2N56A

Ig59 domain of human obscurin a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
104
structure length
104
Chain Sequence
WRLEILELLKNAAVRAGAQACFTCTLSEAVPVGEASWYINGAAVQPDDSDWTVTADGSHHALLLRSAQPHHAGEVTFACRDAVASARLTVLGLPDGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obscurin
publication title Identification and characterization of disease-causing obscurin mutations
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 104
sequence length 104
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2n56A00
2PYED 1YYLL 1HH6B 2PW2A 5DYOA 2DQJH 3QWRD 1XT5A 4PJAF 2W91A 3O9WC 2IQAA 2C3VA 4UQ3A 3QJHA 1RIVL 4HJ0D 2EDJA 3WCYA 5IV2A 3UTTA 3SDDB 1A21A 1IC7L 2HVKA 2YD9A 4JDVA 1J8HB 5FM5M 4M6OL 1FORH 2EIZA 4NN7C 3WUWA 1A4JA 1BREA 3EHBC 1RAMA 1WT5C 5EZLB 4GKSA 5J1TC 4RAVB 5DMKA 2R4SH 1WBXA 5E94B 3P11H 1WF5A 5HHVH 2VLMD 3BKML 1CICB 2FYYA 1TMCB 5B8CB 2XYCA 4LGRB 3AVEA 8CGTA 3D87B 4YZFE 1WQVT 3NCYP 3HUJE 5EBLA 1JWSA 4U1KB 4FTVB 1RUQL 2BVPB 1WIUA 1A2YA 3NPSC 3NABH 1A6ZB 1JWUA 2EYRA 2R15A 4PRPA 2V7HB 5GS1C 4U6HA 3X12A 4MD0B 4C4KO 4LSVL 2KQNA 2XZQH 4WJ5A 3QIWA 1JGEA 1B6UA 2GHWB 4OGYH 3H0TA 4M93B 1U8IA 4S1QL 5DD5H 3WS6A 1T89C 3BP5A 4MQ7B 2FO1A 3IDNA 5GGUB 4KI5C 2EDKA 2H45A 1KNOA 3BGFB 5T1DL 5DVLA 5DLML 4UINH 4WCYH 3RL1B 3P0YL 2ZJSL 3SQBA 3KYOB 3V8CA 1YPZB 4IIQB 2I60L 1CXEA 3BGMB 4N5UA 5BRZA 1OLZA 3ELAT 2ZSVA 3ARBB 3VXOA 3IJHB 2DM2A 3L9RA 4JVWA 4PJDE 4ODSH 3H3BC 5ESVB 4M62L 3K46A 1JJUA 2IMNA 3EYSL 1AXSB 4HZLA 5GJTH 2KZ1B 5C6PB 1JPTL 4JO3H 1KPVA 4Z7QE 3KYMA 1OAXH 5DI8A 1X9QA 3K8KA 4GG6B 4X98A 1XF3A 5JHDA 3DLQR 4OD2A 2VC2H 1KTKE 4EI5D 4WI9A 5HY9A 1IC4H 3SGJC 1YEIH 3LKOB 4JZJB 1HK6A 1Q8MA 3MV9B 4AQ1B 5D6DA 2R29L 1HE7A 1MHEA 2GSIB 4TSBL 5EC2A 5T5NF 4KDTA 5C9JB 4M5ZL 3OPZL 2Y6SD 1F4XH 1LO2H 1EV2E 3DETC 5FHAH 2FO4A 1T20B 4XNMB 3VFTB 5KTEH 3IU4H 3P30L 2X4TB 5GRYA 5C0IA 4Y16A 2R23B 2J8UF 5DRXB 5HHPA 4KMQA 3RDTA 1Q94A 5EO0A 1I8IB 3TNNA 2FATH 1H3WM 1LE9B 3RPIA 4R4FH 3NCJH 1MPAL 4G6JL 3ULVL 5KSAC 1XGPB 3H9YA 1J0HA 5CJBA 4FTVE 5CEXA 1RJCA 2YPVL 3DV6B 5IB1A 5MP6H 5E8PB 2BC4A 2IH1A 3CVHL 1IAIH 1S7TB 3OJMB 1HILB 4YHYB 2QQLH 1IKNC 5ACZB 1HYSC 3WSQH 1FV1A 4NZJA 4LSUL 5F7YC 3T0ED 2VABB 4G9DA 4F57L 3L3HA 1A6VH 1G7MB 5E5MB 3RWGA 3IFLH 3ZT7A 1YNKL 3GMOA 4OT1H 4R7DB 3QJFA 1IGTA 4R4BA 1KPUB 5FIEA 4QRQB 2ATKB 4PJGE 4LMQI 5D7SL 1N0XH 2R8SH 2EE3A 3N9GL 5F96H 2X4RA 4RCAA 3MC0A 5I1EL 5HDQL 1FYTA 4M7LH 3AREB 4KVCL 1K85A 3A6CL 4E9LA 1OGAA 3PGFL 1C8PA 5TFSH 3KG5A 4EN3D 4NRYA 1YPZE 3K8LA 3IDXH 3WXVL 1PZUB 4UTAH 3GKWL 5BVJB 1ZMYA 3QP3A 3VGAC 2UVEA 4L29B 3P9LA 5E2VH 4ZS7L 3IGAB 4Z7WF 1JGDA 5KZCD 4XWOC 3QDJB 3I85A 4CDHA 4TTGA 5EOCH 1NC2D 3MOBH 1QHOA 1RZ8A 5AUMB 5GISH 2YK1H 3U2SA 5CGYC 3DO3A 5E99L 3L6FB 1S7SB 1F11A 1MLBB 1S7WA 1CCZA 1I3RA 4OKVA 3WIIL 4PB0H 3GMQA 1JNNL 25C8H 2ZG1A 2D7MA 3D69A 2OK0L 3HFML 3EFDH 1U8JA 4NM4L 3MLVL 2F54E 4NKOB 5J6GA 4AEIH 1KEGL 3MJ8A 2X2YA 3JSSA 5BOZG 1FC1A 5B21A 5HVFB 5J13B 1GYAA 1BZ9A 1RSFA 3MV9E 2VDLH 2VDOL 2GY5A 2G5BA 2ADGB 5IT2H 2L0DA 1OAQH 5KVMC 4AIZB 4YAQB 2Y06L 2JB5H 3IF1B 4UB0H 3SY0B 1A7QL 4O2CA 4GXVH 4WFEE 2UY7A 3V4PL 2XWTB 3Q1SH 4HWEH 1MAKA 1T1XA 3I3EA 4HIEB 4NBYB 4C56B 3PP4H 4DKEH 5FO8A 1XZ0A 4W70A 1ZTXL 2DBLH 2ZCHH 4KMTL 1AXTH 2WQRA 5D9SA 2XN9A 4I3RL 3LKRB 5DUML 3K2UL 5F1NA 5C0AA 5J56B 2A6IA 4ERSL 3BMWA 5IVXA 2W9DH 1CLOH 4LHQB 5GGVH 3HAEA 4BH8B 2F54D 3C08H 2V2WB 2GUOB 2IAMB 3GGWB 4IS6A 1FSKB 4JB9H 4LFHD 3WHE0 5F1KC 5J7CC 3ARFD 2DM4A 4L1HA 4NQEA 4P5MA 1QYGL 4RDQG 5KS9A 2DLIA 1D9KA 3TCLA 3LN4B 1T0NB 1NGYB 3FTGA 1KCUL 4F15B 4LARH 4U1HB 1QEWB 3GRWL 1A1OB 1KB5B 5DJZA 1SY6A 3ARGB 3KLHC 1CBVH 4Z5RB 4HK0B 3MO1B 4ODWA 5HPOA 3NCMA 3QXUA 4N8VG 1Q9KB 1XF5A 4GG8A 1OW0A 4I9WE 4ONFL 2DRUA 1TXKA 5L88H 5IFHL 4XBGB 1NLBL 1DBJL 1FZJA 1NCBH 1AKJD 1YNTB 4Y4KA 2BNQB 2EIDA 4JFHE 1D5ZB 4XPFH 2P8PB 5E9DB 4AG4H 4OLYL 3H9HB 1F3DJ 2NPLX 1MRFH 3TIDB 5D4QA 1X7QA 4H1LB 2EDEA 4JAMA 4KRLB 3IB4A 3LS5H 2PXYC 4PJHB 4LSSH 2BY2A 3P77B 5CBAA 2VZTA 5E24E 5FHBH 3CVHB 4YLQT 1RI8A 1X4XA 2A77L 1ADQA 5C09D 4GRLA 2O5ZH 3ABZA 4GO6B 2R0ZH 1S7RB 4JFFD 3FFDA 1OTUC 3VRJB 4H25B 3SDDC 1GGCL 4KK8D 1N6UA 4XVSH 5C1MB 4P46B 5KW9H 5I18L 1TETL 4GRWE 1E4XL 3PQYA 1RIUL 4PJEF 1VADA 1JRHL 3RGHA 5DTFB 3FN3A 1E6OH 2AEQL 5GIRA 1P4LA 5HJ3A 4BQBA 1KXVC 5JQ6L 2YXMA 1CICC 2ZKHH 3D48R 5B8CC 3AU1A 1DQQA 2E7CA 1JF5A 1NSNH 3SDYL 3MGOB 3B5HA 2ZOKA 3LHPH 3N0PB 4X4MA 3DTXA 4KDWA 2QL1A 3JV4A 5BS0B 2VDPL 4LBEA 4JJHA 1EHLL 5AYUH 4M48H 5E03A 1T2QL 4U1GB 4L1DA 5IFJB 3HNSL 4GAYA 4HGMA 5F6IB 1VEOA 4NKDB 3M45A 4M93C 4X6DF 5DD6A 3GMMB 1DQLH 4W4NA 4NZRH 4PJAA 3VJ6B 5DHVB 3BGFC 4PB9H 2BSTA 4WI2A 43C9B 2XZAL 4QRUB 3OAYK 2XNAB 5HHNB 2NY7H 2VAAB 3S37H 2AKRA 4IIQC 1MJUH 1IKFL 1OCWL 1YQVL 4F9PC 4K7FB 3PWLB 1I8KA 1TVBA 5HHMD 2V5TA 5GGTH 5DJ6A 3ARBC 1NCAL 3ETBF 5I2IA 5JQHC 4U1IA 5FA3A 4XC3H 4DFIA 1KSRA 5GS3A 2APWA 4EZMA 2EKSA 2BVTA 1MCIA 4JFXB 3P0VL 4C57C 4NFCA 1IBGH 2XQYG 3KPTA 5EWIL 5SWSD 1YNLH 2QHRL 2BNQE 1AE6L 4FQ2L 1YMHA 5E9DE 1BD2A 2XKNB 2DJUA 4XH2A 4RMVA 3SCMA 2FD6H 1AP2A 1KLGA 5IFAH 4EDXA 1TIUA 2VZUA 4X6CF 5EC1B 4P59H 