 4BZ1L 1YMMB 3IDGB 5E6IA 2RB8A 1R3HB 4PJHF 3EO1A 1T5WA 2BVPB 5EA0L 1GOFA 1CTOA 3PHQB 4ZPVA 2QQKH 1NC2D 3AUVA 3HNVL 3V7AG 1RJCA 4WW1B 2PYEA 3DV6B 1FZMB 5JTWA 1G7QB 3BZ4A 3DMMD 2CLZB 3FRUB 3VXRB 3ZKMD 5EZJB 3VXPB 3ULVC 5H35B 3ZSTA 3KXFA 4AZ8A 1UADC 4K3GA 1KXVC 1S5HA 5JIHA 5JO5B 4F9PA 5I6XB 4HMDA 2CLRA 4PRPB 1OAXL 1IKFL 2J4WH 5JMRA 1X6LA 1AD9B 4X8JA 4PRNA 3DHJA 5BOPA 2D3VA 1N64L 1LP9F 4V2CB 1U2HA 5DHYA 5C2UB 1RUQH 4FFYH 3FFCA 4FA8A 2DBLH 4DVBA 1QOKA 3IDIB 1ZA6A 1UWGH 1PX4A 2J8UB 3TBWB 1ND0A 1FL6A 4MJID 5HGBB 3QO1B 4PJ5A 1B4JH 1G6VK 5D8JL 4HJGB 5FA3B 1MCNA 3CMOH 4R4NC 4RFEA 3RWJB 1EHLL 4EN3A 5MEOA 4WFEE 1CD9B 1S3KL 5I30H 3EFDL 4ODBD 5ACZB 5L2KB 2BDNH 3RVWD 1W72A 2DJUA 4ZODA 2OQJA 4RDQG 1FAKT 4HWZB 2DQEL 2EDHA 2VIRB 1NFDB 2V5TA 3NZHH 3FKUS 1S9YA 1K4CB 3PABB 4WFHD 3NFNA 4HS3A 3PP4H 1QSFB 2XI9A 4HCRL 1JV5A 4YHKH 4C83A 5IFHH 3M45A 2JIXD 3CFBB 4YHYB 2R0ZH 4XVJL 3QFDA 1QKZL 1IC1A 2X7LA 3HNTH 3G5XB 4LIQE 4U6YB 1HEZA 4WGVB 4LSVL 4UB0L 1T4KB 1P5UA 1RURL 1BAFL 4Z7QF 2Y7QB 4QHLB 3GSUB 5IBLC 5T3XD 4XPAH 4HT1L 1FL3A 1J1PL 3FHQA 4RGNB 3MJ9H 1FL5B 3U83A 1A6WL 4ZS6D 1RULL 3I6GA 1JUFB 1U3HD 1A1MB 5FGBC 2VLLA 5HBBA 4FHBD 3GHBL 4Z7UE 4Y5XB 2W1NA 3TJHC 4MVBD 4OCRH 2OMNA 3WUWG 3KLDA 2L4OA 1WAAF 4OLUL 5KVMC 1TVDA 5K9KB 2HT3D 1IE5A 1MREL 3MLZH 2DIJA 4PJ8B 3QQ4B 5EZLB 4MWFA 1NUGA 1MCBA 2B1HL 2I27N 4PB9L 5C07D 1R5WB 2R9HC 4AIXA 3QBTB 3RDTC 1BQUA 5L8KB 3CU1A 3SBWC 5IMLB 4LDLB 2DDQL 1U8PA 2X4NB 3MRPB 4JLRA 5I1HH 1Q72L 4NQCB 5CGTA 1EMTH 1HXYA 3LB6C 1MF2L 3DXAD 1JGVL 5J12B 2NY0D 4R2GC 1NSNL 1A5FH 1PKOA 4PLKD 1U8KB 4MD0A 4XNYL 4P46B 1KCUL 1I8KA 1EDQA 4X6CE 3BIKB 4HSQA 4P2OC 1M1SA 2P4AB 3EJYD 5FYLH 2EYSB 3BYTA 3CNKA 5E2UH 5CEYB 4ZFFA 4HPYL 1HI6B 5ICYB 2X10A 1DLFL 4R4BA 4PJ9B 1T83C 1CICD 4JQVC 4QRRB 1EHAA 1KN2H 2FWOB 2GJ6E 4ERSL 3KR3L 3QIBB 3TVMB 1YEIL 4DAGL 4G7VL 5M95B 2DQFB 3EFFA 5ENWA 1CT8A 2R4SL 5E8NA 3MLRH 2BSSA 5K9OA 3DBXB 4OF5A 1A4KA 1F8TL 7FABL 3ZT7A 2X4SA 2UV3A 1FNSH 1IKNA 4MXWL 3O4OC 1G9NC 1KT2A 1UJTA 5GSVA 2OP4H 1QSEB 2DLFH 4ZAKA 5EOTA 5DQ9A 4XCCL 4B7IA 5GSRA 2ITDA 1K9TA 4L8SB 4LHUA 3QUXA 3REVA 4ETQB 4DFIA 3GSQA 2DYPB 5C9JA 3GMMA 5AYUH 1KNOA 4TSAL 5C08D 1CL7I 2WK2A 5IB4B 3GBMH 1X5KA 1I3GL 4YJZL 5IMMA 4OCXL 1JFQL 5GJTH 3EYOB 1P4IL 1WCBA 1U93A 1S9XB 2XKNA 1Z5LB 4KVCL 3T0EE 2E5EA 3QULA 2MKWA 1TVHB 1X4ZA 1ZGLA 3QHTC 5F3HA 4HKXA 1BQHB 4IMLA 3OR6B 5F7LB 3WSQL 2F8XC 4Z7WA 2VYRE 3QUYC 2ZCHL 3VH8A 1TJIH 2ZWLT 1RQ5A 2V7HA 5D1ZB 5IEHB 1X5JA 2GJZA 1CLYH 3VFTB 2ICWB 3BSZH 1GYAA 4L1DA 1JPSL 4JO2L 2FX8H 1KLGA 2G5RA 4WHCA 1I8IB 3PL6D 4Y4HC 5AWNL 1KCRL 2R1XB 3SE9L 2FO4B 1JGEB 2YPLA 4OLZL 4K55A 3X13A 1KB9K 2RAMA 3L9RA 5C0CD 5C0AE 1BJ1J 1NCWL 5ETUB 4OIIL 5T3ZH 2VLMD 3N1MC 3TT3H 5BZDA 1DUYB 2Q8BH 5JLZB 4YDIL 5MP6L 4J3SA 3OAUL 1NKOA 4JKPL 4U31A 1TZIB 4KK6C 4Q74A 5D7LA 3D3VE 1RUMH 4Z7WE 3HR6A 2EDXA 5J6GA 3T3PE 2YD3A 3N0PB 5F88A 2Q8AH 5F7NC 1T66C 4WIQA 3G9VA 2G75B 4ZQKA 1UM4L 1U8QA 4KDVA 3EDFA 4HC1H 3RPIA 3MGOA 5JMOC 3IFNH 4P3DB 3X12B 5DVNA 4CMMA 1H3WM 3V5DA 5E1AB 3U9UB 1AXIB 2QQKL 4MA3B 1OAUH 4P4KA 1JHLH 2NXYB 2VXUH 5EU7C 4ZUTB 4LLYB 4LOUC 3DX8A 3T2OA 3PWPD 3TGXA 1A3LH 4JFXA 2JCCA 5CP3H 3ARGA 2EKSB 4C58B 5FUZL 4YHPA 4I18C 4ZO9A 1RUQL 4FFYL 1LE5B 1DTUA 1KYOK 3KDMB 3LN4B 1VKXA 4UBDC 4BK5A 2DBLL 3GEWB 1UWGL 3GBNH 1GOGA 3AXLB 2WUBH 3R4DA 5E8PB 1H8NA 5B22A 3WDHA 4RWYH 1X7QA 5I16B 2YA0A 3CMOL 2X4UB 1M05B 5I1LB 3I02A 3OWEA 1WBXA 2D7TH 2IANA 4TVPL 2Z31A 3K2MC 5I30L 2BDNL 2AP2A 4P57B 4XRCA 1P2CB 4F7EA 1JRHI 2ADGB 3BWAA 4G6JH 5F93C 4YFEA 2HMIC 1CU4H 5FM5O 1DN0A 3R0NA 4NUJA 1A7QH 4CJ1A 5DJZA 1IJ9A 5TGBB 1A02N 4BSWA 3NZHL 3C6SB 3QEUA 5HYJD 4K3HA 4L8BA 2KQMA 3PV6A 5E4IA 1QA9B 1OGAE 3NH7H 3T0DA 3L3DA 3ARFB 1AO7B 1QQDA 5CGYD 1UKQA 4YHKL 3IYLW 5FGBA 1Q9WB 5SWZE 1B6DA 5IFHL 3HLAB 1MAJA 2R0ZL 1H5BC 2R1YA 2DI7A 3HNTL 4W70A 3RWGA 1KIPA 3FFDB 3NCJH 4MSWA 3UXFA 3V4UH 1A0QH 2IANE 4NC1C 3DX6B 1UA6L 1U91B 3LQZB 4XPAL 4XBPA 2V2TB 1BBJB 3OV6A 5EOCH 3MJ9L 4XH2A 5BRZE 4LRNH 3T4YA 5DXWA 5A16A 4CN1A 3KYMB 3QDME 2C3WA 3RDTA 1MLCB 5EO9A 4M7JH 2PYFB 3SBWA 4OFVA 4BSVB 4LEXH 4X7FC 1TENA 3KPQB 2F53A 3SY0A 5JZ7C 4OCRL 2A6IA 1IAIH 1ZSDA 3C6LA 2A74B 3BDYL 4R8WH 2EC9U 1U41A 4Y5VB 1S7QA 2BY3A 2W92A 3B9KD 5SV3A 3EAKA 1F45A 5FFLA 3MLZL 1A7BA 1LO5B 1URLA 3O6LH 3K8MA 1HDMA 1E27B 3AVEA 3UC0H 3FO9B 5CBAA 2ZOKB 4HBCH 3C5SA 4L4TE 1UG9A 2J8OA 5F89A 4P2OA 4I5BB 2WANA 3QPXH 4GQPH 4P2RE 5AD0B 5I1HL 4NZRH 4NKIH 4EI5D 4N8VG 1EMTL 4CDHA 3T2NH 