2N56A

Ig59 domain of human obscurin a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
104
structure length
104
Chain Sequence
b'WRLEILELLKNAAVRAGAQACFTCTLSEAVPVGEASWYINGAAVQPDDSDWTVTADGSHHALLLRSAQPHHAGEVTFACRDAVASARLTVLGLPDGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obscurin
publication title Identification and characterization of disease-causing obscurin mutations
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 104
sequence length 104
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2n56A00
1FG9C 2C9AA 1CFSA 3G6JB 4S2SA 1KGCD 3G6AB 4QWWC 1OAKH 2GFBB 1MWAA 4YHPB 1T22A 4PJ9D 5C6TH 1MAJA 1ZE3C 2XQYG 1XIWD 1JTPA 3FCTA 3KYOA 1MVUB 5J12C 3UTSA 1P7HL 1NGZA 3CZFB 2VLKE 1FVCA 2DLFH 4LDOB 3SY0A 3RP1A 1Q9WB 3R06B 2D0GA 5C3TA 4JRYA 2BNRD 2AEQL 4OB5H 2V2XA 5DVMA 4LVHB 3FQNB 2B1HL 1CS6A 2VDMH 3OG4B 1LP9A 1XGRA 3WXWH 2YD4A 2NY1D 1JN6B 1WEJH 3S4SB 4LSQL 1OGAA 3MACH 2IH1A 5DSCA 4CMMA 1KFAH 1KLGA 4GRWH 4HFWB 4K3JH 2ADFH 1NCBH 4LHUA 4J2XA 3IDNA 4KJPD 4MLSA 1K9TA 2BDNL 2VIRB 4S1SH 5EULV 4OGYL 4P5TA 2KZWA 4M1CC 3QUXB 3GMPB 4HCRA 4R90H 3ES6A 2BZDA 2Y5TB 3DETD 4M3JA 1CG9B 1J1PL 3HG1A 1CI5A 4AMKH 4LU5H 2G75B 1RU9L 1SBBA 5M94B 4ZOEA 4F7TB 4U0QB 1MLCB 3B9KC 1JPFA 1ZANL 4HUNB 4QRUB 5D7LE 5F9OH 4KI5C 1A22B 1S5HA 4BA8A 5FV2A 3GJEB 5GRWA 2IFGA 4OFVA 5E0QA 3VGAB 2WWKO 1XR8A 4XMPH 3PGDA 1MJ8H 1I75A 2VABA 3B8YA 3RGHA 4L8CA 3RX8A 5DRXA 4M1GH 3RI5K 3DX6B 4KKCD 4OCNC 5E9DB 1FNHA 2R0WH 3SDXA 4EBQL 1R3IL 3ARDD 4N0UB 1J8HA 4UDTB 4XXDA 1J0HA 4PJAA 4FA8A 2E27H 5D6DC 3DURB 2A6KB 4ODXA 2HJFA 4LSRL 4OFPA 1YN6B 2FB4L 2AKRB 1MHHB 3QEUB 3HE6B 1M1SA 5MEOA 3BEWA 2GUOB 3CCHA 1D5IH 2P8MA 4ZAKA 2BSSA 3ZLQC 3WE6B 2FH8A 3WIHL 4YLQT 3CFBA 1A8JH 4LFHG 2D0HA 2XQYK 3U4AA 2PTTB 5IVZB 5E95B 5JPNA 2HWZL 3MFFB 3QUMA 4KJYB 1L6XA 3RVWD 1A0QL 3T4YA 5HDLA 2ZOKA 2HT3C 5EU6E 3QIWD 4RMRA 2YZ8A 1U58B 4X8JB 2Z9TA 3V4VH 2EE2A 3B9KA 1T7ZA 4Q2ZB 2ED8A 1TVHB 2HFFB 3BEVB 1T66D 3VFPB 3VFSA 2OL3B 4MMXC 2C5DC 3MZTA 1GRWA 2FD6L 3RUGE 5HYJB 3JV6A 5EIIA 3QXDB 3TBVA 4WNQB 2BNQE 1HHKA 3Q3GB 1A4JA 4GKZB 5FHBH 1F6AB 5IQ9B 2ZUVA 4YJZL 1PSKL 4P9HL 1IEAB 2O5XL 4NO5A 2J3SA 5TPWL 2UZIL 5GGSA 3IFOB 5EIVA 5J0BA 2XI9A 4N5UA 4P2QD 5D1XB 2YRZA 2XOTA 1I8IB 2YK1H 3LAFA 4HIJB 4CNIB 4P3DB 5HYQB 1QRNB 3VFOB 2XKNA 1D9KB 3L3IB 3TYFB 3NPSB 5KS9E 2ATKA 3QH3B 2Y06H 1JZ7A 3BZDA 5C0BB 4ONFH 3TNNB 1M7XA 4RAVB 4LCUB 4ONOA 4YDIH 1KC5L 2ZSVA 5GGRA 4G8FA 3BRGC 3WHXA 3ARQA 1E4KC 4XVSL 3LD8B 4PJIE 3ARGB 2W9LA 4PRHA 3NCJL 3OX8A 4H8WL 4HH9A 5IF0B 5FYKL 5HPMA 4KPHH 2JCCA 1TJGL 5H37H 5MENA 5I8EB 1A2YB 4XBGA 5IWLC 3CVHH 1HHJA 3ILPA 2BSED 4M6NH 3A0OA 1NLDH 3SJVD 5ETUA 4L3AA 1OM3L 4M6AA 5E6ID 1EO8H 1I3UA 3MJ9H 4HLJA 3OKEB 5J11C 5JW3L 4X98A 4YHNA 1AGFA 2Q8AL 1K4DB 2EYTA 5C9JA 1TCMA 2O5ZL 3WJLC 4KI1A 1FZJA 1VERA 4PLKC 5I1EH 3BIKA 1BJMA 2W38A 3KLHD 4PJFF 2WIIB 4PYHA 1YC7A 5LBSL 4LPUA 2X41A 3VXNA 4LAQL 3G5ZB 1DQDH 3A67H 1CU4L 3CFCL 2QHRH 3L5XL 3B5GA 1FVDB 4JFDA 1UH4A 5IBUB 4L29B 3WIIL 3MNVB 2RFXB 4HUXB 5C2UB 5JR1H 25C8H 1BM3H 3C5ZD 3Q5TA 2AV7B 5C0AE 4NCDA 3D3VE 4D0DA 2C3VA 3OKMA 2EH8H 5E1AA 4KKAC 1QBAA 4WW2F 3DX9A 5CCKL 5JORB 4H20L 4TTDD 4ZSOE 1S7TA 4O4YH 5E2VH 3EOAA 3ISWA 4MA1C 5HPOA 4KTDL 4PJDF 2Z31B 2D7OA 2W60A 1VHPA 3PNWA 2JE8A 3X14A 4GG6A 3FOLA 4LL9A 4HKBB 3LB6D 4Y4FB 2NY6B 1A6VL 3ULVH 4GBXC 2IPKA 4W68A 3DXAB 4FZEH 4Z7UA 2BVPB 4U1LB 5ICYA 5HGHB 1I7ZB 2XN9E 4KRMB 4L5FL 1J5OH 4XH2B 1LO3L 2YOCA 5JOFA 4NOBA 1ZSDA 4QO1A 2VR5A 1SEBA 2NZIA 5DK0A 4QGTA 4AQ1B 1WWBX 3LPFA 3W39B 2AQ1A 2DQIH 1QFUH 2X9YA 5D2LA 2WK2A 3DVGA 1EO5A 1FNEB 3VFMB 4Y19D 3GBNH 3BW9A 5C0EB 1N59A 3NA9L 4WU5A 3UJTL 4K23H 1NSNL 1S8DB 2ARJB 3X3GL 4XPGL 3VXRB 3PP3K 4RGNB 4ELKA 5CFHA 1P2CA 1H5BC 2PXYA 3H9SD 3C6LC 5AZ2H 2CKBA 3GSOA 5F96H 2YXMA 2HN7A 3VRIB 3BUYA 5BJTB 4MNQB 4F7PA 4U6HA 4XCFL 3C2AL 1NBVL 1F45A 4K3HA 2N7BA 2IANA 4IRZL 2J4WL 4DCQA 5SX4I 3GMNB 5IB2B 3WXVL 1UXSA 4WU7A 5C3LD 3VH8B 2FATH 1TJHH 2HRPL 5LVEA 3B6SB 2CRZA 2DWEB 1GZPA 2IMMA 4KQ4L 2VO5A 1MCBA 4YBLB 4NUJB 3BGFC 5E7BA 2V2TA 2IQAA 1EGJL 3BKCL 4RRPG 4H88L 1HQRA 3VGEA 1ITBB 1DQQA 2MPAH 4LGRB 2MSPA 2DYPB 1MCLA 4M7LT 2G9HA 4ZNCD 1U2HA 3DSFL 3MJ8B 5ID1A 5KVEL 5MEPB 2WM0A 3E0GA 1LMKA 2AI0H 5JW4Q 4GRWE 4KK6C 4HS3A 1BOGA 5HHOB 2WWMD 4PP1C 3REVB 4ZDHA 1JNLL 1S7UA 2CLVA 3GK8H 2BJMH 2IBBA 2Z8RA 4H26B 2RBLA 1IGCL 5CBEA 3IFNH 4PP2A 43CAB 1G9NC 4JFYB 5IG7A 4G9DB 3A6BH 1PY9A 5CBAA 4RISL 4Z0BH 4PJ5B 1MI5B 3PQYA 3IYLW 4F58L 4AL8H 4XMLH 3MODH 3QQ4B 4DVRL 4MXWH 1JPGA 5GJSL 3I6LE 1MREH 2XWJB 3ROOA 3IJYA 3SE9H 3VXSB 1D5XA 4XC1L 1JRHL 1Q9LB 4OLVH 4J12A 5C8JB 4QY8A 3V5DA 2F54A 1RJLA 1T80A 1G7MB 1H3XA 5HGBA 5I6XC 1IGFL 3QI9B 4UT7H 4LSPH 4KXZH 4U1GC 2I9LA 1U8OA 5H2BB 2OLDA 4D9RD 3U0PA 3AXLA 4P4RA 1X44A 3BKJH 5I1IL 3AREB 3QIBA 5TQ0H 5FDWB 2DQCL 1V7NL 2GITB 4P2OD 1AHWB 4RZCB 3KR3L 5GS0L 3MV7B 1IL1A 1I7TA 1URLA 4H5SB 1N0XL 1ZT7B 3O2DL 5B38A 3MLXH 3QDJB 4OIAA 5T33H 1JWMA 3J7HA 5CD3A 4JFZH 4QOKE 4DN3L 2DAVA 3X12B 3EJJX 1CR9H 1GGYA 3ZKMD 3KS0J 1U8NB 5L2KE 1WITA 4HZLB 4DZBB 3CXDH 4HUVA 3H8NA 1FBIL 4E42B 1A6ZB 3SPVB 1E4XL 1YEEH 4OZGB 