2N56A

Ig59 domain of human obscurin a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
104
structure length
104
Chain Sequence
WRLEILELLKNAAVRAGAQACFTCTLSEAVPVGEASWYINGAAVQPDDSDWTVTADGSHHALLLRSAQPHHAGEVTFACRDAVASARLTVLGLPDGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and characterization of disease-causing obscurin mutations
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Obscurin
total genus 9
structure length 104
sequence length 104
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2n56A00
1PDKA 3KPMA 4PB0H 3WKNA 5TE6L 1Z9LA 2C7UA 3ECBA 4QXTA 1BHGA 4P2OB 2RQ8A 2QHLA 1FSKB 4N8VG 5C0IB 5HI5C 1GGIH 1HHHA 3ULUD 1NC2D 2YA1A 2XN9E 2FDBP 1DBJL 2XWBA 4NKDA 5EZJB 5DK2B 1FV1A 4NBYB 2BDNL 2Y25A 3KAAA 5KS9A 5L9DL 1BQSA 3C5SB 5DJXA 5KZCD 3KVQA 3OX8A 1VEMA 2BNRB 1F6AB 4I0PC 4OT1L 1L0XA 5EOCH 2VAAA 1AGDA 2CDFB 4M6OH 5E8PA 3QPXH 4OCRH 3QIUC 4F37F 4G5ZL 1M7IA 3IJYB 5DGRA 1G7HA 5I2IB 4LVNB 4ZQKA 3GHEH 4AM0B 3TIDA 3NIDF 4QTHB 2MQCA 4JPWL 3MCKA 1QNZH 1QFPA 2CSPA 3O4OC 1OT1A 3QAZB 2IAMA 5IESH 1NCDL 1MHCA 3BP7A 2BVPA 1K9TA 1EVUA 2FX9H 4LIQE 3L6FA 5FB8A 1Q0XH 3FAWA 2OBGA 3MOBL 1I4FB 1IAKB 1T1XA 2FIKA 1DQTA 5JOPE 3R06A 1MCBA 3G6AA 2ARJQ 3V0WH 2XRAH 3MGTB 4P2CG 4WUUA 5GIRB 4ZSOB 3DGGB 3MRKA 4PJEB 4QHMB 1F58H 3RPKA 4P3DB 4YO0B 4OZHA 3WD5H 4NZTH 1SVCP 1T2JA 4PRPE 1FBIL 4UU9B 1LE9B 1PQZA 5LJYH 4Z77A 1PX4A 4PJIB 5IVZA 3DV4B 4HPYH 2ORBL 4NPYA 4TRPH 1T04A 1CCZA 4H0HB 3FL7A 1S7UA 3DYPA 3MLYH 1JBJA 2A9NL 3ZYZA 1RUAL 4V1DA 2O61A 4D0CA 1FO0H 1HXYA 1LO3H 1TDQA 2GSIB 3MX0A 4AEIH 2EH8H 4U1KB 2FATH 2XIDA 1FVDB 4FTVB 5F9DC 4XVJH 2B1AH 5C2UB 2WBJC 3SGEI 3ELAT 4ZUVB 2CLVA 4HC1A 4WW2A 2FB4L 3VD9A 1LK2B 4QOKD 4H1LG 4ZUWA 4BH7B 4XBGA 3D0LA 5KVFH 2CUHA 1NUDA 4XNXH 5ESVA 2B7DT 1GVIA 5JZ7C 3R0NA 4YE4L 5LQBH 1TTFA 2PTVA 1IM3A 5AZEH 3QUMH 3LH2H 4B53A 1J12A 3MGOA 3S7GA 1XGPB 3NCFB 1QSFA 1A6UL 1ZS8B 1F3JA 1H3PH 4F7EA 3N1MC 3Q5OA 4OLYL 2HG5A 5D7SL 5F96H 4W6YB 2AXHA 4JRYD 4MA3B 2L7UA 2I07A 2H3NA 1FVEA 4UUJB 2H2SC 2OYPA 4PGJA 1CLOH 4GS7C 2ADGA 1VPOH 5CUSH 1BVLA 4CMMA 3W81A 3DVGA 1SEQH 2DM7A 1HQRA 2FX7H 2GSGB 5GGTL 4Z7QE 1I8LA 2DM2A 1KB9J 2G5RA 4O02L 1K3ZA 1QEWB 3CFCL 1NCAL 2VXUL 4XMKL 3MGAA 5F8QC 2AK4B 1UM5L 3L1OL 2FJFB 5KAQG 1D5BA 4PS4L 4E41A 5CBEB 4XPTH 3MXWH 4NZTL 4WI9A 4M8QB 1FFNA 4OM1L 4E5XB 1B4RA 5ACZB 3JTSA 4WUKH 4S1DC 3SJVE 1A7NH 1JGEA 1IEAA 4IOFD 3QDJA 5JA9A 2DYPD 4JZNA 3DUHA 3MACH 2J6EL 2XA8H 3O6MH 2R4SH 1Y6MR 3FOMB 3NFSL 5BO1L 3RTQB 3OKLA 2W59A 2APWA 1UM4H 3TBTB 2QHRL 2DRUA 3BGFB 1C7SA 4UT6L 1WZ1L 1FFPB 1FZOB 4YWGL 2VRAA 1KJ3H 1C5CH 1D5MA 5AG9A 3SGDH 3V7AG 3DETD 2ED8A 1DE4B 2A6IA 4WU5B 5LWYH 4TPRH 2P8PB 2PW1B 4J7RA 4ORGB 1GL4B 2OTWA 3S35X 3W0WB 4LEXL 4E5XA 1JUFB 2XQBH 1RJCA 3VGEA 4YH6A 3GSNL 3IDGB 1UACL 3CZJA 1O7SA 1C08B 4J3XA 4Z7WE 2R2EB 4ENEC 1QOKA 1I3GH 4JM2D 3HC0B 1UB5A 2EDTA 2F58L 4ZSOE 2E8ZA 1JF1B 5FV2A 4KK9D 4PGEA 3IU3B 1GHFL 3MBEA 4LHUB 4NQCE 4M93C 1WSST 1AQKL 1FZJA 1MWAH 1M7DA 1Q9LA 3P4NA 4NQTA 1F97A 1MJ8H 4EIZC 1KEML 4X0KA 4XB7A 3GEWB 1U8MB 3CVIL 2RCSL 5EZIH 2D0GA 4FQ2H 5CJXC 3IDYC 5EN2A 5C92A 3MFFA 4LVOB 2B4CL 1Q0YH 4MDJA 1I7TB 1T7VA 5TQ0L 1FZKA 5IV2B 3QDHA 3G08B 4XC1L 1JYXA 4Z7UB 3VD7A 4OLUH 3KLHC 1FAKT 1FLRL 5DTFA 4HK3N 5SWZD 2VIRA 1WCQA 3EYSL 4OZFH 3MLVL 1LILA 4IDJL 1YNTA 1WC7B 3DV6A 3SE9H 5H94A 4PR5A 1CICA 1TPXC 5CJOH 1DUZA 2BC4B 1NFDA 2ZCKH 4GBXC 1AR1D 2KL6A 5J1TC 3RWFB 1SEBA 2B1HL 3W11C 4HXBL 5BMFL 1DN0A 3EYFA 4RA3A 1ACZA 1JGLH 5LBSL 3F62A 3F58H 1K8DA 4K9EH 4NWTH 4O5LH 3GMQB 4JO3H 5I1IH 4PLJD 1HN1A 4B50A 1GAFL 2IJ0C 1PKOA 1BD2A 3C6SA 3QXDA 1EGJL 2GTWB 3X3GH 5IHLB 2RFXA 1YJDH 2NXYD 4NRXA 1KC5L 1T1ZA 3TZVD 1OL0A 1YEHH 1KENH 1JHTB 4AL8L 1KB5L 3MRRA 2V2WB 3FN3A 2H9GB 3L3IB 4P9HL 1KBGL 2YD8A 3FHAA 2H2SD 3V6FA 3MUGA 3MUGB 1SMOA 2FR4A 1Y6KR 1FAIH 3PGDB 3NOIA 5C0GB 1XF4B 3MRRB 3QIUA 3D69B 2OTUA 5HGHB 1RUKH 1HHIB 1AI1L 4YHLH 5BMFH 4GOSA 4LKXB 2CK0L 3MBXH 2F74A 4ODUB 4ZSOA 1CFQA 4BH8A 2RBLA 1OF2B 3TCLB 2DQHH 5IKCB 5IG7A 4MNHA 4BQ6A 1JHLL 5I75B 4Q9QL 5I66A 4V1DE 3BKCL 4EN3A 3LB6C 4N8VA 4QYOB 1DN0B 1V8HA 1BFOA 3OHXB 4LPVA 1MEXL 3WO4B 5F89B 4CU6A 1QA9A 3QCTL 5GGSB 4KPHH 1WF5A 4OI9A 2P8LB 3NTCL 4XWGL 1UFUA 2NYYD 4L8SC 5CZVH 4PJAF 1Q0YL 2EKSA 2AJ3A 3KPNA 4HCRL 5TQ0H 3BP4B 4DJMA 2EIZB 3BPNC 4Y1AE 2Y5TB 3HG1E 1U8HA 2EXYC 4WU7A 3OKNA 4NT6A 2VAAB 1YN7A 3KGRA 5EO9B 5BS0E 2PXYB 2WINB 2CIIA 4HSQA 3GSRA 4LDLB 2C1OB 2DQCH 3VFPA 4KV5E 3VI4F 4OUOA 5DMGD 4WY7H 4DKAA 4JVWA 4QRRD 5IT2L 1AR1C 4LSPL 4QY8B 12E8L 2DQUL 3DO3A 3ZMRA 2O5YH 5CJOL 4OF7A 1SJEA 4IOIA 1IQDA 5EBMB 2CUMA 5KVDL 1FG2A 1L9NA 4OQTH 4BQCA 4BUGA 1BGXL 2JJTA 3SDCD 5E1AA 3SGJC 4BSVA 5F1NB 1U8JB 1J05B 4UNUA 4CGTA 2R2HA 5FM5M 4J2XA 4X4ME 5CILH 4ELMB 4HH9A 4KQ3H 4FZ8H 2PYFA 5C7XL 4TSBH 1FL5A 3GHBH 4F9LC 4LF3B 5CFHA 3O4LE 3TZVC 4G6JH 1A3RH 3FCTB 3X12B 3QCVL 4WW2C 3RDTD 1BFVL 5DD1L 3TVMA 1DP0A 4JN2B 4PP1C 4OLVH 2EKJA 4Z0XB 4F80A 3BPOB 5E1HB 5HI3C 5HVHB 3RKPA 4AMKH 2Q6WB 3WO3B 2FEDC 5DXWA 3SJVA 4XXCA 4JN2A 3I2CL 1K4CB 4I13B 1LDPH 4NOBA 4WFHE 1NC2B 3OKDA 3X12A 3UTSA 4PTTB 1G0YR 5FA3B 1DQQA 1F4WH 1F11B 