4HGWB

Crystal structure of s25-2 in complex with a 5,6-dehydro-kdo disaccharide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
213
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the cross-reactivity of S25-2: complex with a 5,6-dehydro-Kdo disaccharide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antibody Fab fragment, light chain
total genus 40
structure length 213
sequence length 221
ec nomenclature
pdb deposition date 2012-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgwB01
2I60H 3I3EA 4PJHF 2FX8H 2NTSP 1FNEA 2IQ9L 3QXAB 4JJ5A 1IVLA 4P49A 1R3JA 5C0FB 2J8OA 1S7TA 1ZT7A 1AIFB 2ICWB 4KPHL 4N8PA 5ANME 3S3PA 3SCMC 2NZ9C 1FG2B 2WIIA 2XACC 3C5JA 3KJ4B 4D0BA 4JRXD 1OM3H 4P2RB 1ZT4B 4EI6A 1XF4B 3F5WB 4U1HB 5IVZB 1ZS8A 3KXFA 4FQIH 2DM4A 2F53E 4G3YH 4RAHA 2C3XA 1FIGH 4JPKH 2CDFB 1Q0XL 3HAEH 5KANG 2WLYA 1T03L 3MNZA 1S5HB 4U1NA 2D4DA 2YHGA 1A3LH 2QKIB 2DM2A 2P5EB 5E03A 5GS2H 1OGTB 2J2ZA 4E41A 4YDKL 3GI9H 3MRKB 4YWGH 3NIDE 4M03A 3K74B 5E2UH 4Z7OF 2IF7A 4BZ1L 4H0HB 5HYEA 3BKMH 3P4OB 5MI0C 3TYGL 3N1MC 4ZAKD 5F7DA 5KSVA 4NOBA 4FQ2H 3HPJB 4NQCE 3MLUH 5GRYA 2R1XB 5IV2A 1G9ML 4XCFL 3BDYL 4GBXD 2HFFB 4JM2C 4U6VH 5DD1H 3D5OF 3MOAL 5GS1C 3TT3H 3VG0L 2YD6A 1SBBA 3ZL4H 3T0DA 2JJVA 3GGWA 5A2IH 1JGEA 3I6KB 2W07A 1WQVT 2HVKB 2CRIA 4DGIL 5DFTA 1QR1B 1ZEAH 4WUKH 5E2UL 1GPOH 2H2SC 5E08L 3BT2L 2ZG2A 4HUVB 2VH5L 2PYFB 3FCTB 2GHWB 4WJ5B 4RQQB 2Y36L 5IJKA 4NQSA 4ACPA 4WFHE 3IFPA 3VE0B 3U4BH 2A6IB 3MLUL 5IG7A 3OKYA 4MQSB 1C7TA 1CLOL 1RK1B 4P9MH 3I75B 4OFPA 3CXHK 3T77B 1DDHB 4X7TA 4KJYA 4DWHA 5I2IB 2GFBB 4HEME 3QDMA 4ODVL 2OYPA 1UM6H 5FUCE 2GUOB 3U7WH 1JNHA 4WEUD 3T4YB 4PGZA 1J0IA 2UYLA 3QUXB 3ZKNC 4HD9A 4BFBD 2ZOLA 4RDQG 2Z0BA 4QHKI 4GKOA 2J8UE 3DV4B 4HS6A 3HFMH 5EPMA 2JB6B 2LV4A 4ODBD 