5DLMH 2VLRA 1CGYA 1QLEH 3TPUA 3JV4A 4P4KD 3OJMB 3SDYL 2NY3D 4PJEF 1MIEL 3VI3F 3MBEB 1X7QA 1J05B 3PIQB 5DRWA 2E7MA 1F11B 4KRPC 4MNGB 4R4BB 3MREB 2GCYA 5F88A 5IVXE 4EVNB 3GMMB 2EDTA 2KL6A 3JVGC 4AM0A 2Y36H 4XVUD 1MHEB 4LLWB 4JDZB 5I1CL 5IHUL 4KUCF 2J8UF 1A6AB 3UDWC 2OJEB 4OKDA 3U7WH 3RWIB 4PRIE 1CQKA 1A1NB 2ICES 5GS1C 4F8QA 1ZKAA 1CWVA 4GW4B 1A9BB 3TZVB 1AI1H 3MV9D 4ZS6C 4FQLH 2F5BL 3QYCA 4YIQA 3U82B 3BIAX 2Z35A 1H3PH 3PDOA 2A77H 2OTUB 2R2HB 5CJOH 35C8H 3ZYIA 3OZ9L 4RGOH 1FNGA 4CMHC 4QHNB 1RHHB 1DVFC 2LTQC 3HRZB 4Q9RH 1H15A 1KEML 4N90E 5IEKA 5IVNA 15C8H 3FQUB 5DURB 4XCEA 3UBXB 2W9DL 3HB3D 1FO0H 1EJ6A 5CEXB 1MCWM 2R4SH 3BHBA 4ZOBA 1OSPH 1P84K 3MGTA 4NT6A 3U30B 3BGMB 1IQDA 3QG6B 4YX2H 4YHML 5HYEA 4PLJD 4RAUA 4ONGL 2F53D 1UYWH 4HD9A 5E8DL 4U2ZA 4XGZB 4CAGA 1BGXL 2GSGB 2HT4D 2DQFB 4M8VA 2A9MH 1UB6A 4GAFB 2P49B 3RZCC 1YEKH 2VAJA 1NC4A 8CGTA 1DUYB 1EPFA 3MA9L 3O3EA 3JVGA 4NNPL 5DJCA 1U92B 1I9IL 3Q0HA 1HH9B 1ZTXL 5I2IB 2IALB 2IPTL 5GRVL 2DF3A 2VQ1A 4G6ML 5GRYA 4NO2B 1YEHL 4S1QL 1A7QH 5K9QG 1B0GA 2A74A 5GS1A 4PJ8A 1IC7L 4EN3A 1IGJB 4ODUA 4X4YB 3S5LB 1A14L 4XVTL 2X42A 1SY6L 2HFEA 2JF1A 1F4YL 1EVUA 4E9LA 2GSIB 2AJ3B 3L95A 5D8JL 2WBJB 3R8QA 4JO3H 5MP6L 4NKMA 3SKOB 5KSVA 3G08A 1WCQA 4QRPB 1MCEA 3LZFH 4FQHB 4MCYB 5J8OA 2CDFA 4QT5B 3B2UC 2UVEA 3VJ6B 4WHTB 1J0IA 3QCTH 3DTXA 1KCSL 2JJTC 4OCXH 4WFHD 3WFBL 5DHVB 4D9LL 3N50A 3K81A 5FM5O 3ULVE 4RNRA 1NGPL 4OLYH 5D7KE 4NZTL 5DC0A 5BQ7A 1LEKB 1MCIA 2D4FA 4MJ5A 5T3XD 5FOBA 2NNAB 5CKGA 2C3HA 4J23A 3WNLA 3CGTA 4DVBA 1II4E 2Z93B 4DEPB 4LLUB 1VGKB 4FFZH 2DI9A 2H8PA 1JL8A 3TBYB 5IQ7H 4GRMA 2QSVA 1QFOA 4KHTL 1FV1B 4U1MB 3CX5K 1KCKA 4H1LG 1LE9A 1XR9A 1DBBL 2OR9L 4OZHE 3HZMB 2X9WA 1MFBL 4LBEB 3ZHDA 5F9WB 4DN4L 4PJCE 1W72A 5D2NA 5KVDL 1VFMA 3K80A 3FQWA 4UBDD 1RJYA 4URTB 4MQ7B 3SGKC 2MKWA 2HKHH 1TPXC 4QXGH 4HPYH 2E6JA 4O9HH 1LEGA 2ARWA 3MRHB 4C58B 5I8CA 1RIHH 2X4UA 4U3CA 1JGDA 3MUGA 1PW3A 4DFHA 4JG0H 3VWJD 3WKNA 3FZUD 4UDUA 2YD6A 3IKKA 4MNHA 4OD2A 4HG4K 4KUCD 5DJXA 1H9VA 5EZJB 3MTRA 2GJ6B 5KTEH 3S37H 5IW3A 1MQKH 1S9XA 1OVZA 4L1HA 1YQ2A 4JFFB 2E6QA 1RFDH 1AIFB 4BELD 4K7PH 1EAJA 4HDIB 3THMH 5D7JC 3KPRD 1MCOH 5CILH 5AYUH 3P0YL 1XCTA 2XYCA 4CRPA 5JW4N 2P5EA 4HKJB 4ZODA 3F7VA 4HJGB 3GGWA 2ATPA 4FQIL 4R7DB 1U6AH 5MI0B 1JPTH 3A6CH 5D70L 1GGBL 1YMMB 5JPMA 5ISZA 2VZUA 3B9EA 4APQD 1KB5B 1ZS8A 1ACYL 1W0VB 4FXGA 1J86A 4E41A 3EYOA 3D85A 4JKLA 1KB9K 5CGYD 4OUUB 5FHAH 3FO9B 3LQMA 2PN5A 3T0VA 4F2MA 3BI9X 4LLDB 3GB7B 1U8IB 5BMFL 4LCYB 1UCBH 1Y6MR 1A47A 3AM8C 1FZMA 4PUBL 2FBOJ 4QRRE 4YNYA 3CZJA 5GGTA 3BPCB 1GPOH 1T21A 1D6EA 4YPJA 3VFUA 3X3FL 5DWUL 4JFEE 3CLEH 1JMZA 4O2EB 2J2ZA 4GMTH 5DJ0A 2D03H 1FGNH 3ZTNL 4JGMA 3DMMD 5DC9B 4ORGA 3TJHD 2J6EL 3DV4A 3S3SA 2DWDA 1YEJL 4XPBH 3VG0L 3G6JF 3LPGA 1QRKA 1BFVH 4XNZC 2DD8H 4UQ3A 4AENA 3HI6H 4GT7A 2HJKA 3MRNB 1BQLH 1I1FA 4BFIA 3BZ4B 2FJFB 1IGTA 5CWSA 3U0TB 2UY7A 4HH8A 3PWPE 5DUBB 5TDPA 1TTUA 5BV7B 5I71B 4H1LA 4HIEA 2JJSA 4WWKC 3TBTA 1NQBA 4B5EA 1KOAA 5EIQA 1N64H 4G8GD 2Q7YB 4U4BA 3QFJE 2IF7A 3NAAH 1CYGA 4P2RD 5D1QD 1U3HB 4UT6L 5CZKA 1BFSA 2I07B 4XPHH 1KBGL 4XNYH 3EJYC 3IDJB 1AH1A 4OAWB 1U93A 1JF6A 4D8PB 3QUZC 4WUKL 3IF1B 4OLZH 3NZ8A 2GAZB 1I9RL 3BN3B 4KROD 4MA7H 5KSBF 2ZUTA 2AJYL 1RHFA 1P5VA 1BX2B 1A6UH 5F8QC 3GSVB 4L3EB 1C12A 2GJZA 3LKNA 4H25A 3TYGH 4S11A 5IB1A 2VXTL 4HFUL 2C26A 1J7VR 1H8SA 1QSEE 5IBTL 3W9DA 1HYRC 4OBRA 2FIKB 3INUL 2V5TA 1JZ2A 4NQCA 1HYSC 3C8KB 4P46D 1X5YA 1NMCB 5ADOL 3DX7B 4WTWA 3MOBL 3QCUH 2W92A 4Z7WE 2OCFD 4UU9B 3IU3B 1AQDA 2R0ZL 1KTKE 3MLVL 1CD8A 1CFSB 4ZUWB 4S2SB 2OXGA 4X6CE 4IOIA 5DT1H 1MWAB 3WDIA 1RJZA 4M43H 1T22B 3FCTB 3KYOB 3UTSB 4Y1AA 1FVCB 4KVCH 2DQTH 1FYTE 3SY0B 4OTXH 1CFQA 5J13C 2B2XH 2ITCA 3RBGA 1KJ2A 2IBZY 1Z5LB 2FIRT 2V2XB 4AK1A 1YJDH 3QUZA 1VFAB 2EO1A 5DK3A 1BAFH 5E6ZA 4KC3B 3GMLA 2FNBA 3H2WA 3K8KA 1LP9B 1I1AC 1XGTA 2P42B 3NFSL 3F58L 5D7IF 3DO3A 3ZKXC 4Y16A 4IRSA 3SDAA 1OGAB 4GH7B 1XF5A 2IH1B 2GKIA 4N0CC 1OW0A 1KLGB 3RDTD 1TCRA 3SDDD 3T2QA 4I77H 1U8QA 4LHUB 4GUPA 3IDNB 1QFWH 3V0WL 7CGTA 3HAEH 5DJ6A 2DM4A 3BDBA 5BS0A 1EZVY 2V5SA 2V7HA 1KENH 4TYUA 4P5TB 3CFJA 3W0WD 3ES6B 2NY0D 3JUZA 4L4VD 4BZYA 4ELME 3T0DA 1T6WA 3DO7A 3RWFB 1I8MA 3TIEA 3VD9A 2VYRE 4O58H 2N4IA 5GGVL 4XPFL 1I8LC 1JPFB 5GRVK 1GGCL 2VXSH 4PJHE 4N8CL 1DUZA 2X4OA 1CICD 2MJWA 3QXUA 5DYOA 4NKDA 3TM6A 1N26A 5D9SA 1UA6L 4KWUA 1XR8B 3QRGH 1UKTA 4G43A 5GRZA 2VABB 3TA3C 1QSZA 1A7RL 3WNKA 1C16A 5F72S 1IGML 4D2NA 4L8CB 2YMXH 3EZ8A 4KMTL 5D6CB 4BKLA 1MY7A 3BAEL 3PV6A 3SDXB 1J8HB 4Y4HC 4LGSB 4XXDB 3G5VA 3EJZC 4PJAB 4UV4L 3UZQA 4MQTB 1F58H 1UXWA 2E7LC 3D2UB 2VITA 4ODXB 5DQJA 2HJFB 4HWBL 4JZJA 3QR2A 5C07E 3BSZH 2BNUA 5MEOB 3AC0A 3CCHB 2P8MB 4K94H 4ZAKB 2BSSB 4HG4J 1XZ0B 1N3NA 2BVYA 3CFBB 2VLKA 5F93C 3ZHKA 2OQJA 5HHME 2R8SH 2ZUUA 3EO1B 3BN9C 1NCDH 5JPNB 2A73B 3QUMB 4R4FL 4JZOB 4HT1L 4MCZA 3T4YB 2D7TH 2ZOKB 4X83A 3MOAH 5GGUA 3EDKA 4YXHL 4EDWL 1MJ7L 5K9JH 4TSAH 2HT2C 2MOVA 4G6JH 3B9KB 4R4ND 4RX4D 3MFGB 1LQSR 1MY5A 3AS0A 1EEYA 3OL2A 2K7QA 1JHLL 4AEHH 3QG7L 5IKCA 4HLZH 1NANI 1ZT1A 4IRJC 2PYEE 3C60C 3TA3A 4JHAL 