4HGWB

Crystal structure of s25-2 in complex with a 5,6-dehydro-kdo disaccharide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
213
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody Fab fragment, light chain
publication title Exploring the cross-reactivity of S25-2: complex with a 5,6-dehydro-Kdo disaccharide.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 213
sequence length 221
ec nomenclature
pdb deposition date 2012-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgwB01
4JANA 5IEHB 5L0QC 3LN5A 4JB9H 1WV7T 3VXNA 4JY4B 1ZGLA 3QFJA 4XP5L 5JUEL 1DBJL 3LHPH 2EXYD 2JJWA 3GM0A 4YXLH 4ONOA 3RIFK 4L8DB 1FFQA 5I8CB 2HFFA 2CDFA 1KFAL 5DC0A 3UZVB 3MLTA 4V2BA 1WBXA 1LO2H 4X7CC 2SEBB 4GRLC 5D7JC 3U7YL 3Q5TA 4HCRH 1EFQA 1FFPA 2X5PA 3E3QE 1CD8A 4Z6AT 1VPOH 3GMRB 4KGJA 1TJIL 3BH8B 3L7FA 3QUXB 4V1DE 4D9QE 5H2BB 1DR9A 3MTRA 1F8TL 3IS0X 5FFLA 3U0WH 4K3JL 4RFOH 2IPUG 4PLKC 2VLLA 1AH1A 1EVUA 3UPRB 2X42A 1RFDH 3ILPB 4WCYL 1H8NA 3G9AB 1IFHH 4HIIA 4XP6H 3CFBA 2IG2L 4PGCA 1DDHA 4APQC 3L1OL 1IGTB 1BD2E 2VQ1B 1H5BC 4XWGL 2P24B 3BZFA 3EGSA 2X70B 5FOBA 2Y6SD 4H5SB 4G43B 2R0KH 1OL0A 4PJ8B 4IS6B 1CU4L 4NO2B 4KQ4L 3FB7A 4WNQA 1WAAE 4QOKD 3IDIB 5DMGC 5IW3A 2FEEI 1N2RB 4JFOA 3ZTJG 3WFDL 1OTUC 5I16B 2DWDA 4KFZC 1UKQA 3PWNA 5FYKE 5J1TC 5CHNB 3O3EA 1HNGA 5D2LF 3MFGB 8FABA 2CMRH 3HI6H 3KWWA 2GT9B 4M6NH 2QJDA 2P8PB 4GXVH 4P23D 3QI9A 1CF8L 4HZLB 3LEYL 3RY5A 5DQ9B 1U3ZA 1SY6L 4JLRA 3I75B 4Y5VA 3QHZH 4K3DL 2UYLA 1HH6A 3PNWB 5ACZB 1OAXH 1HIMH 1WBYA 1NEUA 3DVNB 2FH6A 5IR1B 1FN4A 1MI5A 1N26A 4WIQA 3PQYE 1XCQB 2XG5A 5JXAH 5B4MC 3QG7L 4MHHG 4OF5A 3QUKB 4POYA 3FN0L 3GI8L 3HNVH 5CJOH 1N5AA 4PJXE 3GRWL 1JI2A 2WIMA 4FTVE 4W4OC 5E7FA 1MCCA 2ADFL 3KXFD 4GRMA 1GSMA 3IDJA 2R23B 3S36H 3MBEB 1GZPB 1N59A 3BKCH 1NBZB 4OCWL 3OL2A 2A38A 1NCAH 2HG5A 5AZEH 3IXAB 1KLUB 1TVBB 3VI3F 3KAAA 1B0RB 5J7CC 5HVHC 4P3CL 3BYYA 3X3FL 1SHMA 3VDCA 1LQSR 3LKRB 4F9LA 5SWZD 1A2YB 1BP3B 5TE4H 4LKXB 3PE9A 4XI5C 1C7TA 4RBPK 3STLA 4LPVA 5HGDB 1BGXL 5DSCB 2AGJH 3VFTA 1AFVL 4BH7A 1J8KA 5K33A 1DUZA 3VWKC 3TIEB 3D39A 4H20H 1I9IH 2DLGA 4QGTA 2ZUUA 4DK3A 3S96A 4JRXA 4MQXC 3CPLA 3NZHH 1DQJB 1UG9A 3HAEA 3MUJA 4JFEE 3CZFB 5GHWL 4XVTL 3F5WB 4P2QB 1IC7H 3D6GA 4XNUH 5HD8D 3QNYA 3L3KA 1FYTA 1J8HE 2HMID 3S37H 4FOMA 5EA0H 5AYUL 2YPVH 3FQNB 4HFUL 2JTDA 4PRIE 5DQJB 2C3WA 5DURD 4ZG1A 5B8CA 5FUCE 5CEZH 2ITCB 1RULH 5CCKH 4Q6IC 2VLKE 5EOCJ 5ALBH 4DKEH 2NY5C 3SDDC 35C8H 3AS3A 4I0PA 4NQXB 2E6PA 4JN2B 4HIJB 1VESA 4LMQE 5AUMB 2O93L 1FO0B 4MA7H 2PW2B 2BNQA 3QIUA 2OR9H 2IBBA 2GJ6A 3OR6A 4HKBA 4M3JA 3ZTJH 2P5WD 4C83B 2KDGA 2GJJA 1UM4H 5IHZA 3IU4H 4XC3L 4WW1A 2Q7YB 5FF6A 1FNGA 1A1NB 1FVDB 2WLZA 1Z9OA 4M62L 4B50A 1EPFA 4LVNC 3TBSA 2PO6D 5IB1A 3TBYA 5JPNB 3A6BL 2AAVA 4NM4L 3SKMA 4KPHL 2CQVA 5GS0H 2OXHA 1BFVL 3T0EC 2Z4QA 4IMKC 3Q1SH 4KKAD 3VXRA 2Z91A 3VXQA 4M9PA 4PG9B 4KK8D 4Y1AD 4D8PB 5F9JB 1BECA 3RA7H 1R5IB 5DFVC 2AKRB 3BGFB 2D4DA 5GJSH 1CDBA 2NTSP 1MVFA 1WCBA 2OR8A 2H9GB 5FK9B 1K9TA 4ODSH 2FGWL 2CKBB 4HH8A 4OQ1A 4RAVA 2AJVH 1EK3A 1YY9D 2AJXL 3VD4A 1VKXB 3MRJB 4PP1D 1IM9D 2BCKA 4YR6A 1D9KC 3RTQB 1AQDA 2Y1VA 3QHFH 4GRLA 2GK0B 5D7JA 5IOPB 2OI9C 4KZDL 1ROWA 5I75B 3MRBA 3BN9D 1PVHA 1A6VL 2GTZB 3RQ3A 1BEYL 1BHGA 1EHAA 3ORJA 4NZDA 1Z0MA 2PYED 4KK5D 3HZYA 3C60D 3G5ZB 3ZKMD 1QTYT 3OKNB 1KUMA 1GPOH 3TWCL 1AI1H 5IT2H 2E7HA 2HAZA 5HGAA 1KLGA 3CFKA 4YZFF 4V2CB 4PRNA 4FFZL 4APQA 1A7RL 3BUYB 3ZKSD 1KB5L 1H0DA 1H5BA 3O6FC 2OZ4L 5HVGB 3BPNB 1I3RA 4YHNA 4JFFA 5FUOH 5C0AE 2FL5A 1NFDA 1I1FA 4MJ6B 3X11A 5I17B 2YR3A 3GJEB 1IL1B 3MNWB 4G6FD 3FO2A 4JVPA 5DI8A 5DMYA 2AEQL 3RAJL 5F96H 3AREC 4Y0GA 3TNMA 3RRQA 2X1QA 2X4UA 2CRIA 2VJXA 1K8DA 2IANB 5GXBB 3SGEH 3L6FA 4Z7UE 4YUEL 4DKFL 1JWMA 2BC4B 2XQYG 3MRGA 1JZ3A 1WEJH 3OAYH 1SJHB 1M7XA 4HV8B 3MR9B 4HD9A 4X5XA 3ECBA 2XTJD 1JF5A 4OCLC 4WFHE 2PXYB 4XBGB 5L8JB 5ICZB 1AGBB 3QEQE 5TQ2H 5I8EB 4FA8A 4F2MB 4AEIL 3K1KC 3VD9A 4XNMA 3KPRE 1OP3H 3VFUB 3EYSH 2LQRA 2GKIA 4RAUA 4EN3D 1QLEL 3P9LA 3I2CH 4Y2DC 1S7QB 3MRHB 2Y5EA 1XGRB 5HI5C 5I1LA 5E2TH 1NAMA 2Y9RT 4NBYB 4LCUA 4W4OA 4YLQT 5GIRB 5DLMH 4M93B 3WXWH 4TRPH 2NXZB 3MV7E 2FEDC 5E2JA 4LGRB 2R0LH 4FXGA 1PZUB 3FZUD 1JNHB 1UKTA 1DEEA 3PGCA 4OD2B 4DN3L 4U1KA 4DUWA 1A64A 4FXKB 3TCLA 5JXED 4L8CB 5ITFB 4KI5D 2HJFB 1FFOB 1A7NH 2AJZA 4CVUA 4HBCH 3IDNB 1NAMH 3DIFB 2PF6A 4IBLT 1D7FA 5JIIA 2YPLE 4IMLB 4KTEL 5K9KB 3ULUD 4GAJL 1YUHB 4D94A 3CX2A 3V7AE 4OCXL 4V1DB 3QUYD 4UU9A 2ARJA 3TJEH 4TSAL 4YPGA 4PJBE 2Y7QB 3D3VA 1L7TH 3VRIA 5C70A 3VWKA 2F53E 2A1WL 1N3NA 4MDIA 4GMSH 3GNML 2GI7A 3EOYG 4P4RB 4XBPA 1JZ5A 2ESVD 4S1DD 2DQCL 4R4ND 4X83A 2BSED 2JE8A 2X4RA 4U7KA 1DP0A 5TDOA 2MSPA 1BD2B 4HG4J 1CGWA 4QT5B 4Q6IA 3B9KB 4H1LG 5C0BE 1SVZA 3C8DA 2W0LA 3LKPA 2FX8H 2X4NA 3SDDA 4P2RD 2XXCB 1LDSA 2ZKHH 4O9HH 3MV8B 1MFAL 3L9RA 2WINA 4XMPH 3S4SA 1GGIL 2Y72A 3S35X 4TTGA 2FDBP 4XCCL 4M7LT 1YC8A 4Q97A 4CJ1A 4XNZC 2Y6SC 1U92B 3GI9H 4OZFA 1QACA 4JHWH 5F89A 5I1CL 1MQKH 2FR4A 1TJGH 15C8L 2FO1A 2NW2B 1XCTA 4P5KB 2EDJA 3HCVA 3GUTA 1H15B 3P4MA 2NY5H 1K85A 1UXSA 1UWEH 3VG0H 4ZO7A 5KVDH 1EO7A 