1CK0H 2JTDA 5F7EH 2P5WE 5I1IL 3DSNA 3B3IB 2IQAA 3AREA 4CU6A 3DVFA 4JO4H 4ELMB 3ZKSD 1LEIA 3ARFD 4EOWH 3VFTB 2DDQL 2I24N 1NC2B 5EA0L 1X5IA 1A3RL 1WBYA 3MRFB 4YHML 1M71B 1UA6H 1TJHH 3DHMA 3G5VB 4RBPK 1OAUL 1MFAH 3QULA 5E7BA 3GKWL 4JKLA 4LPWA 4CAGA 3KDMA 2VLKA 4BSVA 3GKZA 1L9NA 2DTSA 1RJZB 1FAKT 3GMMA 3UYRL 1AH1A 4UT6L 1P4BH 3CX5K 4PJEF 2C1PA 3NTCH 4RA3A 4FMKA 4PJIF 3UO1H 2B4CC 1U8LA 2XZAL 4U1GB 3LIZH 4WFHD 5CZVL 1N0XL 4PJHE 3AC0A 4QRPB 5D1ZD 3STBA 1YEIL 4H8WH 4EI5D 4MXWL 5H35A 2GK0B 4NO3A 2NR6C 3HCVB 1TJHL 3DYPA 4QHLA 4JLRB 4ODUB 2NY5H 1RUPH 4X7EC 4U2ZA 4RGNC 1IM3A 1WFTA 2NY7H 3BQUD 1ZWIB 3MO1A 5E4IA 5D8JH 1MHCA 4NCC2 4YHNA 5DD0L 3BWAA 4PGJA 3C6SA 1C08A 1BIIB 3MGOB 3T3MF 3QNZB 4MA1C 1DL7L 1BD2D 2H2PC 4LVHC 3MRHB 3SBWC 3NCMA 3PWNA 1FL6A 2LAGB 5TPWL 1H8OA 3F6LA 4NRYB 1KELH 4LCWB 1YY8B 4FTVD 3ZZ1A 1Q1JH 4BKLA 4N0FB 4YXLH 4N9GA 3FT3A 3EOTH 1N0XH 1TITA 4U1JB 1CFTB 2B0SH 5BZWA 3VXQA 3OB0H 4MXWH 1G9MC 2VDLL 3HNSH 4MSWB 3GSOB 4BH8A 2ITDB 2R0ZH 4I5BB 3GHEL 1GGUA 4YJZL 1KJ2A 4ONHB 5ICYB 1EO5A 2P5ED 2I60L 1JIBA 1DLFL 4NC2B 1INDL 1HHKA 2ESVB 5DVLA 1W0WA 4DOHB 5FO9B 5J1TC 4N9GB 5I1DA 5FHAL 4J4PC 4ZSOE 1QLRA 2YMXL 3SCMD 2JJSC 4XX1E 5CJ8A 4K8RD 3VXMB 5ETUB 1T21A 4YX2H 5A16B 5INDA 4MJ5B 1EZVX 5I9QB 4YXLL 3HUJE 5LXGH 3IAQA 3SQOL 5GGQL 1HQRB 1FNGA 1MF2H 2R2HB 4ERSH 3OAYH 3LV3A 2WQRA 3U9UA 3ILPA 2IAMA 4WW2F 3J7HA 5ICXA 1QHPA 2CIKB 2CRYA 2X1PA 4KK6D 1K6QL 3MMEA 2EC8A 2X4TA 5D2NA 2OZ4H 3X17A 1UM4L 3Q2CA 2J6EH 1INEH 4HF5H 2PW1A 3PABB 5L7XH 4HT1H 2GITA 3QNYB 5DK2B 3MFFA 1T2JA 4CKVX 1HIML 1VKXB 2R0KH 1Q94B 1CICB 5L9DL 1KC5H 3OWEA 4ZO7A 3CZFA 5EU6B 3D9AL 1QACA 5F88A 4GBXC 4NZTL 3DXAE 1EEZB 4UNUA 1FO0B 4IJ3C 5E1AB 1IGCL 1MCWM 2FR4A 5BJTB 4M7JL 4F2MB 4NQEB 3X11B 4XNZB 4NQDD 4ODTH 4K7PX 5SWZE 4Y16C 3TT3L 4PJDA 1IBGH 