3UJTH 4ZFOB 1SYSA 1YQVH 4DQOH 3DURA 4JM2C 4OZIB 1A5FL 4NZUH 4RQQA 2FEDC 5GRJH 4MLIA 2NY2D 4I0CC 3ULVF 2AK4E 2FJFB 5DJ2B 4N8PA 5IV2B 1OTSC 3EYFB 3VDCA 1OAZH 4PRHE 5JUEH 2DLTA 3KS0J 5FYLL 4NHUA 5E2UL 4HGWA 3O4LA 3VFUA 2C9AA 4FRWA 5CP7A 3F7YB 5FM4A 1U58A 1KN2L 3BEVB 5T5FH 1EXUB 3JTSA 1A7RH 3B2UC 4YZFF 2I5YH 5F7KC 3WFHA 1YPZE 3RTQD 2WMPA 3HAEB 3MLRL 3E6HA 5DVLA 1AR1C 2PO6B 4Y4FC 4JFED 1KF9B 4MAYB 2DQUH 1MHCB 1PBYA 4LLQB 4XAWL 1BGXH 3IRPX 2JCCF 2EE6A 4XC3H 4PJBB 3VWKC 4OZFB 4CBPA 2VLKB 2OP4L 2DLFL 1MIMH 3QDGD 3WIHA 4UAOB 1YN6A 4CVXB 5C86A 1X5GA 3QUYA 3P4OB 4OAWA 3PIQA 3S5LB 3UEZA 3HKFA 2P5EE 2WIIB 4X4MA 3TO2B 2AK1H 1VFBB 3JUYA 3O9WC 5AYUL 3QPQC 2MFNA 3FO1A 2PTVA 4UQ3A 3GBML 1AJ7H 3FOLA 4BA8A 3RWEA 2W07A 1DSFH 5EC2B 5IVOA 5DK2B 3QEQE 2I9TB 5HYIA 1JPTH 1YNLH 4Y4HA 5ABDE 1J5OH 1OSZA 4BFGA 4MA1C 5GZOD 1IAOA 3AS2A 4IS6B 5F9DC 4U6XA 1N5AB 2XN9E 2MPAL 3UTSA 3KVQA 4LQ1A 3PWNB 4XWOD 2PF6A 3CFCH 5EBGA 1WUNT 5IKCA 2P8MB 3WHXB 4OLXL 2JE8A 5JHDB 5ESQB 1CLYL 5GGRA 4YXHH 2ITCA 1A6TA 4OZGB 1WEJH 1KIRA 1RIHH 3D39B 3GZKA 5D7IB 2FX8L 4NYLB 1RFDH 5BVPH 2H1PH 2V17H 1M71B 3DUUB 4KDTC 5I66B 1IGIH 1FBIH 2YD6A 1EHXA 4Q2ZA 3ZE2F 3MV8A 3LHPH 1ZHLB 1XIWD 1F13A 3HE7D 5T3ZL 2HJKA 3TT3L 2Q8BL 4KVNL 1PDKA 2ZUXA 4D9QE 4TUJA 1F11A 1RUML 2IAMC 1QFPA 3LRSB 1KJMA 5EBMA 1CTNA 4HEME 4HIJB 2Q8AL 4ELMB 1AQDA 1S7VB 5BQ7A 3TO4A 1YUHB 2IMMA 4HC1L 3IFNL 2AV1A 4TNWK 2NXZB 5C0BB 2HFFB 5GIRB 1ZHKB 5DRNA 3Q2CA 2ZJSH 3JSSA 3NIDF 4HUNB 1I3VA 3KAAA 1OAUL 4M7LT 3AB0B 5D5MB 4J1UB 1OARL 1JHLL 3IKCB 2VXUL 1JN6B 4QRUB 3GB7A 3MV8E 4AIOA 2C26A 3ARBD 2CIIB 2H32B 4S10A 2P7TA 3MOQA 2P42B 1N0XL 4N0UA 3BT2L 3F12A 1OT2A 2LQRA 1JZ4A 1A3LL 3F7RA 3KYKH 1P7QD 5IB3A 4OV5B 4PRAA 4XZUB 4JFPA 4NWTH 3ULVH 1K2DA 5TPWH 1EFXA 3MRJA 4GXUN 2VERN 3GBNL 4S1QL 2D9CA 3RGVD 1EEZA 2WUBL 1JF1B 3VXMB 3GBLA 4FFVD 2I24N 3L5WB 5MI0C 2R2HB 3O3EA 5I8CA 4UTBL 2B4CC 2BY2A 2EO1A 4XNQA 5D2NB 2D7TL 1VGKA 1H5BA 5L2JB 4YIQA 1GC1C 1CXKA 4MB3A 5F96H 5KVDL 3GJFA 1V3MA 2XY2A 4G6JL 1S8DB 2LU3A 4S11A 5DFTA 5GGQH 1FJ1A 2E8ZA 2EYRA 4RMRA 1I1YA 2EYTA 4EQ3A 5KOVC 4HW6A 1NBVH 5CWSA 3DMMC 3ZKMC 3QO0A 4F3FB 4LAQH 1S7WB 2WINA 2PXYB 3UTTE 5GPRA 4PB0H 3NH7L 2P46B 5F7FA 1WBYA 1I1AB 5TQ0H 3FQTB 1MFBH 3V5KA 4P2QA 4U0RB 2F54D 3CVHB 5DJ0B 5DJYB 5CZKA 3V4VL 2Z8SA 1GPOH 2P5WA 4OD2B 3NCJL 3UROR 1XGUA 4NQXB 5EO0B 3UP1A 3WKNA 5D93C 3V4UL 1A0QL 1JI2A 4KXZI 4NQED 3M8OH 3QCUH 2WLYA 3KJ4C 1AY1H 1G7IA 5GGVH 4QTIL 3EOBA 3OR7A 5J6HA 1QR4A 2NNAB 4N90D 4WEUD 3KPLB 1W72L 4LRNL 4Z0XB 2OK0H 4X6DB 3W5MA 1FYTE 2UWEB 1A1NA 1GGUA 1QP1A 5DA0B 1TLKA 3RVWC 4M7JL 4DFHA 1N2RA 2BNQA 4LEXL 1XT5A 4HHAB 1Y6MR 3VG9C 3BD4A 3GUTA 1BFOB 4IRSB 1IAIL 3TPUB 4MA8H 1AGBA 1JF6A 4Q6YA 3RNQB 1J8KA 3TIDB 4R8WL 1PEWA 2XZAH 5JOFA 4B50A 4KQ4H 4POUB 3EGSB 2VR5A 2I25N 2E3VA 4LLAA 4JM2A 3P9LA 5HHOA 1CD0A 1NFIA 3EYSH 3O6LL 4XMLH 3SGJC 3UC0L 1B0WA 4HBCL 2Z4QA 5DJCA 3FT4B 1R3IH 1V05A 5B21A 4QRTA 2DTMH 4NQVA 1U0QA 5JW4R 4UQ2B 3OJ2C 2CLVA 4HAFA 4NZRL 5T1KA 2DAVA 3ZDZF 5MEPB 1MQ8A 4NN6C 1R6VA 3T2NL 3O8XD 4XPBH 3KYOB 2HLAA 1VA9A 3VXSE 1YQVL 4DQOL 3LKOB 4U1KB 4ZS6C 5DEZA 5F6IB 5AG9A 1U3HC 3QDJE 3SO3C 5DMIH 5GRJL 1XMWA 2O5YH 3VFWB 3GFUA 2R1WB 5DURB 1AGEB 4LAJH 4QRQB 4Y4FA 2XA8H 3S4SB 4MVBC 1OW0C 1OAZL 1CDJA 5JUEL 4FMKA 3IETB 2RFXB 5KS9A 2HTLD 3KHQA 1P84J 1OF2B 4PJ7A 3VWKA 3C8HA 4GG8A 2BC4A 3Q0HA 3QQ3B 3STLB 3CDGB 1MFEH 5T5FL 3OXRB 1A7RL 3HZYB 1YEJH 1UB5A 2I5YL 3FMGH 3O9WA 1E4KA 1N7MH 4D0DA 3IDJB 2OR9H 1P7KA 4AM0A 3KPRB 3TIEA 5K59E 2QHLA 4JZJB 5CJXC 2KUTA 2DQUL 2N7BA 5GISH 3B6SA 3OF6D 3SOBH 3DRQB 4M6NH 4XC3L 3SJVB 3STZB 1ZT7B 1MIML 2NY0C 1XGYH 2DJ4A 2VWEE 1BQHG 1AFVL 3DI2B 3ROOA 3RWDA 2BZDA 4L4JA 1OTTD 1UENA 4PLKC 5ICXB 3VXUA 3ARDC 1BREA 4I0PD 2G2RB 4A6YA 1XCTB 2AK1L 1NCBL 2X1XR 1G9NH 3K8KA 3RUGA 1UCBH 2X4OB 4I3SH 3EJYC 2YSSA 1F3DJ 2X4QA 1DSFL 5F9JA 3EBAA 5FCSH 4KDTA 1CICC 4X5WA 1I9JH 1JPTL 3IDUA 1YNLL 3BPNC 3FB5A 5EU4A 5L7XL 5IJVB 1J5OL 5TDPB 4Y19A 4JFHE 2V2XA 4BM7A 3VFVA 3BKJH 3U79A 1NBQA 3TNMA 4Z7VB 5C7XL 4L3EE 4W6WB 3IDYB 1NCCH 1ORQA 1FVCB 3CFCL 1Y0LB 4FZ8H 4Z77B 1WZMA 3JV4B 4KH2A 1R3KA 5DQDH 2YXFA 1WEJL 3WIHH 2IAMA 4WJ5A 1RIHL 3ZE1E 1QSVA 2YXMA 1RFDL 2H1PL 5MEQB 2V17L 3FB6A 4X4ZA 4HUXB 4LSDA 1F4HA 1KIQB 1FBIL 1H15B 5HVGB 4S2SA 5BV7C 3H3BC 5A40E 2K9UA 2AXFA 5TF1H 2OYPA 5DMJB 4S1RH 4AIZB 1U8LB 3HCVB 3LHPL 4PY8I 3JWDC 4NHCH 5D7SL 5KSAD 3S3JA 3MTRA 4FXKA 4L4VA 1CD8A 4KKBD 4CL7A 3PDOB 1LVEA 2ILLA 4HKBB 2PW2A 3PQYA 3HZMB 