1Z0NA 1FJ1A 2QSCL 3HE6B 2XY1A 4M43L 3RZCD 4Y4KD 5HHMD 3T0EA 4IMKA 1JCKA 2B1AH 1S7XA 4RGMB 1GOFA 3T3ME 2NZIA 4XXDB 5C6TH 2X1WL 1AGEB 1FLTX 5AD0A 1W8NA 4P23C 1G7HA 3H3KA 4OZFH 3P3YA 3PQYB 3RU8H 1KB9J 4NT6B 1L0XA 3QULA 5GZNC 4NGHH 1U36A 4PJXB 3BAEH 4FTVB 4R2GC 4IOFD 1QBLL 4YHKH 4UOJA 2W0PA 4U1SB 1OPGL 1U42A 4GXUN 3QISA 5IQ9A 4LIQE 3RGVD 1D9KA 1IAMA 5I76A 4S0TD 3GMLB 5EULV 5HYJD 5IB2A 5EUKB 1FL6B 1RZKC 3MCG1 1KCLA 2YUWA 5KAQG 3DVGA 2NTFA 4QO1A 4Z0BH 5I1DB 4X4YA 1ORQB 3WSQL 4Z7QE 1JFQL 1MFNA 4H1LA 3U1SH 4GO6B 5JO5B 4P5TB 4QXWA 3CK0L 3QDJE 1TPXB 3NMEA 3HC4H 4LCWE 1FGNH 5FXCH 1YYMH 2BRQA 3HUJF 3KVQA 1JV5B 3IAGC 1EEUA 4RIRA 3O6FA 1OARL 4ZUVA 5BCAA 4QRTA 4OZ4A 1L6ZA 4G8EA 1WIUA 5I0DA 1FNSL 5IF0B 4PRIB 1RK0B 4F15C 4LSQL 4KRMB 2VLKB 4H1LH 3D2UA 4HWZA 1S9WB 3AREA 1GIGL 2NY6D 5FB8A 1HKFA 2JB6B 5GSVB 4QY8B 5IFJA 1Q0XL 1Q72H 4R96A 2R4RH 5MI0B 1NGZB 2UY6A 4X6DE 4XCEB 4L4TB 2LVEA 3WE6A 1ORSA 1QHPA 5D7KE 4L8BB 1OCWH 4G8IA 4ZDHA 4PRHB 2XIDA 3NACH 5BV7L 1LMKA 4ZQKA 1NGQL 1WVZA 4Q2ZA 4FFYL 2D7TH 1KN2H 4PB0H 2D3VA 3KJ4C 5DQDH 4FN0A 4G6MH 2FECI 5I6XC 2ATPB 1W2KT 4Y2DA 1R3IH 4MS8D 3GIVA 4NIKB 4ODUB 1MCFA 4GBXB 4UT9H 2OMNA 43C9A 3F7VB 4LSUL 1KJ2L 1GZQA 1OAZH 1PKQA 1W0YT 4R6UA 1QZ1A 3VMOA 4QYOA 4U2YA 4TNWF 3LKOA 1FRGL 2P44B 2AK4B 1RIHH 1AXTL 3BEWB 4N5UA 3BKJL 2VKWA 5DJZA 4JY5H 4Y7MA 3GMOA 4WFGD 4PJFE 5AG9A 4KK8C 3PGDB 2PTTB 4NQSB 5DMKA 4OT1L 1Z9MA 3NOIA 1XF2A 5CBAA 1O5DT 1QQDB 2GSIA 2EH8H 4PJEA 5LCVH 3QO0A 1B0GB 3VCLA 1P4LB 4XGZA 3Q6FB 2RFXB 1UCBH 4Y4FD 5F7LB 4ZPTA 4CU8A 1OQXA 1YY9C 3DGGA 4I5BA 1MCEA 4K55A 1OWWA 4HS6A 5F9AC 5DC9B 5DVLA 1N6QH 4UZGA 3TV3L 5DRXA 2GAZA 4PG2C 5D72L 3QA3B 3BN9C 4TVPE 3KYMA 1A5FH 3TH2T 3ROLA 1P2CA 1FFRA 3OJMB 1CLOH 4I9WD 2OTPA 2XYCA 2EECA 4L4VB 2ZOLB 5JW3H 5ADPH 3ZKMC 2HH0L 3QDMD 5KVGH 3D0LA 1UA6L 5C0AB 4NNYA 3IJYB 3T2NL 5EU6B 4PY8J 1EXUA 3MLWL 4L9DA 1D5ZB 4LDOB 4PV8B 3T0BA 1XMWA 2D03L 5BMFL 1BZ9B 4EI5D 1LO5B 1PX3A 5FOJA 1ZLSH 1NJ9B 3QH3A 2BXYA 4K71B 4MXWH 2ZOKB 3N1MC 3UJTL 4S10A 3UO1L 4QOKA 1KEGH 3LKQA 2DIJA 1XH3B 5DJAB 3KPNB 4U1NA 5CJ8A 1F6AA 5INDA 2APVA 5IVZA 3LN4B 1AGFA 1GGTA 3QEQB 4PJ9A 3TT3H 4EDXB 5DWUH 3CFCL 1ACZA 3KPRB 3FQWA 1F00I 5SWSD 4UAOB 4P23A 5J8OA 5E1AA 4WUUE 4XCYB 2C9AA 4FQIL 4G9DA 1J1OH 4JB9L 1EGJA 1T89C 3ARVA 43CAB 1SVCP 3LHPL 1IAKB 2YBRB 3LMJH 4GKOA 3VI3E 4AH2A 4QHLB 5J06A 3OXSA 4YXLL 2C26A 4EN3C 3LQAC 3CZJA 1TMCB 3TA3D 1KJVA 3UBXI 3JVGC 1NFDF 2DLEA 1LO2L 1YMHA 1ES0A 3R1GH 4HS3A 4HCRL 4NYLB 1F3JB 1VPOL 4P46D 5IB5B 4HMEA 4KRNA 3JWNC 3VW3H 1EGJH 2J8OA 4AIZA 3FZUC 1F11B 1C7SA 2I25N 3C6SB 2MQ3A 2Q86A 2YPLB 4L9LB 3U0WL 5DK2B 4MMZC 4ZOCA 1MRDH 4RFOL 4HAGA 1RD6A 1JN6A 4TYUA 5KJRH 1S7UA 5C09B 3LEXB 4NKDB 3RP1A 1RFDL 2VRAA 3X12A 4WY7H 2DKSA 4CKVX 2F53B 3VG9B 4DOHE 3D0VA 3SDCB 2BVPB 3FMGH 4ZTPH 4XP6L 4YK4B 3E8UH 2APXA 2N1KA 3QUYC 1RZKH 4AYFA 2LAGB 5TH2A 3LH2H 1CFNB 4OUUA 3KPSB 3LN9A 3QJHB 2WP3T 1PDKA 1QPXA 3NAAH 1S8DB 1AC6A 4N9GA 2R0KL 4QHUA 5K93A 4TUJB 1NPUA 3OR7A 3TLRA 5ETUB 4UIMB 4S1DC 4R4NC 2V2TA 2YA2A 4GLRH 4LLUB 3QUXD 4M8QA 1NDGB 2DS4A 1HYRC 2VABB 3SY0A 1MJJA 2DJUA 2NQCA 4HX1B 2ICWA 2H32B 3CH1A 4PTUA 4Q9BA 5LJYH 2CMRL 3HI6L 4M6NL 2BSSB 3NFNB 4GXVL 1I7RB 2F54B 3VGFA 1R3KA 2DM4A 5CEXB 4U6HB 4PREB 2FGZA 1BBDH 2DOCA 3ME0A 1YECH 3QHZL 1JF1A 4JCLA 1Y0LA 1EJOH 2P5WA 4XB7A 1MH5A 1OAXL 2QSVA 1HIML 1T0NA 5DJXB 1DBMH 3A6OA 4UUJB 3QUMA 4ORGB 5KOMC 2AJ3A 4CVWA 1PQZB 5JXAL 1QFPA 5AAWA 2C3GA 4PJ8D 5CJOL 3VI4F 3HNVL 4MWFB 1FL5A 2Z31B 5ACLA 1UQSB 5C9KA 1ZWIB 4Y4KC 4Y8DC 3RJQB 1ZA3B 3S36L 4TVSa 1A1OA 1IQDA 3BKCL 3KLAA 4YDLB 2I9LB 4N68A 4P0DA 2JK5B 3CDCA 1QA9B 1HQ4A 2R56H 1NCAL 4Z7OF 5AZEL 2OJZH 2CRYA 1AP2A 2LFGA 1X5KA 5DJCB 3I02B 4PV9A 4K07A 4PRDB 5EH1A 4PGBA 2JIXA 2Y4SA 1HQRA 3D5OF 3EIFA 1J18A 4KI1A 5J13C 1Z9LA 3P73B 4MD0B 4IOFC 5TE4L 3GHEH 5IMOA 4AK1A 4YZFE 2CRMA 2GJZB 5FO9A 2C1OB 3RNQB 3KYNA 2EKJA 2CGRH 2AGJL 1IM9A 3ZHKA 3RGVC 3MBXH 3QG6A 1AGDA 2WMPA 4JPVH 3V6BR 3BJ91 1MCPH 4H20L 4PG2A 1I9IL 5FHAH 4PY7B 4OZHA 3P0VH 1RJLB 3NZHL 5GSRA 3PIQB 4PS4H 5FECB 2W0FA 1JRHH 1IC7L 2PYEA 4XNUL 5GZOC 1G7IB 4GSDH 4RZCB 4A6YA 3S37L 1PJ9A 2CUMA 1AR2A 2CUIA 5EA0L 2YPVL 1ADQA 4J3SA 5CEZL 3DMMB 2MMXA 1RULL 5CCKL 2I07A 5IFAH 4NQEE 3VH8B 2V9TA 4E5XA 5ALBL 4YHIB 4DKEL 5A2FA 35C8L 1CGXA 5C0ND 3KDMA 2FJFA 1X4YA 1T7ZA 5DJ0A 3IRPX 4MA7L 2JF1A 1D5BB 2OR9L 4LDLB 4D3CH 4XCNB 5C0IB 3QIBC 5EN2A 4X6DB 4A6YH 3CX5K 1UM4L 3IU4L 4GOSA 1HK6A 5IV2A 1ADQH 3ESVF 4LLWA 2HYMA 3QRFM 2NY6C 4P4KA 1P53A 3B5GA 5EBLB 4F7PB 4NN7B 3DI2B 4WUKH 4P2QD 5GS0L 4OFKA 2NY3C 3Q1SL 3EJZD 3RX7A 1HILA 1I1YB 4ZODA 1XZ0A 3GSOA 1CGYA 3BP4A 3PWJA 2GK2A 3TFKD 1QFHA 1K8IA 3RA7L 1J0KA 5GJSL 4IIQC 1J05A 4G9FB 1QFOA 1T89A 1TQBC 2NZ9C 2BSTB 4ODSL 2LTQB 4EN3A 5CLTA 3PWLA 5C8JB 1PZ5B 2AJVL 4Z77A 4MS8C 4JE4B 4W6WB 5FA4A 3O11B 4ISVA 3JVGA 4LF3B 1RIVH 4ONHB 1BLNB 4MSWA 4PJFB 5ESQB 3QHFL 1OWRM 5I18H 2VE6B 2K7PA 4BELD 3JV4A 3O3AB 3T08A 4LU5H 3PP3H 2H8PB 4HUUB 3SOBH 3L95B 5H35A 4HKZB 1WK0A 4JO2H 1B4JH 2OX5A 3LQAH 2EXWC 5GJTH 4Y19A 3VFMB 3TEUA 1Q9LA 32C2B 1IQWH 1GPOL 3QAZC 1AI1L 1MUJB 2BZDA 2C3VB 5IT2L 