5T33H 2I27N 3A6BH 5FO9B 4Z76B 3SGDH 1BGXL 4CMMB 3ULVE 3MV7E 4WWKB 4S11A 5TE6L 1HKFA 4XNUH 4JZJC 4Y19A 1HH9A 2J8HA 4XCNB 5I19L 4D9LH 3LQZB 1KG0A 3VXSA 1MAML 5JW4Q 5T3XH 5B38G 2NY2D 2OXGA 2DD8H 4TQEH 4MSWA 2Q7YA 3GJEB 5L2KA 1FZOB 1H3UA 1M71A 4QRTA 2XY1A 5DK3A 3D9AL 3C6LA 4ZAKB 2AJSH 4JHAH 2FHCA 3HA0A 1UVQB 1JNJA 1I3GL 5IP4A 5BZWB 4N8CL 3CFKB 1I7RB 1GC1H 4HXBL 4QT5A 3CDGA 2ICEB 2ARJQ 3QQ4B 1IGIL 5DO2C 5F3BA 5GGSA 1DZBA 2AVGA 4AY0A 4WEBL 4F58H 3MV7D 1TQCB 2YZ1A 3QUZB 3BQUA 1QBMH 3FO0H 4H5SB 3TPKA 3WXWL 1JMZA 1WV7T 1LK3L 5EG6C 3TFKC 2GK2A 3CXHJ 5EFIB 2Z91A 3SGKA 4YHYC 2HVJB 2XG5A 4KGLA 3JVGA 2XQYK 3VG0L 2JCCB 4IM8A 5EZJA 1MQKH 5AAWA 4AM0B 5KVGH 1NGXA 4MJID 3KYAA 4DTGH 3RWDA 5ICZB 2ICES 4JCLA 5MENB 3SKOB 4P2QB 1NGPL 4M3JA 2X89D 3NPZB 1AQKH 5D1XD 4OLZH 1HQ4A 4NQCA 4MVBD 1FVDA 1KN4L 1UCTA 2Q1EA 3LN5B 2MKLC 4EVNA 5I1GH 5T3ZH 3IVKB 3OKNB 2F53E 1MUJA 5MERB 1TQBB 5IKCA 2J8UA 1AGCB 1I1FB 3H9SA 2NY3D 2E9BA 2DMKA 4L4TA 1EX0A 2AAVA 5JDSA 5TGBB 1S9YB 4NFDA 2KQMA 3STZA 5FUCC 3QRGH 4JRYA 3L7FB 2AV1A 1QFWL 4X99B 3GSQA 3ZYJA 2PO6D 3L3IA 1G7PB 4ZPVB 3FQRB 1G9NH 3QXDB 3MODH 3NIFF 3FB8B 4AEEA 2Z35B 2ZUXA 2PW1A 4EQ2A 3I75A 1DANT 5E8OB 3OQ3B 2AQ3A 1N2RA 4JRXA 1IEAA 1TTFA 4U1JB 5J13C 3QXVA 4U1NA 3RHWK 3HS0B 1YEKH 1CN4A 5C2BH 3GMNA 4KVNH 5D72L 2F53D 2F5AH 1Q38A 4UUJB 4OZFA 1NCDL 3KWWB 5FO7B 3U36B 2XY2A 3DMMB 3UTQA 5C07B 3AS1A 2HT3D 2QBWA 1L0XA 2OJEB 3QUXB 5DHYA 5FKPB 1CLYL 5IBTH 3NFNA 2HN7B 5LQBH 4U2ZA 3F7RA 3AAZA 4QRRB 4H20L 4Z0XA 3D5OF 3EFFA 3PDDA 4L4VA 3HZMB 4ZUUA 1VB9A 3VXQA 2C3HA 3LQMA 4KXZH 4Z7WA 4RZCB 4YXKL 4JKWA 15C8L 4PTTB 4S2SA 3CCHB 1NGWA 2WINA 4XPTH 4DVBA 3DUUB 2IAMC 1FSKC 4PJ9A 4WWKD 2F15A 3OXRA 1IT9L 1EO5A 3FQTB 1NANI 1M4KA 5FYKL 5IB3A 1JFQH 3LPGA 3CUPB 3X13B 5L8JB 2NTFA 3BAEH 1G9ML 1DBBH 3QCTL 4MQTB 4F15C 3QUMB 3K4AA 2JCCE 3ARGC 1BECA 3KDMA 1KYOJ 3C8DA 2CPCA 3QCUH 4Y1AB 2EDLA 1OGTB 2FX7H 3P4MB 1A6AB 1D5BA 3SPVA 4M61A 4P2QE 3B2VH 1MHCA 1BZ7B 1SBSH 1Z5LA 1CIDA 5LGJB 2VR5A 3LKNB 3QEGL 1F6AB 4OZ4B 1ZT4A 2VLJB 5CINL 4WHCA 5HDOA 3BEWB 4G43B 5D1QA 3VH8A 2ZUUA 1TLKA 4NNYB 2R2EB 3MBEA 3WN5B 3VXMA 5H35B 1A9EB 3TBYA 3V95A 3JTSA 5D7IE 3ULVC 1I1AA 5IMKB 1A7OH 1DDHB 3P3YA 5EIQA 1YMMB 4FHBD 5DWUH 4PY7A 4Z7UB 4GFTB 2PCPB 4JFDB 4NKQB 4RSVA 5DC0A 4M7JH 3D2UD 4QEGA 2SEBA 4XZUA 3RX8A 1KC5H 3S9DB 3BD5A 5H2BA 3BEVB 2CR6A 3FFCD 4DZ8B 1H3TA 5F70A 4P9HH 5HI3D 3GSRA 4M6AA 5D7JB 1ZS8B 3WS3A 4NKMB 5E8NA 4OFYD 4GOSA 5CLTA 5LJYH 4P46C 3MUY1 2BJMH 3FOMB 1J1PH 4PP2A 3SDXB 4OM1L 2JJWA 3WO4B 1M7DB 5IVZA 2MJWA 5CLWA 3W2DL 1FLRL 3U0TB 5LBSL 4JPWL 4WUUE 1U8KA 4UV7L 5C7XH 1CXLA 2VLKB 4X9GA 5HD8C 3QFJA 3MNVA 5C07E 1FFQA 5CZKA 4U6YA 3LEXA 4WNQA 5GJSL 4F7MB 1CI5A 2DIAA 4M8QB 2P8MA 5B39A 5F7LB 1JZ5A 5BXFA 4HMCA 3O6FD 4OLEA 4QRRE 3M1BB 2VERN 1EUTA 1BQHA 3IFPA 2GJ6D 3DUHA 1OVZA 2DWEA 2YPKA 1ZV5A 3MRMA 3KPMB 1RUML 4U1GC 3JTTB 4HS8H 2XPGA 4HJGA 5F6IC 2IG2H 4TUOB 4AMKL 4YQXH 3O11A 4KK5D 5FUOL 1G1YA 4Z9KB 4IRJD 1DL7H 2H1PL 5IF0A 2HG5B 3MUGB 5HDLA 4CU7A 4WUUD 5CBEB 4OF7A 5HGBA 4NWTH 4ALAL 2K7QA 4RA3A 4GUPB 2MQ0A 4O2FA 1QFPA 2FR4B 1JHKH 3UC0H 2R9HD 3ZDXE 5F7UA 1SMAA 4JY6A 1KTDB 1IAKB 1S9WB 1FE8H 1OSPH 1WZ1H 4HIIB 2A6JB 4PJEA 4NQXB 4R7NA 3QR2A 4KI5F 4J3WA 4Y1AE 4JGMA 3FOLA 1MCKA 3WFHA 3C5SA 4LLUA 2FBJL 3G04B 3ARXA 4P3DA 4XP1H 1P2CA 4NIKB 1WWAX 4FFZH 1XGUB 1U8MB 3Q6FA 3B3IB 1GHFL 3ESUF 1A7RL 2X4SA 4PP1C 1UM5H 4URTB 5TDPA 1LDPL 2OL3H 1XR9B 3VXUA 2VLJE 4L9LA 3VFUB 4NNPL 1OP9A 3B2UD 4JPVL 4LASH 4XC1H 4KK9D 3GZKA 1X3DA 3WE6A 4RRPG 4B5EA 4NT6A 4WWKC 4DQOL 1YMME 2ID5A 1CE6B 4YJZL 4Z7UE 5F44A 4X6DA 3ZYOA 5FYJD 4KMLB 3TJEL 3DRTB 2HJFB 3LKPA 1U9KA 3C6SA 3QDHA 5FDYA 4I2XB 2FHFA 4KPHL 3VRLE 3NFPA 3MYJB 5EO9B 4YXHH 1YN7B 2AJ3A 5B4MD 4H0GA 5ANMA 1GGIH 2VXTH 2A74A 2X7LB 2IPTH 3T2NH 1G7QB 5H94A 2W38A 4F3FA 4PGJA 3X3FL 3CFDA 4DKFH 4JJ5A 5JDJA 1JI2A 3IYLW 2JKXA 4XP6H 3WFEH 3M8OH 2YBRB 3PWJA 1QRNA 4CDGC 4GKZB 1U41A 1SEQH 2DMBA 2VLKE 3L3OA 4JFYA 3BZFA 2BNRA 3SDCA 4H0IA 3MV8A 4K7PY 4KZEH 3EDKA 5GS2D 1GSMA 3HI1A 2IPUG 3ZDZF 1MI5A 3B9KD 4RGOH 4X6BB 3QUZC 3C8HA 3RA7H 3REWB 1EFXA 5CCKL 4PJCB 2YMXL 3RWCB 1NFIA 1PSKH 5FYJU 4XP9H 4HHAB 2VXQH 5IVOA 4N8VB 1DFBL 5IM7A 4X6CA 2P5ED 1FL5B 2IADB 2CMRL 2XV6B 4YHZL 4O2EB 2WUBH 5IMMB 5JIHA 2HT4D 1FCGA 3SQOL 5GRUL 3BD3A 1EJOH 5JW4N 4XMPH 2MHAA 2D31A 5A43C 2Z93B 2BVOB 5EOTB 3ALPA 3T65B 5ISZD 5ECJE 4OZIB 3QAZB 1P6AB 1RJZA 3GSOB 3DURA 4MX7B 4NQDB 2HRPL 5E2WH 1F3JB 2BVQB 5I1JH 4U2YA 4YHNA 2YN3A 5F89B 2APBA 5DFVD 4ZXBA 3MRDA 1TQBC 1DQMH 3ULSA 4AEHH 3GBNL 3TVMD 3NMEA 2GCYB 2YN5A 4OFKA 5D1ZA 5DC9B 3WNNA 3SJVB 1OB1B 3O3EA 3NVQA 3TBSB 2YPLA 2DIBA 1FFNA 3DVNB 5HI5C 5KN5A 1CFNA 1YEEH 2ITDA 2ESVD 1WITA 3BJLA 1H8NA 1Z0MA 3O6FC 4ZMAT 3RRQA 3I84A 4ODTH 4RAHA 4OCNC 4O02H 5I6XB 5D7LE 3WO3B 2XTJB 3O2VH 4RFEB 1JHLH 1LNUB 1MJJA 4Q0XH 1XMWA 2OSLB 2CGRL 4KKLC 1U6AL 4KKBC 4LLMB 3FJTA 5HI4C 3EZJB 1I7UB 2IPUK 1K6QH 3SKNB 3ILQD 3IU3A 4R26L 1CWVA 2VITB 4YR6B 3S6CA 2N56A 1OTSD 1M7XA 5FYKE 1M7IB 4PJXB 2APTA 3EDDA 4FQ1H 4G6MH 2FZ3A 3ROLA 3QWQB 5C0JA 1EGJH 1LEIA 1FDLL 3O3BB 2A9NH 3DMMC 4JVPA 4G6KH 4XGZA 4JM2D 