1MCCA 2Y5EA 4DKFH 3TLRA 4HIHB 3NPSB 5DK0B 5D2LE 4JFFB 3MBXH 4B41A 2ZJSL 4U1IA 2I07B 1VDGA 5CUSH 2XZCH 2NX5E 2MSPA 5JIKA 3CZFA 3OKNB 5FYJD 1KPVB 4GSDH 4APQB 3VJ6A 4X0KA 4AY0A 1IM9B 3BVNB 5A2KH 1CL7H 1CDCA 5E2VH 3MYJA 3PL6C 2A6JB 1Q0XH 2HKFH 4MDIB 4UOW0 4L4VE 4M9OA 2FZ3A 3KYKL 1NC2A 3F5WA 1GGYA 2GFBB 4MNGE 5I17B 3ULVL 4P48A 3U4EA 3BPCA 5TPWL 2FD6H 2AKRA 3DMMA 1S5IH 3PXJA 4FS0A 4RAVB 3PWVB 4PJGB 2IALA 2KZWA 3W9EA 4PPTA 5C2BH 1NLBH 3T77B 5ISZE 1EFQA 2ZZUT 3C5ZD 4JFDE 4ORGA 1OCWH 5IBUB 3X3GH 3WHE1 5KS9F 5F96L 2VLJD 2XY1A 4PJ7F 3TCLA 3P4MA 1BIIB 2A6KB 3B3IB 4HULB 3IJYB 5GGQL 5BS0D 1WISA 4YDVB 1U8MA 3O3DB 1B3JA 4EKXA 2FR4A 2XNAA 5HYQA 2EDWA 4XBGA 4LAQL 5CKAA 4KKLD 4U1HA 1AHWB 2AJZA 1AKJD 3HC4L 1F97A 2XKUA 2Y6SD 2Z9TA 4QT5A 5KSBB 4NBYB 2VUOA 4EUPA 5DJ8A 5TQ0L 1MFBL 3SDXB 1CGXA 2CR3A 4C54A 5B3NA 1FSKC 4FQIH 1GPOL 4F2MA 5DRWA 3OKKB 4MQXD 3DX7A 1IAKA 3RVXD 2YPKA 2XTLA 4ELKA 3HG1E 4F33A 1A7OH 3VI4E 3M8OL 1AY1L 5GGVL 1A47A 1U3ZA 3SGJA 3GJFH 3RUGF 2JIXA 4MJIE 4ODVH 4KPHH 2H6PA 5HXMA 5J1SC 3PJSB 1NCUA 3FQXA 1DQQA 2F9BT 3P4NA 3E2HC 4K9EC 5EC1B 3ABZA 4MA8L 3K81A 4Y1AD 1N5YL 2XZAL 4KQ4L 4WFFE 1D9KB 2FLRT 1BF8A 2IH1B 3OKEA 1U3HA 1M7IA 3EYSL 4O5LL 4XMLL 2AQ2A 5CGYC 1C16B 3LKPA 4XXDB 4Z76B 1WFTA 1SJHA 1OW0A 2BVEA 2EDTA 2R2EB 2VUYA 3HRZA 4WWID 3UJJH 2DWEB 4RA3A 5DFVD 1EZVY 4QNPE 1CGTA 4QTHA 1S7SA 4K7PY 1JRHH 3L5JA 3DNKA 4I2XA 2WQRA 2I9LB 1INEH 3QQ9D 3MACH 1BLNA 2VZTA 4K07A 1T2XA 4TTGA 4XPBL 5FM8A 3QZWB 3BPOC 1JMXA 5C07A 3OHXA 3MRCA 4KKAD 4YE4H 1XZ0B 3HAEG 4PR5A 4JJ5A 4JAMA 5DMIL 2ARWA 4FTVD 5DTFA 2O5YL 4KI5D 5DHVA 3NCCB 2JJUA 2XA8L 2JK5B 5CJXA 2ICWI 2HRLA 5C0FB 4DOHE 4OZFG 4LU5H 3ZKXC 1K8IB 1J0JA 3B9KC 1P7HL 3GMQB 2X4TB 5EU6B 1KB9J 3GSOB 1BVZA 2WUCH 1LNUA 1AI1L 4POYA 5K9QG 5C09D 5J13B 1DP0A 4WUKH 5I1DB 2AXHA 3ARDA 3S5LG 3D87B 4I3RH 1JMZA 2BJMH 4OCWH 5C0RH 1YEJL 1Y6KR 4PG9A 1OAKH 3FMGL 4FFWD 4LKXB 1TVBA 3BHBA 4LNRA 4MS8D 2IG2H 2IPTH 5FF6B 2GEEA 1G7JB 1N7ML 4YX2H 1JWSB 4XC1L 2OR9L 4JFQB 2WBJB 2VJXA 1RJZB 5C07E 2JTDA 5E00B 1FV1A 1C7TA 2F15A 4EI5C 4OZ4A 1FVEA 5GISL 3ARPA 5E9DB 4E41A 1CICA 3SOBL 1BZ9A 4M6NL 1TTFA 2NQCA 2YHGA 2C3HA 1XGYL 3GMNA 4NQDE 5FECB 3C08L 4LGSB 1QZ1A 3KPSD 2IBZY 1CFNA 3SKNA 2NY2C 3DXAE 3V95A 2VITA 5IJKC 4C56B 1MWAA 1G9NL 3TC9A 1NAMA 3IU4H 1UCBL 4I3SL 4R26H 5IF0A 5GGTA 1QLRA 3GMOA 3GGWA 3T8XA 5B38A 5I8EB 3UPRB 2QQQA 5MHSD 5DMGD 3ROLA 2R0LH 4ZUVA 1JI1A 3AREB 3LKQB 4RFOH 4I9WD 2EIZB 3MREA 4ZPTB 5ANMB 4MDJA 1HH9A 4Z95H 4ZG1A 2IWGA 3D2UD 2VZ3A 3EDEA 3CVIH 3GK8H 3I75A 3NPZB 5F7DB 3BKJL 4M02A 3RKPA 3RTQC 3GHEH 4MMZC 1NMAH 4U1MA 4PV9B 5C08A 1YZZA 1NCCL 4LCWA 4E9LA 1T21A 3OKOB 3KPOB 3VXOA 2VQ1B 4MQ7B 3V5HB 3V0VA 1MI5B 5DQDL 3WIHL 4U1SA 3QHZL 4Q6IC 5K9JH 4PY7A 5IFJB 3RBSA 4PRBA 4UNUA 3WDIA 3CLFH 3GSVA 5I9QB 4IRJD 4U33A 3OKMB 5IW3A 4OSUH 4XCYA 3UDWC 2DWDA 3KLHC 1LEKA 4U49A 4PGCA 1SJVA 5F3BA 1P1ZB 3BP5A 5TF1L 4S1RL 3RVVD 3QB7C 4NHCL 2NZIA 4J3OC 4NT6A 2BSED 1NEZB 4K7PH 1KGCE 3L3OA 4MZ3A 4ZFZA 4M6OL 4PFEA 1H3GA 3IFPA 3PL6A 3ZTJH 3KLAA 3IU3A 3G6DH 4K2UH 4NO2A 3ZKND 5GZOC 3Q3GA 4DKFL 1WTGT 4GUPA 1HKLH 1K4DB 3R8QA 2AI0H 4U1GB 3DI3B 2GSGB 2HT4D 4XWOC 5CUSL 5DI8B 2XZCL 3P9MA 4U3HA 1XGTA 4I3GA 4ODUB 4I77H 1UJ3A 1ZLWH 4NWUH 1S78D 2QSQA 3FQRA 3H42H 4GSDL 3VGHA 1CL7L 1LP9B 5E2VL 3BUTA 4BFBD 2ZSWA 5KG9B 4X6BB 4RCAA 2HKFL 5D4QA 2C1PA 4PRID 3RX5A 3MLVH 4BQ8A 1XIWC 1DBBL 4WU5A 1CQKA 1DVFD 3HE7C 5J89A 3ELAT 4JN2B 1YYLH 2BNUB 2B8OT 1HYRC 1UXWB 2FD6L 4XAKD 5KTEL 1S5IL 1T7VA 3UTOA 5JW4N 4HH9A 3SKMB 5LAXB 5C0CE 2GQHA 5HI5D 4H26B 1NLBL 3IVKB 4WEMB 3PWPA 2GAZB 4UUJB 4Y16B 3TJEH 3O3BB 3S3SA 4G8FA 3V6ZA 4TNVF 1OCWL 2WWMD 4Z78B 1G9EA 3X3GL 3K74B 4PRPD 2J6EA 1N59A 2E9JA 4F7MB 2CDFB 4LFHG 5SWSB 5IHUH 1A14H 4AMKH 5J3HD 5IIEB 4OF3A 4GFTB 2B5IC 4DTGH 3LN5B 2OR8A 1MJJA 1GC1H 3TH4T 1FFPA 4JRXE 2XFXB 4MJ2A 1OGTB 3BW9A 3RX7A 1PGRB 3SHSA 2IBBA 5FOBA 4OTXH 5CGMA 1GIGH 1CK0H 4OLWH 4LCUA 1W0WB 3NCEB 4FQIL 2DM2A 2FO1A 1I4FA 2BFVH 5HYJA 3QJHA 3OJDA 3OAZH 2X9WA 3RGVC 2W0LA 2X89D 3H3PL 3MNVB 3Q6GH 1F02I 1A7OL 4ZUSB 5HVWA 2FHBA 5IOPA 5FGCE 2ZSVA 4NFBA 3D0VB 3LOWA 1NGYB 1QSFD 3VFGH 1J8HB 4KPHL 4QYOA 4JDTL 4D9LH 3G04A 1Q38A 3B5TA 3O45B 3GRWA 2VSDA 1CLZH 3QXWA 4FZEH 4HK3J 4QHMB 4MXQD 4QRSB 4WV1A 5A2IH 3DYMA 2K7QA 3LPWA 1KTLB 5CMAA 1G0DA 2Z8VC 3MUHL 2BNRA 3WLBA 1JGDA 3DVGB 1UKTA 3HN3A 4RGND 2J8HA 4YR6B 2XWTA 4JHZA 4L8DB 2EIEA 3L3HA 4JVPA 4WHTA 1J11A 3S4SG 5MENB 3R06B 1GGIL 3UJJL 1TJHL 1D7FA 1VACA 4NNXA 1P4LA 