1RZJC 1CE6A 3NTCH 4N0UE 1UH3A 5TQ0H 4Y4FC 5DTFA 3STBA 2K1MA 5JW4R 3QUYA 3ES6A 1JNNH 3QFJE 6FABH 2WANA 4EEEA 2VISB 4NC2B 5FUOL 1XF5A 2H6PB 1T80A 5DHYB 3FT2B 2ITDA 3WMSA 4D0DA 5B38A 3RTQD 5I66B 3DGCR 5EO1A 1QSEE 3C9NB 2ESVA 3MJ9H 5FO8B 1INQA 3RFZC 2E8YA 3NFPA 4WTZG 3AM8C 5GRUH 1CGTA 5F96L 4KJQD 1ZOXA 3K2MC 5CFHA 5KAQF 2UZIH 5ICXA 2BVYA 2P8LB 3VMNA 4NKOB 3CFDA 1WEJL 1X7QB 1K5NB 1HH9B 2QLVB 2PYFB 4S11A 2FYYB 1SYSB 1YN6B 4NHUB 3ZHLA 2Z92A 1J0JA 1F42A 4PJEF 4L1HA 4U1IB 4EUPG 2VDMH 2WZPD 5TQ2L 1RURH 4OI9A 5DEZA 1S7VA 3MZTA 4EKXA 3MRIB 2CIKB 4M1DH 1A7OH 3DURB 3TO4B 1HHJB 1QSVA 4A2LA 1G7PA 3L3OA 3EYSL 1I7UA 1XIWC 3I2CL 5A16B 1UYWH 2HA1A 1I3UA 4ZMAT 4XPGH 3KNBB 3BJLA 2NCMA 5E2TL 3K4AA 1MCIA 3BXNA 4MJ2A 4WUUB 5DLML 1A6ZB 4QHKI 3WXWL 2DJSA 1G1CA 3N06B 4HHAA 4TRPL 1BZ7B 4NZTH 2W9DH 4Y4KA 1BF8A 4F7TA 1C12A 2HJKA 3T65B 2R0LL 2MCPH 2IAND 4YBLB 2OJEA 3DX8B 5BRZA 4ELKA 1N0LA 2GTWB 2BNUB 2G75B 1K2DB 4HC1A 2YZ8A 1EAPB 2PXYD 1A7NL 4JFPB 5ANME 3LDBC 1NCWH 4HBCL 4OZIA 1NAML 3U6RB 4RMSA 3IJHA 3TA3C 3QQ4B 3TJEL 3ZDXE 3HUJE 3MRPA 3RGVA 4HGMA 1L7TL 3DHMA 3U9PH 4GQ9H 1MI5E 5HYJA 4GG6E 4GMSL 1NCBH 2ID5A 5DJ8A 1RK1A 4P46C 4JREB 4K7FA 1GAFH 3BQUC 4O5LH 4WTZA 4HC1H 1NFKA 1RQ5A 3L5WA 2HFGH 4ZUSA 4DUVA 2ZSVA 3BEVA 4DK6A 4DOHB 1G7QB 1ZS8B 3WHXB 3T2QA 3M8OH 5I74B 5CIPB 2DQJH 1JUFA 1QSFA 3IXTA 2QR0B 1ETZB 5DEGB 3WFZA 1I85C 4PJGA 4QTHA 5C0JB 5CP7A 4GKNA 3C87A 2Q76B 2XKNB 5AYQA 2FX8L 1CQYA 5CWSB 2KKQA 2ZKHL 4O9HL 4P9HC 1CDYA 4XMPL 3QRGH 4G3YH 3O81A 1IGJB 2F9BT 3PHOA 5CINH 5MERA 1LO0H 2FX7H 3AS1A 4V1DD 4ONFH 3QIBA 5C0EA 4JFYB 3GI9L 4JHWL 4YAQB 3JWOC 1MQKL 1TJGL 1LO4H 2CO7B 3O4LD 2EDLA 1C08A 3VXPB 3QUXC 1BVKA 1YJDC 3FAWA 2NY5L 4IOIB 4YFLF 1WT5C 2HVJB 1UWEL 3VG0L 5K9OA 5KVDL 4WI9A 5LBSH 3RGHA 2B1AL 1DUYA 1UXWA 4MJ5A 5CD3B 5ALCH 3R8BB 3KHOA 5HY9A 5C6TL 1BD2D 1SEBB 3GGWA 4O2FB 2VDOH 4DN4H 5INCB 1YEKH 2UWEE 3RU8L 1PD6A 4KK9D 1FIEA 5FM8A 4NGHL 3MV8D 1KC5H 5GRYA 3BAEL 4U49A 3LKSA 4X6CB 4YHKL 3K3QA 4F7MB 5E2UH 3NFSH 4LHUG 4PJ8C 4UBDD 5IIEA 2V5MA 4QHNA 3MA7B 2XI9A 4U2ZA 3TVMB 3ZSTA 4UDUB 5JW5B 2FB4H 5C86A 3M1BB 5EBMB 3QB7C 4MA8H 2VZUA 4R7NB 1JGUH 1SQ2N 3C8KA 2E7BA 1MLBA 3HE6D 4Z0BL 4E0RA 1JF6A 4XRCA 1EBPA 4MNGE 3S5LG 1HHGB 1IE5A 4BQ9A 1BVZA 2EE2A 3AUVA 3KHQA 3U1SL 3LAFA 2XWBA 5BZWB 3GM8A 4DZBA 1OAQH 3C5SA 3PQYD 4C4KO 4RMVA 3MV9E 4Y4FA 5FGSA 3HC4L 1UZ6F 1FGNL 1KT2A 1YYML 4L3AA 1UZ8B 2VLJA 3ETBF 1BX2B 1Z5LB 1T83C 3NCMA 2AV7B 5CP3A 4TULH 3HRZB 2ADGA 1I75A 5IP4A 3MUGA 4S1QH 5IB3A 2WK2A 1MFEH 3AS2A 4J3OC 2DM2A 1V5JA 4YIQB 2X4SA 5CJBA 4XWOC 3ARGB 2HTLC 1RZJH 5IVXF 4FP8H 5H37H 1Q72L 4WI5A 2R4RL 3MBEC 2B20A 3H42H 3ZO0A 4I18B 4MYWB 3RWIA 5CP3H 1OCWL 2AABH 1WC7A 3U7WH 1TVHB 5C0NC 3NACL 5L88H 1T22A 3WKMH 3GBMH 4P5TD 2D7TL 1KN2L 4HKJA 4RSVA 1KG0A 4PB0L 2EC9T 1GGCH 1TVDA 2J8HA 3GSQA 4WFFE 3NIFF 5DQDL 4G6ML 3IKKA 3WNMA 5DRZB 1I8IB 3VFSA 1XIWA 4KDVA 1R3IL 1N64H 4OFIA 4OV5A 2VL4A 2YS4A 1TZHB 4HUWB 3Q5YA 4UT9L 1TDQA 1OAZL 5DHVB 1S7SA 4PRID 1NFDE 4R26H 5IEKA 3R0NA 2VLKD 3CD4A 1RIHL 3P40A 3NABH 3WO4B 3MFFB 1RHHB 3KPPA 1VGKA 4HDIA 3EJZC 3G08B 5SWSA 4L4TD 4LP4A 2IQ9H 4P57B 2IH1B 5CLWA 1AGCA 3TFKC 2IGFH 1MIEH 3IU3A 4ZXBB 3NPZB 4NO0D 2EH8L 1F02I 4PRHD 5LCVL 4Z0XB 5EFIA 5T1LB 1CTNA 4FFVC 3OHXA 3VXTB 3ZSSA 1UCBL 1EV2E 3TA3A 4QRUB 1AXSA 2V5TA 3IGAB 1MELA 4PJ5A 3RL1A 1IT9H 1IILE 1YPZB 1N6QL 4GBXD 2HJLA 3SDXE 4HGKC 4D0BB 5L2KB 1KELH 3HLAA 1A5FL 5FKAA 1NEZB 3BQUA 1YC7A 5GGRB 4IJ3B 1M6OB 2EC9U 1S7TB 5SX4I 3KPOA 1CFQA 1CLOL 2AK4D 1SBSH 5TDPB 4MA3A 4YGVB 5JW3L 4BQ6A 5ADPL 2DJ4A 2O5ZH 5I30H 2PW1A 1I85A 2M2DA 3MO1A 3S3PA 1INEH 5IEHA 5KVGL 3BGFC 1F2QA 4TUKH 3MRCB 4JY4A 4ODWB 4JKKA 1WWCA 4KJWD 1QSEB 5FO7B 1N5YH 1UM6H 4WHTA 1CR9H 4RMWA 3KPQA 4H8WC 1CIDA 5I8CA 5DD1H 4J3WA 1KLFA 5I1AB 4BSJA 1ZLSL 4MXWL 3K4DA 3RPKA 3RTQC 2VZVA 1L4IA 2IPUK 1KEGL 1H3VA 1T20B 4KJQC 1HCFX 3BH8A 3BD3A 3QUXA 1HKLH 1WT5A 3HTLX 5JHDE 3VI4E 5EORH 4WFEE 4P9HH 1W72A 4HW6A 4L4VD 3WJLC 3TT3L 1KCKA 3FONB 5CUSH 2PNDA 5DVNA 1UB6B 5DWUL 5IMMA 1R0AH 3DX9B 1PLGH 1A4KB 4ZAKB 4KI5F 3UPRA 5C0DB 3MRMB 4XT1C 3ILPA 2ZCHH 3JWOH 1J1OL 5C0AD 4Z7OE 5EU6D 4LVHB 3UXFA 3ULUF 4TNWK 1IGTA 4J4PD 3LMJL 4OCRH 1BAFH 2VQ1A 4PJHA 4XC1H 1YJDH 2GFBB 4GUPB 2P24A 3T3PF 3BPNC 3VA6A 4C56D 4CN1A 4H5SA 4F7EA 4G43A 2FD6H 4PJ8A 3QZWB 3R1GL 1KJ3H 4NO2A 1I4FB 4LCIH 1MCLA 3IDIA 1CGVA 1N2RA 2LU4A 5C0FB 4F7CB 5I16A 3PWUB 3VW3L 1X5GA 4WFHD 5ANMB 1ED3B 4D9RD 5CHNA 4AY0A 3L5XH 3DX7B 1MRDL 1HXYB 2GT9A 3KPRD 3FT3A 1ONQA 4RMUA 4HZLA 3U0TB 5KJRL 2PXYC 1UKSA 2XWTB 4PBVC 5DQ9A 2UV3A 1FAIH 3C09B 3I75A 4WY7L 4CU7A 3WHE1 4HG4K 4GG6B 3FMGL 4ZTPL 1JZ8A 4MCYA 4PJ7F 3E8UL 2LE9A 1RZKL 3PNWA 4RDQG 3WIFB 1T83A 3LH2L 3DVNA 5IR1A 1RJZB 1CXFA 1XCQA 1DQQB 1T1YB 4J3TA 3DSNA 3NAAL 4CMHB 1UCTA 2PTUA 4ZNCD 2NXYD 4PJAF 2FWOA 4XXCA 4M93C 2NXZC 1IAIH 2R23A 3T09A 3MBEA 2M8XA 1GZPA 4OLXH 4Z95H 1NBZA 1R3HA 1DBKH 2YPLD 4Z8FH 3WUWG 4YHYB 4XBEH 2DL9A 3IXAA 2WW8A 1CYGA 1KLUA 2IFFH 1OF2B 1B0RA 3SE8H 3EYFB 4X98A 5M95B 3MSPA 5C09D 1U8PB 3LKRA 2F53D 1A2YA 1ZHBB 3SDCD 3E3QC 1F4AA 1YECL 1EJOL 1T2QH 5HGDA 1KB9K 5I8KH 