3V7AE 1RZIB 5GISL 5GSVB 3JV6B 2RGSA 3MPCA 3QUXD 5ALBH 5CIPA 2Y9RT 5EIIB 4XTRC 1T89A 3TBVB 3E2HC 2YPVH 4HPOL 3FN9A 1KB9J 1HHKB 2A9NH 1A4JB 2WQ8A 4XHJD 3N1FC 1MF2H 3QDMA 1LE5A 5DJAA 3NH7L 1U3YA 3FRUA 5SX5H 4BH7A 2P44B 4NO5B 1JGVH 3GRWA 3ARWA 1OTUC 1YEIH 5AAMA 5GGSB 2AGJH 5F89A 2A0LC 1N6QL 3QIWC 5DJYA 5CSZA 5F7HA 5D7LA 4HBCL 1X5IA 5FA3A 5DTFA 1E6JL 1H3UA 2XKNB 1HDMA 3UP1A 3OAYH 4PGBA 2WINA 3GO1L 5DD3H 3CPLA 3VRLF 5HSFA 1SEQH 5E9DD 3FQRA 3WFEL 2ATKB 4I18A 4QYOA 3HUJE 2E6PA 2WWKT 1Q0YH 4DTGH 1QHPA 5ALCL 1IAKA 3RVXD 2Z92A 4ZUSA 2ZSVB 5GGRB 3FL7A 2WUCL 4WUUE 4PRHB 3OX8B 4G6KL 3CXHJ 4HK0A 4HH9B 1IAIH 5GSRA 5HPMB 3MRRA 4F7CB 5FUZH 4R97C 5LQBH 4WEMB 5MENB 1SMAA 4XBGB 3HC3H 4LDLB 1HHJB 1EEQA 1VGEH 2AJUH 2ZJSL 4W6YB 2OX5A 3GBMH 5JNYA 1G7QA 3OQ3B 4HGWA 4K9EH 4XP5H 5F7EH 4ODSH 1R3LA 4X98B 4ZFFB 4YHNB 3GEWB 4Y89A 2EYTB 5C9JB 2W0FA 1YEFH 3BIKB 1WFOA 2VC2L 3VRJA 1IMHC 4HC1H 4KZEH 1MFEL 4WY7L 3VXNB 2JJVA 1X6NA 2F19H 1CDCA 3KPPA 2NW2A 3RUGA 4JFDB 1J11A 3SE8L 1JYVA 1J1XH 4U7KA 4NO0A 1CVRA 4X8XA 4K3GA 2F8VA 5ILTL 1WK0A 1YYLL 5IIEA 3BYYA 5GS2D 4D0DB 2C3VB 3OKMB 1IM9A 3DX9B 3MV8E 3FN0L 5J1AB 3C08H 3UTTB 4GSDH 5HI5D 2W60B 1D9KD 2F5AH 1QRNE 3G6DL 1MRDL 3FOLB 1OARL 2H32A 4CVZA 2IFFH 2IPKB 1JNJA 4X7SL 1EFXA 1ADQA 2UWEB 2W65B 4Z7UB 3OJDB 1M7DA 2J5LC 1HQ4A 3TH4T 4R8WL 1GCFA 5GRXG 4IIQC 2I27N 1BFOA 2R29H 3FT3A 4JPIA 3ZE2F 3QJHA 1BEYH 4TSBH 5J11B 4GOSA 1ZSDB 5C0BE 4KK5C 5DGRA 1SEBB 5DK0B 3MX0A 5D2LB 4U1IA 4PJIA 1UM4L 3DVGB 5E2WL 3LQAL 4QRSA 1GVIA 1RZFH 1YN7A 1N59B 5JMOC 3OKKA 3HMXL 4WU5B 3ULUH 2O26U 3UAJD 1S7SA 3TO4C 2H2SD 4ELKB 1P2CB 2NY2D 3W9EB 5E1HB 2CKBB 4UIKH 3GSOB 2EZ0D 4MHHG 2BVEA 4JDTH 2HN7B 2LVCA 2YN3A 4RAHA 4LSSL 5IT2H 4NQEE 1BMGA 4F7PB 1CGVA 1KELL 4C83A 3FT4B 4U6HB 1ZXQA 3T0EA 3N85L 1XCQB 2AQ2A 4JQVA 2P5WD 2Q20A 4DCQB 1M4KA 1MCHA 5C0GA 2DBJA 1UXSB 4RDQG 4WU7B 5C92A 1G9NL 5KJRL 5GZOD 1NBZA 2NY7L 2OK0H 4CGTA 1NAML 2B20A 1GZPB 5T1MA 5TE4L 1DFBH 2VDLH 4AG4H 2FEEI 3GUTA 1RUAL 1MELA 3T08A 3QXAA 4R2GD 5E70A 2V2TB 4G5ZH 1Q9KA 2IQAB 4YHOH 3DLQR 5B8CA 1HQRB 3L3HA 3ZT6A 3WCYA 1ZLWH 5C0AA 3T2NH 4Y2DA 3D3VA 5JIKA 1INEL 1JNNL 2HLFD 5BXFA 3PGFL 1WIUA 1NMAH 2G9HB 4PY8I 5ID1B 5E2UH 4U7MA 1AKJA 4XPAL 3BE1H 4YAQA 2E9BA 1YNTA 2JB5L 3GM8A 4HS3B 1F4WL 1BOGB 2B1AL 5F1IA 2NY6D 3OPZH 3MXWL 1RK1B 5SWZA 3KPSD 3Q6FA 4ZDHB 3DXAD 5AG9A 5BRZD 1S7UB 2CLVB 1HE7A 2XWBA 5F9JA 2FX7H 3C6LB 4UIMB 3O6FC 2EDLA 3R0NA 2XN9A 5CBEB 4PP2B 3P9MA 2VNCA 3LSOA 1TJIL 2Z8SA 5IG7B 5CBAB 4JJ5A 4UAOC 3PQYB 3L5WA 4OZGF 1JPGB 4P2QE 1SM3H 4DGYH 5C09D 3ROOB 2PW2A 1BP3B 3PDDA 5HHNA 1QSFA 1TETL 3U2SA 2A38A 2WWMC 2ID5A 3QHTC 3LRHA 2CJUH 3L3OA 4M1DH 1RUQH 5F6HI 1JYNA 5HGBB 2I9LB 1U8OB 5FYKD 2IWGA 2N1KA 3U0PB 1IT9L 3AXLB 4MNQE 4P4RB 4BSJA 4UQ2A 3QIBB 4LSTH 3GSUA 3WUZA 4OCSL 1OY3B 3UJJH 4HQQH 2DI8A 2DQJL 4MB5A 3O45A 3VU2A 5JUEH 2ESVD 1IL1B 1G6RA 1I7TB 1U3JA 3IDUA 4R3SB 5B38B 3PABB 5DHXB 1RULL 3O6FA 4HK3N 1JWMB 5CD3B 3LHPH 3JWDH 3WBDA 1F8TH 1U8MA 3SJVE 2G2RB 4RFOL 5KANI 3KAAA 1A7PH 2DYPD 5LWYH 3P77A 3NCYP 5I1GH 1JGLH 1BHGA 2K7PA 3I2CH 1PVHA 4Z7NF 5JXEC 3FO1B 43C9A 2DJUA 4HUVB 4JRXB 5TQ2H 1I7UB 2DQUL 4Z95H 4L8SC 1MCDA 4HEME 9CGTA 4WRLA 2LAGB 3WUWG 2VLRB 3TPUB 3JV4B 4QXTA 5KSUA 3RFZC 2AW2A 4XMKL 3WFCH 1S5IL 2ADIB 2VDOL 4A6YA 1X7QB 4F37F 1UH2A 5I6XB 1DCLA 32C2A 1LO5A 1CF8H 3ZT7A 4CDGC 3FOMA 4NQTA 4AM0B 4PJ5D 2DTSA 1YPZF 3RGVC 4V1DB 2EO9A 3L5HA 3BJ91 1MI5E 4ZFGL 3WSQL 4I4WA 4Y4KA 2ZSWA 2AK1L 4S1RL 1UKSA 4ODVL 2SEBA 2I9TB 4KUZH 4X4XA 3S97C 4FQCH 4ZTPH 4KGLA 1U95A 1FNLA 3BOVA 1MCQA 1C8PA 4YIQB 3PDOB 3DECA 5H37G 2D9QB 3PWUA 1NUFA 3QI9D 1FNGB 4BQ8A 5T3XH 5JA8B 1EMTH 1TQBC 1OPGL 1H15B 3ARED 5IEKB 1DBKL 2DTML 4K55A 3RJDA 4XCEB 5JXEA 4BQ9A 4JO1H 1DLFL 3BHBB 2AABL 3MGTB 4NT6B 2G60H 1IQDB 3GI9H 3MLRH 4WEBL 3MV7D 1CDBA 2AAVA 2C1PA 4RAUB 1F90H 1MFDH 5E2TH 4R0LA 1A7OH 2I5YL 1DL7L 5KANG 4HWEL 4P59L 2QQNH 2VXVH 3H9SE 5JZ7D 1DN0A 4KRPB 4QOKA 1NC4B 3BKYL 4HHAA 1OAXL 1MLBA 3MRKB 3O3EB 2VDPH 5EC2A 1N7MH 5L2KA 5B4MC 5EWIL 5J6HA 2D7PA 4ZQKA 3RGVA 3MUJA 1CGXA 3VMOA 1G7HB 2AXHA 2VQ1B 4P3CL 1TTGA 1B0GB 2A74B 5GS1B 4PJ8B 3OXRA 3QB7C 4EN3B 4ODUB 3VG9C 4IBLT 4JFHD 5TE7L 4JM2C 4YDJB 2HFEB 4R26H 1OAUL 3L95B 4JKWA 4CMHB 4NKMB 2LTQB 4DGIH 5IVXA 5KSVB 3G08B 5I0DA 5I30H 2YS4A 4YE4H 3VGDA 5JHLL 1O0VA 1JBJA 1MCKA 1TFHA 2X5PA 2CDFB 3WUWA 3KDMA 1T1ZA 2ZNWA 1HHGA 3DTXB 4FNLL 5GRUL 2R0LL 2MFNA 4HXAL 2F8XC 3DARA 4QNPE 1EDQA 3TZVD 4J3VA 2R4RL 1UEYA 3F5WA 4RNRB 5LXGL 4ETQA 1RUKH 4XC3L 3CDFA 3J8F7 2Q8BL 3SCMC 5BQ7B 3G5YA 4MJ5B 5FOBB 3S37X 4FABH 4NO3A 2EE3A 4YWGH 3VFNA 1S9KC 2B0SL 4DVBB 4F57H 4PJBA 3LEVL 5DURD 2R2BA 4K7PX 2YD2A 1YEGH 2H1PL 2H8PB 1C1EL 3EFFA 3RNKB 3SDCC 2DMBA 4GRMB 2IG2L 4KXZI 1XAUA 4LVOC 2XZAL 3D6GA 4Z77B 5LGKA 3ULUE 1EVTC 2PKDA 2VDKL 4PJFE 3ZDZF 1LE9B 1FZOA 1XR9B 3ULVC 4K2UL 4X9BA 3MGOA 3CVHA 4ODHL 5D2NB 4JM2A 1QBLL 2EXWD 1HI6A 4JO2L 3SE4C 2CK0H 3FQWB 1RJYB 3GSQA 3MJ9A 2XFXA 5GS0D 1JGUH 1SVZA 1LEGB 2HTKD 4MA8H 4D9RE 5I8CB 2X4UB 3ZE0E 1JGDB 3MUGB 3BXNA 4MNHB 4HEPG 5JQ6H 1K5NB 5GGSY 4XNXL 1FIGH 1U0QA 2V2WA 4JHWH 4PJDE 4CJ0A 1H3VA 1JF1A 4KK9D 