3RJQB 3T1WA 7FABH 3HHRB 1NEZB 3BW9A 1J05A 3IU4L 5F1NA 3BESR 3T0EE 4PJFE 5C0BE 2MNUA 2LU4A 2HJFB 4KRPD 1EERB 1HDMA 1GYAA 3OR7A 4YUEL 2PUQT 3WN5B 3EYVA 5MEQA 4Y5YA 3O2VH 3EYUL 3DRTA 1A1NB 5FYKL 5SV3A 1OHQA 3CLFL 3AXLB 2UUDH 4DN4H 3SDAB 2FHCA 3QFJA 1D9KB 3RFZC 5BO1H 3BIBX 1X6NA 4BZ2H 4N90E 3JV6A 3PGFH 2WQ8A 2A83B 3QDMA 5DMGC 4TUJB 2Y5TA 5FYJD 4RDQF 3F7YB 3MJGX 4H0IA 3QIWC 1N7ML 3QI9B 4HLJA 4PRBA 3S88L 2X4PB 5I76A 1I8LC 4GKNA 2E6PA 2FWOA 1JFQH 3SQBA 1R3JB 2YK1L 3MRMA 1A4JB 4X4YB 1OGTB 4OSUH 4DKEL 3JV6B 4DUXA 3ARVA 1T0NB 1TVHA 2XICA 3S4SG 4RGMB 3QEQB 8CGTA 1OF2A 3VXSB 1EEZB 3ARFC 3UTQB 3SCMA 3CH8A 5DS8A 3P11L 5CBAB 2Q8AL 1YJDC 4HXAL 2P5WE 2XI9A 3MJ9A 4DVBA 1M71B 3UYOD 4Y2DD 1TQBC 1VFBA 1S7SA 5IBLC 5JHDA 3DXAD 2MCPL 3SDXF 4RZCB 3ZLQC 1PYWA 3I2CH 1YEJL 5AZEL 3TFKC 2AV1A 4NC1E 4Y4KC 3UDWA 3UTTA 2E7BA 1Y6NR 4PJBA 4RAUB 3MXVL 4RBPH 1YEFL 4LSVL 3DXAA 4RWYL 2R2CA 3GSOA 4RRPA 1T03L 2YMXH 4KRPC 4BK4A 1C1EL 1I9EA 4MJID 2J2ZA 1AQDB 3Q6GL 4X5LA 3GRWH 5ISZD 1NLDL 2X42A 5HVFB 5DUBB 3VXUA 2HJLA 1S78C 3RVUD 3CFKA 5FO9A 3GUTB 1DQMH 2DDQL 3B9VA 5D2NC 1UJ3B 4PLOB 3KPSD 1ZLWH 3VGGA 3TVMB 1RUMH 2J3SA 4Y1AB 4HKBA 2W0KA 3MGTA 1F02I 2FX8H 1W0YT 5D6CB 3R0MA 2D03H 4XZUA 2DWDB 1SYVB 2F58H 4KQ4H 1J8HD 4MNQD 2YD9A 4HH9B 4XCFH 4DAGL 4TUKH 1XH3B 1BLNA 3TIEA 2ADIA 2ZUYA 3S34L 5HD8C 2P46B 3PABB 4ODXB 4QLRA 4N90D 5JR1H 1ONQA 3CCHB 4JCMA 3EFDL 2YPKB 1BAFL 2R4SL 1OARL 4IRSC 4YHIA 3RHWK 5FYKE 4NM4H 4YFLI 1WK0A 2VDOH 1CIDA 4YR6A 3HZMB 4BQ8A 3P4OB 4QRQB 1CE6A 3D2UD 4QRQA 4D94A 4NT6B 3V0WL 1EEYA 5I1DB 3HG1A 2X4UA 1NMAL 1EH9A 3HC0A 3VJ6A 4AG4L 4DWHA 3D25A 1IRAY 4G80A 4UV4L 2OL3A 5IIEB 1A0QL 4HKJA 5JW3H 1T83A 2HJFA 1BOGB 1EEQA 3MO1B 1Z3GH 4TVSa 1NGQL 2C7UB 4QRPE 1Y18B 4U6TA 4NO0B 3KPTA 1DBBL 1BFOB 4EIGB 2AQ3A 5DRNB 4O9HL 3ARRA 1ES0B 3CMGA 4X9HA 1CU4L 1X5IA 1RIHL 1NSNH 2APVA 2IADA 4G9DB 1OLLA 4PY8I 4ZUUB 5JNYA 3U30C 4NNXA 5AAMA 2X4TA 5I8EA 4XP9H 3BX7C 1A6WH 1FORL 1PLGH 4UNVA 3S35L 5IFHH 4WW1B 3MROB 1QNZL 4KMTH 1YEFH 4XVSL 2MQ3A 4JZJC 1I8MB 4Y16A 2FH6A 4FMKA 3DXAE 4XT1C 1XF3A 5IJVA 4GSDH 1INEH 3V6ZB 1GIGL 1KBGH 4JFHD 3RUGA 4Z7OE 2VWEE 2P24A 3TT3L 5JOFB 3RWDB 1KPVA 1RPQA 3LN4B 1YYML 1QUNA 4MXVF 4H88H 2A9MH 3FCTA 2VYRE 3FO0H 5FXCH 3B2UD 4LLYA 3KPLA 3BGFC 5IB1B 4RGNB 5E2VL 1DQDL 1S7SB 3T0DA 3GMMA 5IQ9B 3NFNB 5BXFB 4TRPL 2EECA 4MQXD 4K3JL 1OAQH 3EDJA 5DJ8A 2X1XR 1VGEL 3JUZA 3HUJA 3T2QA 1ETZA 2OZ4H 4DFHA 5EPMB 5IHUH 1YNTB 3DV6B 1Q9KA 3SBWC 1EXUA 4I77L 2WAHA 3F12B 3HI6H 3HUJF 1SBBA 1YEKH 2AJXL 4RMTA 3W9DA 1NLBL 3RY6A 5FGCE 5CHNB 3DOSA 4I48B 3GRWL 5ECJE 5C0CA 4WI8A 4Z7UA 5BRZE 4ONOA 3UJTH 4L8SB 4KDWA 4V1DD 4MAUL 5I1EH 2YRLA 5H37H 3BRDA 3L1OH 3NCBB 1B2WL 4PRBB 4KRNA 1YPZF 1MH5A 3LEVH 5GGSA 4CN6A 5CIPB 4WWKA 4XPFL 5TE4H 3SHSA 4XCYB 1FGVH 1HWGB 1QQDB 1FZJB 4GKSB 4EKXA 2B0SH 4MJ6A 4MSWA 2BHUA 4YIQB 4HW6A 3O2WL 3CSYA 4L1HA 1P6AB 3GNMH 5DJAB 2GHWB 4DKFH 4ODVH 4YDKL 1JHLH 3AREA 4D0CB 1U58A 3LEXB 1U91A 1WFNA 3VXRD 1AD0B 3JWOL 3VWJA 1C5BL 4JG1L 3PWPD 1MJUH 2AABL 1RZ7H 1TETL 4D2NA 5FK9B 4R8WL 4PJDE 3LB6D 4U05A 4TPRL 2XG5A 3TA3C 1AD9B 5KZCB 5LCVH 5A2KH 1FCCA 3A6CL 5EU3A 5AZ2L 1XF3B 5IJVB 3RIFK 4F2MB 1KIUA 4WHYG 5CP3A 5C70A 4LPTA 5D5MA 5E99L 4UV4H 1ZT7B 5D7JD 2JB5L 4P3DA 4YO0A 1A6TA 2IFGA 3TVMD 2OL3L 5I0DA 2Q7NA 1B88A 4ONHB 1NMAH 1BD2B 3C6SB 5E5MA 3KPSE 3O4LD 1TFHA 1A7NL 2WWMD 5FKPA 4NNPL 4CAGA 1K8DB 4C55A 3U2SB 4HS6A 3O2DA 3U6RB 5B8CA 3ILPA 4U1JB 5ESQA 3WNLA 2P8MB 1PG7X 3BAEH 4DKDC 4KMLB 2R15A 3VFRA 5HHMD 5E4EC 2AVGA 1RIHH 3QXVA 4HKJB 1KCUH 3QDGD 1D7FA 2XQYK 4HX1B 1T4KA 1N2RB 2MKWA 3D2UB 1A1MA 1B3JA 1IARB 1WBZB 2XXMB 4HIHB 4RGOL 1WISA 2WLZA 2GITB 5D7LD 4JY5L 1EHLH 3EYSH 3VFMB 4UT7H 2PKDA 4LARL 4U6XA 4MCYB 3LMJL 5EU4A 1CYGA 1AJ7H 4KC3B 4O51B 3WD5L 3WO4C 1FG2B 1N64L 1SMAA 5INDA 1FP5A 4X6CE 2NX5A 4M3KB 2UZYB 1IKNA 1XIWB 2IMMA 4Y4KA 5EO0A 5FYJU 5SWSE 4BSWA 5SX4H 5C2BL 3MRDB 4WJ5A 3CVHB 2ADIB 2DQTL 4XX1E 1NCWL 1ZS8A 3QAZC 5GISH 1G6RH 2Z31B 1VADA 2GITA 2AS5M 1SYVA 1K85A 4A6YL 1ZHKB 1ZT4A 3SKOA 2E3VA 3IDIB 5EU7C 3MZTA 1R3LB 4X80H 5GS3A 4X6BB 5F9WC 5IQ7L 1IEBA 4ZAKB 4ZUWB 4BH7A 4KRLB 4MA1C 4I77H 2ZSVB 4BZ1H 4L9LB 5J12C 4LAQL 4N0YL 5DJDA 5DWUL 4FFZH 2G9HA 3C5ZC 1MFEH 4HXAH 1YMME 4EZMA 1GC1H 1NMBH 1XT5A 1DZBA 1HNGA 3V2AR 2C3HA 4JFEB 2LTQB 4CADA 4XNUL 5L88H 4ODWA 1S7VB 3D3VE 1HXYB 4ZFOA 3RKDD 5T3ZD 3OL2A 3CIQA 1PG7H 1JK8A 4PGDA 1KXVC 4ZTPL 4TQEL 3SE8H 2HFEB 1NKOA 3O8XA 4AYFA 5IHZB 3K3QA 3BKMH 2A38A 4APQD 3TA3B 4M6NH 2PXYC 3C60A 3QCTH 1QO3B 2ZJSL 4DZ8B 3KR3H 3RVXC 3JTSB 5HHVL 4N68A 2KQNA 5D6DC 4HULB 3ZE2F 1BIIB 4G8GA 3GGWA 4Z7UE 4NJAH 2AEQL 5D72L 3RI5F 3WHE1 1AC0A 1OSZB 3KPOA 3O3BA 1LO2L 3OJ2C 1KJMB 4UIMA 3N0PB 4OI8A 4EVNA 1RZ7L 3OJVC 3S36X 2PCPB 4OM0H 1EBAA 5C08A 3Q6FA 2DM3A 3U7WL 5J1AA 3LIZH 4ETQB 1JPTH 3CZFA 3MUJA 4ODSH 1WIUA 1UKSA 1FAIL 1FIGH 1DUZB 3IFNL 1MHCB 1C7TA 4E42A 2G2RA 4PV8A 5JA8B 3ESUF 3EIFA 3FMGL 3QI9A 1N3NA 2QR0B 4QRSB 4H25A 3E8UH 1JWMA 4JGUA 4P4KB 4ZQKB 5MI0C 3TBYB 1KPUA 1UM6H 3RRQA 3RWGA 2E7LC 2X4QB 5MEOB 1T83C 1LO5B 1JNHB 4ZS6C 3QB7C 4P3WA 4ODHL 3F12A 2VQTA 4UMGA 1MUJA 5EIIB 3VXMB 4Y5YB 