4CVXB 3QUXC 1HCVA 2Z8WC 1FBIH 3TNMB 1IAMA 1KIPB 2H26B 4QF1B 4BZYA 4JM4L 1QSEA 4DAGL 4OD3H 2OTUA 3IFOA 4YDKL 2CKBH 3QIBA 2QQKH 3BKJH 1AD0B 3ZTNH 3PNWA 1X5LA 5D7LD 1XCTA 1LDSA 4BQCA 3LRSA 4MNQA 4JG0L 4ZFGH 2E7MA 4YZFF 4BFIB 3HUJF 4EBQH 2NZ9D 3VXPB 2Y07H 3VFOB 4HKBA 3KGRA 3BXNB 1P7QA 4C83B 5C0EA 2ZNXA 1ZVYA 4L5FL 3HZYA 3N1MC 4NZTH 5CD3A 5FYKD 1TFHA 3UCRA 4PJCE 4PY8J 4LPVA 5CWSB 4AYFA 4FQQA 3OKMB 5EPMA 2VO5A 3KAAA 2UUDH 5HGHA 3AFLA 3X11A 3D3VD 2BSSB 5CSGA 1Z0NA 2QADB 1IAOA 2P48B 4NWUH 4RIRB 5AZ2H 4OIIH 2BY0A 2EYSA 5L6YL 3EGSA 3QHFL 1HINL 2H32H 2P45B 2D2OA 5IMLA 1YEFL 2J6EL 3W0WB 3LH2H 1GCFA 3FQNA 3IDGB 5DVOA 2WNGA 5C6TL 4GMTL 1RHFA 3NBNA 4LCUA 1BFVL 2YEZB 3CSBA 5EA0L 5DQJA 1G7LA 4NQDE 2KZWA 3I9GH 4OZGE 5ENWB 2YA1A 5DSCA 3PG2A 4NHUA 1FJ1A 4DGIH 2NY5L 4PJDF 5DMGD 4H26B 5FYKU 1Y18B 1FL3A 1HXYB 3U4EA 3WN5C 7FABH 3MXVL 1IARB 4CMHB 4JFQA 4HGWA 3QHTC 1J8KA 1G6RL 5CHNA 1YEGL 1JNHB 1UXSB 4JKMA 4K23H 2MFNA 2B5IB 1XGTA 4JE4B 3DX9A 4FQIH 4J1UA 2D7TL 4Z7QF 1BVKB 1IQDB 1MRCH 1CDIA 4HC1L 3PIQB 1LD9A 4CU6A 1EMTH 5DHXB 2HFFA 3KPOB 2FSEB 5LXGL 5ICXA 5DD1L 4R97B 2HT4C 1KJ2B 4FRWA 5GHWH 2V9QA 4KDVA 3PHQB 4XAWH 4NM8H 4YHPA 3WO4C 5L9DH 4XBPB 5IBLC 3QWOB 1MFCL 3RBSA 4WHTA 5DMIL 3K3QA 1TZHA 4LGSB 3OB8A 2AK4B 5I66B 2C3WA 3SHSA 1OAYH 3REVB 2X5PA 1FHGA 3G6JB 1WCBB 1Z3GH 2DLHA 2D0FA 1JPSH 1U8HB 5GZNC 5J4MA 5DMJB 5JOPD 3ILPB 2BZDA 2H2PD 3D39B 1Y0LB 1UA6H 3GBMH 4QHLB 5DEFA 4R2GB 1FIGL 2A83B 5KSVA 4CUCA 1AHWA 1T5WA 5LKNA 4I0PB 2UWEB 1QQDA 3TO2A 4NBXB 5DR5H 1MWAL 1NH6A 2Z31B 3TBVB 5E70A 1UWEL 4EEEA 3HMXL 4X8JA 1U58A 4G8GB 5DEGA 2E8ZA 2XA8L 3MR9B 1HXMA 1U8NB 5CSZB 3ILQC 2V2TB 3B9EA 4KQ3L 3L3JA 3I6LD 3KPNA 3DV4A 1ZA3B 4PJGF 2ICWB 3O9WA 4MXVE 4MNHA 5F9DC 1NJ9B 4Z95H 35C8L 4XAKE 3T3PF 43CAA 3OV6A 3W0WE 1NEUA 2OQJA 4JM2C 2NX5B 2GTZB 3GSXB 2A38A 1YPZF 2IF7A 4XRCA 4D0BA 1FG9C 2A6KA 1WT5A 2IANA 4FG6D 3BZ4B 1PBYA 1CXFA 1G0XA 4PREB 4M1CD 1IEBA 1ZVSA 2P7TA 3IJYA 5K9KA 3L1OL 1A1MB 3E6FB 5EU5A 1ZHBB 4YDJA 1U3HB 1Q1JL 4A6YL 5ID1A 4I3SL 3VE0A 3S36L 3FT2B 5D71H 3O6KH 4Y5VB 4HT1H 4FP8H 3QZWA 1HZHH 4XP5L 3KPQB 5JNYB 1EUUA 2D4DA 4GG6F 1G9MC 2CJUL 3BVNA 5ETUB 3MRIB 2VLRB 5GS1A 4I48A 5HBBA 1A4KB 5BQ7A 3N1PC 3JWOH 1RUPH 4M1DH 1T89A 3G6AA 4M3KB 4YPGB 4HPOL 2AI0L 3P2TA 2UY6A 2QQNH 3QDMA 4GMSL 1A7BA 3VRIA 3ARWA 3VFPB 4N5EC 2AK4E 3UX9B 2DLFH 3X14A 1WK0A 4B41A 3MGTB 1QBBA 3G6JE 3V8OA 5FB8B 1MJ7H 4MJ6B 3TBTB 4X9IA 4P23D 1T1WB 2AK1L 3VWJB 3U30B 5C0CE 1G6RB 5ADPL 4FMFA 1B2WL 1F58L 3D39E 4P5TD 2PETA 2HLFD 4QWWC 3MRJA 4G5ZH 5D5MB 1F4YL 5IB4A 2DQFB 5F93C 4I3GA 5AZEL 4KROD 5CZXC 1CDYA 5IJKC 1U8QA 5F7NC 5FA4A 4F7CB 2UWEE 3VMNA 6FABH 1FL6B 1JYWA 1LO4H 1R3KA 2YWZA 3QAZC 4L3AA 4JO2L 4UQ2B 3MV01 3TH4T 1N6VA 1VGEL 4QY8A 4UIKL 5ITBH 2WSKA 1J0JA 1NDGB 2QR0B 3SGJA 1QSVA 3BPCA 3CFCL 5I1IH 1UACL 1BVLB 1T3FB 2W1NA 2VDNL 4YDVA 5FGSA 4NPYA 5C0CD 1XGQB 2VR9A 4JO4H 3T77A 4RMRA 2NX5E 2WP3O 3HI5H 3BRDA 1I9IL 5DJAA 2D0HA 2OTWA 3MRGA 4G42A 3WEXB 1OAUH 1RIHL 1FPTL 2NCMA 3BWUC 1OHQA 1VFMA 1LMKA 5I6XC 2R0LL 4BYHA 4ZO9A 2XTJC 4ZNCD 1JV5B 2EEBA 1KBGL 5DJYA 3LEYH 4N1HB 4F7EB 4TRPL 3UTTD 3IXTB 4FFYH 2HMIC 3U1SH 2PTVA 1MWAB 2YKLH 2DQJL 4ZFOL 3KYNA 3OSKA 3UJTH 5KSAA 1ORSA 1SEBA 3F7YA 4D9RD 1QD0A 5ITFB 3QULA 1A9BB 4P2OB 1INQA 4NNXA 5JA8B 4GS7C 2W0FB 4IOIB 5I9QB 2M1KA 1IKNA 3D0LB 5FGBC 2W9EH 1FNHA 4GXUN 4LPYA 2VLRE 1FORL 5HYFA 1T80A 4X4YB 4PGBB 2R4SL 1MCJA 1J0ZA 3FRPG 3P11L 4LU5H 3RKDC 3KXFA 1H3VA 5HHVL 1WWBX 5CKGA 4ONHB 5EU6A 4L3CA 4X83A 4OUUA 1XR8B 2CDFB 1LWRA 1HSAB 2HTLC 3UTPE 3KJ6H 5D7KE 4IHOA 5EU7E 5EBWA 5HVGB 2WWKT 2RR3A 4NDMA 1FZMB 1CL7I 3KVQA 5SX5H 4NO5B 4ZUWA 1U3JA 1TZIA 4UDUA 5HHOA 3V4VH 2X4NB 3NABL 4A6YB 1BFOB 2HLAB 4JG1H 4OFVA 1FO0B 5FYLH 4WWID 5FUZL 3D85B 5HDBE 3SE4C 1GPOH 1CXIA 2XZQL 3IKCA 2QADC 5D5ME 5FM4A 5L0QC 4G6AC 1HN1A 4OGYL 2QEJA 3ARRA 5DD5L 4YFDB 1EH9A 1WZMA 1H8OA 5BRZD 5T1LB 4HG4J 5JR1H 3DPBA 2MKWA 1I85C 3L3GA 3OHXA 1A02N 5T1DH 1RZKH 3R06A 3LOWA 3TT1H 4WCYL 4ZYKA 5D7KD 3PHOA 3ZKNC 2ZJSH 5DK2A 3RJQB 3RZCB 3TWCH 2H32A 1CDCA 4WO4B 3NCFB 3JUYA 4I77H 4N90E 3OX8B 4G80B 3QDGB 3UPRB 4WGVB 4XMLL 4ODSL 2BCKB 1CDGA 5JW4R 4CMHC 3B43A 1JZ2A 5DJDB 1EEYA 2NLJB 3V9FA 5JHDD 4OQTH 3HUJA 3VD4A 1M05B 5GJTL 5FXCH 2B5IC 3V0VB 3G5XB 4N0CD 4X9FA 1OF2B 4JO3L 4PRBA 1OAXL 4APQB 4UDTB 3F12A 4YK4B 3SKMA 2HLFC 5HHQB 5F6HI 1S7VB 2GTWB 3ULVF 3FCTB 3GM8A 5IHBA 2VC2L 2C1OB 1L4IA 1IC4L 4BSWA 1G7IB 1S3KH 2V6HA 4Z18A 4GLRI 4TSBH 3LIZH 2CUMA 3ET9F 4HS6B 1KB5H 4JANB 4M5ZH 4Y16D 3T4YB 1F4XL 1LO2L 4MQXD 4X6EA 4L8DB 4IRZH 1KIQB 1ZHKA 3RDTD 5JORB 2OZ4A 3V6ZB 4CN1A 5DJ8B 2BXYA 4ZPTB 3BYTA 2GK0A 3OR7A 3FQUA 3O2WH 3QISA 3IU4L 5KTEL 3O41A 2P4AB 2R0WH 2ARJB 3R0MA 5FOJA 2ED7A 2P47B 3BI9X 3L3KB 2PNDA 1BX2B 4PJDA 2Z4QA 1ZT1B 3EYFB 1JK8B 2AGJL 1KGCD 4X5XB 2FATL 4R2GC 1RJYB 2J2ZA 4R4FL 3U82B 4GT7A 3NCJL 5F9JB 2UZYB 2VLLA 1UG9A 4HBQA 4I0PC 1EO8H 2DM7A 2YPVH 3TH3T 4IMLA 3EO0A 5MP6L 2Z31C 3VFGL 1YJDH 3CVHH 3RWIB 1IAIL 1U93B 3UYOD 3WSQL 4ZFOB 3EDEA 2PXYA 4LSUH 1FYTD 3TP4A 4K7PL 1A6VL 1HH6A 3IFLL 1OGAD 4OT1L 3V7AG 3W11C 5E6IB 4Q97A 1J11A 4KTDH 2CO6B 4Z8FH 