2COQA 2FO4A 1E4WL 4JFXB 4UMGA 3Q6GH 1S9XB 3MRLB 3QIUA 5ESAA 2A6IA 1NKOA 4L4TD 4KQ3H 4U6VL 3VXOA 2WBJD 3RY5A 1JNHA 5FA4A 1XCTB 1FC2D 2MCPH 1RZKH 5KVGL 3M45A 2P5EB 5DEFA 3F7VB 4IMKC 5I8KH 3B9AA 1CN4A 4KDWA 4NQDB 3HNVH 4QRPE 3GGWB 2ATPB 4YK4B 3KPQA 1C5BH 1KULA 3HC4L 2DQHH 5JPMB 3O3AB 3VWKA 5ISZB 5GGRY 5IFAH 2PO6C 4FXGB 4V2BA 5GS3A 1RZ8A 5GRJL 3EYOB 3D85B 4E41B 4WWID 5SWQB 4ERSL 2YHGA 4MAYA 3HI5H 4FQXC 1JFQL 4MB4A 2R9HC 3SE4A 2DBLH 3KWWA 1J0ZA 3FN3A 1NJ9A 2LU7A 1TPXB 1N5YL 3TGXA 1AD9A 4GG8A 1WWWX 4F2MB 1K4CB 2XWTA 3TT3L 4FQ1H 4HUMB 1TQCC 3IRPX 3VFTB 4ETYA 2D4DA 2VB5A 1FZMB 4ZTOH 1CLYH 4NGHL 4DFIA 1T21B 1D6EB 4OZHA 4APQC 2OJZL 4MJIA 4PJCA 4B53A 3K3QA 4LKXB 1QR4A 4UTBL 1IC5L 4ORGB 4X7FC 3DV4B 5D7JB 2DWDB 3V52L 3V79C 4ZUTA 4UNVA 4HIHA 4PG2A 5GJTH 4AENB 2ARJQ 1OWRM 4WCYH 2Y07L 3KYMA 2Q1EA 4HAFA 1SJHB 5BCAA 1I1FB 1XGYL 4BFIB 3FTGA 4L9LC 3MLYL 1E28A 1IGTB 3ARBA 5CWSB 3IDMA 3DYMA 4O51A 4RMVA 4U1JB 3SKJH 1XF2B 4HIEB 4FTVD 3TBTB 4YDKH 5DD6A 2GJ6D 3O2WH 1MJUH 1HN1A 3QEQE 5EORL 5F7LB 1UACL 5I16A 2ERJC 4JFFD 3QJFA 3HR6A 4F9PA 2AJVH 4FQXA 1Z3GL 1U93B 5CJ8A 1T83C 3NCCB 4YHYC 2R1YA 1LP9F 3NZ8B 4M7ZC 3TBSA 5DUMH 4I3RL 1QYGL 2R1WA 1T7WA 3PL6C 3U9PH 1J12A 2GTWB 3ZKQD 1CD1A 3LKNB 4JPVL 4H25B 3F7QA 4GAJL 1YMMD 2IQ9H 2ZNXA 3WFZA 1CDJA 3ZZ1A 4NUGL 4RWYL 3KS0H 4XP9L 2DDQL 4HJJL 1CBVH 1VENA 2HYMA 1OAQL 2ZCHH 5HVWA 3NPZB 5D7SL 3SOBH 2DKUA 2EH7L 4M61B 1KJMA 1AQDB 1NC2A 3QUYC 1MIML 2W0KA 5HJ3B 5T1KA 4IOSD 3NACL 3ILQD 1DJSA 1NAKL 4TTGA 4OCWL 4X6DB 1RVFL 1RJZB 3CFKA 1BD2D 4QRRA 3BDYL 1AGEA 1EJOH 3BP6A 3DGCR 4RGMB 5L6YL 3K2UH 4PIRF 3CUPA 1CFQB 3C9NA 3O9WD 2D7QA 3U0WH 3KJ4B 1ZGLP 3SDXF 2VN4A 1KJ2B 1X6LA 3SN6N 4MWFA 3QUZB 4QXUL 4M7LL 1FDLH 1OB1A 2NY4C 4D0BB 1DE4A 4WI9A 3PL6A 4Y16B 4IRSB 1V3MA 1FH5L 1XF5B 5DMGD 4OD3L 4UILH 4PJ7E 3ZHLA 1LD9A 12E8L 1U8QB 1MFCH 4GUPB 1W0YT 5DJ6B 1S7WA 5BS0B 2V7HB 1U3HD 2J8OA 3QFJA 2V6HA 4NZJA 2GHWB 1V3JA 3KXFE 4MVBD 3W2DL 4XNUH 3IDYC 1UENA 3CFJB 1LO2H 4PJEE 4X6EA 3DO7B 4FFYL 4LNRA 1I8MB 1X5ZA 2BVQB 3NABH 3MCKB 1PFCA 4KI5F 1WZ1H 4OM0H 4L3ED 3LS4H 2HH0L 5CSGA 3MROA 2X4OB 3DUUA 5GXBB 5DYOB 2ENYA 4NKDB 2I60H 3RIFF 5D9SB 5JW4R 4PB0L 1QSEA 4G43B 1EEZA 3SDDC 1MJJA 1C16B 2VDNL 4HV8A 5KG9A 5AZEH 2JTDA 3PV6B 4QTHA 4JAMA 4NM8L 3TT1H 3B83A 1UJ3A 3F65A 1WIOA 3KPRE 4JO4L 3G5VB 1OLZA 2YA0A 3SKNB 2FEDC 2VITB 5DQJB 1IZJA 3ARYA 2Z4QA 1FORL 4NHUA 3UTSD 5F3BA 1TMCB 3R1GH 3PP3H 3OR6A 4U7SA 1N3NB 3LIZH 2VLKB 3NZHH 1FYTA 5BVJA 4BQBA 2OQJB 4N0RA 5EO9A 3EO9H 4YUEL 5DFWH 5DJ8A 3HR5A 4CKVX 4G7VL 4JRYE 4MCZB 5SWSE 3RIAK 3AMKA 5GGUB 4UOJA 2M1KA 2YZ1A 3DWTA 3RWGA 5GIRA 1IRAY 4EJ1C 1OGAD 3C5JA 5IB3A 3MBXL 1EEYB 5JOEA 1BQHB 1T5XA 3FFCA 4CBPA 4LHUD 2AEQH 3Q1SL 5IKCB 1P7KA 5I9QB 1ZT1B 3TA3B 1AGDB 1XH3A 4MJ2A 5DD1L 2YSSA 1CGSH 4P5TD 3IAGC 4P5KB 1FN4A 2H26A 4JGUA 4PTUA 4M03A 4X99B 2NTSP 3QDMB 4LSQH 1LE5B 5EC1A 5DJAB 3UPAA 4LVHC 4WGWB 2UV3A 3FRUB 4BH7B 1KYOK 4RDQF 3HG1E 5GS2H 3IETA 1YYML 3MRMB 4HX1A 4QWWD 3LMJL 1CXLA 5CSZB 5DJYB 4PJHA 5D7LB 3GHEH 4OGYH 3T2OA 5DTFB 4X7TA 4NFBA 1YNLL 7FABL 1I3GL 3KLSA 1J1PH 1MRFL 4PGBB 5J6GA 2WINB 3CPLB 4P2RE 2PETA 4I18B 1A21A 4PS4L 4QYOB 1R6VA 2VL5A 3QUXC 5LAXA 2C4XA 1S7QA 4DWHA 1DANT 3D2UD 1IAKB 2P7TA 3DHJA 2Z92B 4OCYL 4ZUSB 2QSQA 3P73A 4OI9A 2E7BA 4ZAKD 4HK0B 1FRGL 3K8LA 4EBQH 5GSRB 4IRJB 3C60B 1R3IH 2UWEF 3BUTA 3MRRB 5TH2A 2EDFA 3VGAC 1OT2A 4M1CD 1UM5L 4KJQC 4GRLC 3E2HB 1GL4B 3L3GA 4NN5C 1G7QB 4U49A 4HGWB 2OTPA 5TE6L 3DROA 1TXKA 1BOYA 3KPNA 1R3LB 1ZLUH 1C08B 5FKAA 5D2LF 4DW2L 3B9KD 4YZFE 3WIHH 4YXKL 4AYFA 2W0FB 4KI5D 3D39A 3MCLL 3WL9A 3VRJB 5JIIA 2HWZH 2HA1A 5TGBA 4X7CC 4CDHA 3HE6C 4MD0B 3G5XA 1A0QH 4Z0XA 2PYEA 2NLJA 3H0TA 3KPPB 2NW2B 2X09A 3RUGB 4DKAA 4C56E 1HOCA 5H35A 3W5NA 3IDIB 4QHKI 2XA8L 4NO0B 1R5VB 3X13A 1FP5A 5DQDL 2BNQB 5IIEB 1QFWI 4ORZC 5ESQA 4FFVC 5IP4A 1IGYB 1NCWL 2A2QT 3MRDA 1NEZG 1OD7A 2AJZA 2FD6H 4M9OA 3WKML 1HCVA 3UTPD 3VFWB 4IMLA 4HUUA 4LCWD 1NGQL 4JB9L 3I50L 1Y18A 4R97B 2H32B 2X4SA 4CVZB 3FB8A 4HIXL 1EFXB 1MEXH 5KS9B 1PSKH 4NIKB 4O5LL 4P9HH 2O5XH 4GRLA 2ZUQB 5I73B 5TPWH 2UZIH 3T1WA 3MRIA 3PXHA 4GMSL 3HUJA 2HT3D 3FT3B 4JPIB 3BP4A 3T2PA 2VH5L 4LF3A 1LDPL 3QJHB 3RY4A 4DK6A 3MRBA 1JIBA 1ZHKA 1WAAF 4PRHD 1ES0A 4EZMA 4U1IB 2BSTB 4PJIB 1X5AA 2Y6SC 3N1QC 5D1XC 1F02I 2M2DA 4QRSB 5E8EA 2R2EA 3TEUA 5IFJA 2EEBA 5CJ5A 1ZA6B 1YN7B 3OKKB 5IJKA 1S7SB 5JDJA 2A1WL 4LAJH 2JCCE 3MRQA 1T1YA 2X70A 3TLRA 3NPSC 4UTAL 3CDGA 1U2CA 3B5HA 1F4XL 3ROLA 1KC5H 4KJWC 4U6XA 4ZYKA 1P9MC 4WHYG 4XVSH 4PR5A 3RL1A 3QNYA 4C4KO 3U9UA 1WBXA 4KK8C 2W9EL 4H8WH 4C83B 2APTA 1MCPL 5EO1A 4X9IA 5B39A 3C6SA 1TJGH 5C0GB 3K1KC 3MRFB 3JWOC 1NBZB 3EYUL 2NY5C 3ARGC 4PJ9A 5EU7C 4OF0A 5C08D 3WXWL 1OM3H 2VZSA 5T1MB 1NBQA 4JHBA 3GUTB 3MACL 4GS7B 3FJTA 5JW3H 3QXAB 3UAJC 3IRZA 1MHPL 1Q9KB 2Q8AH 2D3VA 4K3JL 2O5ZH 3L3HB 5CHNA 5ANMA 4EOWL 5C0AB 1BQSA 2FWOA 1NFDA 3D3VB 4S1SL 1PEWA 5LBSH 4OQTL 4LAQH 3M17A 5BXFB 3EW3B 3MLTB 4K3EL 4NYLB 3MV8A 5INDA 4R90L 5F7DA 3UTTD 1CU4H 3CFCH 1FFPA 3MRGA 4ZSOB 3K7UA 3WJJC 5KSBE 3L5XH 1VADA 5IMOA 1FFQA 1MOEA 3IGAB 2VSDA 1AKJB 3QDGE 5IVOA 2UZXB 3WIIH 