4UT6H 4OZFA 1RK0A 3T65A 2W65B 2JTDA 5F7EL 4XWOD 5EG6C 2WP3O 2H1PH 3UBXG 2RIKA 4F58H 2CLRA 4PP2A 4RMUA 4KU1A 3WFDL 2EDWA 5FDWA 4Q6IC 2XZCH 2FO1A 1JTOA 1FNEB 3KYAA 2W65A 3EO0B 4R4NC 4EXPX 2GIYA 4LCWD 1JF1A 3VRJB 4Y16C 1XGTA 3GMPB 2RB8A 1KT2B 2AKRB 2DMCA 1Z6JT 4JQXA 4LNVA 2YBRB 1QRNA 3NCYP 2X4QA 2OK0H 1HOCB 5C0FA 1NUNB 3LKPB 5T1KB 1BMGA 5J11C 1F4WL 1YMMB 1BGXH 3TBYA 4LGRB 4Y88A 3TBVB 4GQPH 3DURA 3O3DA 1EAJA 1MAML 2DS4A 3D5OF 1KTDB 3H2WA 4JO1H 3VXQA 3WXVH 4UOJA 2J8UE 4XVUC 1EJOL 4MA8H 1AP2A 4RISL 3T2NL 1MHHB 4ZUSB 2UZIH 2HAZA 4A6YH 1GGCH 3K46A 1JCKA 1GC1C 2P5WB 3W82A 2AK1H 2Z35A 43C9A 5GRZA 3R4DA 5JNYB 2FL5B 3G6AB 1JJUA 5BRZA 5E0QA 4ZS7L 1AHWC 1NAML 3MLTB 4U31A 4H8WH 2VQ1A 1OSZA 5C0RL 1GCFA 1CLYH 1U42A 1CT8A 3ZL4H 5GGRB 2EIEA 5SWSB 4WUUD 5MEPB 2BVOB 3UCRA 4OD3L 2ICEA 3HNSL 4LBEA 3MOBH 2FX9L 2NCMA 3HUJE 5C0JB 5GS0H 4PRHB 2FJHB 4MDIA 4RDQG 2NY1C 3MRHA 4QHNB 3UYRH 3ZE0E 2X4UB 5IMMB 5B39B 2CDFA 4M6ML 2CIIB 4MA7H 2PXYA 2WINA 1MWAB 5KN5A 2WQRA 5B39G 1CD1B 4Z76B 4HT1H 1BJ1H 4YR6B 5HYSA 1W0WB 1ZAGA 3TPKA 3X3FL 1XEDA 3DO7B 4UILH 3T4YA 3D1MC 5E2WL 5FIEA 4D9LH 5LAXA 3QO0A 5MENB 4DFIA 2P5ED 2H8PB 4APQC 2YPLB 1ND0A 5HHVH 4CBPA 4OZIA 2Q7YA 1ZLSL 4LGPB 3ARYA 4KROD 1D6EA 1QRND 3VXPB 1K4DA 2ZOKA 1G6RB 1YQVL 3STZA 3QIWB 1EX0A 1N5YL 4AT6A 2XWTB 3GK8H 4EN3B 4HPYL 1XGPA 3NVQA 1V7MH 4DCQA 4XZUB 3PGFL 3VXUD 4HEME 3OKKA 1NGZB 1QVOA 1OP9A 3O11B 3VWKC 1R3LA 4JQIH 1E4JA 1IFHH 2WUCH 2CUIA 3MRFA 4U3CA 5DQDH 4HKZA 3DI3B 4ZUVA 1IKFH 2D7OA 2B8OT 4G3YL 3QUMA 3VFWA 1PW3A 1YEKL 2FLBT 1K2DB 4S10A 3ZYOA 2X4SA 5DMJB 1IC7L 4PRPD 3PHSA 4G9FA 3FT4A 4QXGH 3IDYB 5IJKA 4J1UB 1QFWI 3MUHL 5K9QI 4RFOL 3CFEA 1H15B 5I1GH 3KS0J 3WFEL 1A4KA 5GZND 4NRZB 2GAZA 4WO4B 4CJ1A 2C3VB 1PSKH 1S7QB 4D8PB 2IANE 4Z95L 5BJTB 1H8OA 3AS1A 4Y4HD 1JGVH 4PRPA 3ARGB 4O2EA 5TE4L 5BVJA 1B4JL 2HFFB 1T3FB 1ZVSB 2MQ0A 4W4NA 5KG9A 1WBYB 4RMWA 4QRPD 2F53A 2BX5A 1UADC 5DUMH 3O6FB 5FECA 1S9YB 1OW0A 2FZ3B 1VDGA 2QKIA 2VL5A 1J8KA 1ZT1A 1CT8B 5JW5B 1KIQB 1YEDA 1RIVH 3EOBA 1F4AA 3RUGE 3WSQH 3T3ME 3LQZB 4QOKA 4LSSL 2R1XB 3QDJD 3FB5B 3DMMC 3C5ZA 2CRZA 3BH9B 4NP4L 4X4YA 3L5IA 1S3KL 2DKMA 1TJHH 1YNLL 4RX4A 4PJ9C 2NY6C 5JLZB 1MHHA 3BPLB 4S1DD 1OTUD 2NY0D 3Q2CA 4FMFA 4GG8A 4R90H 5L2JA 3VGBA 1RUML 3GSWA 1MCPL 1P69B 2Q86B 2HVJA 5HPMB 1AD9A 2A83A 2OMBA 5CILL 1GOHA 2C4FT 2R29L 2YBRA 3G5XB 2QADD 2X9YA 1RUQL 3L3KB 1U2HA 3ZDZE 2XY2A 1FV1B 3ARDC 3IXTB 2R0WL 1TXKA 3QNXA 4GH7B 1G0DA 3LHPH 4X9BA 1H3GA 3RZCA 2WIIA 5IQ7H 3F6LA 2CXGA 3ARQA 3OPZL 5FDWB 1A1OB 2GK2A 1MRFH 2F54B 1INEL 1FVCB 2ZPKL 2Q86A 2G60L 1YY9D 2OJEA 3QDAA 4M7KH 2VH5L 4XP1H 2VDOL 5CIPA 1IGCL 1K3IA 3TV3H 4WDIA 2NMSA 1UACH 4JFQA 2V5SA 2FJGA 5C9KA 3RZCD 3RL2B 3H9HB 4U6HA 1LO4L 4N0CC 4K7PY 1CXKA 1U3HC 1FG9C 1TQBB 4WI7A 4HGKC 1NJ9B 4UILL 5GS0D 1QBLH 1D6VL 4E0RB 1KYOJ 3U1SL 1DBBH 4JO4H 3QPQC 3HRPA 2DQGH 2B20A 1P7QB 4LVNC 1Z3GL 1I3UA 3GIZL 5D7JA 3MRIA 3IKKA 1RULH 1K8IB 4P9HC 1Z9MA 3ZTJH 2C9AA 2R0ZL 4UOW1 1PAMA 5C0AE 4LLVB 4EUPA 1LEGB 1B0RB 4X6CB 3RWHA 2QBWA 4R4FH 3OGCB 3BE1H 5J1SC 2CKBB 4RNRA 2D0FA 1FSKC 3PWNA 2ZG3A 4WNQB 3UJTL 4JFFB 2VLME 1MCNA 1VKXB 1QYGL 2H32A 2NY3C 4C58B 1IJ9A 5IVXA 5ADOH 3CFEB 5SWSD 3DETC 2GI7A 5I1GL 4WFGE 1YC8A 1SY6A 3H3PL 2IMNA 3AS3A 4LCWB 2X09A 4BA8A 4YGVA 1K8IA 1MCWW 5B38G 3QQ9C 5DK0A 5I1LA 2ZUQC 4JO3L 3UAJD 1NKRA 5I1IL 4JFFD 1PY4A 4ENED 2NTFB 4K9EL 4NWTL 4PJHE 1F3DH 4K3JH 4XXCC 5DQJB 4YDIL 2JE8A 4HZAA 4JRXE 3WJLC 1X5KA 5DJCA 1HSAA 5EBWB 1CL7H 2Y7QA 4QRTB 4BJLA 1LQSR 2VR9A 3I9GH 3O0RL 3P2TA 5K93A 2ITCA 1LK2A 4JG1H 5DF0A 5GRVK 5JORB 5E2JA 3BISA 4FQ2L 5IWLA 5ICXB 1N26A 5F89A 3UTSD 3GSUA 4LRNL 2NTSP 3TJHD 1N5AB 3VXPA 1D6EB 3BD5A 2Q3ZA 5I66B 2F54A 1TZHB 3SY0A 1A1OA 4U1KA 3B8YA 3QIBC 1E4XI 2GTZA 3MXVH 3P0YL 3MA9L 4TSCH 1NGYA 4XHJC 4KK8C 1FYTE 5DVLA 3THML 4ALAL 3GM8A 3T4YB 1R0AH 3HG1B 3JV0A 5D96B 2FO4A 1G6VK 4KHXH 5KN5B 2HN7A 4IJ3C 1CL7I 2A6JB 4I0PB 3GZKA 4X7DC 3QFDB 4PRHA 2WW8A 3BP5A 3GSWB 1NAMB 5A2FA 4UU9A 4PJGF 3OZ9L 4P46D 3U9PL 4G43B 1TTGA 1XFPA 4HEPG 4W6WB 1KTLA 1IGML 4L4TE 4LSTL 3CDGA 4K07A 2Y9RT 3OPZH 1V7ML 5HYFA 3BOVA 3C6LC 1KENL 4PY7B 2D9QB 1L7TH 3LQZA 2DQCL 4QOKB 3FQRA 1QYGH 5HBBA 3G6JA 4R3SB 3LCYA 3L3DB 2VDLH 3BP6A 5J57B 3S3PA 3UC0H 2FSEA 4FXKB 4FXKA 3DUUB 5JTWA 4P48A 3VD4A 3MCKB 1OY3B 3MCG1 1S9XA 3D39E 3ZHLA 3O41A 4H26B 4NZRL 3A0OA 3QJFA 4ELKB 1W2KT 5IB4B 4XAWL 3U4AA 1L7IL 2RJMA 1RK1B 5T3ZH 4XNQA 1RULL 1S5HA 1YN6A 3CFCH 3O9WD 1NC4D 4LSTH 1HHJA 4FQHA 4N0UB 4ONHA 5DD1H 3OSKA 5HY9B 4R0LB 4NKDB 1FN4B 4KMTL 1XGTB 4LVHB 2N4IA 2E9IA 3DSNA 4WFGD 4I9WD 3E0GA 3ZHDA 1V5JA 3H42L 4HG4J 2I5YH 3DTXA 3HMXL 4LSUH 5CEYA 3TJEH 1Q9LB 3P4NB 2EIDA 4NIKB 4M7ZC 2CXKA 3TC9A 2Q20A 1M1SA 3SDAD 3SDCA 4Y1AD 5EFIB 5DEZA 3SQOH 5B38A 2GCYB 1FLTX 1NPUA 1ZOXA 1E6JL 4YLQT 5I8OH 2A77L 2VZ3A 2NY5H 1RURL 1KULA 4KWUA 4OFKA 3RWGB 5FO8B 2MTPA 4MJ6B 4HJJL 4OLZL 4CJ0A 1KFAH 2M2DA 1VGEH 3KLDA 3NACL 4P46C 1IT9L 2QR0A 3HB3D 4QRSA 2Q7YB 4LEXH 2NY2B 2BHYA 1WITA 3MMEB 3NZ8A 5DRWA 5JZ7D 4UB0L 4HG4K 3F7YA 1U93A 4HV8A 2H2PD 2A73A 5E2TH 4FXGA 3OB8A 5DRZB 3QDMB 5TJWK 1Z2KA 2BOBA 2AJZB 5IB2A 2JIXB 