2Q1EA 2G60L 3JUZA 1AGCB 1QTYT 2X1OA 1JRHL 5AUMA 1U3JA 3T3MF 3SE4C 2WSKA 1V3KA 1FCGA 5IT2H 3MFFB 3DYPA 3MACL 1FNEA 1D6EB 1S7XB 3V7MA 4M1GH 1ONQA 4L29B 4YE4L 4F7TA 5I71C 3T1FB 2Q87A 3H3KA 2F5AH 2C5DC 1BHGA 5T3XH 3MUY1 5E6IB 5CJ8A 3EO1B 1R0AH 1T5WB 3UCRA 4EI5A 3HR5A 4XX1G 1WZ1H 4KK8D 4ZPVB 3MCKA 4G8IA 4GJTB 4NQCD 2PYEB 2UY7A 2MWCA 4P0DA 4YEFA 5E2WH 5T33H 3BZ4B 2WUCL 2YWYA 1NJ9A 1E6JH 5D6CA 5I0ZA 4WUKL 3BN9D 4LMQE 2ENSA 4I3RL 3ZHKA 2BJML 4KXZH 4OCWL 2VB5A 3KXFB 4OJFH 5C0RL 1J86A 1S5HB 5IJKA 2CLRB 2NMSA 1FN4A 4OV6F 2IG2L 4YX2L 4GKSA 4X8JB 5C6TH 4PRNB 3CFJA 4HG4J 5DHYB 3FFCB 4BQCA 4DVBB 1PEZA 1ZA6B 4XNMA 3K0WA 4RMWA 3O8XC 1ND0B 1FL6B 1IGYA 1KXTB 1KFAH 4RFNC 4PJCA 4PJ5B 4L3CA 3AM8C 3MV7E 1UQSA 4PJ9D 1H8OA 1E28A 3H7LA 4AG4L 1MCWM 5DHVH 4Q58C 1U92A 3RTQA 4RFEB 4EN3B 5E7FA 3TVMD 5MEOB 4JFEA 2ZG2A 4WI8A 3IU4L 4R26L 2OQJB 2O5XH 2I60H 4Q6IA 4R0LB 3C9NA 2W65B 3WO4B 2R0LL 3ZE2E 5I2IA 4JRYD 4ODSH 4RFOL 3QDGA 1RZJC 1S9YB 4X6EA 2DRUA 4Z95L 1HNFA 3UDWA 4LKCA 2OJEA 4M48H 3NFNB 1N8ZB 5TE4L 2YA2A 3GK8L 1SEQH 3INUH 4HS3B 1XFPA 3EDKA 4V1DA 1JV5B 3EW3B 1IQDA 4C83B 3GHEL 1NMAL 1FG9C 3PP3H 1K3ZA 3TA3C 5JQ6L 3QFDB 2X7LB 1V3LA 1HEZB 1FGNH 4K23H 2XXCB 4HFWA 3P30H 4R96A 1JHTA 3CLFL 4ETYA 3QXDB 2FIRT 1RZ8A 5LKNA 4A6YL 4OSUL 5IQ9A 1MWAH 1FL3B 2QADB 1OTTC 4PP2A 1NAMH 1KJVA 4LLVA 4I0PC 1PY9A 3FZUD 4QOKE 5GGTH 1T0MA 3B5HA 3I6GB 3O2VH 2EEDA 1J1OH 4W4OC 4AQOA 2VLLB 5ERWA 1CXIA 1QBMH 3KPPA 3IFOA 4UDTA 3ZKQD 2N7AA 2R56H 3CFEA 2J2ZA 5FA4A 3W39A 4QXWA 3JWDH 3G6DL 4K2UL 4UINH 2PTTA 4ZTOL 4G6ML 4HUVA 3V0WH 1X44A 4CMHC 4NC2B 1UZ8A 1XIWA 3CUPA 2AI0L 5IHLB 3HE7A 4MWFB 1NMCB 4NC0B 5FUCC 4LVHC 4UILH 1FNHA 1ITCA 1HWHB 2NY3B 4Y2DD 1ADQA 1KOAA 3BEWA 1G0YR 4MJ4A 4I77L 3KLSA 3MRGA 1U8PB 4NWUL 3H42L 4JLRB 5HY9A 2Y07H 4K3DH 1VPOH 2VDQL 1HXYB 1QPXA 1KB5A 5I75C 4B5EA 1A1OA 3S98A 2AJVH 2BY1A 1W8NA 3MLVL 5T1DH 3FRPA 3PXHA 3C8KA 4MD0B 3GJFK 1Q0YH 5KSAC 1YEDA 1YYLL 3JBG7 1I8KB 1JK8A 4GAYB 4DKDC 4NRZA 5ICZA 5INDA 5E4EB 5BMFL 5A1AA 4KMTL 1U8IA 5C0ND 4ZFFB 4ZS7H 3D5OF 3ZDXF 3TJEL 1M6OA 2D31A 4R4BB 5SV4A 2ERJB 1P7QA 3BO8A 3X11B 4PGJA 2HVKA 3TH2T 3LRGA 5ENWB 1A14L 5IHUL 1CT8B 3ARTA 5E8NB 1YJDC 2B4CL 3KNBA 5FOJA 4AMKL 4NN5B 5GRVL 2BSSB 1FVDA 3DVIA 1RAMA 3MRHA 4LVNC 5K9OB 4DTGL 1A4KB 1GC1L 2XQBH 3PE9A 2X4SB 2PNDA 3D9AH 1KT2B 5GSVB 4ZAKB 5EOTB 3MRBA 1S9WA 5DQ9B 2O61A 1MHPH 3H9YA 5DZNA 3CXDL 3EJZD 3MRIA 1J0IA 4OTXL 1GIGL 5GSRB 2IGFH 2ITDB 4LHUB 1CK0L 4OLWL 3QUXB 2GK0A 1CG9A 3REVB 2D4DA 2E27H 4LHJB 3GSQB 2BFVL 2OR7A 3AFLA 4I4WA 5C9JB 1FH5L 3GMMB 1GCFA 4GKNA 3Q6GL 1KNOB 3EOYG 4ODHH 3P9WB 2GCYA 5IMMB 3C5ZC 3NVQA 1GL4B 2J6EH 1QD0A 1WCBB 4BELD 4HMEA 4HS8H 1GJIA 1U93B 3VFGL 2Y36H 2XKNB 2F54A 3SCMA 4D9LL 3ARFD 1ZVSA 3QULB 4QXGL 3QRGH 1ZGLB 4WFED 5F3HB 4HKXB 4IMLB 4HDIA 2OI9B 4Z7WB 4X4XA 4DGVH 4OIBA 3SE4A 4FZEL 3VH8B 2V7HB 5KVGH 3QZWG 2GJZB 4KKLC 2J12B 5AEAA 5KBNC 5TDOA 2Y6SC 1A9EA 4M6AA 1FQ9C 4LBEA 3Q5TA 1KLGB 1PG7W 1MHEA 3V7AE 1X9QA 2DQGH 1EHNA 4WHDA 3WNPA 3GSRA 4CJ0A 2YPLB 4Y2OA 4G8GE 5E99H 3F8UB 3X13B 4Z7NE 4MQXC 3L9RB 5EUOA 3OG4B 2G5BA 4LSQH 2HLFD 4KTEL 5IT2L 5BZDB 4J3WA 2E7LA 2LVCA 2HWZL 5D7LB 4M1GL 2IADA 1MRCH 5J6GB 3GRWH 4NQEE 5F88B 1SEBA 2F5AL 4ZQKB 4KKCD 1U8QB 2A77H 5T3XL 3JWOC 4PJAE 3RPIB 3MGOB 1I9IH 4NDMA 1R0AL 4CMMB 1P9MC 4K7FA 3V5DB 1IGTA 3B5GA 1WZ1L 5DD6A 2BSRA 3O8XA 4P4KB 3M1BA 3AM8A 5E2WL 5T33L 4JCMA 2JJVA 2Z0BA 1BJ8A 3WBDA 3G5YA 4OJFL 3S6CA 3DX8B 1A6ZA 4HUUA 5C6TL 1KLUA 4LASH 4JFXB 2BHYA 2JCCB 5DFVC 2ZP0T 3ARGB 1JNNH 4YHPB 1BWWA 4YLQT 5GRXG 5BZWA 3FN3A 2CO6B 3OKLA 1VKXB 1WGOA 3QQ9C 3S35H 1KFAL 4NGHH 1CVRA 1MRFH 2Z8WC 3S34L 1X7QB 3BIBX 1XR9B 4KKAC 3I02B 1P69B 5F7EH 1WBXB 2ZKHH 4KI5C 4P5TA 2IANB 2W0KA 4G6FB 4KZDH 3TA3A 2Z31B 5GZND 3G6JE 1AD0A 1JWUA 4XRCB 1JPGB 2HN7A 2V2WA 1CDIA 1WIOA 4F7EB 3BWAB 2CRMA 3VE0A 2O5XL 3WFBL 2XA3A 2I60L 4NUJB 4HV8B 3K80A 1VGEH 4LQFH 4MAYD 5DJZB 4BSWB 2MQ0A 3QEUB 5EOCJ 3W9DA 3C87A 4L8BB 3PV6B 2C3VA 2YMXH 4AT6A 1SEQL 3QXTA 3INUL 4I0PA 4UT9H 3EOAB 2VDPH 5CZXD 3IFLH 4FFWC 3L3DB 3V8OA 1ZLWK 4MS8C 2GJ6D 1QQDB 1NEZG 2VDKL 4W4OA 3QXUA 4EIZC 1ZLVK 1DEEA 3MLSH 3LKRA 1DBMH 5JOPE 2R1YB 3RWGB 1KIPB 5C0JA 2A2QT 4K23L 4MSWB 4GG6A 3P30L 1X5IA 5LGJA 5ESAA 1OD9A 1IGCL 2EE9A 4XBPB 3BGAA 1MWAL 1NAML 4ZUUA 4YGVA 4XH2B 3T4YB 5GGTL 5A16B 3O2VL 3RDTB 8FABA 1J1OL 2VDLH 5EO9B 4G7YH 5GGUA 4FQLH 1J9CT 3QUZA 1QBML 1HSBA 2CH8A 5CEZE 5DMGC 3SY0B 2F53B 1D5ZA 2A6IB 4HKZA 5C0DA 1ZSDB 2R56L 3C6LB 3CCHA 3L6FA 