3OKEB 3KPSD 3VE0B 4OV6F 2J1KA 4Q9QH 1DBML 3JXAA 3TIEA 5LAXB 5EO0B 3CSYB 3ARRA 1DQJA 1EZVX 4UNVA 2UWEB 3D87B 3CZFA 3F5WA 5DZOA 3CJJA 4MB5A 2IPKB 5I1JH 3FQNA 5AZ2H 5DQJA 4LLMB 5T3XE 2ITCA 3PUCA 2R56L 3N1FC 4UQ3B 3B9KC 2OJZL 1O7VA 2DL2A 4KK9C 2F54D 3HE7B 4LEOB 4OQTA 5T3ZE 5EO9B 2XRAH 2NYYD 4JN2A 1FO0A 4Z7NF 3FCTB 2R9HD 4CRPA 2VKXA 4U31A 4MXVF 3GHEL 5A2LH 1OP3K 1MWAB 4BK5A 2CGRL 4C83A 3FB5B 4PYGA 3MBXL 4UBDC 2Q7YA 4JPVL 5HHNB 5KZCB 1A1NA 2XTLA 1MCPL 4MNGB 1ITCA 5FHAL 5JPNA 5BQ7B 3P0VL 3WIIH 2AXFB 4PS4L 3JWDC 5J6GB 1YY8B 5D9SB 3HE6C 1JRHL 1TLKA 4OQTH 1CXEA 3MV9B 4JO1H 1FO0H 4QCIA 4GSDL 3MYZA 1BVLA 4PG9A 5I71B 3RWDB 5F9JA 5DJYA 3LIZH 4D8PA 2ZPKH 5IFAL 4M5ZH 3EBAA 3QUZB 2AKRA 3DV6B 3HI1B 1PGRB 1I9RH 1P7QB 2H9GA 2XZZA 4E41B 2FJGB 2UUDK 2DDQH 4PJEE 2CKBA 3IF1B 1WGOA 3H9HB 4D3CL 5EPMA 3VXMD 1VKXA 3MRJA 2A0LD 4A6YL 3V6ZB 3MCLH 3RTQA 4JZOB 2GK0A 4FQIH 1NGPH 5IOPA 2Z93A 3G5YA 1ADQL 3D85B 4RGNE 2GTZA 1I3VA 1CGSH 3DXAB 1WFOA 1EHXA 5DFWH 4WUKL 4HIEA 3WJLA 2FNBA 5DDHA 3G5ZA 2CKBH 2IFGA 3ARPA 5HYIA 1YNTA 1ZT1B 4EQ3A 3OKNA 3S6CA 5JDSB 2J12B 3DMMD 1EO5A 1MCBA 1ZA6B 3IETB 4RBPH 2EE6A 1TPXC 2BNRA 2DLFH 4BSVA 4UOW0 4L5FH 5JDJA 2HVKB 3K81A 3RWJB 3E6HA 4MJ6A 2IH3A 1RIVL 2XQYK 1ZLVK 4X9BA 5GGTA 1IL1A 3MNWA 3REVB 5FUCC 5I18L 3TZVD 4FQ1H 5FV1L 5D7KD 1S5HB 1WBZA 2AXGB 2ATKB 1UENA 3P2TA 2OQJA 5MI0C 4LU5L 2Y36H 3BVNB 4WJ5B 5F7DB 5J0BA 3I85A 1YNLH 1Q94B 2BC4A 3SOBL 3W9DB 4JO2L 3VFRB 3ARFB 1B4JL 5KSAB 3LQAL 5GJTL 2EDBA 3MR9A 3W11C 1E4WH 1F90H 4XBGA 1IQWL 4Y16B 5ICZA 1AGBA 4JDZB 5T33H 3NTCL 5GGTH 2R2EB 5I8EA 2G60H 3SDXB 3O41B 1NCTA 4G9FD 1PYWB 1DQLH 4IRJB 5TQ0L 4F2MA 4N0RA 5DD6B 4KMQA 3VFUA 1JNNL 5IQ7H 4O51A 6FABL 1S7QA 1OTTD 3MRHA 5IBUG 4GBXC 1XGRA 5HPMB 1GOGA 4AMKH 1XEDA 4N0YH 3IVKB 2DD8H 3GSVB 2HWZL 3MJ9L 4MX7A 4RMRA 3NCYS 5GRUL 3FRPG 3KXFE 2UZIL 2VLRB 4JPWH 2J8UE 4Y89A 3ZKND 1JNHA 5JNYA 1NSNH 1ZLUK 3BDYH 4KJYB 4OD2A 4C58B 1H3GA 4FXKA 4L8CA 5ITFA 1NCUA 3SPVA 3D25B 2HJFA 1FFOA 3G5XB 2HLFD 3SKNB 2OTUB 4JZNA 4KJWC 3DIFA 5E6YA 2VDML 1VERA 1RURL 4IMLA 4RMQA 5K9KA 4I4WB 3OGCA 4TVPD 5SWZE 4M1DL 1A7OL 4V1DA 3QEHB 1YQVH 1NBYB 3HMWH 1UYWL 2M26A 3CXHJ 4XPGL 3ZYZA 4YDJA 2CPCA 3MGTB 4KGLA 4LLDB 5EUOF 1FNEB 4NZTL 4B53A 2W9DL 5ECJE 4UDTB 3FB6B 2MCPL 2P48B 1BD2A 4KRPB 4M02A 3QBTB 5J9PB 4QT5A 3BZEB 3B9KA 4KVCH 3KYKH 4E9LA 1WWWX 3MV8A 4LLVB 4GRWF 5IVOA 1NCWL 5F3BB 1WAAA 1B88A 3SBWC 5HXMA 1G6VK 1VEMA 4Z7VB 4KXZI 3PHSA 4H26B 2YWZA 3PWVB 4J2XA 4K71C 5DEFB 1S7WA 5D1ZB 3B8SA 3WNNA 3MJ7B 3U9PL 1KNOB 4GQ9L 4P5KA 1VEPA 3SQOH 4EBQH 1WFNA 3KPMB 4PB9H 3KS0H 5I8OH 1NCBL 4OLUH 1H15A 1GAFL 3GK8H 4O5LL 4WUUD 4HC1L 3RVVC 2BP3A 2HFGL 3PHQA 1LE9B 3HE6A 4MXQD 5HYFA 2XA3A 5F9WC 5J11B 4FQHB 2WP3O 3M8OL 4QHMB 2DQJL 4I1NB 4YFDB 1T1XB 5IVXE 1AGEA 4UAOC 3HB3C 2X9XA 3PQYA 4Y1AE 3SN6N 1T7YA 4LDEB 5MHSE 1URLA 4PJXA 3QRGL 4FTVA 2XZQH 4G3YL 3DBXB 5KBNC 3JWDH 4ACPA 3D1MC 1CD0A 4K3HA 5CINL 4U1SA 5A3IC 1FH5H 1LO0L 2FX7L 4ONFL 1EAJA 4NUGH 5ISZE 3NIFE 1LO4L 1R5VB 4WI4A 3I3EA 2FZ3B 3X17A 3GMLA 3VMPA 3TIDB 1DFBH 2Z8RA 3GMPB 5EUKA 4DAGH 1FL6A 3S97C 5IGXH 1B2WH 4HBQA 4NQUA 4LNRB 4ZOAA 1L0YA 4G7YH 1U2CA 5LBSL 5I1DA 3OMZA 3MRKA 1BIHA 3NBNA 4L9LC 1ORQA 5ALCL 2LAAA 4WO4A 4FZ8H 1JGDB 3MXVH 1CDHA 4CDGC 2VDOL 4DN4L 2VUOA 5D7IF 5E8PA 1YEKL 5C92A 3LCYA 5GGQH 3VG9C 3SDCC 4L3CB 2YRLA 3DO7B 4YK4C 1KC5L 3JTSB 1JV5A 5DO2C 4ZUTB 1TZIB 4H0HB 3QIWD 2A77H 4OLZH 5FYJU 1JNJA 3EFFB 4IDJH 5E2UL 3NFSL 1Y6KR 3SDAB 5IF0A 4PRIA 4HXBH 4KTDH 5D71H 2ENSA 4MNHB 2VLKA 3V5KB 1S9WA 5HVFB 2FB4L 5GSVA 3QQ3B 4QY8A 4MA8L 4KUCD 1JGUL 5E8DH 1NGZA 3MLXH 1ND0B 4XCEA 1U8MB 2QSTA 4L4TA 3HR6A 2E7CA 3DV4A 4NO5A 2EYSA 1H3PH 5C7XH 3W39B 3BWUC 4TSCH 4PRHA 1OAQL 3I3BA 2XTJE 5DF0A 5E1HB 1JZ2A 1KJMB 4AENB 5JORB 4POUB 5EU5B 4QWWD 1K4CB 2WLYA 1K3IA 5FM5M 1M4KA 2ATPA 2VZ1A 3HPLA 4TULL 4ODUA 4LSDA 4GBXA 5EZJA 3F7VA 4S1QL 3D9AH 3TO2B 1MJ8H 1MFEL 3GSRB 2Z31C 3U2SA 3QQ9D 3TVMD 3CVHB 2R29H 2X6MA 5CGYC 3BEWA 1RZJL 3LV3B 4FP8L 4HH9B 1G9MC 3GKWH 4NN6B 1JPFB 1KGCD 3H42L 4RFNB 1LK2B 4NQSA 1W0WA 4NZUH 2BHYA 1H9VA 3PDOB 2AABL 1FNAA 4YXKH 3U7WL 1QQDA 1FFNB 5C08E 5L88L 4KI5E 1B0GA 2OL3B 3WKML 1P4LA 3GBML 4NC1E 4RGNB 2RFXA 1U8NB 1KCUH 4U3HA 4F3FB 1GGCL 4DZ8A 4RDQF 3ULUE 4XP9H 2A0LC 4N5EC 1RJCA 4Z9KB 3EDDA 4Z7WB 4NNXB 1N64L 1SJXA 1HHIB 3QA3A 4KROB 4YGAB 3OKLA 2PCPB 4RFEB 4HXAH 2VL5B 4R26L 3Q6GH 4ZUWB 1EERB 3NABL 2ZOLA 2ESVE 3ARGD 5C07B 3ARDB 1OGTA 4S0SD 4PGJA 3TYGH 3RVTD 1NQBA 3OGOE 3QXDB 3OG4B 1CK0H 2IQ9L 3QHTC 5GS2D 1JBJA 2ZG3A 5C0AA 2IGFL 1MIEL 3F6IA 2PETA 1D5ZA 3K2UH 1ZV5A 1IMHC 3RKDC 1X5LA 4P2RE 4XTRD 3SBWA 3MYJB 4PV8A 2VLMD 7CGTA 2QKIB 2NLJA 5FCUH 2YA0A 1BZ9A 2VXTL 1LO5A 4PJ7E 3WS3B 5CD5D 1NJ9A 4QNPF 4Z7UA 3DROB 4GW5B 5C0CD 1IT9L 3G04A 4DGYH 5DJAA 1IJ9A 3KPNA 3FKUS 1KELL 5IROC 4K8RD 3FQXB 4HFWB 5MEQB 4NN7C 3MODH 4JFQB 3LN4A 4PJAE 5K9JH 3QEQA 1SBSL 4EDXA 1CICB 1UM5H 1KTDB 5HHME 2EDRA 4S1SH 3KPRA 4EOWH 4ZNEA 2O5ZL 5I30L 5SWQA 1RUAH 3IFLH 4YC2B 4LK4A 4OUOA 4XCYA 1INEL 2VB5A 4HF5H 2EICA 4TUKL 3P4NB 2EDXA 5IK3B 4ZXBD 4OF6A 1IAKA 4FXLA 4QHLA 4GW1B 1N5YL 3EOAB 1UM6L 2LTQC 3MV7A 