1RVFH 3FB8A 2DMKA 3VRLF 4NQVA 5HSFA 4FQIH 5B39A 3AXLA 4WVRA 3TO4D 1MSPA 4G5ZH 4RQQA 2CGRH 4HGMA 2ZCLH 3GJFH 3ZTNL 1JGDA 4JFYB 3UC0L 2CRIA 3RIAK 3GK8L 1N6VA 5J3HC 4K8RH 2H32H 2YS4A 5KTEL 2YK1H 4Z7VE 2J4WH 4HK3J 1A7QH 3BIKA 3S35H 5IFHL 4F9PC 3VXMD 3LZFL 1S9WB 3MV7E 4OLXH 3PP4L 3TPUB 1ZEAH 3FB8B 4KKNA 1OGAB 2JIXA 1DL7L 4NQCA 3U30B 4PJ5A 3VWKD 5HYJB 1PZ5A 2EH7L 2GQHA 5GRUL 4KKCC 1TZGH 1FCGA 5C0CE 4GS7B 1NBQA 1SJVA 3IETA 1TENA 1W72L 3MRGB 4IOFC 3K8MA 1R5VB 1SY6L 2H3NB 5TF1L 1LEIA 4LLDA 1IE5A 2EEAA 3V8CA 2IBZX 1U3ZA 3A6CH 1T22A 1A6PA 4F7EB 4EEEA 2V7HB 3MRBB 2W0LA 4KUCF 1UXWA 2V7NB 4L9LA 5HYJD 3VW3H 4PJHF 4QEGA 2AEPH 1MJUL 1WZKA 2PW2B 4JRWA 4OT1H 1A14H 3HZYA 1H0DA 5F9OH 5HGDA 4LKCB 1J8HB 3M17A 3CSBA 1KT2A 2AKRA 3D0LB 4RWYH 1QRNE 2UWEF 3OKKB 5IMLA 4LSVH 1KNOA 5DURD 3KHQA 2ICWB 3K74B 1LK3L 2O5ZL 3F7RA 2VSCA 3MJ7A 5D7IA 3M8OH 1XF2B 1ERNA 3WSQL 2APBA 4TVPD 3HE7C 2LAGB 5EH1A 3G5YB 4YEFA 5B3JE 2X4OB 4HD9A 1GZPB 3RTQC 3VXSE 4PB0L 2ENSA 3BWAA 5MENA 5LAXB 2GKIA 4HWNA 4Q9BA 4WW2F 5GGUB 4BK5A 5DMIH 5ALBL 1DSFL 3MYJB 4NKMA 1W0WA 4MCYA 3PWUA 3UO1H 4HF5H 5D4QA 5AUMB 1CS6A 1CR9L 1S7WA 3HMXH 3M1BB 4LSUL 2BHZA 4U1GC 3AROA 4M4RA 3S34H 4AH2A 3GI9L 1ZLUK 2NZIA 2YD2A 2J8UB 1ZA3A 3CFJB 1DN2A 3DVNA 5CGYD 4FN0A 1UQSB 4XBPB 4YGAB 3QQ3A 2WBKA 1R3IH 3OKYA 4HHAA 3R8QA 1NAKH 5FYKU 2XKNA 5IK3B 4GKZB 4GBXA 5H2BA 1I8IB 3QNZB 4M03A 2PCPA 2QADC 4JR9H 3MNVB 3OXRA 2JK5A 4LDEB 1I4FA 2YMXL 2D7PA 5GJTH 3UO1L 1S7RB 4O58L 5CWSB 2R39A 1ZT1B 1BIIA 2VZOA 5C6TH 4FRWA 3INUL 2B5IB 1U3YA 2AXFB 4H20H 3CLEL 1S9YA 5E8EA 3GIVA 4RRPG 2DI7A 2HFFA 1WAAF 5E8PB 5IHZA 3QUXD 4PGCB 5E2TL 3DJ9A 4BFIB 4HIEA 5GGVL 1NC4B 3V4VL 1S7QA 1A6WL 3EJZD 1JK8B 1JWSB 3NN8A 1WAAA 1OTTD 3P4MB 4NO3A 2XN9D 1U8PB 1A64A 1J88A 2HYMA 3GKZA 5IROA 3C87A 2BVTA 2FGWL 2X4NA 4QOKE 4LQFL 4P2OC 3CSYB 4U1HA 3DSFH 4RGNE 1A6AB 3QIBA 4MA7L 1CZ8H 3S37L 3RTQD 3UYRL 4EDXA 4IRSD 3SE4A 4D9QD 2EH7H 5GRUH 3F7PC 5E5UB 4XCEA 2AGJL 1Z9SA 3KWWA 5DO2C 4OZFB 4OLEA 1T89A 4L8SA 3BDXA 1RUPL 2L7JA 2JELL 4I4WB 1IAIL 5GGQH 1QLFA 3BHBB 3RY5A 2XZAL 5MEOA 4IHOB 1R24A 4LLUA 3HFML 4PRAA 1UEYA 4I48A 2X44D 2ZNWA 1VADB 3OQ3B 1P7KB 1ZGLB 2I9LB 5I1LB 4KZEL 2VXVH 1CFNA 5MERB 4YBHA 1FZKB 2FNBA 5IV2A 1UZ6E 3O3EA 5HI4D 3ULVC 1FNGB 4OZGF 4RMQA 3E8UL 4OF3A 3RY4A 1IKNC 3F7VB 2VSDA 4O51A 4XPAL 1PZ5B 4XMPH 5KW9H 2R1YA 3KLAA 3DYMA 2VN4A 5C08B 1VKXA 1VACB 1NL0L 4NP4H 4LSSH 2ZOLA 4G8GE 4P59H 3TPUA 1H9VA 4QRRE 2ZUUA 3VU2A 4FQLL 5IUSA 1T80A 2GK0B 3H3KA 1BQHB 4NKIL 3UPCA 1YECL 1I1AC 1AXTH 4JHWH 2OR7A 4X83A 3BN9D 3SDXB 1B0RA 5K59F 5ADPL 3VFRB 1MFCL 5ALBH 3KPSB 2XN9A 1I1RA 4KDVA 4XP4H 2VKWA 1Q9OB 4M7LL 4JEGB 3IFOA 1N6QL 2CIKA 1S7XA 1MCCA 2V17L 4JQVA 3D39A 5IMKA 4FABH 1UB6B 1GGYA 1JP5A 3CU1A 2P8PA 3Q3GB 1IC1A 1JMXA 1FYTD 5DEFB 4YK4B 3D87B 1B4JH 1DR9A 4P2RA 3RVTD 4X4ZA 2IC2A 3TEUA 43C9B 3B2UC 5CEZH 2EC9T 5F7WC 5A1AA 1QFWM 1T5WB 4PP1D 1G9ML 3B9KD 1F58L 3D18B 3GJFK 3QG7L 4JM2A 5IW1B 2Q76B 4M00A 2E8YA 3AREC 2NXZB 2UUDK 3LKQA 3DSFL 3U9UB 2ZKHH 1KJ2H 5EU3B 4AZ8A 1RZFL 4YK4C 5JPMA 3L9RB 3Q3GA 1AY1H 1CGYA 3H7LA 4N1EA 4OGYH 3WUWB 5J06A 3E6FB 3MZGB 5BW7C 2CKNA 3A67H 1S9VB 4N1HB 1JVKA 2ICES 1WWCA 4K7PX 3W39A 3FQUA 3MTRA 4QKXB 4PRID 3NCJH 1AXSA 3EOAB 4MWFB 3ZZ1A 4JO4L 2XTLA 4UQ3B 3GMPA 1BJ8A 4JHAL 2AJVH 5DJ0A 3UTTE 1OTSC 1MCKA 1CE6B 4X6DF 3LS4L 4BSJA 2NY4D 3ARSA 2GSGA 4G8GD 4LVOC 1IQWL 3QIWD 3PHQA 4MXWL 4NZRH 1DCLA 4Y4KB 5BS0D 2CJUH 1OARH 3F58L 1UKTA 4ZD3H 2R69L 1I85C 4M48H 1CK0H 1OGAD 1MCIA 4I2XE 1H3WM 4OAWA 3BSZH 4PJDB 3SKNB 4Q2ZA 3CVIH 3V6BR 3BEWA 5GS1B 1J10A 4R4FL 4JKPH 1X9QA 1KCLA 2HKHH 4TULL 4XTRD 3PV6A 4G9FE 5BZDB 3ZT7A 1RVFL 1M6OB 4ZO7A 5JDJA 1B9ZA 2AJ3B 3KPNB 2HTKC 3S37H 3L7FA 2PN5A 2QKIB 2A6DB 3OMZA 3EDDA 3C08H 4WW2B 1QBML 2RAMA 5J8OA 3MJ9L 4OCRL 1QBLL 2BNQD 1C16A 2OSLA 4EN3C 1MLCA 1X7QA 2W9DL 1LEKB 5DJ6B 1WWAX 4M7LT 5DHVB 4O2EB 4YX2L 3V5KA 4MNHB 3HAEA 4JFEE 1ED3B 3AB0C 2GSIA 4HJJH 4OLZH 5TGBB 5MHSE 3GBNL 3QI9D 3D85D 3DX8A 1CE1L 5LBSH 4LGSB 3OKEA 3ARWA 4DQOH 2UV3A 5CZXC 2I60L 1BJ1J 1TVBB 3VXNA 4G8IB 3ME0A 4BFIA 1CD0A 5HHOB 5TDOA 3UTTD 2YD1A 2KH2B 3RVVC 1OAYH 4NQCD 4G8EB 2BY3A 3GIVB 3UJJL 1J1XH 1CLCA 2DBLH 5T1DH 2VZSA 5E7BA 1TVBA 4MMZC 5CD5D 3DIFA 1DLHB 4H1LA 4ZUTA 3ULUH 5GSVA 1A7PH 3P3YA 2W9DH 4P99A 3RL1A 3CH1B 3MA7B 4JFHE 3LEXA 2MSPA 4NCDA 1QLRB 2LABA 2K1MA 4Z95H 2R1WB 1S7VA 4FQXD 1T20A 5C0DB 1WZ1H 1IC5L 3MV8A 3BN9C 4L29B 5F1KC 4X9IA 3WL9A 5DLML 2H41A 1LEKA 2QV2A 4L3AA 4WWKB 4XHQA 5IBTH 2DJ4A 1B0GB 1G7QA 1MELA 4HIJB 3TT3H 1E4XH 1JPGA 2AI0L 1IBGH 4ZAKA 2ZUXA 4JFFE 5DA0B 5IIEA 5E8DL 3K2UL 4YPGA 1WJ3A 1N0LA 4M1GH 3ZKXC 5HD8D 1L7TL 2IG2L 2QLVB 4OCYH 3FFDA 3FFCE 1KCKA 5T5NF 5EOTB 4POYA 5DJXB 1AQKH 3SKNA 3V7MA 4I1NB 5HDOA 1XGQA 3HC3H 4KXZI 4X5XA 1MOEA 3T08A 4XNMA 1MAJA 3FMGH 2ICEB 4R7DB 1KIRB 3WFBH 4DVRL 1GOFA 3C8KA 3MLZL 3WFCH 1JNNL 4AEFA 2IGFH 1BP3B 3VI3E 9CGTA 2W0FA 3NH7L 3LKOB 3P9MB 5BV7C 5JIIA 3K80A 4G7VL 3MRLA 4IIQB 4HKBB 4Y1AA 2NXZD 4G3YH 4OZ4B 4S1SL 4PJAB 5I74B 3LV3A 5MENE 3LQMA 4HDIB 4Y2OA 1UH3A 2NY1B 2DM4A 5IOPA 5ITBL 2CJUL 4ZD3L 3U36B 1DUYA 4K3EL 4PS4H 3DI2B 2D9CA 