4YAQB 1YNTB 5F1IB 3RWCA 1U42A 4GG6E 5SWZB 3Q6FB 4ODWB 5K9KB 2XWBB 5F9JB 1GC1C 1VCAA 4Z7UE 4I8DA 5CCKH 5DMKA 2AVGA 4H20H 4Y5XC 2XN9B 4PD4K 3P9MB 3ARSA 3SGJC 4PLKD 3L5WB 4PGEA 1A6VH 3O3BA 3MNZB 4GW5A 4WEUD 2V9TA 4PJGF 1AGCA 3VFGL 1OT1A 2Z31C 2PW2B 2MQ3A 3C5SA 2E27L 2E9IA 4S1DC 3UYRL 3IXAA 4KZDL 4W70A 3ARFC 4L5FH 5HHNB 2EDHA 3GJFK 3U2SB 4Y4FC 3HKFA 3L3OB 3BWUC 1EHLL 1YY8A 3QQ3A 4UI2A 1IAII 1SVCP 1S7XA 3ARDA 2X89D 3PWNA 4KKAD 3ZE1F 4NQEA 4TNVF 2RHEA 1CFVL 1P53A 3L7FA 4Q6YA 1QTYT 4XI5C 4KDTA 3NA9H 4J3TA 1NSNH 4G9FD 1GHFL 4OCRL 2IANE 4XPGH 3X3GH 3GSUB 3E6HA 4NJ9H 2CPCA 4ODTL 1QLRA 2EEDA 4N5EC 5I1DB 4LVNC 4GBXD 3V4VL 1CDUA 1P4BL 4NFCA 3M8OL 5INCA 2K1MA 2P8LA 3DIFA 3O6FB 1CE1L 4XCFH 3C2AH 4ZFOA 3FB7A 1NBVH 4RGNC 1JE6A 4IRZH 5ICXA 2J4WH 1U8MB 4I1NB 3WXVH 2EIDA 4KAQL 4WDIA 2FO1A 2HRPH 3RQ3A 2C3GA 43C9B 4KQ4H 5FGBA 3MUY1 3DYOA 4GRWB 5BOPA 5DHYA 5KSAA 4M9PA 3BKCH 3ZDYF 4H88H 3UMTA 4X6BA 1L0YA 5KSUB 1LWRA 3C6LD 2DLEA 1WVZA 4ZS7L 1NGXA 1QNZL 4FP8H 3DSFH 5KVEH 32C2B 4TSCL 1HHHA 5ADPL 1LO5B 2NPLX 1KJ3L 4S0SD 3Q2CA 2Y06L 2EDEA 4TUJA 3PQYE 3UTOA 5F21B 4I0CC 1AGBA 2E7HA 4FN0A 4P2QA 4I4WB 4Y4KB 1UVQA 2SEBB 3CDYA 3EIFA 1RAMA 1EAPA 4PRDA 4X4XB 2AP2A 3V6OC 4YC2B 1QD0A 4C59B 1U95B 2YWZA 2NQCA 4OI7A 4RISH 3PWUB 2F54E 4DVRH 4NJAL 3GKWL 2IAMC 3A6OA 1JRHH 1D6VL 2EXYC 5CJXC 3QPXL 4CJ1A 1HCFX 4KK6D 1SYVB 4AZ8A 5T1LD 2GEEA 2YUXA 2JK5A 3ZL4L 2DLHA 4CVXA 4H1LH 4PP1D 2C1PB 3KLAA 4Z76B 1IGFH 2ICWA 5HHVH 1M6OA 1IKFL 1K8IA 3MRPA 1XF3A 4OZIF 2DQCH 1V7NH 5C7XL 2HVJB 4QOKB 1NCCL 3P0VH 3SJVA 1UWGL 5E6IA 4PJXF 5EC2B 5L2KB 3KR3H 5DXWA 5HYSA 5J6HB 3ZO0A 1G7LA 3L5IA 5GS0H 4ZQKB 3RGVB 1G0YR 4ZO7A 5CZXC 1JCKA 4JRXD 1BM3L 1N0XH 2P5WE 3O2DH 4NRZA 5SX5K 3SKMA 1BVZA 3RRQA 2VLRD 3C8HA 3VE0A 4BSVA 3ZYOA 4Z8FL 2APVA 3WS6A 1IVLA 4X4ZA 4HULB 3GMRB 1CLOL 2F74A 4DN3H 5C2BH 3P4NA 5JA9A 3RJQB 5E94A 5C71A 3VRLE 4JCMA 2DQEH 1OSZA 3CFEA 1K6QL 3ULVL 1FBIH 4YEFA 5IVXB 3C5ZA 3S35H 1E4XH 4YHLH 2IAMA 2IJ0C 2H2PC 2B4CL 4V1DD 3TIDB 5T3ZD 2X1XR 3GSNL 3KDMB 3SDYH 4P48A 3VFRA 1MIEH 4OLUL 4XT1C 1T1ZB 2WP3T 1P4LA 4PRIB 5I17A 3LS5L 4DZ8A 1QFUL 3F5WB 3STZA 4ETQB 5BRZE 3BQUC 3G5YB 3MBEC 3PUCA 1DBML 4NO3B 5IHUH 3T1FA 5KVMC 3VFNB 4UZGA 1BFTA 1NDGB 2R2BB 2DIJA 4I0PC 3Q5OA 3O2VL 5F96L 3MJ7B 5I1KH 3I3BA 4PPTA 2F5BH 4KHXH 4M00A 3TWCL 1KCVL 3F12B 5C09E 2LABA 3GSRA 4PGCA 4Y19A 1RPQA 1R24A 2ZKHL 1FZOB 4S10A 4HXBL 3GI8L 3MGOB 3CVHB 3TH2T 2H3NA 4JM2B 1KEMH 5MEQA 1UJTA 1HI6B 3KHOA 4KRPD 3H9SA 2W9DH 2YRPA 3GSQB 3QULA 4XP4H 5LCVH 4YHMH 5ECJE 2CLZB 4ONGH 4G6FB 3BXNB 3GIZL 3AVEA 2XTJE 4RFEA 2Z0BA 5E8DH 4WI8A 4F7MA 1BGXH 2ED7A 4HC1A 2X40A 4UOW0 3SE3C 2MKLC 1HEZA 4JM4L 2V2WB 5CLWA 3S6CA 1JF1B 4YHKL 3U30C 2FO4B 1DZBA 3ULUC 3QIUB 5AD0B 2ESVE 4ZS6D 3MA9H 5ESAB 2A6IB 5TDOA 1CL7L 4NNPH 3SCMB 2QHLA 1I9IH 4OGAC 1IEBA 3VXOB 5KW9L 5GHWL 1FG2B 1ZTXH 2IPTH 5FA4B 3MYJB 2GK0A 3KLDA 4G6MH 5DEFB 1YEHH 4S1QH 4X5WA 3GK8L 4I0PA 1IC7H 2VZOA 2R1XA 3QXTA 1CIDA 1LK3L 3KPQB 3WIFA 2HTKC 2NX5D 1A14H 4XVTH 4CN6A 4M5YL 1BBDL 4LVOB 4JEGB 2W59A 5IJVA 2OTWA 1TZGL 5E4IA 2B39A 4ZNEE 3OF6D 5E24E 1JYXA 5D8JH 3NIDF 1KPRA 1RZJC 1RZ8B 2BC4A 3QQ9C 1MREL 4MAYB 4U3XA 2OYPA 4OJFH 3RZCD 5JOPD 3MUZ1 1D5MA 3KWWB 1BWMA 1KXVC 3HCVB 1NJ9B 1AD9B 2WBJC 1KCSH 3WFBH 2XWTB 5DVNA 4D9LH 3P40A 5KAQF 5C1MB 1ZGLA 4OQ1A 3MA7A 1NGPH 3M07A 4NZTH 4KKNA 3FO0L 1ZMYA 4PJFA 1V5JA 2FBJL 4OZHB 1KCUL 1GYAA 4MJIB 2VLME 4PJCB 1HSBB 2X4NA 3ABZA 3HNSL 4ZUTB 4AY0A 4HIHB 3T65B 3KYMB 4KHTH 4X6DF 3FTGB 3ARBB 5IHBA 5T33L 3OKNA 1J88A 4JANA 5ACZA 8FABA 1DBBH 3B2UD 2OR9H 3BT2H 1ZLWK 4O51B 3RWHA 1MFBH 3GIVA 1CR9L 1WBZA 4P2OA 1UC6A 4DN4H 1G7PA 4Y8AA 5KVDH 5DD6B 1KACB 5IESL 3HLAA 4PJDA 1CFTA 1INQA 2PO6B 2UZYB 3MLZL 3QUKA 3QJFB 1CD9B 4FQXB 4M8QB 1NPUA 1VKXA 2R1YB 1V3KA 2K9UA 4FFWC 4Y5YA 1Z9OA 4N8VG 2UVFA 3PHSA 3TBSB 4YPGA 4NN6C 4NQDD 1MFAL 5D5MF 2R1WB 5JDSA 2BOBA 1CD1B 5FO9A 3LDBB 1J8KA 4N0YL 1X5JA 2C1OB 5ISZD 4ISVA 3IFLL 5E2JA 4PRAA 4IDJL 3P0YH 4P4KA 4MQSB 3U7WL 4E41E 4MYWB 4JFHE 4LPYA 2Y7QA 1KJMB 3VA2C 5D70H 1GGBH 1NC2B 1AI1L 3S36L 5CEYA 5T1KB 4NC1E 3DSNA 5AWNL 5LKNA 3IJHA 1G9ML 5I1HH 5J9PA 1T7YA 4NSKA 1L7TL 4D9QD 3CFKB 4MA3A 4QRRB 4FG6C 1AGEB 1CGUA 2FX9L 3BP6B 5K59F 1DBJH 4RA0C 2X4RA 2WV3A 3CUPB 4O00A 2ERJB 4JFEB 5H94A 3LV3A 3R0MA 1FO0L 4LLMA 1BZ7A 1PQZB 5D7JD 5BMFH 1DANU 1QFWM 4M7ZB 4NQUA 5EFIB 1WISA 4PUBH 2PW1A 1F2XK 2GYSA 3PL6B 3X3FH 3KJ6L 2BRRL 1Y6NR 2OM5A 4XBPA 5DWUH 1MNUL 4BK4A 3ZTNH 4ZOAA 1A7BA 2J6EH 3WN5A 1YEJH 1EEUA 3QPQC 3QEQA 1KTLA 5C6PB 1S7WB 1J18A 1GAFL 3QFJB 3QQNA 5I1AA 1KIQA 2XKSA 4NQXA 3WFHA 4TUOA 2NXYC 4NFDA 3MLUL 4NWTL 1FLRH 4X6EB 1F3JA 1RZ7L 2V17H 3MOQA 4LNRB 2JJWA 1T1WA 2EE6A 1P7QA 4M48L 3CSYA 3HZYA 1ED3A 1DQLL 3NCYS 1FJ1A 4Q74A 4UT6H 2GW5A 3TVMC 1KBGH 3D87B 3O3UN 1AD0A 5BV7C 1QSEB 2EYSA 5BZWA 4WUKH 1MJJB 3GKZA 2AJYH 4HV8B 5KG9B 1GGIL 4NQCE 4N8VA 4QTHB 3EO0B 4JAMB 4L4TE 1UJ3B 4MVBC 5F7NC 1MUJA 3E3QE 3D9AH 5GZNC 3TV3L 3KVQA 4HKXA 5ENWA 2NY4B 2WW8A 2VXTH 3ARPA 2BSRA 3SBWA 3O3DA 3BGAA 5IROA 4EIGB 3INUH 4X6CB 1CTOA 4KKLC 4WWKD 1KG0A 1IC4L 2Z4QB 4NHUB 5F3BB 4ZXBC 2FECL 2VAAA 3OR6B 4JFOA 