1WCBA 3T2OA 2ADIB 4WW1B 1H3UA 3FO2A 5KANI 2XWTA 4OM1H 5KJRL 4D9RD 3Q5YA 4GXVH 5DMIH 2WW8A 5E99H 3UMTA 5DEZA 1NEZA 3WFDH 4ZFZB 5HHVL 4WI4A 4E0RA 4ODHL 2HT4D 3H7BA 4NFDA 3ARED 4JHAH 1HXYA 5ERWB 5CCKL 4UTAH 4J8RB 1QLRB 5FDWA 1IC4H 2BCKB 3ZT6A 3GNML 4FN0A 5DA0B 4L4VA 3U4BL 1IGCH 2OMNA 1JI1A 3GSUB 3HE7C 1OGAA 3VGBA 4KGJA 1MJUL 2ZCHH 3IS1X 1NBYB 5I74B 2FX9H 2BRQA 1S7SA 1KJ2L 3DGGA 4LF3B 2FR4B 2J7LA 3W9DA 5CLWA 5I1AA 1GC1L 1FNSH 2PN5A 3UJTH 1G7PA 1I1FB 4FOMA 2JE8A 2PXYA 4JRXE 3SO5A 4K71B 4X7TB 4O2FB 4MAYB 5D2NC 3ROLB 3SDXA 4KRPC 5TJWK 4LCYA 3B9KC 2HKFL 2A9ML 2GITB 3C8KB 3FO0L 2R9HD 3GSVB 5D70H 1O7SA 1U93A 2P8PB 4EVNB 5J57B 3EOAA 5JOFB 5TF1H 4LLUB 1ADQA 3NOIA 4M7LL 3E3QE 1XGRA 3L7EA 5J1AA 2GAZB 3DUSB 5T1LA 4OFYD 3OKEB 1CF8H 2IH3B 5D7IA 3KPPA 4GRWB 4PRPB 1MFEL 1PZ5A 5F9WC 3KPTA 4RAVA 5SWSD 3RIAK 3ALPA 3OKMB 2Z8SA 1ZHLA 1F4XL 1NBVL 2ITCA 4CADA 1F2XK 4M7KH 3KYKH 4ODWA 3DUUA 3RVTC 4LCWD 7CGTA 1QLEH 2QADB 3RHWF 1P4IH 4PJ5B 3HE6B 3W0WD 5H37H 3ROLA 1R6VA 4XVTL 2H41A 1P2CB 2VITA 2AK4B 3MA9L 4KRMB 1UWGL 4Q0XH 1I3RB 1S3KH 3EZJB 4ONHA 1X6LA 5D6DC 2YWZA 5BW7C 4Z8FH 5KN5B 5I8OL 4M1CC 3UO1L 4Q2ZA 1D5XB 5B3NA 1FN4B 4Y4FC 4MSWA 1OOAA 4O00A 5GGUA 2PETA 4Y4FB 3ZKQD 3G5ZB 4G9FB 5DA4A 3IXTA 5FA4B 4KY1L 1CXEA 4RGND 4OQTL 1ITBB 2YPLA 3BI9X 2NY4B 3L3GB 1LEIB 3QUKB 1KN4L 4E42A 3U7YH 4WI8A 3KLAB 4RSVA 2Q3AA 4XPBH 3HZYA 4M6OL 3PWPA 4LSRH 4UIMA 3B9KB 2PYEB 2ADIA 4WW1A 3X14A 2DYPD 3CX5J 1P9MA 2P46B 4X8JB 4NCDA 1AGBB 2AABH 1CGVA 4HWBA 3O2VH 3MRIB 4X6EB 4L8BA 4MD4B 1R3JB 3EO1A 4FQJH 5IB5B 3B5TA 4P23A 3BZFA 1JF1A 2D4FA 5I6XC 1AP2A 4X6BA 1YEHL 1WZ1L 1Y18B 4D94A 3MV8A 3T77A 3IJYA 5F1IA 2VXTH 1U0QA 4M62L 3GM0A 5IJVB 5JLZB 4DUVA 4UBDC 5E2TH 3VWJA 1C5BL 1SMAA 3ARGD 3FRPA 2HG5A 3PQYB 1ZKAA 1F4YH 2E7LA 3P0VH 1CVSC 1FFOB 3FB5A 