1EO8L 4NQEE 2A2QT 4PJAA 1T2QL 1U8KA 3BGMB 4YEEA 3SQOL 3VG9B 4JFDD 5LGJA 4IIQA 3TBTA 2P1YA 5D7KD 3BRGC 4WV1A 3OG6B 3UX9B 3VRJA 4UINL 1MLBB 2NY2D 4WHTB 4D0DA 4X6CF 3IDNA 4LQFH 1ITCA 4MVBD 4HCRA 3L3JB 4RIRA 1EIBA 2ADFL 2IQ9L 4M1DH 3QULA 4U1MA 1FRGL 3IKCA 4OZHF 3EJYC 4CDGC 5T3XD 1JGDB 1T1WA 3GO1H 4CMHC 1J86A 3MJ8B 4AIZB 1G9NL 1KG0A 1ROWA 1YQ2A 3GM0A 3B3IA 2CRMA 3BPOC 4IMKC 1FBIH 3VWKB 5JW4R 3WNOA 3S3JA 1UGNA 5CEZL 4PFEA 2BOBB 2D7MA 1BREA 1T21B 4HS3A 3OXSA 4GKSA 2ESVD 4Q9RL 1U93B 3QQ4A 5E00A 1GPOL 3G5VB 1QACA 1LE5A 1UCBL 5I17A 5C2BH 1J1XL 1ONQB 5T5FH 2YEZA 4OV6F 4EJ1C 2R56H 2YN3A 5SWZA 2WBJA 4R2GC 3V7AE 1MWAL 1GGBL 1XH3A 3TIEB 2GJ6B 4N8VB 4QYOA 1JL8A 4PJ8D 3O9WB 3S4SB 1KB5A 4S2SB 1AO7E 5IKCA 5HGAB 2Y23A 2X9WA 2R1WA 1I3GL 1QLFB 4XC3L 3BJ91 5I9QB 4DGYL 2D3VA 4JJ5A 1A9BA 1AKJA 2QQQA 3GGWB 1OPGH 3DLQR 3VRLE 5FGCB 4KKLC 1IGIH 3WIIL 5I16A 1JHKH 1NCCH 2RHEA 3TA3A 1HI6B 3OV6A 4FTVA 1A6AA 3QIBB 1F4HA 5TPWH 3ULUE 3CDCA 4LHUG 4O00A 5IF0B 1KPRB 5DMYA 4D9RD 1HYRC 1FN4A 2GAZB 4NRZA 2RFXB 4Z5RB 3BRFA 2P5WD 4Q0XL 5C0AA 4MQXC 4P5MA 4X7SH 4YHZH 4CADB 2VZVA 4YDJB 4WI4A 5HHOD 3RWDA 2UYLB 1RIUL 2QEJA 5F7KC 1FNFA 1UVQA 1MLCB 2OSLB 1WZMA 3K8KA 4ZFZB 1DFBH 3HLAA 1X5XA 5EUKA 4HLZH 4UT9H 1CDUA 5I16B 2HTLC 2D7QA 5CSBA 3B9KA 3WFHB 4HT1L 5JOPD 1Z5LB 4NM8H 5ETUB 3FFCB 3MXWL 4JM4H 5B4MD 1N59A 4XPHL 1A9EA 1YEIL 5EOQL 4Z7OF 3VXRB 5F88A 4Y4HC 2BSRB 1HILB 3G6JB 5E94A 1ZHKA 2WBWB 4JDZB 1AE6H 4JHAH 2PYED 1TZIA 3T0VA 4HUUA 4Y4FC 4EOWH 4XP6H 2HKFL 1OGTA 3WBDA 1NMCC 3QCUL 4X9GA 2Z92A 3PQYB 3O45A 4L4VB 4GKZA 3U9PH 2Y06L 3BDYL 4P49A 5EN2B 4NO5B 5B21A 1DBKH 5CJQH 1VFOA 4P4RB 3OKMA 3RGHA 5F96L 4XAKD 4AM0A 4X98B 4C83A 1H3PL 1BBDL 3CFJA 4P2QE 4TUJA 2NX5D 1AGDB 1NLBH 5ILTH 3GMOA 1MWAA 5I8CB 5FDYA 1A7RL 5BV7L 4MGXA 5F9WB 1UB5B 2KBGA 5FYLL 1JV5B 2O26U 5MEQB 3K7UA 1AH1A 4PBWD 3W39B 3T04D 2BVOA 3WCYA 4U1MB 4ZOCA 5EIVA 4K71C 5JQ6L 3L3HA 1QA9B 4MCZA 5DZLA 2J88H 3GO1L 1WBXA 3UTSE 5IT2H 2HH0H 5D2LB 3FOLB 5FKPB 3S9DB 2VQUA 4WHYH 2Q76A 5D6CA 2J12B 1H3VA 4RMVA 3X14B 5LXGL 4HMCA 4HZLA 5F88B 4LSQH 2XTJD 4RAVA 5DJYA 5ISZE 5LGJB 1HQ4A 4N0RA 3SGDI 4JY5H 5D1XA 4M6NL 1R3IL 5HGHA 4X7SL 1N8ZB 4YHZL 2DQIH 1KTDA 2ZPKH 2D7NA 1XIWD 5DEFA 2NNAB 3TBVA 5FUCE 1BBJB 2R0LL 2IPUG 1NCTA 4M3JA 1UB6A 3T77B 2V5YA 4HBQA 3EHBC 4NN7B 1BZ7A 4JFZH 3S6CA 3WLWC 1DEEB 4HGWB 5C9JA 3IJHA 4JKKA 1EFXA 1CDIA 5IVXB 3BYYA 1AD0A 2VXQH 2GJZA 3BZ4B 1IVLA 2XQBL 5F72S 4P46A 4Q6IB 4TOYH 3EO0A 2F15A 5C3TA 1A6VL 5IB3B 3QUYA 4EI5C 4PRNA 4RNRB 3QCUH 5HHQA 4I3SL 5DEGB 5GJSH 3AU1A 4XCYA 4HS8H 4NQUA 1X4YA 4PIRF 1U3JA 3AGVA 1F6FB 4JO2L 4X6DA 1YYLH 4X5WB 3STBA 4PRDB 5T1LA 3T1FB 1IM9D 1JPFA 3ARBA 1AFVH 4HLZG 5D1ZA 3QXWA 5JIKA 4I0CC 1MUJB 5EIIA 2ZSWB 4LCIL 3RWEA 1NBZA 3LRSA 5KVEL 3D39D 4HKXB 2ZUSA 1W0VA 1TETH 4NHUB 1WEJL 3O3AA 1EV2E 4PD4K 3MNWA 5GS1A 1U8HB 2HRPH 4WU7B 5EZIL 1I1CA 2BVUA 3STLA 4NHCH 1FYTB 1N3NB 5I1KL 4F9PA 3I02A 5T3XL 1DBJH 3ARBB 1R3HB 5HVWA 5K9KA 3I50L 4NQSA 4WO4C 2EDHA 3HR5A 5FM8A 3BPCB 3G5VA 5J4MA 5FCSH 2AJSH 4L8CA 1ACYH 3CK0H 2ATKB 2AERT 3IFLL 3SPVB 5B8CC 5GZOD 4S1RH 2VXSH 4XCFL 3HZKA 3LZFH 4R97B 2OXHA 3PE9A 1KJMA 5GPRA 4F57L 5DJ0B 5FYKH 3NCCB 3D3VB 3V4PL 1IC5H 5LXGH 3HMWH 1F90L 3QP3A 3T3PE 2WZPD 2CQVA 3MRPA 5CJ8A 1JE6A 3QUKA 4BZ1L 1AR2A 1FGNL 5ID0B 1VA9A 2EO9A 4ORGA 1BF8A 3WE6A 2WWKT 3VXME 1UXSB 4IIQC 3VXRE 2VERN 3LH2L 4TSCL 4WV1C 2VDPH 3RIFF 3J8F7 2DL9A 4D0DB 3OAYK 3NPZB 2FIRT 2EE2A 3NGBC 2HFGH 2IALB 3MROA 5C07D 1NH6A 2MPAL 5FA3A 5IR1A 4LSPH 1LK3H 4R26H 4WY7L 1X5LA 1TJIH 1BD2D 1OM3H 1S5HB 1YN6B 3NIGF 5DD0L 1KOAA 2R1XA 4JFEA 1J0ZA 3V5KB 1S9KC 3WIFA 4L5FL 5IFAH 4JVPA 4K3DH 1HXMB 3NA9H 3PDOA 1R5WA 3HMXA 5JUEL 5BRZD 3L3HB 3HE6C 2IQ9H 2C5DC 2GJ6D 3NIFE 4JPKL 1MFDH 4DGVH 5D1XC 4MX7B 2B2XL 3QCVH 3NMEA 4LQ1A 2DD8L 4JANA 4E41B 4WEMB 3RWJA 3FQWA 2A0LD 2AXGA 1MCFA 2VZTA 4U2ZA 4UTBL 1ZE3C 5D7LB 4YBLB 3ILQD 4Y5VA 4HMDA 3QUXB 2HMID 1OAQL 3W0WE 3QHFL 4ONFH 3IGAB 2XA8L 3DX6B 3O6ML 4LP5A 4YXHH 1KCRL 4CL7A 1HZHL 1PD6A 4X99A 1MAKA 4NO5A 4WI6A 4C59B 1A6UH 4APQA 3QJHB 3KYOA 2X4SB 2IBGA 3ECBB 4JR9L 3THMH 2ID5A 3PF2A 1ZGLA 3VFMA 3C60C 4YBQD 3SDYL 1U9KA 1IQWH 3HNTL 1H5BC 4YXLL 3KG5A 1C8PA 5HJ3B 5EWIH 1BQLL 1AXSB 4MWFA 4PD4J 5F7DB 4KGLA 4URTB 4TN9A 3BFOA 2UVFA 1U41A 4UIKH 5K9JH 1R5IB 1BZ9B 3WNMA 4X7EC 1OCWH 4GMSH 2BVQA 4L4VE 3JSSA 3LVEA 3DX9A 3WL9B 3I6KB 1A3LL 3TWCH 1D5MB 3EFDH 3U2SA 3GSOB 3LKQB 3OB0K 2V5TA 5DD5L 5E24E 4XPGL 2X4NB 4OGZA 5E5MB 3LS5L 4Q58C 2NY5L 2XWJB 5JDSA 1DANU 1A6TB 3MRJA 5FYJE 4QRUA 3VFSB 1E4KA 3QG6B 1INQB 4MXQD 1NUGA 4GQ9H 4NQED 4F2MA 4HWZB 3VCLA 2UWEE 3VFTA 3EDKA 1GGBH 3HE6D 5C08D 4WI2A 1F2XK 1E4XL 2X05A 3SCMC 3IDXH 4OD2B 3TT1L 2CIKB 1SJHB 4Y4HA 1MQ8A 3DYOA 3L3IA 3DPBA 1OOAA 1IT9H 2H2PC 3HPLB 2EDOA 5MEPA 1TMCB 1T1ZB 2OR9H 3BE1L 1P2CB 3BXNB 4XXDA 3D3VA 1UEMA 4N8PA 5GRVL 3W2DH 1VACA 1QSVA 1KB5B 1AXTL 1V3LA 3EYFB 3ZKMC 2DBLL 5T1DL 3SDDB 1I8IA 1XGYH 1X5GA 5KSBB 2DQIL 1OGAE 2BC4A 2BNRE 3JZ7A 3NZ8B 2ZUWA 3VXQB 4PYGA 4P23B 4XMPL 3S5LG 5BQ7B 5I1AA 3QWRA 1MRDL 1KACB 1QR1A 4JKLA 1LO3L 4UTAH 4MNGE 2ICCA 1JMZA 1A7QL 4LLQB 2WIMA 5KSVA 1S8DA 