2CIKB 2XY1A 4KV5F 3S3JA 4Y1AE 5ADOH 1WBYA 3MOBH 1FYTB 5BVJB 4LEXL 5MHSD 5IB4B 4TVPD 2R0ZH 3IDYB 3HR5B 3MLVH 3HE7C 1QO3A 2F58L 4J3SA 3QUZD 5EOQL 1I8KA 4PTTA 4F8TA 1QEWA 3LH2L 1NMCC 3QO0A 3RWGB 3V6FA 5GIRB 1NANH 2ZPKL 3C5JB 4G3YH 5IB3B 3H7BA 2OZ4L 1FO0B 5C0DA 3FFCB 5MERA 4PJ7A 5IGXH 4HPYL 2YR3A 1A4KA 4IEFB 1XH3B 4BFEA 1HYSD 5CINL 5I0ZA 3KXFA 1ERNA 3OR7A 4OT1H 2H26B 4PTUB 4TNWF 1SJXA 3GMOB 4ELMB 5C0FA 4PJEA 1EIBA 5EC1B 5KTEL 3S88L 1BJ1H 4CU8A 3IETB 4HX1B 5FFLA 3V0WH 1OCWL 4PJHB 1MCOL 3KPOA 3BYTA 4Q7DA 2ADJA 4X7TB 4BSWA 3D25A 3VWJA 1IAOA 4ZXBA 2M8XA 4FTVE 3K74B 4GXVL 1N5AA 3CFDA 2J8UA 4QTIL 3HPJA 1U6AL 3PWVA 2APBA 3A6CL 4XCCL 3D69A 3LQZA 1IAIM 5GGVH 2CQVA 1F3RB 4K3DL 2VL5B 4XPFH 5I76A 1U3ZA 1GGCH 5LAXB 4N8CH 5DA4A 4C54A 2NXZB 2P4AB 4X7DC 3KPRA 1S7QB 4PGDA 4UUJA 1UA6H 2P7TB 2YEZA 2MTPA 3Q48A 1EH9A 1A7RH 4N0CD 3P73B 1A5FH 5C07B 4Z18A 5CEZH 5F8RC 4KMTH 3NIFF 3BAEH 3OHXA 5IOPA 2VLKD 3RVUC 3MMEA 5KS9F 2RAMA 2H6PA 1MCRA 2ENSA 5TH2B 3WNOA 3GSXB 5C0JA 2GT9A 1G6RH 1JPST 5HHMB 2NMSA 4FQ2L 4UV4H 3ZDZE 3L3GB 1GPOL 1S78C 3TC9A 5CS7A 4HWBH 5SWSA 4PRNA 2OL3L 5F1KC 2X1QA 3DROB 1RZKC 2D03L 2X1WL 1FGNL 3WD5L 2LVEA 3ELAT 4J3WA 2YKLL 1HIML 5EUKA 2BHUA 3B3IA 3D39B 5HHXH 4QCIA 2WQRA 5IMLA 1FVEB 5TGBB 3UYPA 1ORSA 1BD2E 2KKQA 3TA3D 4R4FH 3G5XB 4HT1H 4Z0XB 3TO2B 4XAWL 2PYEB 1VA9A 4OFDA 4ZAKC 3H0TB 2R23A 4JN1L 3N1PC 2IADA 5H35B 3CSBA 4YXHH 4EDWH 3BZEA 1MJ7H 2WLZA 3B2VL 2R0KL 3LN5B 4R96A 5E7FA 4Y4HD 3NVQA 4A6YH 1N64L 3DMMA 3EJZD 5ESQB 3QDME 2CLRA 1JHLH 3CMOL 1KJVB 3QG7H 4X9HA 1A02N 4XNYL 2VQUA 3HPLB 3MV01 5J7CC 2AJZB 4JHAH 4LARL 2CXGA 3OSKA 1CXIA 4OLZL 4MA7L 4HUUB 4YDLC 4HPOH 1Y18B 1DEEA 2X4SB 1LILA 3FB8B 3NH7H 3BN9D 4G8GA 2BMKA 3TYGL 1RUPL 4GRLB 1ZGLM 3JWOL 4P2RA 5D1QA 2VKWA 2NY5L 3P9LA 3HUJB 4NN5B 3S96A 1N6QH 1DBAL 5J06A 3BP4B 4HBCH 3NBNA 4LF3B 1OF2A 3MRBB 2HT2D 2BVUA 2AQ3A 3ORJA 1ZHKB 4NBYB 2VISA 2L0DA 4WUUB 3GO1H 3X17A 5E8EB 2R2EB 5IFJB 4IRJD 3C60D 5B21A 3DUSA 5IW6B 3VXUE 1XT5A 4U05A 1T1YB 2X70B 4XTRD 5ALCH 4WFEE 3CDGB 1T7VA 3HS0A 1AQKL 2FL5A 3ROLB 3SO5A 3FFDB 5JIHA 4ZYKB 1NKRA 2DQTL 2WUCH 4PR5B 3RL1B 5EU6D 2AK4E 3U9UB 1WBXB 4Y5VC 4G6KH 1I3RA 1OTUD 4KU1A 1GC1L 2A0LD 3LRSA 2CIIB 5EO1B 1CGTA 3HZVB 3C6SB 5B39B 3MZGB 2DLIA 3T3PF 1U36A 2ZJSH 3S4SG 4PJ9B 4Q9QL 4C57C 5D71L 4DOHE 4C56A 3EOTL 3QHFL 1R5WA 2BNQD 2YD1A 1H3GA 3G9AB 4L8BA 4XWGH 2ZOLA 5FYJE 2AEWA 4NCC1 4OV5A 5CHNB 3K8MA 4TQEL 2FWOB 1NFDB 2XT1B 2KDGA 2PF6A 4K7FA 5IUSA 1I85A 1MFEH 4WY7H 5EU4B 1ZWIA 3M17B 1RQ5A 1Y6KR 1M05A 3MV8B 1JF5A 1FFPB 2P47B 5J57B 2V5RA 3SHSA 4EDXB 4M6ML 4GKSA 5BVPL 3QEGL 1AE6L 3SE8H 4X80L 4EUPH 4XWOC 3RDTA 3RWCB 2O61A 1YYLH 4PREA 3BH8A 1NBYA 1EFXD 1FL5A 3BD5A 2JELL 4WW1A 4Z5RA 2FSEA 1KTDA 5HYFA 5DMKB 3W0WA 4ZD3L 3DI3B 3GZKA 4BUHA 4Y5VA 5DFVC 4NM4L 2ZUXA 3G6DH 1MRDH 1OARH 4PGEB 4JRWA 4GRWF 5F3HA 3O3BB 1RMFL 3ZKSD 4X7SH 2EIZA 4GW5B 4U33A 5I19L 5HVGB 1AGCB 4WTZG 4R8WH 5TDNA 1CICA 3C5SB 2Y72A 3IXAB 3K4ZA 1YY9C 2LE9A 1UEMA 3DUHA 1YY8B 3QQ3B 5B22A 5FM4A 4YFEA 3VXMD 2DICA 1S7XB 3ARDB 5JXAL 3PWNB 4G8EA 4NQEB 1UM4H 2DM3A 1CK0L 3WNNA 5E2WH 3LQAH 3LN4B 4DAGL 5F9AC 3L7FB 2NYYC 3JTSB 4JGJA 3HMXH 4QHMB 1MFNA 3T0EE 3K4AA 3E6HB 3MOAL 2HFTA 4XAKE 4C4KT 1GIGL 4YHPA 1QLRB 3MNWA 3EKCA 1OAYL 5J1TC 3CZFA 5INCB 4OLWL 1DLHA 4KMQA 4LSSH 5HI3C 2P8LB 2V7NB 1KELH 2A6DA 1U8LA 4AEHL 1NL0L 5LGJA 4ZFOB 3FB7B 5JTWA 1WWCA 3HMWL 3LKQA 4Y5XB 5JHDE 2PXYC 3D3VD 4M3KB 4KK5D 3FQNA 3U1SL 1G9NH 5KJRH 3DI2B 5T1DL 2EDWA 2NY7H 3BWAA 1NAMH 5KSBA 5TE4H 1JN6A 3OKDA 1AKJD 5KN5A 3T0XA 1VSCA 1RUAH 1U8HA 1JI1A 3QDGA 5KSAB 3HAEB 4X6BB 2RCSL 3TO4D 3EHBC 1KF9B 3ARFB 4ZPVA 3DPBA 1HK6A 2QKIA 4CL7A 5SWZE 4ODBD 3O4LD 1JNNH 1NGXB 3PGFH 2EC9T 3GMPA 2XN9D 3AU1A 3FO2A 1YA5A 3ULSB 3V6ZA 3AB0C 3T0BA 1HHHB 4XPAH 2JB5H 1F4WH 2B1AH 1SEQL 1CFBA 1ZHNA 1NDMA 3MXWH 1MLCA 4FZ8L 1RIUL 5BO1L 3RHWF 1AGBB 1H8OA 4P2QB 1UVQB 1EAPB 3D0LB 4LVNB 4PRDB 1AXSA 2XACC 5ABDE 1WZLA 1EBPA 1TJIH 1QSFE 1X5HA 2HKFL 5IVXF 3IAPA 1QBMH 1S7VA 4N0UA 4PG9B 2MQCA 3HRPA 3BH9B 3NIGF 3ZDXF 1QR1A 1R3KA 5FYLL 1U8PA 4OD1H 4I2XE 4YFLI 3W5MA 3L3JA 4G42A 1TETH 1YN6A 5D7IA 3S35X 5CEZE 3TCLA 2JK5B 4CVXB 4I9WD 1IEHA 2E9JA 1JV5A 4OI8A 3VI4E 3KLAB 3WE6A 1R3JA 1KN2L 1M6OB 3V4UL 2CRYA 4NC2B 1K8IB 4FXKA 3MRPB 1YUHA 4NN7C 2PTTA 2VR9A 3I6KA 1IT9H 3O6FD 5L2JA 1XF3B 3TESA 2YPLE 1T5WA 4KJYA 3OGCA 3PV7A 2GI7A 4KDVA 5IBUG 5TF1L 3SJVB 4WI6A 4TPRL 1NGYB 4OCSH 1SQ2N 3QDAA 1A3QA 1QP1A 1UG9A 4MDJA 5HYSB 1U58A 1G7LB 4RFNC 2W0LA 3VMPA 5DC4B 5JW5B 2Q76A 5FCUL 3QIBC 1F3DJ 2GTZA 4NRZB 3SKMB 4JZNA 1RULH 1KEGL 2VZTA 2QADC 3VE0B 4YQXH 4Z7QE 1IQWL 2F74B 4JM2F 5C08E 3P4NB 4GSDL 5E56A 5E94B 3CFEB 2EDYA 1F6AA 3BJLA 4AIXA 4XPTH 2IAMB 3RU8L 2DIBA 4LCCA 4XMKH 1G1YA 3I6LD 1CXFA 4BJLA 1BEYL 1S5IH 3V8CA 5LJYH 1P4LB 2D31B 5D4QA 2VDOH 5I17B 1D9KA 3B9DA 4MJ6A 4DZ8B 4GLRH 5TFSL 5DFTA 1CDYA 2MCG1 4POZC 3STZB 2VUYA 4QRQA 4KY1L 4B41A 3T1FB 3ULUL 2XZQL 4Z9KB 1A3LL 3WSQH 2AK1H 4OSUL 5EZIL 4LCUA 5JXED 4ACPA 2Y4SA 1S3KL 3B8SA 5HGDA 4DGVL 2AEPL 4J8RA 5EN2B 5HI4C 1ZLUK 3WEXA 3ULVF 4WV1A 1GGTA 4MD4B 1CZ8H 1I1YA 3GSRB 3FHQA 4PGCB 4F9LC 