1RJYA 2DQUH 4GMTH 5DRWB 1CR9L 1ZLWK 5I2IA 5GS1B 5DD1L 3VU2A 1XR9B 3KXFB 2J8UB 4J3XA 4N0CD 3L5HA 1BWMA 5T1DH 1N6UA 1RUMH 2ZG1A 4RWHA 5IB5A 2HT3D 5L2KD 2YD1A 5HYJE 1HKLL 4I77H 2XKSA 5EORL 4P9HL 3ZKNC 3C6SA 3MLSH 2YPLA 3EHBD 4L9LA 4NRXA 5JIPA 5CUSL 4U6TA 4LHJB 1R0AL 3QO1B 1PLGL 3GB7A 1OP5K 1KBGH 1CFTB 2UY7A 5K59F 2HLFC 2LVCA 3LEXA 3O6LH 4NKDA 2VOTA 2F53A 2ZCHL 3JWOL 3SDCA 1BPVA 4OCRL 1BAFL 1QSED 4XC1L 3K74B 1YJDL 4JAMB 1CI5A 3KPSA 1IKFH 3DTXB 3QJHA 4NDMB 4MZ2A 4MXVE 3X14B 3OKMB 1NMAH 1UEMA 2FD6L 2YMXH 3W0WE 3R06B 3FFCE 5E95B 1KJ3L 3ZDYF 4JPIA 4LCIL 5ETUA 5C0BA 5C0GB 5FM4A 1F3RB 4GG8A 3C6LB 5CSGA 1NDGA 1Z6JT 1OLLA 4OF0A 4UT6H 2VABA 3BO8B 5KN5B 5DRNB 2R1XB 5D2NE 3BIBX 4P5MB 3PWPB 2H32A 4LAQH 2XZCH 3PV6B 2MPAH 3L5XL 5ILTH 1FVEB 4JJ5A 1AO7E 4XVJH 3VH8G 2BSSA 4OI8A 1I7RA 4ZAKD 4LSSH 4FQXB 4U6HA 4XX1G 1FAIL 2VAJA 2R1YB 4PREA 1TNMA 2EEAA 4HWBA 3BESR 4YWGH 4I3SH 4OCSH 3HNSH 1LHZA 3TO4C 3BI9X 2PO6B 3MJ8B 4WW2F 5DJXA 3P0GB 1ZVYA 3QFDA 2VDLH 1PQZA 4OSUH 3W2DH 2H32H 1BOGB 3Q2CA 2DKUA 4MWFA 2V9QA 5KSUB 1IGFH 2Z31A 4Y4HA 1UQSA 3ALPA 3OJ2C 3O45B 1ZWIA 4WGVB 4JFZH 2NR6D 2BOBB 4Y1AB 4MXQC 1IAIL 1ZA3A 4R0LB 2J88H 4HWBH 2BRRH 1C16B 4OLXL 4YBLC 4Z95L 2HN7B 1ZHKB 2I9LA 2OSLB 1DBKL 4P99A 3F7YB 4Z8FL 2A6KB 5KSVB 4WFGE 4XBEL 5D93B 3VFGH 4QF1B 4M61A 4PIRF 3AROA 4HGWB 2IFFL 3Q5OA 5HYSG 5DJCA 2WQ8A 5IM7B 1QBAA 5ISZB 3I02A 5EU3B 4PRDA 3EYOB 3SE8L 3UROR 2XA8H 3H8NA 5BZDB 3P73A 4MD0A 1WAAF 2EDEA 3ZZ1A 4PRPD 1E4JA 1LNUA 1CG9B 3V4UH 1OOAA 3RNQA 3MNVB 1T2QL 1MLCB 1G9MH 1HINH 3K8LA 5I8KL 2KQMA 3RY4A 2JELH 1EMTH 4KHXH 2EYRB 4Q9QL 1KIRB 3LQZB 4TTDC 3ZLQC 3O9WB 3BGAA 1IGYB 3C60B 1GVIA 4JREC 4PY7A 1RJLA 4NOFA 3PIQA 5FECA 4LIQH 3BIAX 1KV3A 2Z8VC 1JHTB 4I0CC 4ESKA 3MRQB 3QDJA 4RZCA 5I74C 4NCDA 5I1JL 4R8WH 4NKMB 1ZVHA 1BFOB 3T2OA 5AZ2L 3QCVH 3EO1B 2O5XH 4YHIA 1EZVY 2DQHH 3GMQB 3QDME 1HXMB 3TP4A 2HLAA 2XRAL 3FTGB 2VXSH 5IJVB 1P9MC 4MQSB 5C0IA 4X6DA 5E7BA 5DK0B 5D1QB 5B3NA 1D6EB 3WXVH 2A6IB 5EBLA 3MRRB 4ZFZB 3WIIL 2D31B 1F6FB 4OQTL 4KWUA 2XTJB 2W07A 4JO1L 1FO0L 3R0MA 5DS8B 4Q6YA 3WFCH 2V17L 3ZE0F 1U3HB 2X1XR 1BJ1J 3LIZL 4CMMB 2ZPKL 5SWSE 4M5ZL 2E8ZA 4NZJA 3HE7D 1I9RL 1FNFA 2N7AA 4QWWC 2E9IA 1D5MB 4WTXA 1JNLH 5KANI 5BV7C 5JOPD 4ZO8A 2DDQL 1DANT 4EIGB 3DVFA 1PZ5A 3MOBH 3EO9H 5HHOB 1CD1A 3I3DA 2GCYB 1HHHB 3BIKB 3M07A 4ONHA 2JB5H 3AAZB 1BLNA 3MCLL 4PJFA 5ESQA 4UILH 3H6JA 5J6HA 1NGPL 5KZCD 4N90E 3QQ9C 3MX0A 3O3AA 1CGSL 2XFXA 4HWUA 5FKPB 1KPVB 5C08B 3BX7C 1HHKA 5F1IB 5F70A 3DUSB 4HUUA 5EUOE 3L95A 3MV9D 4HKZA 5ENWB 5IESH 2CKBL 1S9VB 1TJHH 3VFMA 4UQ2B 4TQEH 32C2A 1MUJA 2C3VA 3QUZD 1E4XH 5FYLD 3RBGA 3VDBA 1T2XA 4PBWD 4UT7H 4E41D 3ZMRA 4XNQB 2DLFL 4UTBH 1NBQA 4GRWE 7FABH 3NA4A 2ZJSH 3CGTA 4L5FL 1WISA 2VISA 4HJ0D 4HLZH 2CUHA 4LPTA 3WBDA 5DHYA 3FT2A 4UB0H 5I66A 5CJXC 5JW4M 4KY1H 4NFBA 3C9NA 1PY4A 2B5IB 5FO8A 4FQ1L 3D85D 4DVRH 1GRWA 2DQEH 4TOYH 3ARGC 1DANU 1BREA 1K4DB 3DXAD 5E6IB 2YK1H 2HKHH 2Y36L 4LARH 4TVPH 1YNLL 2P8LA 4NKOA 1FNLA 3FO9B 4I18C 1X7QA 2DLHA 1K5NA 1HH9A 3IFNH 1CIUA 3MMEB 5F7YC 2FYYA 3IAQA 1SYSA 1YN6A 4NHUA 4PJ7B 3A67H 1E4WL 1F90L 1U8HB 4U1IA 3E2HC 4XTRC 5T33L 4CUCA 3G6AA 4JFXB 5GGTL 2G60L 4G8FA 1DQLL 2CIKA 3MRIA 4MLSA 3STZB 4LNVA 2HT2D 3DURA 3TO4A 1HHJA 4BJLA 5IQ7L 5CD5C 3KLHC 4PJAB 4O2EB 5A16A 3FO0H 4YHMH 4WVRA 3KNBA 3RZCB 3TF7C 4JKPH 4AMKL 4K7PX 4N0YL 4JANB 4K8RC 2DD8L 2UVFA 4NCC2 1A6ZA 4WUUA 3FQRB 5J3HD 1BZ7A 1T5WB 1C8PA 2VDPH 1VFMA 3HPJB 3TN0D 4JPWL 4X7DC 4XMKH 2HFFB 3DX8A 4CGTA 3H0TA 1NSNL 3BDYL 1WBXB 2GTWA 1DLHA 3ARFD 2G75A 1BM3H 1UEYA 1K2DA 5KSAD 1EAPA 4ZXBC 4JFPA 1FFPB 4Y16D 1VFBA 3U6RA 3GJFK 3BUTA 3TNNB 5D7IE 4WRLA 1A9EB 2QL1A 2H2PD 5T1MB 3WS6A 2DQGH 1EBAA 3HMWL 4UI2A 2R1WB 4YHPA 3MQIA 1AY1H 2HT3C 4CAGA 3IFOB 2F15A 3ISWA 1TCMA 4IJ3C 2JJTC 4HIIB 1T3FB 4PGCB 4J23A 1G7QA 1ZS8A 5GRWA 3WHXA 3EHBC 3V4VH 1H3WM 5CIPA 3OKYA 2QBWA 4HIHB 2VLRD 2A9NH 2QR0A 1ETZA 3IDGB 3L3DA 5DEGA 1VDGA 1IZJA 2AJSH 5FOBB 1KACB 4EUPB 2C4FT 4KVCL 2Q76A 2XKNA 3KYKL 1E6JH 1CWVA 2C3HA 5CWSA 1RZ7H 3W0WB 3FFCB 4ZO6A 5IMKB 1BJMA 3QEUB 1P9MA 1IGJA 1QKZH 2YN5A 1WIOA 2YN3A 2DWDB 4OTXH 1E4KC 4JFYA 4PD4J 2UZXB 4WFED 5F72S 3O2DA 4G6KH 1UH4A 5CIPH 2DICA 4YAQA 5CZXC 3UBXG 4GT7A 8FABB 3KWWB 3SQOL 1BBJA 4BH8B 4EBQL 5I8OL 4PB9L 3VXPA 5ERWA 1AO7B 3WDHA 4OLUL 4IOIA 5EU4B 3GK8L 1UWGH 2HVJA 3EOBB 4TNVK 3KPTA 4JVUA 1T04B 4P2QE 1WBYB 2H45A 1FN4B 4DVBB 1SEBA 4KRPD 2DMKA 2ZUWA 3VXOB 3NA9H 3O2DH 5INCA 4PRBB 2K7QA 4RQQB 4U05A 4LVHC 2L4OA 1L0QA 4X4XA 2XZQL 4EQ2A 3RUGE 3BOVA 4LSTH 4X6CA 3JWDL 3V8CA 3SKOB 3UP1A 1FH5L 2C4FU 1YDPB 1HN1A 3LSOA 3GJFB 4NUGL 3I6GA 5T1KB 5KS9B 3LB6C 3MA7A 4UDUA 5JW5A 1DFBL 3UX9B 3M1BA 4O58H 5EBMA 4R7NA 4DAGL 5IGXL 1B2WL 2DYPB 1QUNA 1H3XA 4G7YL 2A6JA 3OKKB 2I9TB 4PUBH 3W5NA 2L7JA 4HULB 2AK1H 4FQJH 5HYQA 2CLZB 1HHGA 4FZ8L 3MXVL 1QSZA 3GMMB 1A3RH 5BZWA 5GGQL 3C09C 5AAMA 3U79A 3HAEB 5E99H 1TXKA 1UZ8A 1T4KB 3VXUE 5DA0B 1P7KB 5JHLH 1BX2A 2NY2D 1Z5LA 2YXFA 2AV7A 2A77L 4OLZL 1BIIB 3S3JA 3HRZA 1CBVH 1P84J 4IDJL 4CMHC 5F7MC 4NWUH 5CJXA 4HXBL 4KTDL 3TM6A 5D71L 2AS5M 4M6OH 4YIQA 4QNPE 4XPTH 3ARGA 3Q3GB 