2SEBA 1D5IL 2XZQH 1IMHC 1I7UB 4HK0B 4NKOA 1C1EH 4ZFFA 4RCAA 1VB9A 4OSUL 4LSDA 4XNXL 3IKCB 4K3EH 2FD6H 2AP2A 1NEUA 3IYLW 1WLHA 4R2GB 3AU1B 4J3VA 2D03L 3D0VB 4NO2A 2Y36H 4RIRB 3UBXB 5F6HI 3MJ7B 5D7IB 3MLRL 4U1HB 3ARDD 5F44A 5GS2H 3VXSD 4GXVL 1MLBA 2VLJA 5DT1H 1D6VH 1RU9H 4V1DB 3HI5L 3LS5H 4PJHA 4KV5F 3VI4E 3P4MA 1ZTXL 1UENA 4U3XA 4N0UA 1TPXB 3HRZB 5I1JL 3LN4A 3N85L 1F42A 4NC1C 3U83A 2P24B 1YNLH 5A2JH 1H5BA 4K94H 2E9WA 2FX7L 4D9RE 2OR8A 1V3JA 5I0ZA 3OKOA 1GGIL 4AEEA 2COQA 4N0CD 3VDBA 3PXHA 2DTML 3GI8H 4AL8H 5CINL 2YXMA 1FFPA 5GS1C 2VC2L 4O2CB 3B43A 3ARGC 5HYJE 1XGRA 3IFLH 1KC5H 1RZGA 3EUUA 3GKWH 5JW3L 3B5HA 3MRLB 1A0QH 4R3SA 5EIQA 3B9DA 3BUYA 4LF3A 3QO1A 5EC1A 1A21A 4G6KH 3EO9H 3VE0B 4BM7A 4MLIA 1ES0A 3CXDH 1GGCL 1G9EA 4M1CD 4HWEH 5CJ5A 2V2XB 1CBVL 2VDLL 3LKNA 2BNQB 3I6LD 3BGAA 5AYUH 5FF6A 2DICA 4MJIA 3O6LL 4K7PL 5DJ2B 2YPVH 2BJML 1MY7A 4X5XB 1V3MA 2G5BA 5J11B 4RQQB 4MJ5A 4OKDA 2ICWI 4U6VH 5AEAA 4YAQB 4AH2B 4QRPB 1QEWA 3RU8H 3OX8B 1MF2L 1HINH 2ESVE 1A4KB 1HYSD 2ZKHL 1F3RB 2L0DA 5DI8B 4LNRA 3KLSA 3CUPB 2JLLA 2R9HC 3QBTB 4G6KL 1RZKH 2ADGB 2HLFD 3MBEC 1FL6B 2WUBH 3B9AA 4H88L 3VI3F 4UV7H 3ARTA 1QG3A 4MD0B 3UAJC 3G5YA 1B0GA 1G7QB 3ULVF 2YRZA 5DMIL 5DZOA 1JRHL 2X2YA 3CLFH 4L29A 1BF2A 4KK8D 1LNUB 1XMWA 2IBZY 1QKZH 3DARA 4NN7C 3GBNH 4PLKC 2JB6A 5ETUA 4Y19E 5EA0H 1NGPL 3KWWB 1NBVL 3FO1B 3EYOB 3TJEL 4EI5D 3U0TB 3EO1A 3F5WB 5DHXB 3T0EC 4CW1A 5I19L 4YHML 1J5OL 4QXWA 5EB9A 5I8KL 4L4TA 3QUZD 2X4RA 2DIJA 5IROC 4IRJB 3D9AL 1DBAL 1I7ZA 1PG7W 4G6JL 2MJWA 4MD0A 1IZJA 3MRGA 2V2WA 3V79C 3QXTA 3ES6B 5EDXA 2AXJA 1T7WA 4YJZL 2R4RL 1I85A 4PJBB 4RAUA 5DI8A 3C6LD 1IEHA 3HA0A 2VLJE 3QUXA 3FTGB 5F7HA 3JV4A 5TFSH 3FN0H 4LRIC 4RZCA 3INUH 1RI8A 1OGAA 4WHDA 3VG9C 1I7RB 4U0QB 1T6VN 4HIHA 1B2WH 3CJJA 1DBMH 4MB4A 3VD5A 4KZEH 3RWJB 1ACYL 2W92A 3O0RH 3NAAL 3H3BC 3P9LA 1AGBA 3PHOB 3ZO0A 1CQYA 3BVNA 2GY7B 1KN4H 5SWSA 3BZEB 5FF6B 3SCMB 1U95A 4P2QA 4WUUB 1T6WA 4YHYB 4JB9H 2VQ1B 4K3HA 1KB5H 4R9HA 3QEQA 5HGAA 1SQ2N 5CIPH 2VXUH 3R06B 3RDTC 5KANI 4M9OA 4X8JA 5T1LD 2FL5A 4MB3A 2GJ6A 1Q94A 2Z93A 5FB8B 5TFSL 1DQJB 3MV9A 5HI3D 4ZUSA 3A6BH 3AMLA 1I9RL 1P7QD 2FEDD 4R7NB 4J8RA 3HNSH 1G7PA 4HHAB 1PVHA 1MCEA 4NM8L 2YD4A 3QQ4B 5E00B 4Y2DB 5KSAD 5EC2B 1G7HB 5I2IA 1A7PL 3QA3B 1YMMA 4HQQH 3SBWA 2VABB 4NWUH 1E27A 5ID0A 1T21A 4DOHB 4ZNCD 1JNNH 5C0EB 1OM3L 1KF9B 1QRNB 1G9MH 2OP4L 1CGVA 2NW3A 2VR5A 4ZO6A 3NA9L 4PJ9D 1ZSDA 3V0VB 1J1PH 1OAXH 2DI9A 3MYJA 4FOMA 3KPRB 4PJHB 3NTCH 1CFVH 5HI5D 1U91B 1WT5C 1T1WB 4M1CC 3G5XA 1LD9A 1MEXH 1TNMA 5C0EA 3W11D 4KK5D 4LRNH 4KAQH 3QULB 4MMXC 4F33A 5HPMA 2I26N 2ITDB 4LLWB 4P57A 4RGOH 2MWCA 2CRYA 5KW9L 1BM3L 2ATKA 3LPWA 4G6AD 3U9UA 2NR6D 4MZ3A 4GMTL 1F11A 4L8DB 1IGTA 1JGUH 4R0LC 5F3BB 1BWWA 1RJYA 4LLMA 3M17B 4JRYE 4LKCA 3MV9B 3OKDB 3LPGA 1NC2A 1I7UA 1KLUB 1UH2A 5E9DB 25C8L 2ESVB 2LAAA 5AG8A 2EYSA 1N0XH 2E7CA 4KFZC 3VWJD 1NGQH 5CP7A 4OF6A 5I71C 3IDUA 3TZVA 5KVDH 1TLKA 5DQDL 2R9HD 2D31B 4JZNB 2R2BA 5DDHB 1KPUB 2JJWA 3ZT5A 4YFEA 1Q9WA 4YHPB 3O41B 5FGBC 1T5XB 5JW5A 3P4LA 2J8OA 1O5DT 2G2RB 4PV8B 5DYOA 4IRZH 2KZ1B 2P4AB 5FFLA 4AG4H 4M8QA 4PRDA 5T1LB 3BSZL 3E6HA 4HUWA 5T1MA 1JYWA 3P9LB 4ZPTA 3AAZB 4DZBB 1CK0L 3L3OA 3QPQD 2OQJA 2Z4QB 5ITFA 4PLKD 4KKAC 5FYJH 3UEZA 4FA8A 2XG4A 2ZOLB 3LN9A 3HE7B 4PREA 5KS9E 5JW4N 2V5MA 3KPOB 3TNNB 4BSVB 4ZPTB 2UY6A 5JPNB 3QT2A 1U2CA 3KXFE 1KIRA 4UT7L 5KVGH 3UXFA 2ZG1A 4DZ8A 1JTTA 1PSKL 3SDAC 2ERJB 2X4RB 2DLFL 1LP9B 1K6QL 5EO9A 5MP6H 7FABL 3KXFD 5DQ9A 3U0TA 3BYTA 5D6DA 1MREH 2FYYA 4NC2B 5C86A 3A6OA 3WS3A 4P23C 4F7TA 1MJ8L 4GFTB 4LPCA 5FYJL 4CRPA 4CU7A 4XNZC 1R3KA 5F3HB 4V2CB 4WDIB 4KAQL 3QQ9D 4M43L 1JI2A 4OZGB 4W68A 4AT6B 3QIWA 2FD6L 1AXIB 4OD3H 3MO1A 2MOVA 4LVEA 5T5NG 1GOGA 2IH3A 4AIXA 2WIIB 4TVPH 3IXAB 2QL1A 3PUCA 3RNKA 4NYLB 4N9OB 3TH4T 3I50H 4NZJA 1T0MA 3GJFA 4CN1A 1NC4A 4KZDL 2ZUQB 5C0GA 3P4OA 3H0TA 3FO2B 3DV4A 4JPKH 5HDBE 1VFAA 1YPZA 4MNQA 2UZXB 4XP5H 5JUEH 3QJHA 1NANH 2VE6A 1LE9A 1P1ZA 4I18C 4C54A 2J8HA 2Z91A 4U1SA 5EZLB 3DX7B 1VSCA 4NGHL 4IOSD 1OB1B 1OLZA 2BFVL 4C56B 5HY9A 2BNQA 4KQ4L 3FB7A 5EU6E 1U36A 5HHNB 2H1PL 2H26A 2ZUTA 5E08L 3JWOC 3LEYL 1IAKA 3HAEG 3L3OB 2VXVL 3D2UA 5I1CH 1FNHA 4EXKA 3L6FB 4MD4A 2MKLC 4IS6B 1AP2B 4XB8A 2F8VA 4NQXA 2IAMB 2NY0B 5AAWA 5D2NB 1AGEA 1ODAA 4HMEA 3OKOB 5D96C 4BZ2L 4PJXE 5D5MF 2VIRB 4M62H 3MV7A 3V8OA 1M7IB 1FYHB 4HIIB 4HWBH 3EJZC 5TH2A 2PO6B 1S7WB 2VDNL 4KHTH 1NDMB 1HEZB 1MAMH 4DEPB 2O93L 3FB7B 4WFHD 4XP4L 3P73A 1YA5A 1ORSB 3PG2A 2WANA 5LKNA 5BZWB 3V52H 2EDDA 4POZC 3O81A 3BKJL 3S37X 3GI9H 2M8XA 1GZPA 1XR8B 1NCBL 3CC5B 1FO0B 3I75A 4PJEE 1YPZB 4MNQB 3U4BL 1KELH 4NQEA 5HHPB 4GMSL 4UDTB 2PO6D 5F71A 3JWDC 4NUJB 3MRFB 4OB5L 3T65B 4EUPG 2NY7H 4JY6A 2CR6A 2E7LA 1IGJA 2NW2A 1HK6A 1QSFE 3WXWL 2VLRE 2QHRH 5JW4Q 3TA3D 1FJ1B 3IXAA 3ARFA 4GXUN 3RNKB 5E6YA 2VZUA 5IBUB 1MCRA 3ULSA 1SM3H 1TZHA 3SY0B 2OTWB 1KJ2A 2HT2D 4O5LL 5E70A 4F7PB 3A67L 1BAFH 2X70B 3TBSA 3V6OA 2X6MA 2D2OA 1VGKA 3PDDA 4C56E 2PYEA 1XR9B 3TFKD 3ARFD 1R5VA 1MCPH 4Q7DA 5E2WH 1HINL 3QYCA 3ZYJA 3QO0B 4O02H 3QRGH 4TOYL 3BIAX 4LASL 4ETQA 4JPVH 1R0AL 3RTQA 