3RL2B 4JO1H 5D7SH 4K3HA 3N9GH 3GSNH 5F96L 3MUZ1 3GO1L 4M7LL 3T0WA 3SDDA 3PGFH 5TFSL 5I1AA 3IDXL 5EZLA 4NUGL 4RAVA 3WNLA 4UTAL 4XVUC 5E94A 4LCWB 5E2VL 1CICA 1KFAH 3QDGE 1AGBB 5B8CA 1U3HC 4GQ9H 4ZS6C 4QKXB 1FFRA 5EOCL 2AV7B 3MOBL 3D6GA 3S4SG 2Q8BH 2YK1L 4U1KA 4Y5VC 4U6XB 4L8SB 4FTVA 4XPGL 5GRJH 2BVPA 3CGTA 4F37F 5JTWA 5FEBA 2Q87A 1A6ZA 5KS9E 4PB0L 25C8L 2V7HA 1NC2A 3OL2A 4MD0A 5SX4H 4NM4H 2GAZB 3EFDL 4AEIL 2YRPA 4Y5YB 3NAAL 4WTXA 1XGRB 4YWGH 2CLZA 4JDTH 4G7YL 4XT1C 4OCSH 2VDLL 2VDOH 4MQ7A 4LSPL 5IT2L 4PJGA 1OAQL 2BSED 2Y06H 2NXZD 4OM0H 4UB0L 1AO7B 4HD9A 3GSUB 4LQ1A 1GIGH 4GXVL 3QRFM 5EU7C 2XN9D 3Q1SL 3SGEH 1HSBB 5C0AD 5C0DB 4KAQH 4HWEL 4QHNB 1YC8A 3RL1A 4FXGB 2FEDD 2VUYA 4CJ0A 3KYOA 1ZLUH 1YPZA 4IIQA 2NY5C 5J6HB 3BGMA 4RGNB 4F9PA 3NN8B 3QPQC 4BM7A 3PP4L 4TSCH 1AXIB 1ZTXH 2DQDH 3ARBA 2DBLL 2ZCHL 2BMKB 3VWJC 3IJHA 1AXTL 3NCYS 3U30C 1JZ6A 4JEGB 4FQHB 5CMAB 4XNQB 5JUEH 1D9KD 1DQTA 1DBAH 2YA2A 3BESR 5ESVA 5INCB 2W9DL 1CLOL 1YN6A 4O4YH 3OKOB 5GGVL 1AXSA 3C08L 3OB0K 5I30H 4TPRL 2DTSA 3BDXA 4JB9L 1JZ4A 3VGDA 4KJQD 3T4AB 5IWLC 1IC5H 4HV8B 4JRWA 3TN0B 3ROOB 3DVGB 3F6LA 4LK4A 4M8VA 4XPHH 2ZWLT 3UPCA 2KPNA 4OTXH 3WFBH 4U3XA 3HNVH 2JCCF 1AH1A 1VFUA 4LARL 4U7SA 5F8RC 3T0DA 1CBVL 2A2QT 4Y4KD 4JZJA 2OM5A 1NAMH 2BERA 3MV9A 4Q6YA 4MHHI 1YEDB 2GSIA 4MQXC 5C9JA 3KYKH 1CFSB 5EU4A 1UADC 4UNVA 4YUEH 1M1SA 2RQ8A 4EJ1C 1D5XA 4X5WB 1T20A 3VFTA 1GH7A 5IFHH 5L88L 4MA1B 1NLBH 2XG4A 1NCBL 4Y5XB 2X4TA 4DFHA 4XPFL 4AG4L 2R23A 5DQDH 1OLLA 1MRFL 4LRNH 5F88B 4GRLD 3C8KB 2OP4H 5D7IF 1X5FA 3LS5L 3CH8A 4OF8A 2E9WA 4X8XA 1I8IA 3OKKB 4NRXB 1LE9A 1INEL 3S5LG 1AKJA 5HYSG 1VGKA 1H0DB 4YO0B 1AC6A 3PQYD 4GW4B 5FHBL 5CZVL 1XGPA 1TJHL 3K4ZA 3V6FA 1FGVH 2BOBB 4HWBA 3LPFA 3DV6A 4PJAE 1QVOB 5E8PA 3O2DH 4P2OC 2O5ZL 1S7TA 1ETZA 4ODUB 1HILA 2R0ZL 3CVIL 3IAGC 5CILH 4XVSL 2JF1A 3VXNB 4LPXA 3WMSA 3MLXH 1G7MA 5E5MA 2X9WA 1JRHH 1E6OL 4YFEA 4JHBA 4LPCA 4R7DA 2X9XA 1JTPA 3DX7B 1KPUA 2AXFB 1F6LL 4QRQA 2ATKA 1A22B 2ZKHL 3WHXB 2B1AH 1QO3B 4YX2H 3NCBB 4QRPB 5IJVB 1AO7E 5K93A 3P4NA 1NSNL 3BWAB 3QNXA 3LHPL 1E4XI 1LO5B 3T1FB 1LK2B 3IRPX 5E1AA 1BD2E 4JDZB 1K2DB 1TDQA 4RGNE 1BLNB 3WFZA 3HG1B 5BVJA 4L29A 5CS7A 5AYUL 3KNBB 3IGAA 3RVXD 5K9QG 4I0CC 3HRZB 3MCG1 5AG8A 1IM9B 4LVOB 4NQUA 3HNSH 1U95B 3OXSB 5AUMA 3C60B 4S0TD 1BQLH 9CGTA 1DQLL 4NZRL 3L6FA 1S7SA 1MLBA 3T0AA 4K94H 4I1NB 4AL8H 4PB9L 4G8FB 4HUWA 3FN0H 4Z7VB 5ID0A 3B83A 3ZDXF 2NY7L 4NKOA 2NNAA 5C8JB 3RZCC 1MJUL 1OCWH 3AMKA 1YQVH 4QXTB 4WO4C 3QEHB 1DLFH 1Q9LB 1UWGH 5GGTL 1VFAB 3WV0A 1A3QA 3MLPA 1BD2D 3EOTH 3SCMD 2ADGA 4CN4A 4XC3L 4AIZA 4YAQA 1C1EL 3ZKQD 1MNUH 3IF1A 3SY0A 3UAJD 4XTRD 2IFFH 2XWTA 1IBGL 4H88H 3DXAB 5GSRB 3VWKB 4WFHE 2QHRH 2CDEA 4Y19D 4HIEA 1UJTA 4C56A 2IGFH 3BYYA 3QUYB 4LLDB 1MFEH 3MFFA 3VXSD 2FD6L 4APQC 5ADOH 1A6TA 4YK4C 5IFAL 3MCKA 4NUJB 5L2KD 1NMAH 2OR7A 3A6BL 3BGAA 5T33L 4Y4HB 3W39B 3LKRA 1FNEB 4NO0B 4QXGH 4Z7UF 3C6LD 4XNUL 2V2WA 3QUMH 2IAMA 3GGWA 5E5RB 4LLWB 4D9LL 5I73B 5T3XL 3ALXA 2NY0B 3RU8H 5BO1H 3UZQA 2DD8L 3CX5J 4TQEL 4PJBB 4XI5D 3VRLF 4X9HA 1BMGA 3LN4A 1T0NA 5FOBB 2CKNA 2FHBA 4CVWA 1I9RH 4X0KB 2AJSL 4JLRB 4U1HA 1QEWA 3SDXF 1A1OA 3ARGA 4WFGD 1KENH 2OR9L 2Z8VC 4WUKH 3K81A 4Z5RA 5CP3H 1CGTA 4HKXB 4N8CH 4HK0A 3MROB 1GC1L 1Q9KA 2YD1A 5DURB 3DRQB 1F3RB 4A2LA 1IGIH 2VR4A 5C6WH 2MQCA 4XBGA 2CRZA 1IGFL 1YNTA 1J7VR 1X4ZA 2BNQA 2L4OA 1DE4A 2P8PA 4YHIB 5E9DA 3FO0L 1LK3H 1Q0XH 3E8UH 3H9HA 5B3NA 3QEQE 3TIDA 3HG1E 3V5DB 4PD4J 1Z9OA 2VXSH 4H1LA 3G9VA 5GS0H 5ALBH 4MMXC 1Z9MA 1S7QB 1UH3A 5CGMA 1ONQA 3P77A 5ESQB 4NQCD 3MV7A 3MRBB 1MQKL 4LQFH 3KR3H 4H8WH 5KVGL 1B4RA 2NW2A 3OJVC 5E6IC 3CVHA 3F5WB 4DTGL 4HCRH 3RPKA 1P84K 4MD4B 1NCNA 1J05B 4F33B 3H9SD 4GW5B 3QNYB 1L0QA 1S7RA 1AQKL 5GGSY 4OLZL 3VRJA 3RNQB 4H25A 1YEJH 1T83C 2PTTB 4P46A 2YHGA 3EIFA 5I1GL 5T3ZL 5DTFA 4OCLC 3GB7B 1I8LC 2CO7B 4L4VE 5D2LB 4QHMA 3QEQD 1S7XB 4Z7WE 3LS4L 1OWRM 5I1HH 1OP3K 3QRGL 1PEZA 1VESA 1RULH 2HFEB 2KH2B 3DXAE 3THML 3MGOA 1T0MA 4JRXD 4OCYH 4YH6A 4L8SC 4D0DB 2YD8A 3EYUH 1KUMA 4G6FB 1G9NL 3MODL 1NBZA 4L8CB 3ZHDA 1PLGH 2NMSA 5IFJA 4BK4A 4Y5YC 4NKDA 5JOEA 1CTNA 3GMMA 3Q3GB 1YEKL 2E6PA 5C2BL 4KVNL 1TVDA 2F5AL 2P8LB 4L4VD 3VJ6A 2IPKB 5DHVA 4ONGL 4PJBE 5KSBB 3IT8D 43C9A 4QRUA 3SO5A 2XNAA 5HHNA 5IBTL 4L3EB 1TCMA 5LQBL 2VAAA 4NP4H 3TCXA 1RY7B 2V7NA 4RGNC 1DBKH 2PN5A 2F53A 2A73A 4GSDH 4HFUL 4K7FA 1BJMA 4PJ9D 3PWLA 4MA8H 1X4YA 3V5HB 1NDMB 2YUXA 4RDQF 3WNKA 4Y2OA 1GOHA 15C8H 1A8JH 3IDYB 4JFXA 4GAJH 2EE9A 3OBAA 3MLZH 1H3GA 4YNYB 4MAUH 4EKXA 4XPTL 4Y4FD 3DX6B 1KOAA 5DT1L 1FNSH 4PJCF 4NFBA 4F80A 2XKNA 1WSST 3IS0X 1S78D 3TN0C 3IETA 1JFQL 1V3LA 4HUKB 2WW8A 4NJAH 4BZ1H 5EC1A 3BAEL 5FO9A 1DBBL 4Z76A 5EUOB 3OKLA 4CMMA 4JKKA 3KPRE 4RMWA 4WWKA 1MCWW 3JXAA 2E8YA 3QCUL 3HE7B 1J88A 1FGNH 4XCNA 3UYPA 2V17H 3LQZA 1WEJH 2FX7L 3OZ9H 5D1QD 4OZIF 3GJEA 3MBED 3INUH 3B2VL 4ISVB 1FZOA 3FHAA 1SBSL 3BKCH 3Q2CA 5DVNA 3VXMD 4KRPB 5CIPH 4PJ5B 1I1AD 2EXYC 2CIKB 3MMEB 4OZGF 4Y5XC 4ZD3H 5MEOB 1UVQA 2KBGA 1PYWB 1RHHB 1HDMB 3TT3L 4OF3A 1AD9B 4MLSA 1I7RA 5D2LE 3OKDB 3TLRA 1QP1A 3RQ3A 1NGQH 3QQ4A 3RNKA 1A7OL 2XA3A 