4NZJA 5HHOD 4OLUL 4LHUB 5I8CA 1BLNA 3RWDA 2KKQA 2OXGA 2GT9A 1UACH 5DWUL 3QULB 5HYFA 4QHNB 3QXTA 3K80A 4HJGA 4PTUB 4A2LA 2JLLA 5ESAB 3O6KH 3U46A 1GXEA 4IRJA 5D7JD 2CKBH 3W11C 3MCLH 4S1DD 5ACZB 5IIEB 4RFOH 3LY6A 4F58L 1T1WA 4O2CB 4K8RL 3H42L 2FB4H 4O9HH 3UBXA 4GS7B 5K33A 2UWEF 2F58L 2Q20A 5I1EH 5TE6H 2XN9A 4HEPG 5E00A 3NGBC 5DFWH 1OTSC 3PIQB 1FZKB 3UZVB 4D3CL 1NFIB 2J4WH 5E5UB 1JZ8A 4U4BA 2YBRA 4XCEB 4W68A 4LKXA 5C0IB 4JZNA 4K7FA 1HHKB 4Y5YC 5SWQB 2EEBA 4NWTH 2AXGB 4R4FL 4JFXB 1WZLA 5E8NA 3ABZA 3EDEA 3RDTA 3G6JA 3QH3A 2ICWI 3SO3C 1A7RH 2DBLL 4YHLL 4CGTA 1ZSDB 1AE6L 4OQTA 3KYNB 4U1NB 3BPOC 2CLVB 3VH8G 3H9HB 1HN1A 1B0GA 2ICWJ 5I9QC 1ZHBB 2CQVA 4M43H 1UCBL 3IFPB 4HUNB 1OD9A 2DLFH 2VXQL 4WJ5A 4KVCH 5D6CB 1PD6A 5DMKA 4P2RA 2Y06H 3PP4L 5DHYA 4G6FB 5DXWA 1UVQA 1A4KB 1ODAA 1FPTL 3MTRA 3GJFK 4JFYB 5BRZE 3RKDC 4JRYA 1AFVH 2IAMD 2VKXA 5C0FA 5EULV 2DJ4A 3F7QA 4PYGA 5C07D 3LPGA 4GRMB 3FHQA 1VFBB 3B9DA 4DZBA 1XZ0B 4R2GB 4PRHA 4PV9A 4Z9KB 4ZFOB 2QR0A 3MQIA 8FABB 4CN6A 1N6VA 1YQ2A 4OZHF 5I1GH 2ADJA 1B6DA 5DFVC 3DARA 3LN4B 1IL1B 4PRID 4GG6E 5IB4A 2A6JB 2VAAA 3SGJC 4HUWA 4L5FL 5ACLA 3S37H 4HKJB 5C0DA 3HG1B 5GS1B 2V6HA 5JA9A 2Y06L 2LVCA 4P2RE 1OW0C 2XKNA 4HDIA 4OIAA 5E8PB 3FQRB 1NMBH 5E9DE 5KAQG 5D70L 2FHBA 2HLAB 3IJSA 5J9PB 3S96B 5MEOB 4UV4H 3TZVD 1AGCB 1WIPA 1V3MA 3KPRB 1M71A 3MV11 4I0KA 2Y72A 2H1PL 5T1LD 1XGUA 4J7RA 1CF8L 1Q9WA 5D71H 3QDGB 1IL1A 1TQBC 4IRSA 3RWGA 3OMZA 2AGJH 2AKRA 3T3PE 2BRRL 1YMMB 4KUZL 4PV8A 4OZHA 4D9QD 4HZLA 4Q9BA 2K9UA 2VISA 4P4RA 3RPIB 4JFEE 5JPNB 3DV4A 5B39A 1FG2A 4F15B 2Q86A 1CFNA 3HUJB 2FNBA 4X4XB 1F58H 1A6TA 5I74C 3L1OH 2B5IC 1A9BA 4UTBH 4JZJC 1KB5B 3ZE1F 4NT6B 4UDTA 1BVKA 1YECL 5DLML 5C6PB 3VA2C 1I7UA 2OJEB 6CGTA 1PX3A 4Q0XL 4XZUB 1TTGA 3LHPH 4BSWB 3BW9A 3EGSB 1SM3H 2CUIA 