1OD7A 3BKMH 1S7QB 3JWDL 3D39D 2RCSH 4UINL 2DQDH 4HK0A 1PW3A 4JZNA 3OKYA 3ECBB 4MQTB 1WJ3A 4R2GB 5GRVK 4OZIF 1FDLH 2X9XA 5L8LB 1HDMB 1MSPA 2NY1D 3T0ED 2LAAA 5CBAB 1ORSA 4YH6A 4YEEA 5KSAA 3QCVH 3OPZH 3C5SB 1RU9H 4UILL 1I8MA 5F89B 4P2OB 3JZ7A 4F7CA 4OB5H 3IT8D 3OX8A 4LEOA 2Y07L 4K3DL 5LWYH 2WW8A 5HGDB 4H8WH 1IC7H 1VPOL 4N8CH 1F3JA 4NJ9H 2F74A 3SDDD 3OAZK 3Q6FA 3OXSA 1N6VA 1S9KC 1SYSB 3TFKD 4OCSH 3DURB 3RVVC 2AJVL 3HZKA 5T1DL 3CPLA 4RQQB 1PLGH 2O26U 1Q0YL 1FGVH 5CIPA 1EJ6A 5C0AD 3TZVD 2VXVH 1G7LA 1FORH 3OTTA 3MCLH 4NHUB 4PJBF 3O4OB 4HGWB 2AEPH 3O4LB 4ZS7L 5EWIL 3ZKNC 3VFUB 2ZUYA 4F8QA 5CP7B 2X6MA 1II4E 3D3VD 2ICES 4OZHA 1U58B 5D6DC 3JTSB 1EAPA 1QFWM 1ADQH 2HT4C 2LE9A 1RK1A 3WFHB 1QRNA 1OL0A 4UT7H 4GH7B 3E6HB 4RMTA 1FIGH 1S78C 1LEGA 4MNQE 2RBLA 1KB5H 2XQBL 3VXMD 5JDSA 1ERNA 3D9AL 3GSXA 5B39G 5HI3D 1A8JH 2VLJA 1HWGB 4P9ML 3VWJD 1MHPL 4DUXA 2QEJA 1LGVA 1YN6B 2IGFL 4YGAB 2LU7A 3VGFA 1UM6H 5BS0A 1MFNA 3QUYB 1DVFC 4OAWB 1NGXA 2E27L 3PIQB 1CD1A 2XV6B 4AENA 1REIA 1I7TA 1HHJA 4OZGF 1MFCH 4ODHL 5HI5C 2FYYA 3FO1B 1AKJA 4UQ3B 3AAZA 3FOLB 1DANT 5D7IF 5ELIA 2J6EL 3RWEB 1YECH 5F1NA 4HS8L 1RIUH 5I6XC 1ZXQA 2WWMC 5DWUH 1IAOB 1JHKH 3QRGL 5IVXE 3NN8A 3QG6A 4U6XB 4DN4H 4ZOBA 3PHSA 4JHAL 2FBOJ 3UTSB 4DGVL 5J3HC 5FYJU 2X40A 4M8QA 1MLBA 4LFHD 2YUXA 5IKCB 5ESVA 1EIBA 5GGRB 2ITCB 1A6TB 4XHJD 1XF1A 3KWWA 1KIRB 3QG7H 2WIMA 1BFTA 4YHZH 1P4BL 4TUKH 4M9PA 3TP4A 1OGAD 4AK1A 2DQGL 3AMLA 4GG6F 1P9MA 5IR1A 4Q2ZB 5SWZD 3MV8B 5E99L 2ZUUA 4Y1AA 3I3EA 4LSQL 3VA6A 3VCLA 3BRDA 4DUWA 4TNVK 2HJKB 1A6UH 3NTCH 4AEIH 1L4IA 3HS0B 4N1EA 1D5MA 1NCDH 1KACB 4TUJB 3ZYIA 1F11B 1KJMB 5EBMB 1MRCL 2OTWA 3H7BA 4KRLB 4UV7H 1WBZA 3GRWL 4ONGH 2VISB 1AQDB 5BQ7B 4YHYC 3TO4B 1BFSA 1I9IL 4OT1L 3T4AA 3U0PA 3TF7C 5DRNB 1K8DA 3ZZ1A 1AIFA 1HQ4B 4FQQA 4MXQC 5J8OA 3OKDA 3PP3K 1MPAH 1Z9OA 4K8RH 2UZIH 2YUVA 3GB7B 1Z2KA 4RGNC 5DEFA 3HC3H 2D7MA 4FTVA 1IARB 4Y1AE 2P7TB 5FV1L 5I1CL 2JB6A 2OJZH 4Y0GA 4N0UB 4GRLD 2X41A 3JV6A 2B39A 4LASL 3VGBA 4UI2A 3NCMA 5IB3B 3NZ8A 5IROC 4PRAB 3O6KH 4JFPB 5ACLA 4GO6B 3BMWA 1K2DB 5CD3A 4NJAL 1EFXB 1MY7A 3MRJB 1TFHA 1JWMA 1S7RA 1OLLA 5IMOA 4P2RD 5C09A 3S35L 1EEZB 1JP5A 4NGHL 1MRFL 2W60A 2XZQH 4IRZH 4MD4A 4N5UA 3O3EB 3ZMRA 1FZOA 3MJGX 3TCXA 4XNQB 2KZ1B 2ZKHL 4MAUH 2H3NA 1VGKB 1CF8H 1H5BB 3TBYA 4YIQB 3GJFB 5FEBA 1DEDA 4KK8C 3MRQA 4LCYA 1R3JA 4KI5E 4Q0XH 1FJ1B 2EYRB 1VGEL 2BHUA 4LQFL 1I1YB 2EYTB 5CJQH 5CWSB 4HF5H 3PDDA 1B90A 4RA0C 1I1CA 1RZGA 2I26N 3SJVD 3F65A 4FABL 3BN9C 3GMPA 3KPSA 3QO0B 4D0BA 2VDOH 2WINB 1ZS8A 2YMXL 4NBZB 4PLNC 1SYVA 1CIDA 1UM5H 2X70A 3MROA 2VDPL 4UT9L 4YO0A 4OFKA 3IFLL 2OXGA 2UWEF 4NFCA 5TH2A 1BECA 1HH6B 1WBYB 3RJQB 5ILTH 3V5KB 3B2VH 4P2QB 3MLSL 1RZJH 4WUUA 1DBML 1H9VA 5FM5M 1KEMH 1FAIH 2P5WB 1XGUB 1JPST 3H9SA 4JFZH 3SGDI 3D2UA 2MOVA 4DGIH 4PJ9C 3BI9X 4JO3H 4QXTA 4XPFH 2Y06H 1G7IB 1P6AB 3H9HA 3OR7B 3EOBB 2YD1A 5E5RB 1LO4H 1UH2A 3TVMC 3CDYA 1A1NB 1MVUA 2VDLL 5TFSL 2VDRH 4G7YL 4FQLL 1N2RB 3NIFE 5HD8D 2P5ED 2BNQB 2ICEB 4I1NB 1CXHA 3GUTB 5D71H 3LSOA 1AGBB 1GGCH 4PJIA 5E6ZA 5JOFB 4NO0D 1T2JA 2RCSL 2DQDL 3ULUE 2FHCA 1UACH 1I9EA 5MHSE 3ALXA 4JM2B 1L7IH 3P9LB 3QEQD 3WIIH 5HHOB 1FDLL 2M8XA 4I9WE 1NFIB 1CXFA 1TJGH 1QVOA 4JZOA 3OPZL 2Z4QB 5DJCB 2XN9D 1RU9L 2NYYD 3HMXA 2OBGA 5HHPA 4QRTB 4NQVB 1B6UA 2ID5A 3RBGA 3DVFA 3M17A 3UBXG 2CLVB 1AXTH 5T1KB 1H3XA 1IC7L 3ARQA 4DGYL 3HE6D 4N8CL 5F7UA 5D6DA 4W6YB 4L9DA 4IOIA 1MUJA 2HLAB 3Q1SH 3FZUC 4PBVC 1R5IA 4OCSL 2V5SA 3QT2A 3RIAF 4MCYA 1T1YA 3IDMA 4JFFD 1PSKH 5FO9A 3MBED 1PLGL 4J3UA 3LV3A 4U1LA 3CGTA 4LPYA 3BIAX 4Y4FB 2OS7A 2VXVL 3U6RA 3ZE0F 4PTTA 5TE6H 3MCLL 1HHGA 4HIEA 5KS9B 2AEPL 2IEPA 4PJ7B 3VWKB 4LLUA 1GRWA 5EZOH 4GG8B 5J4MA 2RR3A 2BC4B 1QBAA 2HH0L 3D6GA 4IEFB 4GXVH 4LHUG 4DK6A 1MCIA 4QGYA 3OBAA 4OQ1A 1I7ZA 1DVFA 1TNNA 2W9DH 1ADQL 1UB5B 2X5PA 3O9WB 4Y2DC 4D0DB 3P2TA 1P7KB 4UT7L 5TJWK 1G7QA 4AM0B 4WO4D 1FIGL 3TIEB 2DQHL 5DF0A 4LHQB 4Q9QL 1KB5L 1CDUA 3CLEH 3B6SB 3L5XL 1R5VA 4N0YH 3MJ7A 4YFDB 2WBKA 5CIPH 5FYJH 3W0WE 3ROOB 3RWDB 4Z7VF 5F6HI 3VXUB 1AP2A 1PYWA 3VH8G 3BFOA 1CE1H 3CAFA 2DF3A 5A2LH 3RUGB 1AH1A 2EZ0D 4PRIE 5L6YL 4D94A 1YMME 5DUBA 1MFCL 5C0NC 2YSSB 5EU5A 3TESA 1AE6H 5KJRH 4LVOC 1YECL 2X4QB 5CLTA 3BKCH 5F9JB 4X5WB 3FB5B 5EU4B 1Q8MA 3NFPA 2EDNA 5JR1H 4Y19B 2V2XB 3CU7A 1YY9D 4DN4L 3VFVB 2H26A 2CUIA 3TNMB 1DQMH 4PRPE 1BD2B 3J8F7 1Q94A 1ORQB 3I2CH 4YHIA 1IEBA 3PG2A 2ED7A 4RGOH 2Q3AA 1I7RB 1R3KB 3MODH 4KHXH 2CDGA 3CX2A 1C7SA 4WJ5B 1SJXA 