1UWGH 1F4YL 3DUSA 4R96A 4JQXC 4P23D 1Z9OA 4HKXA 1W72H 4WFED 4YAQA 3VWKA 4DW2H 2GJ6E 3P40A 4JPWH 1J18A 5T5FL 1OD7A 4R2GD 4H8WL 1JF6A 2K7QA 1OQXA 1AGFB 2C4FU 4XRCA 4JFOB 3C60B 4PJFF 1KXQE 4XCCL 5C0BD 4D3CH 1NGPH 5BXFA 2DLGA 1J87A 1UJTA 4HFWA 4NQVB 1NGWB 4K8RL 3PWNB 4FG6C 4I18A 2OQJB 2Z4QA 4FTVD 4WUUE 4X6EA 4WO4A 1AHWA 2C4XA 4OCWH 5B22A 4ZNEE 3U4EA 4ZDHA 3BEVA 1EFXB 1T66D 2LVCA 3ZHKA 1KCSL 5FCUL 1JWUA 3MFGB 1FVEB 3GSNH 4RSVA 2FATL 3WFEH 3I6KA 4PBXA 5ANMA 1PG7L 3S5LB 2PR4H 3VGFA 5T3XE 2ED9A 4L4TB 3EDFA 1KEGH 4OD1H 1WT5A 2L4OA 1CDGA 3PJSA 3WKML 1SYSB 1RZJH 4KKCD 5ICZB 1RU9L 1EAPB 5KOVC 2FEEL 3GJEA 5DJYB 3VH8B 1RV6X 2OZ4L 5D9SA 3IDIA 1XCQA 1IILE 2XACC 3WDJA 4JY6B 3J7HA 1KEMH 4WI5A 4F7CB 5CEZD 3ULVD 3P0VH 5DRNA 2CLRB 2ITDA 4JFDE 2DLIA 4P57B 2EZ0C 3L5WA 4W81A 2YSSB 4A2LA 3UPRB 3D6GA 4APQB 1TJGL 5DVKA 3K4ZA 3KYNB 4P5TA 4R7DA 2NX5B 3KS0H 1ADQH 4PJ8C 1FE8L 4ZMAT 4XVSH 1JNLH 3DX6A 4DN3H 2R8SH 4LEOB 1OP3H 2IPKA 5EU4B 3K2MC 3QISA 3G9AB 3N9GH 5JXED 4XPHH 4XI5C 5EOQH 1BVKA 1KJVA 1RK1A 4XMLH 3MV8E 1NCAH 1NCDH 5IVZB 3PWPA 5EU6D 4TUOA 3C8HA 4MDIB 3VFGL 1KIPA 2MHAA 2NLJB 4JANB 4TYUA 1I9IH 2EE9A 2BNUB 4OFPA 1YY8A 1VPOL 4M5YL 4ODVL 4YDKH 5CUSL 3NABL 5DK3A 4Y8AA 3WFCL 5F9JB 2GUOB 3N85H 3QZWG 4K7PH 3LHPL 5B8CB 4FFWD 1II4E 4OCYL 5GGTA 3HNTH 5E8OB 4R8WH 3IVKB 3MLTA 1MFNA 1HH9A 2AABH 3UJIL 1JNLL 1JIBA 5BS0A 2H26B 1HWHB 4EQ3A 3O3BB 2HWZL 5GS2D 1MI5D 1MRFL 1OAUL 4MAYA 1D3CA 5KSBF 5LGHL 1CGXA 4LKXA 4XCNB 4EN3D 5D5MB 4W4OA 1GGTA 4U1SB 3GUTA 1KXTB 3BVNB 1BJMA 3HLAB 5EUKB 1SJHA 3GKWL 3DURB 5F7LB 1I3RB 4KY1H 4JZOB 1J0IA 5ESAB 3UZEA 1MCLA 2YPLD 1YEGH 1HKFA 3PP4H 5T1KA 3U82B 3C5JA 1KJVB 4K8RD 3VXTA 3LQAC 1T2XA 3BQUB 5C07B 1N0XL 4PGDB 1RZJL 1C12B 1ZKAA 4QRUB 3VFSA 1A3RL 4IRJD 4MJ4A 4YQXH 2GTWA 3QXDB 4CVUA 4ZYKA 4KJWC 4RWHA 4PRIA 3T0XA 5DWUH 4DUWA 1A2YA 4G9FB 3BPLC 4Z8FH 1DBAH 1RZFH 2FEEI 2X4OA 3D0VA 4NO2B 4U6YA 1Y0LB 1QQDA 1K2DA 1CFTA 5FA4B 2VDRL 2EYRB 4IRJA 1XF2A 1C16B 4Y4FB 1I1AA 4NSKB 5CMAB 2PNDA 3BPCA 4NRYB 5I30L 3MRQB 1UWEH 3R8BB 2V2TB 2A6DA 5ADOL 2R23A 2YC1B 4ZFFB 2Y7QB 1FYTA 5D1QD 4NZUL 1K5NA 4OCXH 4ZAKC 4JJ5B 4GQ9L 3WLBA 3HZYB 1QPXA 2W9LA 2FB4H 2YOCA 4UDUB 3MNWB 4DCQB 3O6FC 1XGUA 5ACMA 1UXWB 2V7NA 1CE1H 1HE7A 1X44A 2ZCHL 4JFDB 4JPIA 2V17H 3UPAA 3BKJH 3SOBH 5CCKL 2VLRA 3IDXL 5I1AB 1YNKH 3V0AC 2YEZB 4LCIH 1DVFD 1XIWA 5EO0B 4TSBL 3NABH 4UTAL 1P9MC 1RFDL 4KI1A 1IFHL 2LV4A 3BD3A 5J1AB 5F7MC 1WWWX 3H9SD 1LDSA 1W72B 4TULH 2VL4A 2NY5C 3ARBC 2C26A 4LHUA 2XTJC 4JKPL 5D7LA 4NKQB 1DVFA 2E6QA 4ODSL 3REWB 4WCYL 4CUCA 4P5TC 3FN9A 1WBZA 3EOAA 2OXGA 3OGCA 3GSQA 4P5KB 5D7JC 2Z8WC 5T1MB 5I73B 4OF5A 5DJ2A 4DN3L 3RGVA 2EZ0D 4OZHE 1KPVB 4W6XB 5GGRA 3EOYG 4JLRA 4XPBH 2IWGA 3TESA 3MA9H 1SBSH 3LN5B 3RUGB 3FO0L 1NEZA 3SKJL 5I18L 5J89A 4ZTOL 3IDNB 2H45A 3S36L 2NXZC 4HFUH 1GRWA 3BUYB 3FRPG 1IL1B 1V7NH 1EFXD 3C6LB 3KHOA 3MOQA 5I8EB 3GSNB 1K4CA 2P47B 2AW2A 5IGXH 4DQOL 4XP5L 1UZ8B 5D1QA 3RA7H 2IEPA 4I3RH 4G9DA 3DMMB 4XBEL 4QRRA 3O8XD 3Q0HA 5LCVL 1OAZH 4AEIL 1QFUL 3KPPA 4KMQA 4MCZB 5FO8A 4GG6E 3HCVA 3S8WA 4DN4L 1HOCA 1I8KB 1JGUL 1EEUA 4Y19B 1T7YA 2F19L 4OTXH 4LAQH 3MUY1 5DUML 4CMHB 1OWRM 1U58B 3IFNH 2XOTA 4EI6A 2Z31C 3BH8A 3L5XL 1FIGL 1TZGL 5SWQB 3QNYA 1EMTH 1UC6A 3CFBA 4JDVB 5E1AB 4QWWC 3C8KB 3SOBL 1BVLB 4M62L 4L8BB 3TM6A 3SDDC 5CD3B 4X99B 1OAXL 1J1PL 1G7PB 3OKMB 1EJ6A 2P5EE 3BI9X 3TN0C 1ORSA 2DQEH 4Z7VA 1WICA 3CGTA 3WIHL 3AS0A 1DQLL 5INCB 4YE4H 5LQBL 3SKMB 4HUUB 5IVNA 4OFYD 4XP6L 3GBLA 4Z0BH 4HIIA 1AJ7L 4OTXL 2Q3AA 3H9SE 5FYKD 4KGJA 4POZD 3WS6A 1PKQA 3RKDC 1OAYL 4JFED 5LG1A 1JPGB 1LO2H 1U6AH 4YDVB 4M6OL 5CMAA 2LVEA 3EOTL 1FH5L 3VD3A 3REVA 5L0QB 2E5EA 1C5DB 3SKJH 3WIFB 3MOAL 1URLA 1DSFH 5DD6B 4YC2C 4OKVA 3BXNA 3QWRD 4UIKL 5K9JL 1CTNA 1KLGA 3DGCR 3S98A 4KK6C 4ZO8A 2PYEE 3HPLA 3GBML 4JREB 1BZ7B 3VXTB 3C5JB 5CINH 2YHGA 3PGDA 1P53A 1YJDL 2KDGA 1DVFC 5C1MB 2JB5H 3EAKA 4Z18A 3VCLB 5HHOA 4N5EC 1MQKH 3P30L 2FO4B 3FO1A 3WKMH 3BKYL 4KRPB 3GMRA 3VWJB 5BVPH 1KLGB 4WCYH 2BERA 3O11A 3QHFH 4ONFL 3S96B 1U3HB 1TIUA 5D71H 1MCQA 3UP1A 1NCNA 3SCMD 3HZKB 3I85A 1HH9B 1C5CL 2PF6A 2ILLA 4S2SA 1HKLH 1ZVHA 4YHMH 1N5AA 5GS0L 3RWCA 5DVNA 4DVRH 2QSCL 3RWFA 3GNML 1QHOA 5KJRL 3MREA 5K9KB 1QPPA 4NFCA 4PR5B 1LE5B 4UBDD 4M8VA 5C0BB 2G75A 3WS3B 4M4PA 4ZPVB 1G1YA 4ELMF 1L9MA 4FNLL 3CD4A 2Z9TA 4NNYB 3VJ6B 3F8UB 1N64H 3CX2A 4UV7L 4M61A 3MRHB 4QHNA 4N9GB 3BWUC 4P4KD 3G6JE 4WJ5B 5EZJA 4OZIE 1NMBL 2BSED 5GGRY 3QSKB 1T0PB 3RZWA 3CCHA 5DJ8B 2CGRL 2OM5A 3QEUB 4FQIL 5JIHA 1BLNB 3BJLA 3FQNA 3HE7A 3MOAH 4PREB 1S3KH 3VE0A 3ISWA 1DTUA 1CLOL 2Z8RA 1KNOB 1DQQB 3BMVA 3BZ4A 4PRHE 4U1IB 4GLRH 2XQYG 1N59B 1XCTA 5IW6A 2CO7B 4IMKA 5L8JB 1XGRB 2P49B 2IAND 4MX7A 3HCVB 1MIML 4NN6C 2F53D 2AV7A 4X7TA 2HP4A 5D7JB 3KPPB 3BPNB 2DTSA 5CJQL 5FOBB 3WLWD 1BVZA 1E0OB 2FECI 4IMLA 4HUVA 4YDJA 5ITBH 4GRLA 4R26L 4WFFE 1G7IB 4FABL 4TNVK 3RWIB 3PWVB 1T5WA 1YMHA 2BVYA 4J4PA 4JCLA 3U4EB 1XIWC 3FOMA 1TCMA 2FJGB 2EEDA 2HT4C 2NY1D 3OJDA 4YDIH 3QDJB 1UXSA 2JJSA 3PV7A 2XYCA 4LDOB 3I6LE 1A5FL 1A6ZB 4JFOA 4NJAL 3FO9A 1GSMA 5DSCB 1Q9OA 4ZG1A 1LP9F 2EIBA 3PDGA 1RUKL 