4L4VD 4NRXA 3D25A 5HGDA 4NIKB 4FQQB 1JPST 4H5SA 4MNHA 5B3JF 4AQ1B 4R7DA 1NDMA 1NMAH 5IP4A 1QSZA 3LZFL 5GS0C 5IG7B 2L7JA 2BXYA 1MRFH 2VQUA 1D5MB 4NKQB 1WICA 2X4SA 1OAZL 4S1DC 2R15A 2B20A 2O5ZL 4LSPL 1ZLWK 5TDNA 2WZPD 4B53A 3IDMA 2BY2A 3CSGA 4I0CC 3UTOA 4ENED 3MLPA 2W1NA 4ZO8A 3TBSB 2R2EB 2XTLA 4GG8A 1LO3H 1EERB 4HWUA 5IMOA 1MCEA 5FHBL 5EH1A 1M7IB 2WIMA 5E00B 3GMRA 5EUKB 3T65B 1MIEL 2XN9B 4EDXB 1NCWL 4PGDA 3QI9B 4OGZA 5AYUH 5C1MB 4KJWC 4Y8AA 1UJ3B 2E7CA 5D1XA 4FFYL 2V2WA 1KYOK 5EDXA 5CUSH 1FYTE 4QHUB 5K9QG 5TDPA 3ULUE 1D9KA 3UTSD 5C09A 1CDUA 4DKDC 1ZVSA 2WBJA 3T3ME 1FCCA 2FDBP 1KULA 4JZJA 3O4LB 4ZYKB 4PJ9A 2APFA 2LU4A 3RL2A 1GVIA 4ZUVA 1L7IL 4FQHA 2AJXL 3H9SD 3UTPD 3X3GH 5INCA 1MJ8L 2BNRB 3FB8A 4YC2B 2PO6B 5C2BH 3TVMC 1TENA 5JHDA 4R96A 3OXRB 4RFOL 3RRQA 4QRRD 4CMMB 2YR3A 3BXNA 1HZHL 4H25A 3TIEB 1EXUB 4I9WE 4YNYB 1CTOA 2CKBB 4Z76B 2P24B 5GJTH 1KIUA 3GI9L 3MRIA 1P84K 5HHXH 2YZ1A 4ZO6A 2Z9TA 3WNMA 3ZMRA 3WFBL 1BFTA 2VISB 3PHQB 3QXAA 4RMSA 4F33A 5C0CE 1F6LL 4GLRI 3TN0D 4Q6IC 3VRLF 3JV6A 3DXAA 2J8UB 1P5VA 1MRCH 4XB8A 2VDRL 3JUZA 1KPVB 1L7IH 4IRSB 1UXSA 4BFGA 2X4NA 5FYJL 3X3GL 2N7BA 3NCCB 5IHUL 1IAII 2R39A 3OHXB 4G9FA 1LE5A 1A7BA 1B0RB 3L5WB 4ZXBB 3HUJF 2DLIA 3VRIA 2EE2A 1VFUA 1KN2L 1CICD 5C09B 3JSSA 3AS0A 3KS0J 3A6BL 4PRIA 4EKXA 5EOQL 4NHCH 4YUEH 5K9OA 3WO4B 1KCUH 4RGNE 2WUBH 2C7UB 1JPSL 4JY6A 1LE9A 4LKXB 4G6AD 4MJ6A 4NZRH 3TZVB 4ESKA 1P1ZB 3RUGF 3K2UL 1FPTH 1NGXA 2YD1A 3F65A 1CT8B 5HI4D 1X4YA 4FQ1H 1ES0B 2DLGA 2V9TA 5DQ9B 1RPQA 3OB8A 3OAUH 4XI5D 3SY0A 3TNNB 1DR9A 1NKOA 2H2PD 4IDJH 2UVFA 4XCCH 1QFUL 4HK0A 4HX1A 1DBKH 4QF1A 1VFAA 4PRHB 1H5BA 3I3DA 2F5BH 2A6DA 3KPSA 1O5DT 1X4ZA 1DANU 4JHBA 1AKJD 3TC9A 3PGCA 3CVHB 1OP3H 3SE8H 1D5BB 2FJGA 3SCMB 2GT9B 1KLUB 3GBNH 2XRAL 4L5FH 4XPFL 3QDJE 2XPGA 