5DWUL 1A14H 1ZT7B 1BFSA 3V6OC 3PDGA 4D0CB 2UUDK 3KPRD 4M7JL 4JKPH 3A6OA 5IVNA 4MAYB 3QUZA 4ZUTB 4PR5B 3QUKB 4OLXH 3UYRH 5EFIA 4H0HB 4P9HL 2HT2D 2HVJA 3CSPA 1Q9WB 1V7NH 5C71A 2BJML 3PJSB 2JCCA 1J1PL 4AM0A 4HIHB 4XPAH 1R3IH 5C0ND 3GHBH 4PJXF 3GKZA 3OAYH 1VACB 4FFWC 4TSAH 5ICZA 4N0UB 3GUTA 1FFOB 3FB7B 3SE3C 5C7XL 5MENA 3SKOA 4P2QA 5DJCB 3O6LH 5KSBE 5A3ID 5LAXB 4OI7A 3F58H 3FQWB 4L3EE 3IAQA 4OZHB 3V6BR 1OSZB 5GRZA 3VXUE 1ZSDB 3IVKA 3OKNA 4LKXB 1WCQA 1S5IH 1U3ZA 4XNXH 5MERA 1NAKH 2GJZB 2QJDA 5I1CH 1AGCA 1I1FA 3VXTB 3CMOH 1VFOA 5EBMB 1J18A 2JJSC 4LVOC 5D7IA 3CAFA 4HS8L 5TGBA 1S9YA 5DXWA 3ALWA 2IG2L 2P42B 3C60C 4RMQA 3MSPA 4YQXL 6CGTA 4DZBB 3O6FA 3L7FA 1DL7L 2H1PH 4PTUB 3R1GH 4TUKL 4TTDC 5F7HA 4R4ND 2CH8A 2EDDA 4X99A 4J6RH 1G7PA 4ZPVA 3FQRA 4WV1B 4ALAH 1PKQB 4NWTL 3QXDA 2XKUA 4GAGH 5I1KH 2W92A 3FB8A 1FN4B 2Z35A 4P2RB 1JHKL 5ESAB 3FMGH 5E8OA 4PYHA 5EUKB 1OSPL 1WZ1L 3HC3H 3OGOE 3M17B 1N59B 5T3XE 3MX0A 5J06A 4MXVF 4U1JA 3EDJA 1FFPB 3HS0A 2APXA 3VXUD 4WUUA 4UUJA 2IH3B 2E6QA 4OV6F 3KWWA 4OF6A 5FO7A 3U36A 3N50A 1P7HL 4KHXL 1YY9C 4XP1L 3DMMA 5C07A 4FFZL 2OJEA 3QUXA 5FKPA 4PJ5E 5K33A 3VWKC 1A7RH 3FQXB 5GRVK 1UM5L 5J57B 2A0LD 2OL3L 3MRFB 3EDFA 4QRRA 3PF2A 2HP4A 1UZ6E 2JE8A 2PR4H 2GY7B 2PF6A 3QUYC 4XMKL 3RVTD 1B0RB 3HZMA 4LASL 4YIQB 3S96B 3EYOB 4RZCA 4X6CE 4Y4HC 2X6MA 1OM3H 4EOWH 4F9LC 3TJHC 3GJFK 3DUUA 3ARZA 3B4NA 5I73C 1CYGA 2ZG2A 3FQTA 2I5YH 2NY0C 1X5XA 1CGYA 1QRND 1YZZA 3CUPA 4KPHH 4Y88A 3X13A 3I6KB 4UQ3B 4YXHL 3DO7A 3QUMA 1YQ2A 2BNRD 3RUGB 1GGIL 2VXTL 3MV8D 1X6NA 2IPTL 3T2NL 4IBLT 5FK9A 2HTKC 3VGBA 2HVKB 1MI5D 4DKFL 5CD5C 1EFXD 3LPWA 4Y1AA 4XP6L 2APVA 3WKNA 3RHWF 3WUWB 1XCQB 3M8OL 4QOKB 4QGTA 3P4MA 1A6AA 2GSGB 1JHTA 4OGZA 5TF0A 1SEQL 3WLWC 1F5WA 3BPNB 3H3KA 4AT6B 1WFOA 1BZ7A 4U1LB 4UV4H 5LGJA 5T3ZE 3G6JF 4TN9A 4KZEL 3LKNA 3STLB 1F6AA 1DCLA 4MA3B 3RY5A 4RGOL 4OZ4A 3RA7L 4OZHE 2NY6D 5CCKH 5C3TA 2VLJA 3V7AE 4N8PA 3AB0B 3BEWA 4G43A 1A0QH 5CEZD 1NUGA 3ARDB 1FCCA 3FO2B 4NNYA 1ZK9A 2R2EA 3T2OA 3WN5A 5H35A 1A9EA 1DDHA 3RGVB 5DRWB 1YMMA 2WUBL 4CL7A 3GM0A 4PRPB 4Z7UA 2UWEF 4JFDA 1KJ2H 4ODVH 1EJOL 3CZJA 4XMPL 4ZXBD 5TE7H 3BEVA 3QIWB 4DZ8A 1ZGLM 1LQSR 1U8IB 5J3HD 3OKYA 2R69H 3VD7A 4NKMA 5D1ZD 1HHKB 3NIGE 4YPJA 3QQ9C 2I9LB 1FNFA 2B0SH 4P2RE 5E2WL 5A16B 5E2JA 3FOMA 5I1JL 2F8XC 3S5LB 5HYSB 3CNKA 4NC1C 2YR3A 5E8DH 1T5XB 1EA9C 1M7DA 4UZGA 5D70H 1J1XH 1DQML 4FN0A 3UBXI 4AEHL 5BJTB 3U0TA 3WKMH 5M95B 2VLKA 2DQEH 4ODXA 5A2KH 2HJLB 2DB8A 3AUVA 3KPPB 2VXUH 4ODTL 4M8QA 5SWZB 4O02L 1CG9B 1A5FH 3O2VL 4RX4D 3DHJA 3M1BA 1JHLL 1IGJB 2UV3A 4W6XB 1H3PH 4Q0XL 1MQ8A 3KPMA 4KJWD 4O5LH 4ZQKB 4YHMH 2VH5L 3JTTA 4IMKC 3OF6A 4ODBD 4QYOB 1ES0A 1K6QL 5DI8B 4J2XA 3LRGA 1WAAF 4TUOA 4BQ9A 4KWUA 3DOSA 1QSED 4OJFL 4ZOCA 1XF3B 2K3TA 2AEPH 5TH2B 3QIBD 4G6ML 1X5GA 4FQ1L 4YEEA 1EGJL 2HG5A 3MBXH 2FH8A 1FDLH 2WV3A 1JZ3A 2ZUWA 2W0LA 5DJ0B 2A9NL 5E56A 1MCOH 4NHCL 1AR1C 5CBEA 3V0WH 4MNQD 3CSYB 4G6KL 3U4BL 2F19H 4YXLH 1FBIL 4GUPA 2FR4A 2DQHH 3RUGE 1KTDA 4M7KH 1S9WA 4HIIA 2CKBL 2WBJB 2A6JA 2QQKL 4NQXA 3BKJL 3STBA 3ZTNL 3HN3A 3QIUB 3Q5OA 2MWCA 1T21B 4JG0H 4ORGB 4QOKE 4ZFGL 4Q9RH 4JM2A 4Y2DB 3ZE0E 4MDJB 4EBQL 3IDYC 5JIIA 2Y07L 1XGUA 1U8MA 3VG9B 3ZSTA 2BX5A 1OD9A 3B3IA 1IJ9A 3RVUC 1OT1A 4L5FH 5JMRA 3O3AB 1H15B 2RIKA 2XWBB 1XR9A 4NZTL 3VFUA 2FJFA 5CUSL 3IRZA 3SE8H 3R0NA 3SBWC 4XCYB 5TE4H 4LIQH 5D5MF 1PG7X 4MXWH 4NWUL 1CE6A 5AZ2L 4OIIL 5L6YH 1R3JB 3HE7C 2J6EH 3BN9C 5F7KC 3DRTA 3LH2L 2HJFA 1MRDH 4GMTH 3QNZB 2UZXB 1NPUA 3MYJA 4KRPC 5EOQL 5EO9A 4HMDA 5BW7C 1YN7A 1GC1C 2X7LA 3I9GL 2X4RB 1G7QA 1W72L 2HJKB 4LEXH 5C0RH 3F7QA 3NIDE 4DGIL 2NY5H 3EOAB 4TVSa 1KIRB 2YBRA 4RWYH 1CL7H 3LKSB 7FABL 4QRSB 3MXVH 4GKZA 1LGVA 5JZ7D 1L6ZA 4J3SA 4UOW1 1MF2L 3P9LB 3RWHB 4KY1L 2NY6C 4K23L 1IL1B 4FQIL 5I8CA 4X6BA 3PWVB 5SWZE 1DQJA 1MRCL 4PJCA 4KKCC 3RWCA 4I18B 1EMTL 4HHAA 4N8VA 5IHZB 4DN4L 2ENSA 3MNZB 3U79A 1F11B 1V05A 3GNMH 1N4XH 3F6IA 2IADA 4X7TB 5GHWL 4OKVB 4O2EA 4XAWL 5IMMA 4NM8L 2XRAH 3GMQB 3KJ4B 5IJKA 4AIXA 5L9DL 2IJ0C 2Z93A 1ULVA 2BVOA 2F74B 4BH7B 5EOTA 1G7JA 3T65A 1DQDH 2ADFH 4OZIA 1XFPA 1UJ3B 1OAYL 4I13B 3GSOA 2H2SC 5GSVB 5IGXH 2P24B 4MX7A 4NQDA 4ELMB 2CUIA 3GSVB 2BVQA 1CIUA 5I76A 4JFEB 5L2JB 4OZGA 4O2CB 3QSKB 3H7LA 2AEWA 5F89A 3U0WH 2Z8RA 1G84A 3GBML 1T1XB 1UA6L 3JWNC 3W9DB 4LLAA 1QOKA 3MLWH 5GRVL 2GCYA 4LHUG 1KCRL 2P49B 1FIGH 2PYFB 1OB1A 4TVPH 4LAJH 3TBSA 3DVNA 3O8XB 2DF3A 2X4UB 1FH5H 5E95B 5DR5L 4R3SB 1CZ8H 5IVXB 2RHEA 3MGAA 3FB6B 3O9WD 4RFEA 4FQPA 1LNUA 4WV1C 4IS6B 4LP5A 2H3NB 3BH8B 1MLCA 4J4PC 4GLRH 2OSLA 4GBXB 1UFUA 1E6JH 2JK5B 4LLMA 1F2QA 3Q5TA 4P5MB 1I7UA 4OFIA 4ELKB 3SKNA 3TCLB 3EHBD 4R0LC 2R56H 2VITA 2IAND 4XVTH 1M7IA 4PJXA 3O4LB 5DJZB 3NFSL 4R90H 2X05A 3O3BA 1XF2B 4KTEH 4DK3A 2BRRH 4HS3B 5FGBA 2I25N 2YS4A 2CKBB 2QLVB 2Y36H 1XF5B 3FO1B 2O5XH 3TNMA 1KIPA 2H26A 4QF1A 1UEYA 1DSFH 2YD7A 3MNWA 4YFLF 2FECI 1AD0A 5K59F 2EO9A 5C0BB 4NQVB 1FNAA 1OP5K 2J3SA 3OTTA 4BFIA 1L0YA 1FO0H 3CXDH 3OGCB 4XBEH 3VXPA 4K8RC 5D71L 5H37G 4PLJC 3O6KL 3VFOA 4JAMB 1FVCB 1MFDH 3BXNA 4HT1L 4FP8L 1T04B 4C83A 1HZHL 1YDPB 1CF8H 2UYLB 3DNKA 