5E8DL 1KIUA 3MLXL 4L3EE 3QXTA 1NC4D 2WM0A 3MUZ1 3QP3A 3OR6B 4KKBD 4NN5B 2VAAA 4I18A 1Q9KB 5BXFB 3H3PH 2PUQT 1H3PL 5C7XL 2DQFB 1OM3H 3JTTB 1R6VA 1TVHA 3JV6B 2X9YA 1AD0B 4TSCL 5FF6B 3U36B 4CBPA 1TCRB 1J86A 5FGBC 5GISH 4LHUB 2BMKA 1I8IA 1AIFA 3HG1E 1MAKA 3KYAA 3ZYIA 5FDYA 1CLCA 4YXHH 3VXQB 1KXVC 1TZHA 4HUWA 3RL2B 5GS2H 5LVEA 3D9AL 1MJ8L 4GLRI 3SDAD 4RX4D 3B5HA 3PJSB 2R29L 2IPTH 2X1PA 2CKNA 2VMFA 2WQRA 1RHHA 2HT4D 2VR4A 5T3ZD 5AG8A 3GKWL 3G08A 4FNLH 3P77B 4KHTH 4P57A 2IH1A 2IANE 4L8SB 1Z2KA 1MSPA 4NZUL 1ZGLM 4Y5XB 4UV7H 3GSWB 4ZO9A 4YXKL 3HE7C 4ZXBA 2BHZA 4Z0XA 5DHVH 1B90A 4K8RH 5T1LA 1R5WB 2MFNA 5K59E 1M05B 3VXTA 1KCUL 3ZKXB 2X7LB 4QRUA 2ICWI 3IGAA 2WWKO 4XP9L 2C1PA 5K9QI 2YEZB 3QZWG 5EUOB 3VGHA 1X9QA 3DECA 1JMZA 4LL9A 4D0BA 5L2KA 3P30H 1NEZA 4HXAL 6CGTA 1M6OA 4Y88A 1S7TA 2JJTA 4K94C 5L8KB 3Q6GL 3ZDYE 1JK8B 4N0UA 2YD3A 1JWSB 1RZGB 1XAUA 2D7PA 3TYGL 1NKRA 5F3HB 4P2YA 3BKMH 1CK0L 4GRWB 3X11B 2YHGA 2FX9H 2O5YH 3QUZC 5EZIH 5EOCH 3MRCA 4ODWA 3ULVE 5MEOB 2XICA 4ZUUB 3K2UL 5DI8B 1JYXA 3O3DB 1QSEA 5FO7A 5F8QC 4GQPH 3PDGA 2R15A 3O8XD 4RGND 4XAWH 5FCUL 2Q6WA 5LQBH 1E4KA 4HJ0C 3L6FB 5I1AA 4GS7C 3I84A 1G0DA 3IYLW 4PJFF 1WSST 5DVKA 5LWYH 2GUOB 3QQNA 1JRHI 4DGYL 5HI3D 1T20A 2ZNXA 4KROD 4WV1B 5IG7B 2DTMH 3DJ9A 3O4LE 5B21A 3MODL 5K9JL 1RUKH 5CAYB 2UZYB 5C07D 3KYOB 3FONA 5F6IB 3ARDD 1UM5L 1EUTA 4NSKB 2BHUA 4RAUB 4S1SL 4EOWL 1JHKH 1MQ8A 1RUAL 3IFLL 3C5JB 5C0DA 3MRMA 3ABZA 2PN5A 4HF5L 3V79C 4LCUB 1JGEA 4KMLB 2CJUH 4K9EC 1XGPB 1QBMH 3MV8E 2GFBA 4GUPA 4HPOH 4LLYB 4YJZL 2DQUL 2AXJA 4GMTL 4FXGB 5TPWH 4JN1H 3LKNB 5DGRA 4LRIC 4ONGH 3PGCB 4U7SA 1NGYB 3UTQB 4U1KB 1I4FA 3Q0HA 5T1DL 5M94B 4LPCA 1RUML 3L3IA 5J3HC 3F8UB 1LP9B 2AJZB 5C0FA 4XPBH 3CXHK 4F7CA 5ANMA 4I77L 3MROB 2XNAB 1ED3A 1T1WB 4XB8A 3MLSL 1CICD 5D7IB 4FG6C 4KKLD 5IW6A 4UU9B 3DWTA 3ARFC 4JRYE 4ODHH 3DX7A 3DYPA 5KSAC 1OD9A 3HUJA 4XVSH 1KBGL 2XWTA 4Y16C 3NCYP 1DVFB 3CH8A 3O6LL 4UIKH 1KIPB 3GSXB 4GG6A 4IRJC 5F9DC 2H2PC 5DUMH 1RHFA 3I9GH 5C0RH 5CMAB 3WIFA 4U1HB 3AS0A 5TDOB 1IKFL 1RJZA 4WHCA 2I24N 1DQQA 1NMAL 1F97A 2YMXL 3ROOB 2IJ0C 5HJ3B 2YZ1A 4GAFB 1G9EA 4YEFA 2JCCF 3U9UB 3L9RB 2WINB 3MJGX 2MOVA 2CR6A 5F7KC 2E6JA 3CXDH 4UT6L 4LAQL 2VZ3A 3QPQD 1X5XA 5D6CB 2XZCL 2MPAL 3ARBD 5ILTL 1C5CH 4XVJL 1EJ6A 2BY0A 4M3KB 4XVUC 3ZE2F 4HUKB 2XT1B 4LSSL 3EYFA 2Y06H 5C1MB 2FJHB 2QSQA 3ZE0E 1U8PA 3N1QC 4LVNB 5FGBA 4YWGL 1TENA 4I3SL 4OCSL 3RIAK 1FJ1B 1QBBA 3HNSL 1U6AH 3OKEA 3VE0A 4PJCB 1FZMB 4MA1B 1LEIA 3MRNA 2VDLL 4U6XB 4OSUL 5LAXA 3W2DL 5EO0A 2ORBH 3CSYA 3BWAB 4XHQA 1A6AA 1EVTC 1IGFL 3OX8A 3TH4T 1VFAB 2UWEA 4JFZL 1W8OA 4O02H 3C6LD 2J88L 2IPKA 3O3UN 4HWBL 2BRRL 2F8XC 2IC2A 3V6OE 4KRPC 3RUGB 1FBIH 3PWPD 4UQ3A 2EIEA 4L4TE 3VFGL 4XZUB 1F4WH 4BSWB 3B3IB 4LEOA 4FQXD 2XA8L 5EO9A 3BW9A 4PRHE 3ARYA 3CSPA 1MWAA 3V4UL 3MUY1 4X4YB 1G9ML 1HINL 3FB5A 4X9IA 3H9ZA 2JELL 1EMTL 4KHXL 5D1ZC 2APWA 5HHNA 1NUFA 3BPLB 4JG1H 3JBG7 4GFTB 4MNGA 2XG4A 4KUCF 1I1AB 3K8KA 1EIBA 3ARTA 5J6GA 1YY8A 4LIQL 5D9SA 3KPLB 3WUWB 1JWUB 3MV9A 5J11C 5MHSD 4YO0B 4WEUD 2AK4E 2J2ZA 1LGVA 4R8WL 1T5XB 3VXUB 2ERJB 5BW7C 4ZUVB 5FUZH 1MWAH 2FLBT 3RWDA 3U4BH 3WLBA 4X6EA 1AE6H 4ENED 3E1F1 3QCVL 2EEDA 2O5XL 4X4ZA 3QUZA 3DV6A 2MHAB 3HI1A 4HQQL 2DQHL 1P6AB 1QLRB 5ISZD 4RMTA 1P7QA 3FQTB 2VXSL 1HWGB 1QO3B 4N1EA 2W38A 4K94H 4X6CF 3IF1A 3H9HA 2HTKD 1JI1A 3PL6B 3QWRA 1SJEA 1UFUA 5CJQH 4L3EB 1ORSB 1UB5B 3GHBH 4JZOA 4G8IB 4KQ3H 3LPGA 1FV1B 5DD0H 3WXVL 4Z18A 2CR3A 5BOZG 3O9WD 1HNFA 1CDJA 3OF6D 4MD5B 4Q2ZB 5FYLH 2PTVA 2O61B 4X6FB 1CLZH 4K23H 4KKBC 3H9SB 2D7OA 3CC5B 4L4VE 3WFCL 1ZT1A 1FC2D 3GIVB 1SJVA 3HG1B 5JDSA 4QRQA 3AY4C 5SV4A 3OPZH 1PKQB 4NRZA 3B6SB 5IUSA 2UVEA 1SMAA 3IETA 4F80A 1JNLL 2I5YH 3SEPA 5EU6E 1QR1A 1AHWC 5JPMB 3FO1B 3L3HB 2HVKA 3MOBL 3EO9L 2AI0H 3RWJA 4LRIA 4YEEA 2VQUA 5DMKB 2JB5L 4C56E 3SDAC 4UILL 5D1QD 1XF2B 5F1NB 3O2WH 1S5HA 2P49B 2VITB 2AXGA 5DK3A 2YWYA 3QDGD 2ATKA 5A1AA 3OXRB 4YDIH 4JGJA 4XGZB 5F7DA 4WJ5A 2AV1B 4ZPTB 4K9EH 1Q94A 1UH2A 2EIZA 3DGGB 4I5BB 4NUJB 3W9DA 2GITA 5IESL 3ARFA 1P6FA 4D9RE 2RGSA 5KSAA 1TJHL 3T0WA 5CSZB 1U3HD 4BK4A 4TQEL 1RI8A 3GKZA 4Y16A 2C5DC 5D7LE 2GAZB 3MCKB 4ZNEE 4JDZA 2R2EA 3SDXA 2MTPA 3O41A 1E4XL 4IRJA 2ZWLT 1E6OH 1ZT4B 3WLWD 12E8H 2ILLA 4UT7L 3VGAB 3EYQC 4WENB 3E6FB 4UTBL 7FABL 1RUPH 2ZJSL 1EHNA 1BJ8A 1MCOH 5HHOD 1MAMH 4Y5YB 4HKXA 5HHPA 4UB0L 1Y6NR 1XR8B 3IVKA 1SYVB 4JKMA 1JJUA 4KY1L 1IVLA 4P2OD 2BDNH 4DVRL 4GKSB 2DQEL 4TOYL 2B4CC 2WBWB 4XPAH 2YK1L 2VLRA 2HKHL 4LARL 4NN6C 4TVPL 4W6YB 4NQVB 5EZLB 5C08D 4RFNC 2EXYC 4KJYA 3CCHB 4FQQB 3IFNL 5F7EH 1WZKA 4ZFGH 2UUDH 1C5BH 3D25A 3A67L 3G5XA 4XP4H 2OTUA 4NPYA 2APBA 3QYCA 4WW2B 1JYVA 4RGNC 5C09E 1U8IB 2AEIT 2D0HA 2W9LA 3O4LB 5JHDA 4PJ9B 3AGVA 2F74B 3RWHA 3WNPA 3FO0L 2YD2A 4YHML 1M71B 1YPZF 3IDMB 3KPSE 3VGEA 5HI3C 4KROC 4JKPL 4G9DB 4PGEB 2VSDA 1KTLB 25C8H 4LLDA 4XCFH 1FNEA 4OGAD 4AH2B 4R2GB 4UDTA 2AEPH 3OXSB 2VDPL 3ARDC 3FB6A 2X4TB 4AJ0A 5E6ID 1NLBH 1VACB 4XMKL 2BSRB 2ZUQB 2FIRT 5J9PA 4K7PY 3BZEA 1QFWM 1BM3L 3V95A 4YHLH 4QHKJ 4HS3B 3EZ8A 1BQHG 2F54E 1CL7H 4R9HA 2D9CA 1AQKH 5IBUB 2R2CA 