2D7NA 1T0NA 4CU8A 3QG7L 2HP4A 5GGSA 3IXTA 4YHZL 3FB6B 2J8UE 4TUKL 2F58H 3EJZC 3FTGA 1GZQA 1MAKA 4S2SB 2UY6A 4U6YA 1UZ6F 2AXFB 4KGLA 1U8JA 4JCLA 3S96A 1OHQA 4NRYA 4O2FA 2DMKA 4JDVA 4OFYD 1LD9A 5L2KE 4FXKB 4L4VB 5CJOH 3KGRA 4LSUH 5B4MD 1NCDL 3K1KC 1NFDE 4OCYH 3ARFC 2PW2B 4UV7L 5EIIA 1FZKA 3PQYB 4ONGL 3F6LA 4B7LA 3MNWB 3ETBF 5IROA 5D8JH 2DIBA 1QSFE 4PJIF 1RUPH 3DSFH 2ATKA 3LQMA 2A73A 4U1IB 4Z5RA 3WCYA 4PJGF 4PJFA 3CZFB 1MPAL 5MI0B 2UZIL 2DQIH 5F1KC 4RNRA 3QQ4A 3VJ6B 1RJYA 4X0KB 2DQEH 4ZO6A 1R24A 3MYJB 4OCLC 2OJZL 4XWGL 5CD5D 3S37H 4M7KH 4RGNE 2FZ3B 2XT1B 3HNSL 1NC2B 3F5WB 1CFQA 4OLYH 4PS4L 2AS5M 3MRPA 2XYCA 3QWQB 2HLFC 4PUBL 3BPCB 3U4EB 4ZFGH 1T20A 2AKRB 4PJXA 3DMMB 5EG6C 2ESVD 4Y5VC 4E5XA 1H3PH 3W9EB 3VFRB 3P40A 5T1MA 4GRMA 2XZQL 4IRZL 5DUMH 5LBSL 3QNXA 5KSBF 5KANI 1ITBB 1M7XA 3GNMH 2X1PA 4KKCC 4MAUL 3VXSD 4ORGB 1CF8L 2DMBA 3W11D 3QDJD 1JCKA 2R0WL 3A0OA 4HT1H 3P4MB 4PJDA 5TE7H 5D93B 2ADJA 3TYFA 1A6WH 4M7LL 1WV7T 5CJQL 1U8MB 2CXGA 3BJLA 1MH5A 4H0IA 4HF5L 1NQBA 3KJ4B 4HLZH 1PKQA 2A83A 2FR4B 2XNAB 5HYQB 4ZSOA 1XF2A 4XBGB 3GHBH 2VDOL 1N4XH 1CGWA 2D4FA 1MCEA 2WP3T 4U1HB 3WXWH 1UM5L 4Y8AA 2AJZB 3TVMA 4KROB 4NQCE 1UXSA 3T09A 4QT5B 2VZOA 2E7HA 1BF2A 4PJXE 5DC9B 1HYSD 4EUPB 5DJ8B 5ILTL 3B2VL 4RZCA 1RZJL 1MELA 4C56D 4Z7OE 1PG7X 2F8OA 3VG9B 3HUJA 1MREH 4JRYA 4GW4A 2AEQH 4R9HA 1VESA 1KEML 1FAIL 2B7DT 2ADFH 5I19H 4F2MB 5D1XA 3QEHA 5DRWB 3CC5A 2E6JA 4JFZL 1WFUA 5H37H 3DX7B 1IAKB 4PD4K 2YPKB 4X9GA 1WZLA 4F33B 4DGIL 3MPCA 2SEBA 2IPUK 3ZDYE 3MV9D 4XPFL 3NCFB 4XMKL 2DDQH 2JIXB 1LO4L 2CIKA 1BBDH 2H6PB 2JJSC 3KPNA 3QNZA 5GZNC 3P0YH 5I15H 3QA3A 2VDRL 4QRRE 4O00A 2CXKA 1EZVX 3FQXB 1D6VH 1J0HA 1DQQB 3P4NB 5DGQA 5HDQH 3AC0A 4MAYC 4K7PX 1MI5D 1GGCL 1I1FA 2ZG3A 3RWIB 1KCUH 4JKLA 1UACL 4QRPB 4KC3B 3OKEB 5CZXC 1L7IL 5DRXA 3WIIL 1F42A 4AEEA 1U3HB 5JA8B 1M7IB 4KTDL 1TJGL 2HRPH 2NTSP 1JZ8A 3NFSL 4JFHD 3LKPB 1QSEE 3ZDXE 4M00A 1SJHB 1G1CA 1NGQH 1IILE 4HPOH 4RAUA 4WTWA 3ZHDA 2YK1H 4GOSA 1NC4D 5DSCB 4MXVE 3HRZB 4JPWL 1NL0H 4ERSH 3KR3H 4L3ED 1Q1JH 2PKDA 4FQJH 4QTHB 1S7SB 5JORA 4DAGH 3U48A 1IGMH 1U8NA 2EC8A 2YC1A 5I18L 4I2XB 3VGDA 1YEFL 3J7HA 1BLNB 3QXAA 2RJMA 4U3CA 1QG3A 1SJEA 3Q1SL 3OHXB 2QL1A 3MRCB 3EOTH 2DMCA 3GJEA 4TNWF 1PSKL 4PR5B 1ODAA 3T04D 4JJ5B 4Y2DA 4JAMB 5DTFB 3ISWA 5ETUA 4QGTA 3ILQD 4OUOA 5DHVB 3EHBD 4KRMB 2EECA 1T7WA 3MC0A 4NKOB 3BXNA 5TE6L 4J3TA 1CS6A 4WI6A 3G6AA 5EZOL 3OZ9H 1BVLA 1LNUB 1QLEH 4GXVL 3BH8B 3HMXH 3PHOA 2EO9A 2NY1C 2BSTA 3T0EC 3ARDB 3CK0H 3HA0A 3P4LA 1N6QL 4X5LA 4PG9B 2Y9RT 3U9UA 1TVBB 3BHBB 4LNRB 5GHWH 1LEIA 3DRTA 1WWBX 5IWLC 1DBAH 1MCPH 1FV1B 2NX5D 4OZ4B 1FVEB 5E8EA 4QHNA 3CLEL 2AEWA 4E41B 1CICB 3EO9H 1BZ9B 3SDDC 4N0YL 4UV4H 4EBQH 4Y16D 1DQLH 3RZCD 3TFKC 1YJDL 3BGFB 3CSGA 3L95A 3GMNB 5FYJL 1D5BA 3MFGB 3RZWA 3JV0A 4GRWF 1A6AA 2DD8L 3WNOA 3THML 1CFNB 1NPUA 5SWSD 1CE1L 1MWAB 1U8HA 4ZNEE 4HAGA 1NAMB 3MRMA 4HK3N 1MJ7L 4LF3A 3TZVC 3UAJD 5IF0B 5GJSH 4L5FL 1QLRB 3GMOB 3GGWB 2VZVA 3T8XB 5B38B 1AE6L 5BCAA 1JYVA 4ZUVB 3WJLC 5KJRL 4KJPD 3IAPA 5DJDA 3MREB 5DJXA 2H8PA 4MDJB 1G7HA 1HH9B 4HXBH 4HKJA 5J56B 3ZT5A 4LPWA 4PJDF 5ISZD 5JR1L 5IFAH 3I75B 4JFDD 2ADGA 5DK3A 4PP1D 5E6YA 2FJGA 4U1MB 1DQML 5C08B 4LCWB 3I2CL 1T21B 1I1RA 4P9HC 3TH3T 4YXKH 3VXOB 2PUQT 3MODL 4KHXL 3V0VB 4UIKL 4U1SB 1X5HA 4PY7B 5HI3C 4JFOA 4PRBB 1AXSA 2YWZA 3GSVB 3HUJF 3KYNA 3VWJC 5D2NC 2F58L 3RU8H 5L8JB 5J1TC 2DBJA 1J8HD 1T0PB 5H94A 4XCYB 2XACC 2DWDB 5KAQG 3PNWA 1LEKB 1IL1A 4PGCB 5F3BB 4WTZA 3BP5B 2MHAB 4BUHA 1I7UA 4NT6B 5FDYA 3S36X 1RZKC 5DHXB 2V2TA 3L3OB 5CJOL 5E2TH 4LSUL 4ZFZB 3UX9B 5EBWA 4JG0H 1TQBC 5FUZH 3HG1D 4EOWL 3PL6B 4OCYL 3L3KA 3KLAB 3IU3B 4NO2B 1TDQA 3MO1A 5AZ2L 3Q3GB 4BSVA 5MEND 4GUPB 1PZ5A 2CMRH 1RUPL 2GI7A 3DSFL 3OQ3B 5DGRA 4HGMA 1KULA 3P9MB 4TVPH 2P47B 8CGTA 1XGTB 4XHJC 3ZYJA 3JWOL 1UJ3B 2DQIL 3FQRB 4OF8A 1IVLA 4WFFD 2Y5TA 5IEKA 3JTTA 4TRPH 3IDXH 2ZSWB 4FQXD 3V6FA 3S37L 5DC4B 2ZUTA 3DO3A 1NH6A 2RHEA 2C1PB 3N1PC 4M7KL 3SN6N 3OAYH 3VXQA 4ZXBA 4Z7UA 5E6ID 4OLYL 3VD5A 1BVKA 4WU5B 1W0YT 3AS3A 2W0FA 4ZFGL 2XOTA 1L0YA 4G42A 2VR4A 3LQAC 2CUMA 1H3PL 4HH9B 2DN7A 1HHHA 4LL9A 2ADIA 3FONA 4KMQA 5DUML 3SDAC 1AGFA 2E8YA 3PWPB 1ZAGA 3HPLA 3GNML 4G8FB 3V6ZB 4JE4B 2VQTA 3RY6C 5DEGA 2AXGA 1UA6H 1FSKB 4F8TA 5ADOH 3LZFH 5TE7L 5IB5A 3VD7A 3FFCD 4LVEA 2YD9A 3B43A 1C5BH 2BXYA 2EDDA 3SEPA 1MJJB 5DLMH 5IB1A 2Q6WA 1N4XL 3WXWL 1FFPB 5T5NG 2JJSA 2ZOLA 3BW9B 4GRLC 3IAGC 3BDYH 2KQNA 1I3RA 1C1EH 5FOBB 1ZWIA 2V9QA 