4KI5D 5CWSA 3OKMA 2MCPH 3QDMD 4RISH 4XP4L 3K4DA 3SE4A 3TIEB 1MCSA 2BSSA 2HKHH 3JWOL 1BJ1J 1RUPL 4M1DL 4RIRA 3C2AL 2DLGA 1J9CT 3EJZD 4RAUB 3C9NB 5DK0B 2QQNL 5JXAH 2EXWC 3W0WA 3IDGA 3BPNC 1N7MH 4P99A 3VXRB 2DLFL 2YEZA 1D6EB 5MEPA 1W72B 2LTQB 4XXCC 1E27B 4ELME 1MJ7L 1FNLA 3BRFA 4JFEE 1CT8B 5ENWA 5IEKB 3AB0C 1GAFH 3ARDC 1Q9OB 4HDIB 4PGEB 4H26A 1Y18A 1D5MB 1HXYA 5I8OH 5B38A 4BSVB 1UM4H 3BOVA 4G5ZL 3RGVC 2ZUVA 4NQTA 4Z7OE 5F1IA 1L9NA 1JNHA 1UXSA 4DUWA 6FABL 4P9HC 3DIFB 5E6YA 4P23A 4QGYA 1BVKA 1IQDA 4OGXH 1LO4L 3PIQA 5ILTH 3HB3D 3KPOA 5FCSH 2FSEA 2G2RB 5KSUB 3DETD 2WANA 1BBJB 1JNLH 3BUTA 4M4RA 1T0PB 1W0VB 5ITBL 1ZLWH 3PHQA 1DEEB 1HOCB 2G75B 3HRPA 3KHQA 4NKIH 5I1IL 1EEUA 4XBPA 2DYPB 3O81A 2NY4B 3QWOA 5EU6E 1ZLUK 4WTZG 3O4LE 1ITCA 1R0AH 1TVBB 2AK4A 3HI5L 3SE9H 1IZJA 5I2IB 5I66A 5ICYB 3D25B 4KV5E 3REVA 1DTUA 4ZDHB 4LF3B 3G6JA 1OAUL 1FPTH 1WCBA 2D3VA 2P5WB 2XFXB 3VFSB 1NFKA 4RFOH 5KSAD 2EYTB 1U8HA 3D39A 3LEYL 1IVLA 1HYSD 4FFYL 1JE6A 2A83A 1R5VB 3U1SL 4L8BB 2YKLL 4BA8A 4E41B 4GJTB 3UJTL 4I0PA 2UWEA 3UTSB 4N0FB 2Z31A 3KXFD 3GJFB 2EECA 3V4UH 2QHLA 5HPMB 5EU6D 1HYRC 4G8GA 4LVHB 5I75B 2W9EL 3ZHKA 3MR9A 1U8NA 5CSZA 4MMZC 3GI8H 4HPYH 3TF7C 2V2TA 4MJ4A 4CW1B 1MREH 2WBJC 4ETYA 4LU5L 3CK0H 1ZA3A 3QIUC 2ICWA 2VAJA 3QXTA 5HHOD 1JYNA 2DI7A 3CFBB 3RWJA 1NJ9A 1RZJH 3K8MA 5DZOA 1UKSA 3V5KB 4Y2DC 4NCC1 3BO8B 1NMBH 2NX5A 4XWOD 3KJ6L 2GTZA 3GSXA 3VXRE 2XI9A 3VG9C 2VL5A 4I0KA 5CGYD 4DKAA 3D18A 2Q8AL 3BZ4A 3NTCL 3AMLA 3V4VL 4PREA 3RFZC 4BQ6A 1A1MA 3E6FA 4JG1L 5FUZH 5FYLL 3BQUB 2XWJB 1GPOL 2XZZA 3RP1A 1XF4B 4HG4K 3FT2A 3VGEA 1G1CA 1WAAA 4Y5VA 2LV4A 4CBPA 2N1KA 4BUHA 4YHKL 5JR1L 3MLSH 4NSKA 4OSUH 3KPQA 5JNYA 1JWMB 3VFRB 1RZKL 1I1RA 5ETUA 1I8MB 3CDCA 3VMPA 3TT1L 3A0OA 4PS4H 2AABL 2VLRA 5KG9B 5ERWB 1RZFH 5FF6B 5DDHB 1GZPA 5DUPH 4NN6B 2H8PB 2AXGB 1A4KA 3TWCL 3EJZC 4I77L 1BJ8A 2J6EA 3PWPB 4JQVC 4YPGA 1MCDA 4XMLH 5KOVC 1S7UB 4PRAB 5K9OB 3BISA 4HFWB 3H7BB 3VFPA 3RZWA 4AENB 4OQTL 1A7PH 3MZTA 2HFGH 3S34H 1YEHH 3MGTA 5F9OL 1UH4A 5FB8A 2P5WE 4L4TB 4MJ6A 3D0VB 3TBTA 3BP7B 5FV1L 2CRMA 4I18C 1NMCB 4QCIB 4JRYB 1T1WA 4J23A 3GIZH 3RTQB 3VWJA 4G9FB 5IOPB 1G6RA 2VIRB 3GSQB 3ZE1E 5D5MA 4D9QE 4XCEB 1S3KL 3KJ4C 3W9EA 4E41E 4HC1A 2ZPKH 5FM8A 3LIZL 3T04D 1KB5L 4F7CA 5TQ0H 2YSSB 3BKYH 2ZNWA 3I75B 3UTSE 5IWLA 3KLHD 3HB3C 3AGVA 4IRZL 4WRLA 1DVFB 5I16A 1RPQA 5E2UH 3OJDB 1KTLB 4POUB 1UJ3C 5FV2A 5JW4M 4LPUA 1J8HE 4UQ2A 4MDIB 4CADA 32C2B 3O2WL 4OQ1A 1JPFB 2R0WL 1NDGA 1J0KA 1VA9A 2QR0A 3UP1A 1HQRA 4YE4H 2AQ2A 4DGYH 1BVLA 1T3FA 5F3HB 1P7KB 4U3CA 2AGJH 4MCYB 1XGQA 2Y4SA 2Y72A 2PXYD 3ULUL 4NC2B 4U1MB 3O8XC 5CJ8A 1EO8L 5DD0H 3VFGH 1YJDL 2QSQA 4ZOEA 4NBZB 5DUBB 1JV5A 4IRSB 4P9MH 4WW1B 4GQPH 3OXRB 4F7EA 5EULV 4PRIB 4GBXC 1OTUD 1U2CA 4K7PH 3SDDD 3IXTA 1F8TH 1J8HD 1MWAA 3P73B 4JZNB 5C70A 3HMXA 3AROA 4QTIH 4POZC 1U92B 4KTDL 5T1MA 4Z8FL 4JO1L 4P2OA 1A9BA 3GSNL 1CICD 3GO1H 3T3PE 2W0FA 4IOIA 3D1MC 5DS8B 4LMQE 3LV3B 4FMKA 5FYJH 4QHUA 4OLWH 3MJ9H 4AH2B 5IEHB 4NUGH 1QSFB 4N0RA 4FTVD 1R3HB 3ECBB 3T0XA 3CSGA 3KLSA 3PWPE 1F13A 4KTYA 1KFAL 4ONHA 4MS8C 5B22A 3TA3B 1PX4A 4GQ9L 1ZT4B 3K74B 3MRPB 2CDFA 1HSAA 2CK0H 2Q8BL 3VH8B 3P0GB 5TDNB 4NO5A 4XPGH 1JBJA 5GRJL 2X4NA 5E6ZA 2J1KA 4A6YA 4GG6E 2HLAA 5DFWH 1FO0A 4G9FE 1ZHLB 5H2BB 1CQKA 2NXYB 3NAAH 1RZGB 4YWGL 4G7YH 4JDTL 3DJ9A 4OCSL 4D3CH 4QXUL 4LSPH 2DQIH 5T1LA 3MLRH 5T1KB 3ARBD 3X17A 4PJBF 4OM0L 4PP2B 3RVWC 1GIGL 3NGBB 4Z7NE 4IOFD 3QQNA 2EC8A 1W8NA 4KAQL 2LTQC 4X5LA 1V3JA 4RRPA 4D8PA 3LN9A 2C1PA 3RZCA 4WO4A 4RMTA 3QFJB 4P4KB 5A1AA 4TSCL 3OX8A 4U6YB 3RY6C 2DQDL 2GW5A 2MQ3A 1T1YB 1CK0H 4G80A 3QDGA 3UPRA 4XPBH 5SV4A 1MAJA 5JUEL 3N1GC 2BCKA 1DBAL 3WIHH 5DJDA 4O4YL 1TCRA 4ZO8A 3OR6B 2DWEB 1M05A 4XXDB 5I30L 4TPRH 2MNUA 4PY8I 3TZVB 7CGTA 3V0VA 3G5XA 3MV9D 2IC2A 1IC5L 1QACA 3RWEB 4HJGB 1OF2A 5I17B 3C09B 4APQA 4UDTA 1KCKA 5C0FB 4UU9B 3MRLA 3EJJX 3S35X 2AJXH 4XPHL 5HHQA 1S7VA 4PRDB 4WFED 3FCTA 4OTXL 4PRIE 2VRAA 3WFBL 4Z77B 3GK8H 3HNVL 2C1OA 4NOBA 3U6RB 1VCAA 1YUHB 4PRHB 1M6OB 1G7IA 2LU4A 1NAML 2R0KH 5EO1B 3SDAB 4DKDC 3HE6B 4HS6A 3KYKL 4JANA 1YYMH 2NY4C 3T4YA 2CQVA 4YUEL 2DBJA 4PLNC 4L8DA 2X4QB 5E0QA 5IESH 3MLYL 5JORA 3V6ZA 5DJ8A 4ZPTA 5DO2D 5JW5A 3PHSA 2ARJA 5DQDL 1QSFE 5D2LF 4V1DB 4LRNL 3Q6FB 3TFKD 3LRHA 1BWWA 3L3KA 2OP4L 1BX2A 3QDJE 3PL6B 1ZT1A 1JK8A 4E5XB 4X5XA 5A2IH 1INEH 1RJYA 4PRID 5FUCE 3QEUB 4KZDH 4OLUH 5F9JA 5CZVH 1TJHH 4M5YH 1FGVL 3NZHH 3QXWA 1QRKA 2GEEA 3O2DL 4NT6B 5FYLE 3RWIA 3EW3B 1U93A 1ZEAH 3CVIH 4LVHC 3R8QA 5I75C 5CILL 4I9WD 3DROB 4ZFOA 2AJYH 5C2UB 4LHUB 3UPAA 4HULB 3MLXL 3ARED 3TO4B 4JFHD 5E6IA 3NFPB 3GSNB 1BM3L 1MCRA 2FEEI 1T1ZB 1UM6H 2N4IA 3UDWC 4YEFA 3VD9A 2AJ3B 2R1WB 2B1AL 3RL2A 4YX2L 2DAVA 5KSBF 3JWDC 4JJ5B 3QDJD 1NQBA 1J1OH 3G5YB 5JPMB 2ICWJ 4WI4A 1T83A 1IMHC 1P4IL 2RJMA 2DQGH 3HZKB 2ZUYA 3GIVB 3KS0J 1I8LA 4C56E 1KCSH 3SDCB 1I7ZB 1EERB 5DVMA 1A6UH 1KJMA 1NEZG 3S7GA 1OARH 3HI1B 1AGBA 2ILLA 2AV7A 4ORZC 1C12A 2YRLA 2YA0A 2WIIB 2WWMC 1UZ8B 2HRLA 1O7SA 1BQLL 4L8SA 4HIXH 4UT9H 5HXMA 2QKIB 3VGGA 4K94L 2VSDA 4AL8L 3FN0L 3WIFA 4ZTOH 2V2XB 3HR6A 1T22B 2L7UA 