1U58A 1ZLVH 4H26A 2Q86B 2DQGL 4IRSB 5DEFA 5D1ZA 4PR5B 3MJ7A 4R97B 3VJ6A 1KNOA 2RCSH 3KPMA 1AY1L 2VDKH 3AU1A 4G5ZH 4JRYB 1MCSA 3VD5A 3SDYH 1S7UB 4AG4H 4FQ2H 3BP6B 1LE9A 3RY6C 4DJMA 1CICC 4KKLC 3V4VL 4QHMA 2DIAA 1T1XA 2A9NL 1EDQA 5BW7A 2AJSL 3RI5K 1JGLH 1ZEAH 4JQIH 4YC2C 1JPGB 2FECL 4QHUB 1QP1A 1E6JL 4N8VG 2C4XA 1RZ7L 4MCZB 3GBLA 3ESUF 1X5AA 3OKDB 4MGXA 4LQFH 4OCYH 4MAYB 2IEPA 2DQDH 3MNZB 1QKZL 5J57B 5GS1C 2CLRB 4RA3A 1MJJB 4OTXL 3CDFA 1A6UH 3S34H 4G6KL 3VXME 1QFWH 1R5VA 4JDTH 2DM3A 2DTSA 2FZ3A 3ZHDA 3GMPA 1NDMB 1UWGL 4LNRA 3RKPA 1ZLUH 5HHQB 3OB0K 3R4DA 2YD4A 2WIIA 3MJ6A 3QPQC 3J8F7 4YDVA 3QUMB 3ZDXF 3AY4A 3NA9L 3O2DL 5DZNA 3MZGB 1FG2A 2CDGB 4L3CA 4WWID 4GG6F 3W0WD 3JTSA 3FFCD 2HFTA 2ZG2A 4ZUTA 2AERT 1AHWA 2EC8A 4XX1E 4LSTL 1TZIA 3NIGF 1A02N 2ADIB 4U33A 3EFFA 1KCSH 1YEIH 3QJFA 1HQ4B 4OAWB 5HD8C 2HMIC 3O3BA 4RX4A 4MNHA 3V5KA 1AO7D 4JQVC 2JIXB 3QQ3A 4O58L 3C6LC 2EKSB 2CLVB 1ND0A 4MQ7B 2CSPA 1GGUA 4PUBL 4NO0B 1A6TB 2AK1L 4FQJL 3FOMA 3UCRA 5DXWA 1LD9B 2DQTH 1MF2H 4ZOEA 4FQXC 4UOW1 1A3RL 3ULSB 4LPXA 5EC2B 2NX5B 1KJMA 5JORA 5T3XH 5ID1A 5HGHB 1IEAA 1YEJH 5E99L 1K4CA 4IOSD 4G9FE 5JHLL 3ZDZF 1C5DB 1A3LH 2PO6C 5T3ZH 5E9DE 3V8OA 3RWGA 3S88H 4LPWA 1CBVL 1TQCB 2EDDA 4M6MH 3TO2A 5T1KD 4X80H 4N1CA 2EDKA 3GSRA 4NWUL 5IFHH 1RPQA 1CQKA 4KKAC 4TUOB 4M6OL 3CVHA 4H88H 4XPTL 2UWEF 1CGUA 4ETQB 5J1AB 2P8MB 3LV3A 4R0LC 4HH9A 2DYPD 4F8QA 4PRAB 2F19H 1JPFA 1F4YL 1R24B 4XAKD 1G6RB 3H3PL 5IWLC 4X9FA 5D93C 3PDOA 1HEZA 2V2XA 1OM3L 1ULVA 5IV2B 2HP4A 1G1YA 3EOTH 1FFNA 3SGDI 4P4KB 2OL3A 4PGZA 4PP1C 4JRXD 1Y6MR 1KYOJ 5GISL 1U8NA 3CVHH 2F5AH 2HTKC 2B4CH 5I9QB 3BPCA 2ARWA 4PP2B 4YXHL 3OAZK 2H1PH 1DQDH 3WFHA 3GSOB 1XZ0B 1HHIA 1IAII 3BP4B 4KK5C 1K8IB 1B4RA 1T7VA 4DGIH 2PCPA 3C60C 2DN7A 1CT8A 2VL5A 2VXQH 1YEDB 1WITA 1UWXK 1M7DA 4ZUWA 2IPTL 1MCWW 4OM0H 5C07A 2OL3H 3ARZA 1XGTB 5GS0D 3ARDA 5IW1A 3ET9F 2NY4B 1BQUA 3QXDA 1U8JA 4JRWA 4FNLL 2GW5A 4QXTB 4KHTL 4PJIF 4HJJH 1LVEA 5DJ6B 4J1UB 4MSWB 4UV7L 3EUUA 1II4E 2GIYA 4NKQB 4C56B 4EVNB 4K8RL 3MYJA 2D7NA 2QKIA 3JV4B 2AQ2A 3ZT6A 4LHUD 3QT2A 4X8JB 4MDJB 1G7MB 3UYOD 3WS3A 5H35B 3MPCA 3DROA 5E70A 3SQBA 4GW5A 3VXRD 5D1QC 5D96B 3RNKB 4OGZA 3VRJA 4K7PH 1RU9H 3K46A 2X4OA 4HT1H 4PJDB 3P30L 5MEQA 3QPXH 5D7LB 2H2SD 4JFQA 4RRPG 3RY6A 5DTFB 1TTFA 2XTJC 3T8XA 1TETH 3L3GB 4U4BA 1CICA 5GRVK 4KDTC 4CADB 2JCCE 4FFWD 3TT1H 2BY2A 1KTDA 5AWNH 3BKML 1N7MH 5EB9A 1Q0YH 1U3HC 3UDWC 1XF5B 1QOKA 4ELME 2FX9L 4H25B 5E2VH 5C71A 1U8OB 2O5YL 2VZSA 5EZIL 5EOCL 5KVFL 1IKNC 3DX6B 5D7JD 5IK3A 1INQB 5HHVH 5EWIH 4G42A 3WFBH 3ZE2E 1NL0H 4GW1A 4Q74A 3FN3A 4GJTB 4N90D 5DRWA 2FHBA 2NXYB 4XAWL 3G6JB 3BP5B 5GS1A 3DNKA 5LQBL 4W70A 5ICXB 1XR9A 3KXFA 5IMLB 2J8UA 5L2JA 1F45A 3ZYOA 5HGBB 2A73B 4PLKD 2KZ1B 3RZWA 5LWYL 4LCCB 5KG9B 4J8RA 2EO9A 1DN2A 2DTML 3V7MA 5IJKC 3B5TA 1AKJB 1F4XH 5JXEC 1X3DA 4I2XB 4X99B 4KI5C 4AZ8A 1RUKL 3QXWA 1QYGH 4NC1C 1G7PB 5SWZA 3QO1A 3BP7B 1JHKL 4BFGA 3ULUC 2PKDA 3LZFH 2DF3A 4OD1H 3BXNB 3SDXF 5D7SH 1XGYH 3ZYJA 4MB4A 3HHRB 4Y2OA 3J7HA 5H8DA 2CJUL 3BGMB 5D70H 2HJKB 1QBML 1U95B 4JAMA 4HPOL 1OTUD 4F37K 3EKCA 1I7ZB 2R2BB 5TPWL 4JN1L 3OKMA 1NGXB 4ONGL 3R06A 5BRZB 5FEBA 2R8SH 2NY7H 2B5IC 1TTGA 4HUNB 3QNZA 4JQVA 4OGAC 5C0GA 1FE8H 1CTOA 4GKZB 3C6LA 4NRYB 4OZIB 3TPKA 4Q0XH 4XPBL 4RWYH 3OWEA 5E6IC 5E5MB 5KN5A 5DRNA 2R1XA 5KTEH 3W9EB 4P5MA 2F8OA 2BY3A 2YKLH 4I3GA 3EO0B 4LLQB 3G5VA 3PV6A 4ODHL 1FVEA 3MRPB 5F88A 1QEWB 1OGAB 4XVSL 4FQXA 5CZVH 2E7MA 1XFPA 5DJ8B 4UIKL 3JUYA 3RWFA 1J10A 5DD5H 5DUML 3PABA 3I9GL 5C0RL 5CJ5A 1VGEH 2PO6A 3MJ8A 4ODTH 1JUFB 1QSFB 1KPUB 3BFOA 1IEHA 4X6CE 3DSFH 3OJDB 4YX2H 1ZAGA 3P9MB 3RZCC 5IVXA 4PJGB 4QTHB 5KSUA 5ESVB 1MHCB 4Q58C 3O45A 2GY7B 4PD4K 1AD9A 2BOBA 4Y1AA 4E42B 1MHEB 4R0LA 5DUPH 3KG5A 3V6FB 3BPOB 2W1NA 2HN7A 4X5WB 3CXDL 3PHOB 1ZHKA 2OSLA 2P47B 2OP4H 5BVJB 1YEHH 3F7YA 3QIBB 2A6KA 5IWLA 1KGCE 1N0XH 4XMLH 4EDWH 4M9OA 5KSVA 4U1LA 4QF1A 1C5CL 4HGWA 3QWQB 2LABA 2A9MH 5IM7A 5ISZA 5EU3A 3EYOA 2Y06L 5BZDA 1ZLWH 1D5XA 1DVFD 3VXMB 5CEYB 1BVKB 4Z7VF 1CG9A 3MNVA 1NANH 5JOEA 1U6AL 1CE1H 2NY3B 4B7LA 1UXWB 2FHCA 1L6XA 1PG7H 2EYRA 4JKLA 1KIRA 2FO4A 3LQZA 5MEPB 1QG3A 1HSAB 2ORBL 3ZT5A 3DRQA 1IGYA 3C60A 3VGGA 1EHLH 3DARA 3OF6A 3IDYB 1IC5H 4HMDA 4F8TA 3L5JA 3F7RA 1NCCH 3U46B 4O02L 4R3SB 1OP5H 4NKMA 4HZAA 1BFOA 3MXWH 2VDQH 2H3NA 1FBIL 4LFHG 3EO1A 1A47A 8CGTA 1NC2B 5LGJA 5IIEB 1F4WL 3GMQA 1XGQB 1U41A 1HXMA 4QKXB 4G80B 3TZVB 2VLME 4LLAA 3S98A 1MCKA 1DQTA 5D2NC 3M45A 5DK0A 5D1QA 1D6EA 2LU3A 1W0VB 1TIUA 2A6IA 1ZHLB 4JG1L 1IEBB 5C0CE 2XWBB 4DZBB 3C5SB 3MRRA 3O6MH 1FP5A 3EDEA 3HZMA 2Q7NA 4KC3B 1P84K 1MRFL 2D31A 3R8QA 4KDTA 5C6WH 5DS8A 5HYSB 1MNUH 4EJ1C 1U91B 1JZ7A 1U3HA 5FUZL 3NCBB 3UDWA 1MWAL 3U4BL 2WWMD 1AE6L 3BH9B 3KJ6H 4CMMA 1U8LA 5E9DB 1YMME 2VXUH 1QR4A 2VZOA 5EC1B 1D5MA 3EW3B 4U6VH 2CIIB 1FHGA 4HEME 1AC0A 3L3JB 4K94L 2FH8A 5ACMA 5ESAB 1E28B 5HHOA 2GCYA 1HHHA 3S7GA 1IC4H 3BIKA 2G2RB 5CJQL 5E94B 3C08H 3GHBL 4HWEH 4KQ3L 1A1MA 1WC7B 5DD0L 5FYJE 1FVCB 1YPZE 1FZKB 5IJKA 1I1AD 2P46B 5FKPA 5FYLL 5JXEA 3I6LD 5L2KE 1KPVA 4OGXH 5C08A 5ID0B 1CLZL 3MJ9A 5F1IA 