4GRWH 4X6CA 12E8H 1C5CH 3E2HB 4LCUB 2AEQL 4OZIE 1I4FB 1S7TA 2ADFL 5I19L 5HYJB 1SQ2N 2P43B 3QJHB 4ALAH 3OJDB 2GK2A 4OZFA 2VKXA 3KS0H 1N3NA 2EDEA 3T0AA 5IOPB 2O5ZH 2VABA 2GJ6A 2ZSVB 2JELH 3QSKB 2Y1VA 4QYOB 4NQDD 1BBDL 3CX5J 3P0YL 3G04B 5I15L 2DQJH 1UWXH 1JBJA 4CW1A 3HI5L 3RPKA 3TWCL 3QCTH 5HDQL 1D6VL 5JDJA 4JZJC 4U2YA 4XP5L 3V0AC 1EH9A 2A0LD 4OKVA 4FP8H 2WBWB 1DFBH 5CKGA 4WV1B 4QLRA 4ONHA 3BPOB 5CMAB 2OZ4A 3AU1A 4I48A 3WLBB 2BNRB 3TN0A 1JGDB 2QADD 2HRPL 4ZYKA 1F4YH 4GMSH 4PJBE 1YNTA 4PGDA 1T80A 3L3HB 4WHTB 1NGQL 2PN5A 4HPOL 5DD0H 1WZKA 2YK1L 1Z9SA 5ESQA 5HHQA 3QHFH 1FE8H 1LWRA 1NDMA 1NL0L 1Q1JL 1VACB 3WLWD 4NNXB 4FQJL 1BOYA 1P4LB 4PJEA 3ZKXB 1ACYH 4W4NA 1CIUA 1IGML 5AUMB 4HS6A 1QUNA 1FNEB 3T0EA 1FC2D 4HZAA 4E0RA 5FYKE 2C7UA 4QWWD 1ONQB 1SM3H 3I3DA 4J6RH 4BZ2H 3EOTL 3WN5C 4F7TB 5CLWA 4XAWH 1Z3GH 3DPBA 4DCQA 5HD8C 4GAJH 5JIPA 3WNNA 1DE4A 1ZLSH 5I1AA 1KCLA 2AJUL 3HR5B 3BDBA 1KCVH 1ZTXH 3MCKB 1CWVA 3SDDA 1YQ2A 1KGCD 1TETH 4G8IB 3K1DA 5LG1A 1YEKH 3WD5H 3OZ9L 4BKLA 5JHDE 1QLEL 3DETD 1NJ9B 3HMXL 5D6CB 3SGDH 4OZGE 1SY6L 2MCPH 3CK0L 3DSNA 3D39E 5D7IE 4PJEE 2NYYC 2X9YA 1FN4B 4YK4B 5GHWL 5C0AA 5DMKA 4U7KA 4GKSB 3TZVA 3CFJB 4JVUA 4OF7A 4WWKA 5FYKU 4PIRF 3F6IA 1DBAL 5JXAH 4K3JH 2VRAA 1MCPL 3WJLA 3D69A 2CKNA 5J9PA 1VFMA 3D3VA 3HE6C 5JA9A 3EO9L 4XNMB 2MPAH 4UV4L 3G9AB 1IGYB 2XPGA 4Z7UF 4EBQL 2EH8H 3C2AL 4PJCB 1DQLL 2W9LA 4L3CB 4ZMAT 1UQSB 3ZTJG 4OLXH 1PQZA 1E28B 3WS6C 2V5YA 1U92B 3RTQB 2WWKT 3MBEC 2FDBP 1WICA 4KZEL 4ELME 4JFEB 2V5MA 3SDCD 4M61A 5DRZA 1MVFA 5GJSL 5DVKA 1OB1A 4GXUM 4Q6IB 5ACMA 4NKQB 5C0BE 1ZT1A 3C9NB 4KV5E 3LEXA 5I2IB 3D85D 3VWJA 3QDGB 4X6EB 2E7MA 5D5ME 2P24A 4HXBL 3TBSB 5L2JA 4LKCB 2OJEB 4O58H 4ZAKD 1DQTA 3FCTA 1NAKL 5J0BA 5IFAL 3MUZ1 4KVNH 5F1OB 4V1DB 1L9MA 4LHUD 3QFJB 1IQDB 5HGHA 2LAGB 4P5KA 4WO4C 2R0KH 3CJJA 4MA7L 4Y4KD 3W81A 4YXKL 1JVKA 3RIAK 4HFWB 1FZJA 4R96B 1JHTB 5CCKH 1RZ8B 3RU8L 2R8SH 4UTAH 1K5NA 1I85C 3VXTA 1O7SA 4IJ3C 3CVHA 4JRXD 3VXME 5IQ9B 1OARH 4HFUL 4PP2B 3TBTA 1KJVB 4LLVB 4P5MA 1JZ2A 1T0MB 2Y23A 5LCVH 3K4ZA 4D2NA 5D2NE 3TV3H 3O3AB 2EZ0C 1EEYA 2MCG1 1N0XH 4GKZA 5ERWB 3BT2H 5HYEA 3KPPB 3IFOB 5E2TL 4UDTB 2BHZA 4JG0L 4D8PA 2X44D 3CFEB 1QR1A 1OGAA 2GITA 5FA4B 3W39B 1KC5H 2PTTB 2AJ3A 4HUVB 3WO3B 5SWZA 1YY9C 4S1QH 1V8HA 1UZ8B 3W2DL 1XIWB 2VZUA 4ORZC 2CMRL 3B9EA 3CUPB 3F62A 3HE7B 5C6PB 4PREA 4R97C 4UTBH 4WI3A 3UYPA 3BKYL 5I1EH 4CADA 3BEWB 5HDBE 3SDAA 4XT1C 5KVDH 3MRGB 3QI9D 4G5ZH 1HQRA 5HY9B 2NW2A 4J8RA 1A3QA 5BRZA 1QFUH 1X5AA 3RY6A 4TRPL 1INQA 3IDXL 4HJ0D 4ZDHA 5JHLL 1KB5B 2XZZA 3QDMA 4S0SD 1A1OB 3UTZA 4MB4A 3C8KB 4X6DE 4PY8J 2UWEE 4YC2C 1YEDB 5B8CC 2HG5A 4N0RA 1JK8B 4HJJL 1EUUA 1NCTA 4NRZB 1J0KA 5ICZB 3CMGA 4LP5A 5B4MC 5INDB 3BE1H 4JO4H 4KJWD 4ONFH 4P4KD 4MMXC 5IVZA 5GXBB 3V4VH 3WUZA 1WWAX 4GRLA 5HVHC 3L3GA 4LIQH 1M6OB 5IM7A 2D31B 1P7QB 1I9RH 3RX8A 1RHHA 3GI8H 4L4TA 4JGJA 2HVKB 3HMWH 4QTIH 5ADOL 2FJHA 3ARGD 1W72H 3LZFL 4P2RA 4RMUA 3KNBB 1FVDB 3MRHB 1C5BL 3TBVA 4CUCA 4KWUA 5D96B 5DLML 4O51A 3BZDA 1RZIA 5CD5C 4WCYH 1S9WB 3MRBB 2O61B 1JNJA 1C1EL 3MRIB 4KHTH 2AK4A 2Z31D 1JGUH 4BFEA 2VN7A 3IJHA 12E8L 4Z7WF 1C5CL 2FECL 2GK0B 1CG9B 2FX7H 4YNYA 3T3PF 1A6PA 2XG5A 4PRHA 4I4WB 4ALAL 1IQWH 4GKNB 1BOGA 1HOCA 4OBSA 1KPRA 3AMKA 2GCYB 2O5ZL 2JELL 4XPTH 3X14A 3MV7D 2F54B 3SCMB 4WHYH 5DVMA 1ZVSB 1YPZA 2DQJL 1T83A 4JQVA 1GZPA 4H0GA 1UH4A 2L7UA 4X99A 2DL9A 3QCTL 5JW5A 4CGTA 2LV4A 4IHOA 4X4XB 1BQLH 1VFOA 2VAJA 3A67H 4FP8L 1IC4H 1DFBL 2APBA 1FO0A 2NR6D 5TDOB 1EO7A 1CFSB 1A9EB 3ZE0E 3WN5A 3MV01 4LBEB 4XX1E 5I71B 1F4YL 3VMNA 2FRGP 3SJVE 3FAWA 1MHEB 4GMSL 1OT1A 2HFGH 1DCLA 2P5EA 2R9HD 2Q7NA 1I75A 5DD0L 3GSRB 3QHFL 1FE8L 1ZHBA 3UZVB 3K2UH 5EUOB 4NO0A 3RKDC 2G5BB 3C6LD 1ACYL 1F3DH 1MHHA 1ZKAA 3QEQA 1EJOH 4OFDA 3GSNA 1I3UA 1SM3L 1HINH 2IADB 2VWEC 2XN9A 4J6RL 5J7CC 4BZ2L 3BQUD 4JG1H 5F1IA 1SEBB 1Z3GL 1TXKA 4QOKD 4GAJL 1T7XA 3KPMB 4M3JA 4K71C 4YFLI 3RHWF 5IB2A 3QH3A 4NDMB 3BP7A 4NKMA 1ZLSL 3MZTA 4DKAA 4K7FB 1AFVH 1IGTB 2ZUWA 1KCVL 2JB5H 1ZTXL 3HE6A 5DD6B 2OZ4H 2BSRB 1TETL 3O8XB 3FB8A 4RFNB 1WC7A 5I8OH 1YEKL 1NCBH 3WD5L 5EIQA 1DQJA 2EDRA 4HIHA 3NIGE 2MCPL 1EGJA 3MBEA 3VGGA 3G5YB 5HPMA 2H45A 3GSWA 3OB0K 1OVZA 1LK2A 4HUUB 3O11A 3BDXA 1KLUB 2Y4SA 3V6OE 1W0VA 5L7XH 4G9DA 5B38G 3NACL 5CSZA 2AV7A 4U05A 4NZJA 5JXAL 3DLQR 4K3JL 1V7NH 3OKLB 2XWJA 4JGUA 3MLUL 5C7XH 3KG5A 3ALWA 3L3IA 4K94C 2EH8L 3ZT6A 1VCAA 1FFNA 1MJ8H 4WFGD 4FQ1H 1F2XK 2BVUA 2XXMB 3QWOA 4U1GC 4OM0H 4P5TB 3ILQC 