1KT2A 1R24B 4OF6A 5I75C 5E8PA 3VH8G 4GQPH 3I02A 1OPGH 1A2YA 2H3NB 3UPRB 5MEQB 1DBKH 1MCJA 2DTMH 3H9SB 2OK0L 1QUNA 2WMPA 4TUKL 1CFNA 4AG4L 3QULB 1RZJL 5L2KD 1CVSC 1MPAH 4RBPH 3U4BL 3HNTL 4WEBH 3RGVD 4E0RA 4LKCA 2JKXA 3WIHA 4YHOL 4AEFA 3F7PC 2P5WA 4IJ3B 4F7MB 4G9FE 4M93C 2I5YH 1DL7H 4P59H 4HWEH 2D2OA 1VFBB 1NMAL 3I6GA 4OFKA 3BKYH 3MYZA 3K46A 1MRCL 4RRPA 5EWIH 3BQUB 5K9QI 1IEBB 2CRIA 3SO3B 2FGWL 4M62H 2YBRB 2AV7A 2BVOA 2GK0B 4LSUL 4P3CH 4HKZA 1QVOA 4X5WB 3U6RA 1Q1JL 4I0PB 4BZ1L 1N4XH 1HHIB 2X10A 4YXLL 1YECL 3WIFB 1KLFA 4PRID 6FABH 5TE7H 1WAAE 5IJVB 2OTWB 1OAUH 2MQ0A 4F9LA 1JWSB 3L3DA 4K8RH 4DK3A 3RWJA 4PJ8C 4Q6IC 2BC4B 3KPSA 4HF5L 3DXAA 5BRZA 5C0NC 5DEZA 4EN3C 3CFIC 4QHUA 3EDJA 4JN2A 4U1LA 1FSKB 3KYKL 4NWUL 2R56L 1YNKL 3NTCH 1FHGA 5H8DA 5B4MD 2HFGL 5I1LA 4N90D 2BVTA 3DYPA 1CCZA 2R0LH 5GRUH 1X5XA 4HXAH 3RTQC 4PJBE 2X2YA 4WFGE 1ZGLB 2R4RH 1Z0MA 3MA7B 1VEMA 5LXGH 3C2SA 1G0DA 2Q8BH 1FNEA 4XB8A 5C09A 4JFQA 5DD0H 4PJFB 5EZLA 3OXSA 1JRHI 3VFVA 1Z0NA 3CX2A 2B0SH 4JM2D 4M5ZL 4GO6B 3M1BA 3LEVH 4HQQL 4N1CA 2H1PH 2X4NB 5KZCB 1C1EH 1UCTA 1B90A 4Q58C 2IG2H 1WZMA 2EEAA 4UB0L 3RKDC 2XZAH 4G8IB 4NZUL 4XP6L 4G6FD 5EUOF 2E5EA 3OKNB 4HBQA 2VDKH 1A6TA 4NRYA 4JANB 5ACZB 8FABB 3H9HA 3RWHB 4K2UH 1F8TL 3HI1A 3GIVB 4WFFE 5IB2A 4P2OB 1G7PB 2DS4A 5F7FA 3HLAB 4PJDB 1JHKH 1IGIL 1CFTB 1INQB 3B6SA 2RIKA 5DR5L 4EI5A 4L4JA 1PKQE 2ESVA 3QUKB 4Q6IA 3SCMD 1W0WA 3LRGA 1S9YA 3RKPA 5GGQL 5D2NC 2OR7A 5L9DL 1KB5L 4YPGB 3IVKA 4XNXH 4MXQC 4K7PY 1HSAA 3FT2A 2AXGB 3QFDA 3RTQA 1U8KA 4DUVA 5JDSB 2YA1A 1E4WH 3SDCD 5L88L 1HKLL 5FO9B 1HZHL 3LVEA 4LQFL 2VLJE 5EU3A 1F00I 4ISVB 4GW1B 1E4XI 2ICCA 2XICA 4U6VH 3ULVD 4ZNEA 4PJGE 4R7NA 2EDQA 1CTNA 5KVGH 4XNQA 1F4HA 1A3RL 1AJ7L 1AXTL 2Q7NA 4U1SA 3RPKA 4ZFZA 1KIRA 1PZ5A 2Y7QB 3LEXB 3HC4H 4JFYA 5CEYB 2JIXA 1EFQA 3IJHB 1TZHA 5A2LH 2P48B 4NSKB 2QQKL 5GRJH 3QA3A 4YK4C 2JB6A 4ERSH 3UBXG 1JFQH 2X4RB 5IB5A 1TENA 5H94B 3LV3B 3TCXA 2FYYB 4LLMB 4PRBA 1HWGB 3TT3H 4Z7WF 1I9JH 4MJIE 5BV7L 2ZCKL 1J0YA 2QQLL 1F90L 3MRCB 4NN6B 2PW1B 3ALXA 3O8XA 2CDEB 2Q3AA 4NGHH 1IM3A 4X6CF 1REIA 4KFZC 2QR0A 1SBSH 2OJZH 1V7ML 1INDL 2D9CA 4UTBH 3H3PL 1IC5H 2PO6D 3WN5B 3MV7A 3QEQB 1ETZA 1KTLB 4AJ0A 5I1AB 1KIQB 1EHAA 4FQXD 4NQXB 3WFHB 1XGYH 2R9HD 4TUOB 3MLYH 1F3JB 4Z7VE 4NQSB 3AUVA 1T1WB 3N06B 1P7QB 3CSYB 4DZBA 3HZYB 5EORH 1UACH 1G7IB 1FJ1B 4LIQH 3IKCB 3LY6A 4E42A 1A6ZA 1AD0B 1Z3GH 3N1GC 2JJSC 2EYSB 5BZWB 4U0RB 5HTSA 2B5IC 2GY5A 3V4PL 1LVEA 4ELMF 5IV2A 4I3RH 1QYGH 4FQPA 1MWAL 1MUJB 4HUWB 4JPVH 2HTLC 4GAJH 1NC2D 4MNGA 4HKXB 5ENWB 4MQXC 1JYWA 1PG7L 2BSRB 4PJHF 3O3DB 4OFYA 1ZLVK 1KTRL 1MHEA 2EDBA 3U79A 1ZHLA 4RWYH 1KG0B 4QRRD 1CD0A 4OLEA 1J0JA 5I66B 4XP9H 4HJJH 2NX5E 4Q0XH 2VAAB 3RWIA 4JFOB 2AJSL 2BRQA 4JFED 1OAQH 4P57A 2EC8A 1YEGL 1B88A 3L1OH 4WHCA 2EH7H 1GJIA 2YD8A 1MIMH 1S9VB 4Y88A 2NXYB 1QO3B 4UV7L 3T8XB 4PTTB 3E3QC 1NAKH 4OCWH 4PLNC 5I15L 1RVFH 1FNSL 3FONB 3TP4A 1T1XA 4OZIE 4IS6B 5K9OA 3PL6D 3AS3A 4N8PA 1QHOA 3QO0B 5L6YH 3V6FB 3BVNB 3PHQB 2DM2A 1NGWA 4PJXE 4OF3A 3PWPD 3H7BB 4HCRL 1VFUA 4NKIL 4Q9CA 3ZSSA 4F37K 3CXHK 5MERB 4PJ7B 3EBAA 3TVMB 4HIIB 1V3LA 5AEAA 3BGMA 2BOCA 1ZT4B 1A4KB 4RGMC 4P3WA 5EBLB 4WVRA 2EIEA 4QXUH 5FGRA 3WO3B 5DMIL 3KXFB 1FGVL 3KJ4C 5JQ6L 2X9XA 2DQFA 4EQ2A 4PJEB 4IHOA 2QSCH 1FH5H 5FIEA 1IKNA 3OB8A 3QUYD 4OD3H 3BISA 5DUPL 1DUYA 2ZZUT 5F71A 4YO0A 1QZ1A 3H42L 2ICEB 3OBAA 5BW7A 1ND0A 1L9MA 2YA2A 4FHBD 3KPOB 3O2DA 4BSWB 5C86A 2ADJB 4Y16C 5I2IA 1YPZA 2G5BA 3D25B 4IRSC 1DQML 4JFPB 3SDAC 1H8NA 3CLFH 4ZXBB 3VWJB 3W2DH 1QSED 1OW0C 3E8UL 1N5AB 3CFDB 4DUWA 2YD3A 1RURL 2EDNA 3QT2A 4FFYH 5CP3H 5ACMA 4ZUUA 4BK5A 3PWVB 3WS3A 4K71B 1H3WM 3HE7B 2DQHL 3D69B 3LQZB 4OV6F 5I76B 4L4TA 5IFHL 1TITA 2HH0H 4KVNL 3JV0A 2GSIA 2AJ3A 4CUCA 2NY4D 2VWEC 3KPRB 3QEHA 1ZLSL 2XG4A 3OG6B 5E99L 2YEZB 4GAGL 3RWEA 1ZK9A 3QUML 4FQHA 5M95B 2DQDL 4YFDB 3V9FA 2VDNH 3B9VA 3GJFH 4L9DA 4EI6A 5ITFA 5E4EB 3S8WA 4NM8H 3MMEB 1LDSA 3EOBA 1NGZB 2GT9B 5A2IH 5D72L 3EYVA 3HUJF 4N0FA 1ZVSA 3L5JA 4JRYB 3QWQB 4WHYH 2XIDA 5SWSB 4PRNB 5DDHA 1V05A 4P49A 1FORH 1LEIA 5EBWA 1OHQA 1XGRB 2OSLA 4J4PC 3B3IB 4YUEH 3QRFM 4QCIB 5GJTL 5DSCB 4G7VH 4JZJC 1ORSB 4X7EC 3FFCE 4CMMB 1FV1A 2DIAA 4M4PA 4GQ9L 2R23B 3BZEB 2E8ZA 4J6RL 4R96B 1RIVH 4W6XB 3MV11 3DMMB 3ALPA 3MBXH 1X5GA 3NCEB 2CLRB 3DBXA 4MQ7A 2FEDD 2CGRL 1AO7D 3HG1B 1CLZL 2UYLA 3LKSA 3IS0X 3MRHA 4LLVA 4H0GA 3HTLX 5DD1H 4HAGA 3RAJL 1T03L 1FFRA 5DK2A 3SKUD 2HLAA 3LCYA 3U4EA 4W4OC 1S5HB 2C3XA 4FTVA 4PBWD 3VD3A 1DEEB 1MHCA 2GJ6A 4AH2A 3LKRA 4LCIH 3PGDB 5I9QC 4G8GB 2BMKB 3C8DA 5F7YC 4P2RB 4JFFA 2IQ9L 1YYMH 4U1NA 5D1QB 3TJEL 4EIZC 3U48A 4NCC2 5DRXB 3S96B 3LMJH 1T89C 4HDIA 2Y25A 1YEDA 1OF2B 3CDCA 4KROB 5CZVL 5IW1A 2YC1A 1O5DT 1YNLH 1FL6A 7FABH 1I3GH 2VISB 4JG1H 4J4PA 3R8BB 1P69B 5C07D 1MRFH 3QDHA 4FOMA 2WBKA 1SY6A 1T0PB 4PS4H 3BEWB 4KH2A 1XGUA 2EC9U 2IPUG 2NZ9C 5HHMD 2R15A 3QP3A 1F5WA 2EECA 4OUUA 1EJOL 3HS0B 2FL5B 4OCYH 2CKNA 3FO9A 4I18C 5I8OL 3U0WL 1IBGL 4A2MA 1I3RB 2EDKA 3T77A 1FRGH 1YQVL 4IDLA 3GB7A 3QO1A 4XZUA 4I3GA 4LCYA 3CVIH 2XQBH 3PHOA 4J3OC 1UM5H 3D39E 4W4OA 4YDLB 1BD2A 3BPCA 