3DUSA 2FIKB 4K23L 1JZ6A 1F58H 4LEXH 1S9VA 3VXUD 4W4NA 4UQ2A 4OV5B 3T2PA 4KXZH 4ZSOE 4OZGF 1RVFL 3OPZL 1S7SB 4G7VH 1VCAA 1PY9A 2DBLH 4L4JA 4MD4B 2A74B 2MJWA 1CZ8H 5D1XB 3U48A 2I5YL 5E8NA 4XNQA 3JUZA 2IQAB 1VGKB 2HWZH 2AI0L 3KLDA 2VH5H 3PL6D 4MJ4A 4L3ED 4F57H 5FHBH 5FCSH 4MAUH 3ULUH 3O2WL 4RISH 5DUBA 1Y18B 1U8QB 4X0KB 1K4DA 4YDIL 4UNTA 5E6IA 2I27N 5E08H 4P2RA 1A21A 4K9EL 2Q8BH 3FO9A 4NN5C 3H9SD 1JL8A 3MMEA 1RSFA 2F58H 4Y2DD 4PJ5B 1J11A 4PJ7A 4HLJA 2AJUH 4OF8A 1B6DA 2ZNWA 3HG1D 4EI5C 4M1CD 1U8HA 2HJLB 4NJ9H 4P59H 5HI5D 2X44D 4JFXA 5FKAB 3STZA 1E6OL 2FEDD 1CFQB 12E8L 3EZJB 4Z5RA 3F12B 4PJAA 1RUPL 4X6BA 4Z7WF 1U93B 1MCOL 2JCCB 1MAML 2ADJA 4YNYA 3RZCA 1YQ2A 2PW1B 4HIXH 2A6DB 1ZANH 3HC0B 4M4RA 5CKGA 4BKLB 3FQRA 4ELMB 2H2SC 2BDNL 2BOCB 1T5WA 1NBVH 2WUBH 1KPRB 4XPAL 4FFWC 4WHTB 3HPJA 3KPQB 4D0CB 2FHFA 4L8SC 2XN9E 3UMTA 2YSSB 4Y5XC 5F7EL 1FIGH 5D8JH 2FBOJ 3I6KB 4ZFGL 1C5BL 3P4OB 5JIHA 4XP4L 4R7DB 2XPGB 3CSGA 5BS0E 5J1SC 3TNNA 3UTTE 4P3WA 1A9EA 4LMQI 5DT1L 3ZKXC 2YPKA 5T1MA 1W72B 5E8EB 1KSRA 2G9HB 4PRPE 3SJVE 5IMMB 5H94B 3BHBB 2R1WA 3EDFA 3NIGE 3UPAA 3IFOA 2IALB 5C3TA 1R3LB 4AEEA 25C8L 1KIQB 4XCFL 1A7PH 3O4OB 1T3FA 2KH2B 3CDGB 4LGPB 1PW3A 2AEPL 5GGSB 4PJHB 3F65A 4AIXA 3T0DA 3ULVD 1NLBL 4HIHA 5MENB 4F58H 3IDGA 1UGNA 4EUPA 5I1IH 1YEFH 4F7EB 2I60H 2CK0H 4YHLL 3QIWB 2NNAA 3W0WA 3HAEG 3FFCA 5IMKA 3QEUA 1MEXH 1CL7L 1RZFH 2V5YA 3ARUA 4JM2B 5EU7E 1AQKL 5FIEA 4KK6D 4PJ9D 3CVIH 4JPKH 2J8UF 5D2NA 3ZDZE 1WF5A 3QNXB 3FT3B 1ONQB 2RCSL 1LE5B 4BH8A 4EUPH 4G5ZL 2VDKL 1AO7A 3T1FA 3BE1H 3F58H 3SDYL 3U0PB 4JFDB 4WV1C 5IB4B 2EDHA 4AG4L 5EU4A 3EOBA 3DETD 4P3DB 1MCNA 3QCTH 4FQ2L 5GZND 4NKIH 4MCYB 5JOFB 1JE6A 4R2GD 3ARQA 2CRZA 5F6IC 1T04A 4IIQA 3EDJA 4CU6A 3Q48A 4DVBA 3BDBA 5DR5H 1JGLL 1ZEAL 4JQIL 5TE6H 3VXOA 1T03H 4PRBA 1MHHB 4RQQA 4XH2B 2FWOB 4UTAH 3U30B 4LQFL 4OCYL 3MC0A 2DQDL 4WDIB 5F97E 3SKOA 1R3HB 5JOPE 1YDPA 3FL7A 1X5HA 1A6UL 3GJFA 3S34L 5T1KA 4IRSD 5KS9A 3QXAB 5EOTB 4JZJB 3V5HB 2X9WA 1IAOB 1QFWL 4GW4A 4JDTL 1S78D 4JRYD 4X98B 3MOQA 1S5IH 4LSVH 2DYPA 2DWEB 3MACH 1LEGA 3AFLA 3OKKA 3QR2A 5E4EB 2I9TA 1WCQA 5JMOC 2CLZA 1EEYB 1B3JA 3FFDB 1DZBA 3GJFH 1F3DJ 3GMMA 5HDQH 1DVFC 1EH9A 4PJIE 3VFPA 5ITBH 3LPFA 5JR1H 1T4KA 5FYLE 1P7KA 3UBXB 4C4KT 4MAYD 4AQOA 4JFHD 3EYUH 3BZ4B 4E41E 3CFJB 1BIIA 4N9OB 1LWRA 3ZT7A 1X5YA 3AM8A 2V7NB 1KCSL 1IC1A 1YEIL 4HJGB 5F6HI 4PLOB 4BQ8A 2V5SA 1IM3B 3DLQR 2X89D 3QDMA 3Q3GA 3K8MA 3HAEH 3MV11 4LVEA 4JDVB 1EFXB 3DXAE 4A2MA 2XZAH 1Q9KA 5BXFA 2IADB 1IGMH 2DQFA 1ZVSB 3JTTA 3JV6A 2DQTL 1AD0A 1MF2L 1ZSDB 4EI5A 3HZKB 3U36A 2BVQB 4LCYB 5T3XL 5C0CB 1TCRA 1EEQA 3X3GH 1YEJL 4LHUA 4OKVB 1QVOB 4Z78A 4QCIB 1A3LL 4RGOH 5T3ZL 1BVLB 1J0HA 4MA1C 3RL2A 3S88L 1OHQA 5DJYB 3REWB 5KSBF 4M6ML 1YYLH 4X80L 4PTTB 4OCMC 5J12B 5IFHL 3WEXA 3VXSE 4LSPH 3BZDA 2D2OA 2W92A 4WHYG 1YMMB 4H88L 3PJSA 1DSFH 4U0RB 3PF2A 5EBWA 2JIXD 1G0XA 4MLIA 3WJJC 3S5LA 5D6DC 1EA9C 2F19L 3P77A 4FQLH 5E00B 5EPMB 2WWMC 4L8SA 3MLVH 4Y5XA 4PLJD 3FB8B 5F7FA 3GSWA 1HZHH 1I3GH 1J5OH 2VXTH 2Z93B 1JMXA 3G5YB 5BJTB 3EOTL 4ZFOB 4M7LH 2NX5D 1MCHA 1R5WA 4OKDA 1M05A 3CVHL 1ZXQA 2X7LA 2F5AL 1JPTH 4HIEB 1T7WA 2B4CL 5T5FH 4P46A 5DDHB 3B43A 5E8OA 2YEZA 3VGBA 5EUOA 5FGCE 1YNTB 1CXLA 2H1PL 1DQDL 3BPLC 2FLRT 3DHJA 2CDEB 5DD3L 4DGIL 5J56B 2ZCKH 2P5EE 2VXQL 1I1AC 3H7BA 1JK8A 4ZSOB 2BVOB 2B1HH 4OM0L 2OL3L 1JWSA 2BNRB 3MLPA 1RZGA 4BSVB 5F3HA 2ERJC 5E2WH 4CDHA 1A7BA 3RVXD 2VLRE 4HJJL 1BQLH 3E6HB 2IH3B 5HI4D 5ADOH 4LP5A 5D5MF 4B7IA 4L8DA 3HZVB 2Y5TB 1U3JA 5MEOA 4ZUUA 3ARXA 3O3DA 3RPIB 1WBZB 4OJFH 1JP5A 4P4KD 4OFVA 2OQJB 5KANG 3BRFA 3NCEB 2SEBA 3WUZA 1X5FA 2VC2H 4LRNH 5HTSA 5I75C 3GMRA 3PL6C 2XV6B 1MRCH 2HRPH 4LQ1A 4JHZA 3SO5A 5GGUB 5H2BA 3MGOB 1N8ZB 2GUOA 4GRWH 4K7PL 1FZJB 1RU9L 1HWHB 4DGVH 4HT1L 4WV1A 4XPFH 5IG7A 1OB1B 3S4SG 3QPXL 1MFDH 2N4IA 3LEVH 1TETL 3KYOA 5TGBB 4NSKA 3TT1L 2NY4D 4OZFG 5AWNL 1IAIM 4O51B 1N7ML 2VDNH 1Q0YL 3JZ7A 3C5JA 4M1CC 2ZSWB 5E2VL 1V3KA 1T0MB 4B5EA 1FZOB 2X70A 4MX7B 5HHVL 1JVKA 5EWIL 3WFBL 5I1KH 1NL0L 1XGPA 5DHXB 4QXGH 4IS6A 1N6VA 4LLYA 3FQUB 4WHYH 2APFA 3OZ9H 4M1GH 1NGWB 3LKNA 4Z7VE 5JNYB 3ALXA 1NGYA 3UTQA 4XP1H 4Y19D 1PFCA 2XN9B 4JJHA 3SPVB 1T1ZB 1LP9A 2DI9A 2OM5A 4JZNB 1XF1A 3U4EB 5D7LD 1F4XL 3MROA 2P8PA 1QNZH 2XNAA 5BS0B 3T4AB 3OGCB 1T1WA 4QLRA 1QYGL 5D7IA 4DCQB 3UTTB 1MPAH 3PXHA 4U7MA 2DLTA 3RWEB 4PRPB 3SJVB 2XQBH 3LZFL 1DVFA 2RHEA 4YDJB 5ACZA 1KIPA 1DE4B 1ZHNB 4OD1L 3UJIH 1DLFH 3GSXA 3ILQD 5E4IA 5D7SL 1XGYL 2ARJQ 2WSKA 3QUKA 5D70L 3VGAC 5CMAA 1MVUB 1CFVH 4U1HA 3THMH 1I9EA 3SKJH 4M48H 4QXUH 3X13B 4P48A 4C55A 4Y5YC 1R3JB 3ROOA 3DYOA 4DFIA 5HJ3A 2R8SL 3ELAT 1WZMA 2NY7L 3EFDH 3U9UA 1FE8L 4JHAH 4Z76B 4Q0XL 4RWYL 3WO3B 3ULVC 1MHPH 1AKJD 1TVBA 3P0YH 5KTEL 2YKLL 5D6CA 2VO5A 4HUMB 4LKXA 1E4XI 1S7WB 1BMGA 4CN6A 5CZVL 2FJHA 1UJ3B 5DSCA 1KF9B 4WW2C 3WIHA 3CMGA 3PHQB 5DD5L 4OBRA 3CU1A 4KK6C 4AEFA 4PJ9C 2WUCH 1VGEL 1QHOA 1OT2A 4ODTL 4PJCA 1FZMA 4C54A 3BISA 4U6XA 3DSFL 4P2QA 4QRRE 4YX2L 5I1HH 4CVZB 3BWAA 5CBEB 3V5DB 5BRZD 5HHXH 3DETC 1VFAA 3L7EB 1YNKH 1M7IB 1S7RB 5DUPL 3WJJA 5D6DA 2AQ1A 3PV7A 3WIHH