4WO4A 3TA3B 2IQAA 3EHBC 5HHMB 1AD0B 1JWUB 2HN7B 2V2WB 2EDOA 5GGVY 4JFFE 3VE0B 1JNHA 2OSLA 4BH8A 2ICWJ 1SMAA 2N1KA 3IB4A 3U0TA 3QAZC 3L7EA 1CFTA 1I85A 2GY7B 3HRPA 4GS7C 3W9DB 5D7SH 1LILA 2CR6A 4O58L 3VFPA 4U7MA 2C3VB 2AJXH 4AT6B 4I0PB 3WFZA 1M7DA 4W68A 5E7BA 4I8DA 1QACA 2P45B 1DEEB 3LKRB 2R0KL 4FN0A 5EFIA 5C0JB 3IXAA 1YEEH 3U7WH 1IC5L 2GKIA 4NIKB 4I18A 4O9HH 3OAYK 4GG6B 5LGJB 1FNLA 5CCKL 3RZCC 5ESAB 4JGMA 2R8SL 3DROA 2JF1A 4UTAL 2MQ3A 1PZUB 4DZBA 2DI9A 4CKVX 4PJGE 4CMHB 4P9HH 4ZUUB 4YGVB 4NO3A 3D0LA 4YDLC 4P49A 1TIUA 1KTKE 4AYFA 4LVHB 3S8WA 5LCVL 3TV3L 8FABB 3HB3D 5GGUB 2WQ8A 2HKHL 3QUZB 1PAMA 1HSBB 1D5ZB 4KJPC 4HKZB 5C0DB 1FPTH 3CCHB 1YPZF 5KSUA 3UTTA 3L6FB 3P73A 1KC5L 4HK0B 4LSTH 4JZNB 4KRPD 4LDOB 3WE6A 5I75B 4PD4J 1Q9KA 5MERA 1UC6A 1SVCP 4PP1C 5I74B 1ORSB 4OFYA 5KSAB 5B8CA 4PTUA 4X7TA 1JZ3A 1UYWL 3SDXE 4QF1A 1I8MB 2EH7H 3WNLA 5I1EL 4QKXB 5DA4A 2NY5C 4XPHH 4F7CB 2BVOA 3U36A 1XF3A 4G5ZL 3OX8B 4LEOB 1KPUA 1C16A 4DVRH 4XB8A 3L3JA 1QFUL 2ZUQC 1F3JB 2JJTC 2F74B 2QSTA 4R3SA 1FYTA 2EEAA 4N1CA 3Q6FB 5EO1A 2R2EA 4HX1A 2D2OA 3B4NA 2FGZA 3HZKB 3TO4D 1U42A 3CPLB 3HC4H 4J3VA 5CIPB 3WL9A 4G8GD 4LVNB 2I9LA 2OXHA 4QHUA 4R7DA 2FB4H 1QEWA 2JKXA 3BE1L 4JO4L 2F8VA 4ONFL 1UWXK 1G7LB 3MRNA 1TZGH 2DICA 3MOBH 3CFDA 2WP3O 5KSVA 1U6AH 1DQDH 4X9IA 4LIQL 2WAHA 4GT7A 1MFAH 4OZHB 2APWA 1I9RL 1CLOH 1JNLH 1IFHH 2EDBA 3GI8L 3LQAH 4UNVA 2QQLH 4MCZA 1EAPB 1T22A 3A6CH 5KZCD 4FXGB 3HMWL 4HUMB 1RK1B 4FQ2H 2GTWA 2ESVA 2X09A 1XGPA 5GQBA 1QRNB 5I73B 3GMQA 4P59H 1R3LA 5JPNA 4PG2C 1LEGB 3RJDA 4X6FA 2JLLA 4LP4A 5JDSB 4O4YH 3VXSA 3GSXB 1OP9A 2ORBH 3QDJA 4FQXC 2VLJB 4WCYL 1OP5K 1N5YH 4P2YA 4KHTL 3TT1H 5GRYA 5E6IC 1JGUL 3QIWD 5BS0B 1O0VA 2FX7L 3MGTB 4U4BA 4O5LH 4HBQA 2R39A 1CD1B 1CN4A 2OLDA 4EVNA 4AENB 1IQWL 3OGCA 1I7TB 1HHJB 3NABH 4RGMC 3WEXA 5F44A 1AKJB 4TUOA 2MQCA 3ILPB 3C60D 4AEFA 2VZ1A 3MRKA 5K93A 1CR9H 4XPTL 5F1NB 3WJJC 2PW1A 2ESVE 4YPJA 4LNVA 3O2WH 4C56A 3MLTA 5EU6E 2OL3A 3DTXB 3NN8B 3QG6B 4G43A 5I8EA 3QDAA 5JZ7D 4JPIA 1YC8A 1BQLL 2EIZA 2P5WD 1INDH 4M8QB 3A67L 3MV9A 1MLBB 1IC4L 5ESVB 3LY6A 3KWWB 4UNTA 5GGRY 1EO8L 5E9DE 2PCPA 1UKSA 2HFGL 3WS3A 4N68A 2HT3C 3QUKB 1UEMA 1XGRA 4A2LA 5KAQF 4EI6A 5IR1B 1AI1H 1CE6A 4R0LC 4Y1AB 3K2UL 5JOPD 1F6LL 2YZ8A 3PWUA 4KU1A 3IGAA 3VCLB 4C56E 2ZNWA 4Y8DC 1EJOL 4GAFB 2CRIA 4XC1H 3RWCA 1D5MB 3QUMA 5CJ5A 5HHOD 1LDPL 1HINL 2NY6B 2OTWB 3UPCA 4HIIA 3H7BB 5ANME 4JPVH 1WBZB 1NC4A 4JG1L 3MV9E 1LE9A 1BX2A 1RUAL 1SHMA 2GJJA 4L3EA 3QIUD 1ZA3A 3R0MA 3T4AB 2UZXB 3U0PB 1FO0H 2A0LC 3C08H 2JB5L 5ITBH 1K8DB 2OZ4L 1AIFB 4FQQB 4PJHA 1OWRM 3VFSA 4NQTA 5CEZD 3OKDB 1PFCA 3X3FH 5I8OL 2J5LC 5C0IA 3WFDH 4P2CG 3VFNA 1OM3H 1MI5E 2NTFA 2QADC 5DEFB 2L0DA 4FTVB 3DUSA 1CLCA 4BQBA 1NFKA 2X4PA 3JV6B 6FABH 2EXYD 1UVQB 5FKPA 3WLWC 3NZ8B 5J1AB 1QBLH 1F5WA 3GSNH 1V7NL 5EOQH 5CD3B 1JWMB 1S7RB 5IMOB 4JDZA 5C09B 2YOCA 3N9GH 4LLDA 5E2JA 4DK3A 3NGBC 4XCFH 2A9NL 5IHBA 1MJ8L 4E42A 2W60B 4QWWC 4MD4B 4FQ1L 2CD0A 1FZOB 5D2LA 5ID1A 3QHZH 4OM0L 3VRIA 1EERB 4PJHE 1NMCC 3TBYB 1NGZA 5FYLE 5IW1A 3SKMA 2NX5A 3FT2A 4XP4L 2EKJA 2QKIA 3MRQB 2GY5A 4H26A 4LCYB 1R3JB 3IVKA 2BOBA 1LK3H 4NRXA 4UUJA 5JW4M 5LGKA 3RZCA 2HT2D 2QHRH 3BP4A 3DETC 4NN7C 4W6XB 1RZGB 1MEXH 3GMPB 3KPSB 4D0BB 5DS8A 2AJXL 1ZS8B 1SYVB 2DKUA 3MROB 4M6OH 4YO0B 5T5NF 1XF5A 1JGLH 4OLEA 5SWSA 5TH2B 1LP9E 4M5ZL 3VXUD 4JPKH 4MNGA 1W8OA 1ZV5A 4WUUB 4MHHI 3K46A 5HI4D 2CK2A 1YEEL 4JY4A 3U7WL 4C55A 4KJYA 4O9HL 3O6FD 1PVHA 3H9SB 5ISZA 4MNQD 3D2UB 4JREC 4JFDA 4JM2F 4ACPA 1MCFA 4QXTB 5HHVH 4ZO8A 1HSAA 3H9HB 4P9HL 5IHZA 4Y19D 4YUEH 4MX7A 4G9FD 4GBXD 2YUZA 4X5XA 4OM1H 1MVUB 3SDCC 1VEOA 3MNVA 4U1JA 4NN5C 1BD2D 1H0DA 1MCSA 4R7NA 25C8H 4OF6A 3H6JA 5SWSE 3S9DB 1FPTL 3LSOB 5DT1H 1DBBH 2JJTA 4PJIB 5B39A 4XTRD 2DJSA 4LSTL 1RJLA 5K59F 2CRYA 1WAAA 5KTEH 3CSYA 3FRPG 4EDWH 1QVOB 1S9VA 2R2BA 4PYGA 3V6BR 5T1LD 2X2YA 4JZOB 4BQ6A 3QISA 5HHPB 4Y4KC 2EH7L 4CVZA 4Z7QE 3HG1A 4XPHL 4Y5YC 3M17B 3CVHL 1BZ7A 1G0XA 4DVRL 4MJIA 2A6DA 1KUMA 4WTXA 1CFVH 4IOIB 1GGBH 2MKLC 3WNMA 1MUJB 4OI8A 1P84K 2YBRA 4MCYB 1T1YB 3LEVH 4X7EC 5T3ZE 2OI9C 5FO9B 3S37X 1J8HE 5IVNA 3LV3B 4TQEH 3VXNA 1CZ8H 3MRRA 4J12A 1WAAE 4PG2A 5E8DH 2FB4L 5FDWA 4V2BA 3U6RB 3MR9A 1S7XA 4PTTB 3S7GA 1HHGB 1TZGL 4HIEB 3MOBL 1RPQA 1U6AL 1RD6A 4FQXA 4RX4D 4LLUB 1DQDL 3RIFF 5DYOA 1MFAL 5C8JA 2XQYG 3H3PH 1JL8A 3SQOH 5I1KH 1CLOL 1JNLL 1IFHL 3LQAL 1AGDA 1N6UA 3RFZC 2WM0A 2QQLL 4XP6L 1I7ZB 1DVFB 3A6CL 3T0XA 4LMQI 3G5ZA 3ZE1F 4BUGA