5IW1B 1URLA 5EUOF 3JWOC 1K4DB 4NN6C 1HI6B 4U1SA 4Y5YA 4PRHE 1DLFL 1XGRA 4HUNB 3G6DH 1UWGL 3ZSSA 5E2TH 2E5EA 3EOTL 4YHOH 2JTDA 4C56D 1HKLL 1E28B 1RMFH 4IOFC 1C1EH 1MNUL 4YHNB 2AJUH 4LL9A 1AO7A 3GSUA 5I1DB 2IFFL 4H88L 3ZKXB 3ULSB 5C0DA 1HSBA 1RFDH 4QHNA 3S97C 1UZ6F 5J6HA 2IAMD 3NN8A 2IGFL 2YPLB 1WIOA 1MFEL 2X44D 2YC1A 1TPXB 1ZWIA 3E6HB 5ADOL 3AS3A 5CJOH 1NMCC 2BMKA 1IC1A 3RTQC 3T8XB 2UZIH 3PE9A 3ULUE 4FQHA 4XNQA 1NMAL 4PJHE 4NQSB 4LHJB 4QXGL 2HKFL 4KKAC 1MCHA 5IBUG 2EZ0C 5EN2B 3OKOA 4HEME 3QUML 3DUSB 3WUZA 1X5AA 3ARGD 3RAJH 4PRHD 4K07A 3T4AA 4PYGA 4HV8A 3RU8L 5BO1L 3TN0A 5KAQG 3B8YA 3ROOA 3DVGA 2X4OA 3GI9H 1DVFC 2GT9B 2DL9A 2BDNH 1FAKT 4JHWH 3SGDI 2FZ3B 2W9LA 1NAMB 1I9RL 5EIIB 4U4BA 3IDJB 1NC4B 1SBBA 4MJ5B 5ALCL 2OR9H 1KENL 4ZTPH 2DLTA 4WUKL 4LKCB 4XGZB 2BNQD 4WTWA 1YEDA 5E9DD 1CFSA 1TVHB 2Q3ZA 3ZKMC 1I75A 1VFBB 1HHJB 2GFBB 4FABH 3PNWB 2NZIA 2ADIB 4X5WA 3ULVD 3BSZL 4QTHA 2E3VA 5HSFA 3LRSB 4OZHF 1IGFH 4Y5XA 4PD4K 4Q2ZB 3OWEA 1R24B 5BS0E 5J89A 1Q0XL 3E8UL 3WDJA 2GIYA 4PGCB 4IDLA 4IRSC 1J5OH 4HKBB 1VDGA 2VXSL 1P7QB 1SJHA 3C8KA 3UEZA 5GS0L 5ALBL 3HZYB 1CXKA 4EIGB 5CD3B 3GMPB 3OKKA 4NRXA 4P46D 5E4IA 4LQFL 3KR3L 4H8WL 4IJ3B 1H0DA 3V6OA 3MACH 4GW4A 4HCRL 3MQIA 4KQ4H 1B4JH 1WGOA 3X11B 2BOBA 1KB9K 3OG4B 1QVOA 5C08B 3BIKB 4ODUA 3NIGF 3FN9A 2EYSB 1RZIB 4NYLB 5GGRY 3AREC 1JIBA 1YEJL 2BXZA 5HD8D 1JL8A 3VXNA 3T08A 5EH1A 3IFNH 2K1MA 3CC5A 4NRZB 4GXUM 3K80A 2B7DT 2LE9A 5BS0D 2AXFA 1JF1B 5HGDB 3WHXA 4M4PA 1QO3A 3TA3C 3SE3A 5DJ2B 3LS4H 1C5CH 5IJVA 1O0VA 5EZOH 2VISB 5I1HL 5FM5O 1BAFH 3THMH 1RULL 2E27H 2P44B 3BWAA 4J3XA 1QA9B 1LK2A 3T1FA 4OCYL 1FP5A 1A7NH 4JFQB 1BF2A 4HGWB 1IRAY 4JDZA 3EYUL 1K2DA 4LFHG 3QEQA 4WGWB 3HG1A 1FIEA 3OB0H 3KNBA 1R5IB 3IXAA 3HRZA 3MXWH 1PLGL 2JJSA 1INDH 2NXYC 1U95A 3OXSA 3BDYH 3I50H 1L6XA 3C60A 2P46B 3C5ZB 1CFQA 1RZKC 1QLEH 3KLAB 1N6QL 1NL0H 4FFVC 3HCVB 4FZ8H 4ONGH 4G8FA 3NGBC 4DVRH 3RUGF 4K71B 1IGMH 4M43H 4NP4L 5C8JA 4QXTA 3MRCB 4HFUH 1DBKL 4GSDL 1Q9LA 4PP1D 4P4KC 2VDQH 4MA8L 1VFAA 4E42B 1JVKA 2AJZB 1F3DH 3ZE0F 1LO3H 1H8SA 5IB5B 3LB6D 3MJ7B 4EDWL 2E7LC 4GAJL 3MLZL 3DXAA 5GSRA 4MAUL 3I3DA 3VWKA 3T0BA 1C7SA 1MVUB 5F8QC 3TZVC 3LMJH 5DT1H 1FNSL 4K8RH 3ARYA 5HVHB 3QUYA 4LLDA 2C3GA 4FQXB 1T5WB 4NJAL 3U9UB 1S9VB 3WIHA 4BZ1L 3TO2B 4KXZI 1I9EA 4NUJA 1XIWB 5A40E 4Y4HA 1T4KA 1FNEA 4NO0A 4PJ8B 4Y4FA 2NW3B 1JMXA 4BFBD 5LGHH 4HUXB 1DEDA 1TJGH 2HH0H 4F9LA 4ZAKD 1KT2B 4HKJA 3SDAC 3HE6C 1FGNL 5F7MC 4LLWA 2V17L 5E08H 1F6FB 2E7HA 2ZOLB 1WEJL 1F4WH 3OZ9L 3MRKA 2CIIB 5C08E 5MENE 2ED9A 4PJBA 3AS0A 3INUL 3BKCL 4PPTA 5FOBA 4KJPC 1ZLVK 3ZMRA 4X0KA 1NBYB 4JLRA 4ZD3L 4BJLA 3HTLX 4G8IB 3NIDF 4NCDA 2Z0BA 3TT3H 4MB3A 3QUZD 4HKXA 4B7LA 3QI9B 3MROA 4O00A 3ULUC 3DRQA 1NGQL 4OLVH 2CXKA 3PL6C 3CLEH 2VMFA 2EDXA 1NFDB 2E9JA 1Z9SA 1A14L 1YJDC 2V9TA 4JKPL 4LPWA 5IROC 1H9VA 2OX5A 2B2XH 4HXAL 4YHIA 3UO1H 4OLXL 3UYRL 2MOVA 4K3GA 3V5DA 3RWFB 4GKNB 4UT7H 4PBWD 5MEND 4P2QD 1V7NL 3S3JA 1S7QA 5ESQA 3KPRA 1J0IA 5JXEC 3MRBA 3TO4C 1CDJA 4M6NH 4XPAL 1FC2D 1R3IL 3AC0A 3GHBL 3F5WA 5BZDB 2ERJB 4TSAL 4LVEA 4MD4A 3KPLB 2VNCA 1J05A 4F33A 4GW5A 3O6LL 3QNYA 3AXLA 5AWNH 3RNQA 3F58L 1BOYA 4LEOB 2IWGA 4MCZB 1XF1A 5HI5D 1DLHA 2NY1B 3GB7A 5C86A 1OAKH 5LVEA 1S5IL 4JFOB 4L4JA 4NOFA 4XNXL 1NAKL 5D2LA 5I1CL 1S7XA 3CMOL 1FVEA 4KKLD 4KKBD 1JN6A 3P9MB 3NA9H 5HI4D 1DUZA 1RK0B 4K2UH 4HK3J 4GKOA 2H9GB 4TUKH 3GMRB 3MRJB 3R1GL 1LP9B 3FRPA 2AXHA 3KPSB 3PGCB 4J6RL 3VFNB 1IGCL 2H6PB 4FQJH 4GAGL 5I1KL 3U46B 4F8QA 4L8CA 2EH7H 3DMMD 5C07D 5DA0B 1W0WB 4IMKA 3FMGL 1R3KB 3QUXD 2WWKO 3HC3L 4LCCB 4WENB 2BSRB 3L7EB 3Q3GA 2ADJB 4QRRD 1EAPB 4WEUD 3BUYB 1FLTX 1V3MA 4QY8B 2J5LB 4TUJA 1N5YH 4WI6A 1X5ZA 2P8LA 3CPLB 4Q9CA 2IPKA 3NACH 4KHXH 5HYJB 3HR5A 4JFPB 1KJVB 2I26N 5KSBA 3ZYIA 2C5DC 4F2MB 3ZDYF 3ZKXC 3EJYD 2VQ1B 4L3EA 2C26A 3RX7A 5GGTA 2JIXB 3B5GA 2QSVA 3PV6A 4XMKH 5BVPH 2PR4L 3DWTA 3V5HA 5BV7H 1TPXC 4Q9QH 1NDMA 3LB6C 4P4RB 3N1FC 2LABA 4PJFB 5D6CB 2D7QA 1NFDE 3FT3A 4JY4B 1K8IB 1OM3L 3MUHL 1NCWH 4EOWL 4YNYA 2V5RA 1S8DB 2ZCLH 4JFDE 2J12B 3DX6A 3G5ZA 1UKQA 4K3DH 1JPST 2I5YL 3W82A 2DWDB 3VGFA 4Y1AD 4RFNB 1QG3A 3FO9B 4G7VH 3SBWA 3LSOB 3RIAK 1RJLB 4ZAKC 2CSPA 1B88A 5IMOA 4WFFE 2PYEB 3SDXE 4C58B 4LSQH 2ITCA 2VLJD 3HE7A 4HLJA 2IBZY 5CIPB 4KRNA 1RUKH 3BH9B 3U7AA 4ISVA 5J1AB 4UV4L 1MFAL 4PJ5A 2MSPA 4ELMF 2CIKA 3MMEA 1TQCC 1YMMD 4Q6IB 5BW7A 2VKWA 4OUUB 4JFDD 1MHHB 1K4CA 1PYWA 1RHHA 1OP3H 1HDMA 3S8WA 4OCWH 1A0QL 5JO5B 1NKRA 3OKDA 1ZGLB 3MYZA 2QSTA 5D7JD 1GGBH 4JPKH 4Z7OF 1K8DB 4EUPG 3PGDB 4CVZB 1L7TH 3OKEB 1ZT7A 1AGEB 4IJ3C 1CU4H 1KJ2L 4ODVL 1HHIB 4PJ7B 1RQ5A 4WFFD 2VQUA 1FZKB 5IVXF 3IKCB 4ZUTA 5TE7L 1LP9E 3QUKA 5IBLD 3L3DB 1N5AB 3KPSE 1ZANH 2R69L 1QHPA 4YGVA 1QR4A 2GITB 1DUYB 2VLKD 1Q9WA 5CJXC 2B0SL 2VQTA 5B3JF 3PJSA 1RZ7H 2DDQH 4HW6A 5E8DL 4HIHA 5SWQB 5D70L 1J1XL 3PXJA 1VACA 5GZND 3WKML 4N0UA 1FFOA 5KVEH 3FB7A 2DQEL 4UOJA 5DJCA 2WBKA 4KV5F 1IE5A 3CMGA 5LAXA 3OF6D 2VXUL 4EXPX 3FQWA 3ZZ1A 4IEFB 1S5HB 3BZEB 4OZHA 1OSZA 3T2PA 1A5FL 1ZSDA 1AR2A 3HPJB 1CGSH 4LKXA 3OAZK 5SV3A 2GJZA 1H3PL 3VXTA 1PEWA 4PJFE 1OPGH 8FABB 4NO3B 4O5LL 