4YGVA 3VFSB 4XXCA 3DOSA 5TE6H 4LHUG 3O9WA 4C56B 4LRIA 5IBLD 3CSGA 4DW2H 1R5WB 4YXKH 1MFCL 2ZOLB 1CQYA 3EAKA 3P30L 4OV5B 3HN3A 2FJGA 4M02A 5C0CE 3MCLH 4JE4B 4JREB 1TVDA 1SHMA 1AR1C 1ZWIB 1M05B 3OAZK 3IDXH 3LEYL 3BMVA 5C0IA 4GKSB 5D5ME 1FAIL 4NHCL 2XA8H 3NABL 1UQSA 3PXJA 4NZDA 1JI2A 4PBXA 1L0XA 5DQDH 4PREB 3BH8B 4P9MH 4KJQD 4GRLD 5A43C 4WW1B 1JK8A 3T0WA 1U3HA 3ARZA 3LN9A 4Z5RB 2FSEB 3JXAA 2CMRL 5DRZA 1NCWH 4OAWA 3W0WB 3WHE0 4FQQA 1JWUA 3WKMH 1T0MA 4Y5VB 2Y23A 5F1NA 4HJ0C 2FZ3A 1J10A 3I50H 5J89A 3BPLB 3RVTC 1KCRL 1XFPA 2PR4L 5F3HB 4HIXH 2CKBL 4WUUD 4LIQE 4O5LH 4G8FB 3WHXB 3HE6D 5TDNB 1CICB 2EE9A 4QGYA 4GMSH 1UB5A 1JJUA 2AXJA 3DHMA 2VH5H 3VXUA 1LDPH 2JCCB 2IPUK 1D5BA 3QCVL 2ZUQC 3ILPB 2FHFA 3KPLA 1L6ZA 2X1OA 4FFVD 1CE6A 4LASL 5HHQA 5I73C 5ETUB 2AK4A 4G8EB 4PRPE 3P4MA 5HHPA 5A3IC 4XX1G 4ZUWA 5A16A 4MHHI 1AGFB 2RQ8A 2A1WH 3O6LL 1FZJB 4UNTA 4P23A 1KGCE 4UTAH 4KTEH 3MNWB 4LGPB 1F4XH 5E5UB 3PWJA 1D7FA 4LSVL 4YHIA 1DLHB 4NP4L 3ET9F 2W9EH 5HYJD 2A6DB 1U8LB 1MCPH 5LGJB 1Z5LA 3KYAA 1T20A 3LKQB 4LP4A 4YH6A 3VXPA 4LPXA 1VFAA 2BNRE 3P4LA 3TN0C 5ANME 5D93C 1CGSL 1NFDE 3EYUH 3BWAB 3MV8D 5E1AB 2ZWLT 1LO0L 5EDXA 3EOYG 5KSBB 3VXTA 3AAZA 3OKDB 3T0EC 4ZO8A 5KN5B 2Y6SD 4EEEA 1KSRA 5D1XD 4JQVC 1S7TB 1U8HB 3EOAB 3KPMA 2DKMA 3QDGB 2CSPA 1AC0A 1QRND 1MHPH 5HDBF 3PNWB 3P9WB 2J6EA 1R0AL 3X14B 4GG6B 4ZPVB 2ADGA 4EOWH 2QKIB 3GHEL 4OQTH 4KJWD 4GS7C 4K3EH 3AU1B 3FO2B 3V6ZB 2DN7A 1NFIA 4KK8D 2ED9A 5ICYB 1A9EA 5B8CC 3RWFA 4AEEA 1WV7T 2OP4L 5C0BD 4LOUC 3T3MF 5HBBA 5JOFB 1RK0A 1T2XA 4Y2DC 1WWAX 4JR9L 4ALAL 1ZHNB 5FYJU 1NDMB 3BO8A 3TFKC 1KLUA 5CAYB 3VDBA 5IMKA 1MCNA 2KH2B 3ARGD 3I9GL 4P99A 4FRWA 1AXSB 4XCYA 3OGOE 3RA7L 3BW9B 1A1MA 3BMWA 4KV5E 4RA3A 4KKBC 5D6CA 5LGHL 2PXYB 1S7VB 3TN0A 5CP7A 4NQED 4LHQB 3VFGH 3BUYB 1QR1B 1R3KB 4HSQA 1U8PB 3UYRH 3D2UA 4KZDH 1AY1L 4PY7A 4OGXH 3L3JB 4G42B 2IANB 5D7IB 5CJQL 3TCLB 4MSWA 1JZ5A 5I74B 3QNZA 2P24A 1EHLH 3WFDL 3PF2A 1JV5B 1XZ0A 1R3JB 3GNML 4FXKB 1YUHB 3I6KB 1CFVH 2P45B 1HXYA 3EO1A 5EA0L 5L2JB 2A73A 3C09C 1T5WB 3OGCB 4NRXA 2AXFA 3QBTB 4JZOA 1RY7B 5JHDA 3AB0B 3RIFK 5DI8A 1GHFH 4OCRH 1JMXA 1XGQA 3VGHA 4MDJB 4ODTH 1DQQB 3O0RL 4B7LA 4AEIL 1P4BH 3M8OH 2Q76B 1BF8A 2GTZB 1X5KA 5HVHC 4JZNB 2Z31D 3HFML 5KSAD 4I13B 1EV2E 4S1DD 3O6ML 1CE1H 3ARFD 5F7UA 3V7MA 4Y4FD 3IT8D 1RZIA 5GSVA 4KAQH 1B0RA 1DQJA 1QFPA 3DX8A 5L0QC 4QXWA 5T3ZL 1C7TA 3ARTA 5JLZA 2J8HA 5J56B 3K2MC 4MXVF 1MEXL 1EO7A 1MCSA 4XI5D 2BFVL 4MD5A 5D6DA 1BECA 2R69L 2XKUA 4LCCB 1UWEL 3U36A 4N5ED 4ZS7H 4NZRH 2JJUA 1QNZH 1D3CA 4LCWA 5AG8A 3OKOA 2YUWA 1OTTC 3OAUL 4MJ6B 3IJYB 2YN5A 3NIFE 4PBVC 4TSCH 5D1ZC 5FUCE 5ADPH 1AP2A 1D5XB 5DJDA 3JZ7A 4NN7B 5DO2C 3VXRD 4GKOA 4RGND 1KJ3H 1C7SA 4QRQB 4QY8B 2PCPA 3V5DB 2F54B 1RJLB 5HGAA 2VXUL 3SGDH 1FCGA 3ETBF 4MNQD 4RFNB 5CD5C 4I2XA 5HGDB 4JY4A 4J8RB 1WIPA 1DEDA 4QNPF 2QADB 3WEXB 4WV1B 3U7YL 1WFUA 2OI9C 1I1YB 3DV6A 4Y4KC 1MH5A 1P4IL 3WLWC 4F7CA 1KT2B 5E8PB 4NJAH 2FX8L 4ZMAT 3I02B 4YC2C 3GKWH 3S98A 2YPLA 2NY2B 3QWRD 1D6VH 4HWBA 3V95A 3VXQA 1CFNB 3QPXH 3VXME 3ZL4H 4ZFFA 1UZ8A 4E0RB 4LKCB 3BP7A 2MMXA 1CLCA 2P5WB 1OP3H 1IKFH 5ACLA 2AEIT 1NMBL 3EYQC 3ULUF 4GJTB 3FMGL 5C7XH 3I6GB 4BQCA 5HHOD 5D1ZA 1NCCH 1KN4L 5C08A 4EUPG 1UWGH 2BY2A 3O6KL 4HS8L 4FMKA 4R0LC 4R2GB 4U1HA 5DRWB 2BVOB 2IAMD 3ZE0F 2W0PA 4HKZB 2GCYB 1QVOB 5F88B 3U6RB 4Z8FH 2EXYD 1MI5D 1CLOH 5J1AA 3UTTA 1E4KA 1CXKA 3BFOA 5IHZA 2ZUWA 3BKML 1OWWA 1N6VA 4LPWA 2Q6WA 1JPSL 3G04A 3VXSD 5I75B 3L3DB 5KVFL 4NNXA 1K6QH 4BZ2L 3RWJB 2I26N 3ARUA 5CUSL 3PP4L 3KPSB 4JVPA 3GSWA 2UWEA 4LDEB 5BRZB 2W65A 5IWLA 3OJDA 4QHUB 4OZFH 3O4LE 2B4CH 2FHBA 4GKNA 4JN2B 2PYFA 2Z35B 1L0QA 3GSNH 4JKKA 1AR2A 4M6OL 2KZ1B 4GXUM 3W81A 3CC5A 4OLUH 5I1LB 4IM8A 4POUB 5M7QA 5CZXD 3LS5H 3WJLA 1W72L 1XGPA 3RL2A 4M93B 1PJ9A 5BZDA 1LO4L 3TH3T 1QKZL 1TNMA 3NN8A 5C09B 2ILLA 4JFQB 1DBMH 3T3PE 5EZLB 3OXSB 5E6YA 3VFVB 4Y19E 5FYLD 4Y0GA 1E0OB 3WO4C 4NJ9L 2GJJA 1LHZA 3M1BB 3W9EA 1N8ZA 3QDJD 5B3JF 3O2VH 1I1CA 5DD5L 5B38G 5E03A 1UB6B 1L7IL 2H2PD 2X89A 1MCFA 3FT4A 3TWCH 1KCVH 2VZ3A 1AFVH 5DJCB 1Q8MA 1JHTA 1A6TB 1P1ZA 1XCQA 2ZKHH 4NRYB 1GXEA 2XTJB 4JY5L 3H9HB 4HXBH 1L4IA 3GI8H 5L8KB 3HI1B 4G9FA 5LG1A 3DRQA 1QACA 2DJSA 4EI5B 4I9WE 1BQUA 4GBXA 2ESVB 5DZNA 4Q6IB 1OP5K 3CJJA 4FS0A 1RJCA 3BQUD 1W0WB 2AERT 5I18L 3MBED 3QAZB 4JQXC 2CD0A 1S9YB 3P2TA 3V8OA 3GIZH 4J7RA 3B5TA 1AXIB 3IVKB 3LQAC 1FQ9C 1HSAB 3FT2B 4I0PD 3QFDB 4JM4H 1U8KB 4O02L 3RTQB 4YHKH 4FP8L 4XRCA 1NCUA 1CGWA 1CL7H 5EU3B 4EUPA 2CO7B 3ZTJG 1WAAA 1TZIA 3ZYJA 6CGTA 5KW9H 5GHWH 2UUDH 4R7NB 1RK1A 4MS8C 1B2WL 1IC1A 2VXQL 4D0CA 4XNQB 3QIUC 3BPOB 1H5BA 3C6LA 3IFPA 4UIMA 3MLSH 3GM0A 1KPUA 4U1SB 5GGTL 4ZFZB 1KIRB 1PZ5B 3QHZL 1LK3H 4O2FA 1PAMA 1BBDH 1VEPA 4GLRI 4M5YH 3BZFA 2JIXB 4NPYA 1X4XA 4QRTA 1TZGH 4ZUVA 2ZG2A 3P11L 1TZHB 3CH8A 3VDAA 1CT8A 3QA3B 4OCMC 4ENEC 2JB6B 1NLBH 3MXVL 4LHJB 5FK9A 1JP5A 3ULUD 4P2CG 3MRJA 5IB5B 1J1OL 2XZCL 3VWKC 2XNAA 5CGTA 3OKYA 4XVJL 2XA3A 4PRBB 4OGAD 4JQXA 4D94A 3TF7C 5KZCD 1W72B 4MAYC 5J3HC 1U8JA 2Q86A 5HHVL 4PV9A 3O8XB 2IH3A 1PLGL 1IM3B 1Z9LA 1YZZA 3FO0H 5JIPA 2EKSA 3HMXA 1JTTA