4NQDD 2CO6B 3LIZL 1JPTL 5DS8B 1F8TH 4OM0L 3MR9A 3D25B 4M5ZH 5E4EB 4PUBL 5FYLD 5EOTA 4KROC 3VXSA 4HH8A 5D8JH 2J6EA 4KK6D 1MCDA 4YIQA 2AEWA 4PPTA 1HQRB 4NNYA 4WTZA 1JFQL 2LU3A 5DRZA 4XVUD 2AJSL 3BAEL 2ZCHH 4X98A 4C83B 4F7MA 3U79A 1CR9H 1FFRA 3MMEA 4ALAH 1VCAA 4E42B 4OM1H 2NY6B 4GRWE 4IRZL 3CMOL 4I5BB 3PABA 4NUGH 4GAGH 3MCLH 5CP3H 3SE8L 4MXWH 5C0NC 2VLMD 3UYPA 4HWBA 1CDHA 2NY4B 3T8XA 5DLMH 2VLKD 2VR4A 4JDZA 4UI2A 5JQHC 1MHPL 4LLUB 1F8TL 5IESL 5D1ZD 4HJ0D 3BQUD 5F6IB 1ZWIA 2OZ4A 3VXRA 3O4LA 3VXOA 1BQUA 5ERWA 4AIZA 4FQQB 4LOUC 3VFUA 5EFIA 3SDCB 5B38B 5DC0A 2OTUB 3TO2B 2I25N 5GZNC 5CEZE 5HGGS 4NBZB 4M02A 2PR4L 2YKLH 3ROLB 3H9SA 1B90A 4S1QL 4HS8L 2VXTH 3ZKNC 3VXUB 4Y4FA 4OGAD 2FR4B 3M07A 2YRPA 3OWEA 1NSNL 1U92A 2XTJE 1VERA 4PB9L 4FNLH 3CC5A 1JZ8A 1XR8A 5CLWA 2HFEA 3O8XB 1U8OB 1RZIA 4Q6IA 1MVFA 1MFAL 5DD0H 4ZYKB 4CVZA 3HC4L 5IW3A 2H6PB 1BEYL 5HHMB 3K0WA 5EA0L 2HLAA 2HLAB 15C8H 1KYOK 1P4LA 3T0ED 3NN8B 4OCNC 1M4KA 1S7TB 1HHJB 5E2UL 1G9NC 5EORL 1U8OA 3T2NH 2QQLH 4HC1L 3BZDA 3T4AA 1VFBB 3E3QE 4PJIA 3DX9B 5D7IE 3L95A 1PEZA 1MIEH 3OF6A 4OUUB 1IC7H 3REVB 4C4KT 4ZS7H 1PY9A 1LMKA 4QXGL 3T0EA 4WWKD 5D2NA 1NFDB 3QIUD 1QSEB 4ORZC 4KH2A 2VDQH 4NZDA 2FBOJ 4XCNA 1ORQA 3IAGC 2DIAA 2IQAB 1IEBB 4QHMA 3KJ6L 5ADPH 1JZ7A 4PGZA 3BZFA 1S7RA 4LARH 4PJEA 4C4KO 3SKOB 3PV6B 3CFDB 1JPST 4QF1B 2EDFA 2XZCL 3ZDXF 2J6EH 5TDNB 3CDGB 2ZOKB 3I3BA 4TVPE 4O4YL 2XKUA 1R3JA 1T2QH 3QEUA 1B6UA 4KJQD 3CFIC 4FQJL 3EKCA 1BOGA 1DL7H 4FFYL 1AIFA 2J8UF 1SJEB 4IOIB 4P2RE 4JM2C 4F3FA 3RAJL 3CNKA 3EFFB 1WUNT 3L7EB 1G6RL 1DANT 4K2UH 3V5DB 4NUGL 4XBPA 1KN4L 4PJ5E 4PJXA 4OCSL 5SWZE 1R6VA 4QHKJ 1KJ3L 4M61B 3OXSB 4HS3B 3QH3B 3MRNA 4JG0H 5I1DA 5D1ZC 5A3ID 1YDPA 2HMIC 1YDPB 2UWEA 1CDJA 5F97E 5GRJL 3HZMA 4HCRH 3QFJE 4X6FB 1BD2E 3V52L 4U33A 3QUZC 2CK2A 4YHIB 4GUPA 4JRXB 1BX2A 4LHUD 3MREB 4ZXBB 3V95A 1B6DA 2P8LA 3PNWB 3L5WB 4LPXA 1HCVA 5HYQB 2F19H 4KHXL 2BXYA 3DWTA 3MV8B 2X1QA 5JORA 1WVZA 3QO1B 5EC1B 1HHGB 4OFIA 3JWOH 5E5RB 4PGBA 2CKBL 1AI1H 5E6ID 3ZT6A 4YHLL 4LU5H 2E27L 1G7IA 3IAQA 2A74A 4ZXBD 4H5SB 3WJJC 2BY2A 1SYSA 1RHHB 4ZNEA 4PJ7F 4BYHA 1UH4A 4RMSA 3ZKSD 4D0BB 4JZJA 4LIQL 2VH5H 1JYNA 4I8DA 1IEAB 3G6JF 4F37K 4NDMB 5T3ZE 3V6OE 1UVQB 4BQBA 2NY3D 2UY7A 5H8DA 2MCPH 1RQ5A 1G7LB 3I9GL 3HNVL 1TITA 2HFGL 5C0AB 4O58H 2W38A 5I1CL 1CIUA 4MXQC 5GJTL 2OK0L 2BZDA 2YKLL 2H32B 1OD9A 3BD4A 1ZA6A 4X6EB 3PQYE 1B0WA 1FL5B 5DD6A 3SE3A 5F8RC 3FRUB 3FQTB 1FNSH 3MJ9H 2EYTA 4LOUD 3DVGB 3LMJH 3MV01 1HH6B 3GSXA 5ENWA 4XRCB 4K7FA 5D2LF 5EBMA 1AGFA 1MH5B 4FFYH 1H3XA 4HUWB 1EUUA 3E6HB 3ABZA 5T3ZL 1FDLL 4JJHA 3MRCA 3T09A 4PJGE 1L7IH 4JDTL 5CGMA 1RK0B 4YHYC 1UWGL 3U0WL 3L7FB 3C2AL 3Q48A 4NKOB 3UTQA 2EO1A 1JN6B 1JNHA 1KLFA 3FFDB 2HVKA 3WNKA 1ITBB 1P7KA 3TYFB 5CKAA 1F90H 2F54E 2AJZA 1CLYL 4LCCA 2WBJD 3T8XB 3MUZ1 3MLWH 5INCA 4YPGB 3LRSB 2R69H 4I4WA 3MRMB 2D7TL 3G08A 4HV8B 4PJ5D 1QR1B 2FWOB 5F70A 1INDH 4CVWA 3ZDYE 4KVCH 1T7XA 2OCFD 3NBNA 4EDXB 1HH6A 2VN7A 1IGFH 5ID1A 2DLFH 2OJEB 5I75C 3CFBB 3ZYIA 1YPZE 4MNQE 3GHEL 3FRUA 3FQTA 4UIMB 3VDCA 5J56B 4LLYB 1NEZG 4ETYA 3BH8B 3SDAA 2EICA 3VWJC 3GIZH 3VGDA 1CXLA 5DC9B 3IXTA 2F74B 1P2CA 2GY5A 4D9LL 4XGZA 1X3DA 1BQHG 3ARDA 2CDEA 4C57C 1C12A 4NN5B 3TV3L 2F9BT 4XBEH 1OCWL 2AJUL 1X5AA 2IAMD 1OAZL 3RA7L 3EW3B 1L6ZA 4F8TA 4KTDL 1TJGH 4Y2DA 1TNNA 3KYKH 5AWNH 3ALXA 1NFDF 1QR4A 1ZANL 3VH8G 4D0BA 2H9GA 5TE6H 4R7NA 1INQA 1CG9B 3RIAF 1Q1JH 1P84J 5FAAA 5C6TL 1TTUA 3D18A 5JHDE 2O5YL 5GIRA 5J9PB 4PJ9B 3X14A 5JW4M 4TQEH 5F1IA 5EUOA 2PO6A 4XPBL 2KQMA 5IVXF 2IADB 4PLNC 2I9TB 1D5IH 1SBSL 4JFPB 3SJVB 3SKUD 4OV5A 2EC9U 1RJLA 2BOCB 4OBSA 4OLXL 4FHBD 1X7QB 2BSSA 3IRZA 2DQDL 2X5PA 3GHBL 5JOEA 5IOPB 3IFOB 4P9ML 1IAOA 2C3XA 1JHKL 1OP3K 3T3PF 4OF8A 4JRXA 5K59E 1XCTB 5IW6B 2OL3B 5I73C 4ZO9A 2BCKB 2EEBA 3LKOA 3PWPB 2VUYA 3T0AA 2DQJH 3L3GA 5C8JA 1KN2H 4J12A 1I7RA 2RGSA 4KTEL 2PYFB 4FP8L 1G9MC 4Z0BL 5ANME 5HVGB 5IBLD 5TDPA 1A7OH 4JRXD 3FTGA 3IFPB 1FLRH 4NKMB 4UB0H 4CMMB 3QDGE 1KTLB 3W5MA 1M05B 4YHNA 4I3GA 2W91A 6FABL 2OJZH 3SN6N 2CD0A 4P4RA 1NCWH 3LKRA 5E8NB 1E4KC 1QSZA 5D7SH 4B7LA 3IGAA 3IFPA 5TDNA 2HG5B 4U6XB 3FO2A 4K23H 1G84A 1YN7B 4F9LA 2B0SL 4QF1A 3ILQC 1PFCA 3ZE1E 1CF8H 4UQ3A 1HILA 4EBQL 3BP4A 1J8HA 4YDLC 5ESVB 1BECA 3BZFB 3IRPX 2G75B 5C0BA 3DNKA 1EFQA 3CSGA 4JGMA 3VA6A 3PJSB 5EULV 3QXAB 3W0WA 4NGHH 4Y8DC 5I1HL 3E6FA 4I9WE 2V7HA 4ZFZA 3ARGD 2VXTL 3O9WC 5JHDD 2ED7A 3GSUB 2EH8L 3K4DA 3N9GL 1K4DB 4U6YB 3B8SA 5M95B 1KTKE 2UYLA 5ALCL 2EC8A 2ITCB 4HF5L 3HI5H 3ROOB 5K9OB 4FFZL 2W1NA 4UAOB 3GSNA 4OQTL 3S88H 4PJ8A 4NQDB 5DFVC 2LQRA 4NO3B 1U6AL 5ICYB 3DO7A 2ZUVA 5IR1B 1WFUA 3GMNB 1FL3B 4Z7NE 1EHNA 4MD5A 4H1LB 3DIFB 2ZZUT 4I18B 5KSUB 5FO7A 3UTZA 3EBAA 1EO8H 2XNAA 4EBQH 3NFSH 2P5EA 2F5AL 3MCLL 5F1SA 5DMKB 4G8EA 4N8CL 5KJRH 1FZMA 3MACL 4L3EB 3CMOH 2ZG2A 2G5BB 5KOMC 2HJKA 2AEQH 3ZE1F 2AXFA 1EA9C 4GSDL 3PWJB 4MJIB 1MCOL 2DLEA 3UJIH 4EUPH 2YD5A 3LKNB 3U7YL 3RPIA 4YFLF 3UTPD 5TGBA 2DWEA 5E6ZA 3MLSH 3OXRB 4S1QH 1T0NA 1NCCL 1TVHB 3O2DH 2N56A 4AQ1B 4YNYB 2P5WA 4DZBA 3AAZA 1LGVA 1NBVH 4OFVA 2X89A 5DD3L 5I76B 2JF1A 1U3HD 3HPJB 2PO6C