2VH5H 5EBMA 4YHML 3IJSB 1IM3B 3F12B 2VL4A 4MZ3A 5EOCJ 4OJFH 4K94C 4DZBA 3C5ZC 4RX4A 2AEPL 5F9WB 1UWXH 3ME0A 4PTUA 1ZKAA 3MRQB 3MBXL 4K3EH 1ZLWK 2IBZX 2LQRA 5KOMC 4NHCH 1P5VA 1MCOL 3V0WL 4XHQA 4WV1A 1NEZB 4I2XE 4JR9L 4PLKC 4J4PA 3U4BH 1SY6H 2F19L 3ARTA 4YXLL 1FN4A 4P2RA 4K71C 4X6EB 2DQHL 3S4SA 4M7KL 2KDGA 3M17A 1N59A 4R0LA 2PYEE 4EI5B 2O61B 4LVNB 1FFPA 1ORQB 1E4WH 3L5HA 1WLHA 2O93L 2IH3A 3J7HA 4Q9RL 1BIIA 1RURH 3EJYC 1OTTC 1JP5A 1BZQK 4XNZB 1FNGB 4AIOA 1H5BB 1KCVH 2I07B 1G7HB 3MRFA 4YBHA 5HVHC 1LEGB 4I8DA 2DTMH 4WY7L 4N0YH 4FQXC 5CUSH 5K9JL 3SE8L 1B0RA 3EOYG 4YIQA 3S96A 1XIWC 3EYOA 5TE4L 4LIQL 2VYRE 2HAZA 2VLME 4X6FB 1X6LA 4PJ8C 4MXWL 1PJ9A 3ARUA 3SKJH 4MA7H 4LCIH 1ADQH 3RVVC 1UXWB 5AEAA 5EZIH 1GGTA 1QPXA 4ENEC 2OMBA 5CEYB 1ACYH 4N9GB 1MRDL 3SOBL 4V2CB 4OZIE 4AQOA 3HPLB 2VDRH 5EOQH 3I6KA 1B0GA 4N5ED 1FG2B 3EYQC 5HYQB 3B9AA 1REIA 3RUGA 2IFGA 5IBUB 3MRNB 3E3QC 3ZT5A 3DGCR 1W72H 2G9HA 3T0EB 1KJ3L 4LEXL 5C0RL 2EDFA 4OCRH 3QI9C 1XCQA 4PFEA 4QOKA 1CL7L 3HI6H 4YGAB 2GSGA 4RWYL 5I1AB 4LSRL 3VFVB 2VZ3A 3UJIL 4O9HH 3SJVE 3VDBA 4AT6A 3RIFK 4EI6B 1MF2H 2CLVB 4QWWD 4KY1H 4U1LA 4MXQC 1IILE 4XXCA 1WBYA 2HA1A 3STLA 1B90A 1WISA 3RI5K 3PWUA 4MA3A 5CZXD 2VZ1A 2XTJE 5GS0C 4M6MH 1D3CA 1I1YA 4EN3B 5DRZB 1NCCH 4U0QB 3WJLC 3ARDA 5D7JC 3FO2A 2VJXA 4DN4H 4MB5A 1VHPA 3QDAA 4JN2B 5F7DB 3ZE1F 5KANI 4H8WC 3I2CH 3GNML 1N4XL 5KZCB 2R1XB 3RGVA 5DRWA 2J8OA 2XRAL 4NQDD 1NC2B 4POYA 1MCPH 3F7VA 5IK3B 5CP7B 2ERJC 4PJXE 1C5BH 3NA4A 5IQ9B 4OIAA 1DQDL 2CLZB 2ADFL 3T0VA 1ZHNB 1HHKA 4PJGB 3SJVD 2ZG3A 2I9LA 5IGXL 3ZT6A 2E7BA 3DX8A 5A16A 2GJJA 3S5LA 5HYSA 5DFTA 2NY1C 2A1WH 4JQXC 1A1NB 1T5XA 1W2KT 1UB6B 3U0WL 4X7SH 3S3PA 3MJGX 3JUZA 4D94A 1U8PB 4ZFZA 2XTJD 5BJTA 3MLWL 3LY6A 1KCRH 3O45B 4TVPL 2C9AA 2HJLA 1KELH 2HMID 3KPPA 1FH5L 4G8EB 1YY8B 2NYYC 5SWZA 4JKLA 1CZ8L 1CG9A 1YN6B 4E0RB 4OF5A 1IGJA 3PDOB 3GJFH 5I71B 4O51A 4ZQKA 1E6JL 1N3NB 1OWWA 2YWYA 4QYOA 1QFHA 4LCCC 1I7TA 2R56L 4TNVK 4KRMB 3T2QA 4XVTL 2ZSWB 3FZUC 5CJQH 2F54B 5TH2A 2IBGA 3RKDD 1NBQA 4QNPE 2J5LC 3NFSH 4UT6L 4WI8A 4R90L 5DJ0A 4KTEL 4XCFH 2OJZH 2BRRL 3ARFB 3CSYA 1ERNA 2DIJA 3DSNA 3VFMB 5EU4B 4BKLB 2ORBH 1KLUA 2HTLD 4YDIH 2Y36L 3MZGB 1NGZB 4HIJB 2O5XL 3JWDH 3BZDA 1DSFL 1S9XB 3UTZA 1EO7A 2WBJA 4XB7A 3QO1B 1D5XB 3T0EE 1C5DB 3QIUA 4S1DC 4HJJH 1T21A 1PAMA 3L95B 4ORGA 1BQUA 4Y2DA 2W0KA 2WMPA 3LZFL 4MDJA 3CXDL 1FO0L 1G0YR 4TULH 2IEPA 3CDFA 4XBEL 3MJ6A 3SEPA 2OL3A 2DKMA 2QADD 1MFDL 4G6AD 3CFEB 4HUMB 3O3AA 1WFUA 3C5JB 1CF8L 1MSPA 1H15A 2XWBA 3QG6B 3V52H 1AKJB 5BOPA 1VGKB 3QA3A 4RFNC 1R3LB 4XAKD 1HHHB 4RISL 2MCPL 4XHJC 1Y6KR 2LAAA 3W0WD 1FRGH 1L9MA 2EEDA 1G9EA 4XCYA 1T2XA 4XP4H 3V6FB 2EDYA 2CDGB 2GI7A 2NR6C 1ETZB 2HKHL 4WDIB 2WLYA 4NCC2 3ZKND 3C2AH 3HMWL 4NJ9L 1R3JA 3QH3B 1VSCA 2OBGA 3LAFA 4Q9BA 5JXAL 1KTRL 2VUOA 3JV6A 5EORH 4Z7NF 4J7RA 3QNZA 1N7ML 5JW3L 5C09B 3VW3H 4ODHL 4HJ0C 4JFFB 3QHZL 4Q6IC 1F42A 2EIBA 5DZLA 5ACMA 3P4NB 2HJKA 1GAFL 4WU7B 4JQVA 3QNXB 3R8BB 2R2CA 3EOAA 4QHKJ 1TJIH 2DICA 2J4WL 3G5VB 5E1AB 1KIRA 5I8OL 4NZUH 3LKSA 3QQ3A 4QRSA 3GSWB 1UM4L 2EDOA 3MRHB 2X1WL 1UKTA 3RWHA 2FL5B 1U36A 1NKOA 3TPUB 1IL1A 4OV5B 4LLQA 4XNYH 3PWVA 4JCMA 4OGXL 5DGRA 1RU9H 2V9RA 3MA9H 4I18A 5ILTL 4G8GE 1UENA 4I4WA 2X70B 5HGAB 5IHZA 2VSCA 4OAWB 3VMOA 4HH8A 4GRMB 2AK4D 3MNZA 3UZEA 1JNLL 3FRUB 2Z9TA 4X7TA 5I8EB 4HUWB 3TH2T 4OZFH 4NKIL 4LSTL 5ID0B 3QCVH 4GRWB 2NNAB 1LE5B 2R2HA 1WWWX 1QLFB 2F74A 4BH7A 3D39D 5IR1B 1R0AL 3SE9L 1UJ3A 3FT4B 3CIQA 4R2GD 3TYFB 5GSVA 2M26A 2P24A 4KUCF 4ELMA 3GSVA 3CZFA 3JV0A 1AC0A 3EYVB 5FFLA 4RFOL 4JFEA 5L2JA 4I0PD 5C92A 1FAIH 1JTOA 1A6WH 2Z31D 2CDEB 5HHMB 3W9DA 4G8GD 1JGVL 1CFBA 2PYFA 3MFFB 1R5WB 4QXWA 1A6TB 3O8XA 4Y8DC 5C3LD 5I8KL 3MCKB 4YDLB 4WU5B 3GMLA 1WAAE 2X4UA 3I02B 1TTUA 3PABB 5F9WC 3OAUH 3W11D 2B4CL 2G60H 3DARA 1AQDB 3DVIA 4R3SA 3V4UL 5SWSB 3LKQA 2LAGB 3FB6A 5D8JH 5J11B 4LIQE 2XXMB 1T6VN 5FKAB 3N85H 1P1ZB 1XGYH 2H3NA 3BH8A 2NX5D 4GBXA 3GI8L 3WFCH 4HPYL 3LDBB 3S98A 2DQTH 2JK5A 4S1SL 1CDUA 1MREL 3VFWB 4ELKA 3HNTH 1EGJA 4EI5C 3CK0L 1AJ7L 4LVNC 1HEZB 2VZOA 4M9OA 4PG2C 4XVUD 3IKKA 1RZJL 3O4LA 1WFNA 2I9TB 1NMBL 2Y6SC 1XF2A 5TDOB 1U3HD 4HH9B 2NY2B 1IFHH 4HS3A 4ZS6D 5C09E 4XNZC 5E00B 2CKBA 1H5BC 3FO1A 4JFFE 2YXFA 4M00A 4PV9B 2Q8AH 3ESVF 3NTCH 1BBDH 4FQLL 4F7TB 5GGRB 2QSCH 1BEYH 1IEHA 5C0BA 4NQVA 1DE4B 3VCLB 2VLRD 4M1GH 3H2WA 3OGCA 3DSFL 4FOMA 1FVCA 1SYSB 4BQ8A 4MWFA 1T04A 4YHKH 1YDPA 1ONQB 3MLSL 5CKAA 2UYLA 1DN0B 3MV7B 4OSUL 3G08B 1OT2A 3QO0B 5IG7B 4RBPK 2NW2B 2AABH 2J88H 3B6SB 4PS4L 4U31A 1Q72H 3UTPD 1RZFL 1DBMH 1T7VA 5DUPL 4PV8B 3TIEA 2WIMA 1W0YT 2VDMH 3IDMA 1KPRB 3DYPA 4X7FC 3T0EC 1SYVA 3HC0B 4MB4A 2D9QB 1MJ8H 4PJIB 3OMZA 4JHZA 3QPQD 4YHLH 4RAUA 4K9EH 3C9NA 4MJIB 5DK0A 2RFXB 3QPXH 2VDKH 1IAIM 4ZSOB 3VWJD 2ATPB 4XCCH 2A9MH 3HZVB 1KXQE 1A7PL 3VXRA 4PG9B 1D6EA 1W72A 2HFGL 2R1YB 3BMVA 4QHMB 3S34L 5TF1H 5D1XB 1YEHL 5F9OH 1E27A 1MHPH 3TV3H 5E7FA 5FDWB 1CT8A 5JPNB 2A6DB 3RY6A 5IEKA 3L5WB 4EN3C 3AM8C 4JGJA 2HWZH 3VDCA 3ULUF 3GIZL 1Q9OA 1T0MB 4HDIA 4PGEA 4PJHF 4TVPE 1D5MA 4WI3A 5HHME 4ZUVB 1NUDA 4BSVA 2EKJA 4R97C 2C7UB