1T1XB 3G6DL 3F58L 2ED9A 1QPXA 1GYAA 2D0HA 2NMSA 3QJHB 2Z8WC 1FGVH 1TETH 4EI5A 2A83A 2Y25A 4KTDL 1REIA 2DMCA 3PXJA 4ENEC 2AJUH 3VGEA 1PYWA 3WIIH 1SEQL 4OSUL 2WSKA 3CCHB 3TV3L 4G6KH 2O26U 4KKAC 1J1PH 2JJUA 3IFNH 3D39B 4H26B 5B21A 4LGSB 4LSQL 2V5SA 3MXVH 4P59H 4POZD 2FECL 5D9SA 1CLZL 3RVUD 1JHLH 1X5ZA 1J0HA 1J1XH 1DBAL 1QHOA 1ZTXL 2QADC 3CLFL 4F9LC 1UWXH 2OR9L 5CILL 4XC1L 2VNCA 3VXSB 1HXYB 5JXAH 2GCYB 5SWSA 2ORBH 3BWUC 2C4FT 3QQ4A 4U0QB 1KB9K 1VADB 5KVFL 1AC0A 5CP7B 1AGDA 3LMJL 5F72S 3DNKA 1F6FB 3FRUB 5D2LB 4NDMA 2Q87A 3DETD 4WWKA 5TH2A 4JPKL 3U36A 4QHNA 3IDNB 1ZGLM 1Z5LA 2DI9A 4PJ5D 5KZCD 3Q6GH 3JWDH 1MNUH 4HJ0C 1T83A 2A77H 4V2BA 3OAYK 2FO4A 3GRWA 1ZTXH 3VFGL 5JZ7D 2PXYD 2ZG3A 4ZS6D 3HR6A 2X7LA 3TVMD 2BNQD 1FZMA 5DI8B 3MLRL 4HKBA 3P30L 1IGYA 3ULVL 2V5RA 1JFQH 1E28A 4PLKC 1Q1JL 4NNYA 4PRIE 2XZZA 4XP9L 1HILB 1KCRL 1JHKL 4PV9B 1V3KA 2PNDA 3IDXL 1H9VA 4Z7QE 4OF0A 1HKLH 3PWPD 2ZUVA 1KB9J 5BRZD 4PJ7E 1CG9B 4LLMA 1QSFD 4F7MA 3WXWL 2VJXA 2ZSVB 4AL8L 1R0AL 4LK4A 2R2BA 2FCBA 1BZ7A 1UYWL 3QA3A 5E5MA 1G0YR 4JFOA 2EKJA 4G8GD 2X1OA 3QQ9C 3U2SB 2VZVA 5T5FH 3OSKA 1YMME 4NQXB 3A0OA 4XNQA 1ZEAL 1X5HA 4PRNA 3AXLB 2BSSA 4HUUA 4GMSL 3QCTL 3LKQA 1T6VN 1NFDE 4KKLC 3GZKA 4U1SA 2Y4SA 3A6CL 3IU3A 3MODL 1BEYH 1U2CA 1P7KA 3F7YA 1GL4B 2P8MB 3A6OA 3QUMH 1NMCC 3SDCC 5GGUB 4WU5B 3LPFA 3QXUA 4JPVH 5F6HJ 4Y4KA 1OTUD 3CLEH 1S9XA 3V6ZA 4XVJL 1MCOH 3INUL 4J6RH 4JFXA 2ZUXA 3NFPA 1NAKH 1Z3GH 5TE7H 4W4OA 3SJVD 2E7MA 1C5DA 1TIUA 4K7FB 5C3TA 1CCZA 1NFIA 2FLRT 2J88H 4JFPA 3SDYH 2F54E 1Q9KB 3TPUA 4CDGC 4OD3H 3QCTH 4GMSH 1I8LA 2EC9U 2SEBA 3QFDB 3B4NA 2DKSA 3CH1B 3O4LE 4HPOL 4JFZH 5FKAA 1I85A 2VZOA 4M6ML 5FAAA 1OM3L 2AJ3A 4KMTL 1BEYL 1XR9B 5FO7B 1HCVA 3JTSA 3O3EA 4CVXB 2DQHL 1LNUA 3GO1H 3HC3H 5D93B 4RAVB 4IRZL 3RGVA 1X6NA 4LLYA 3BRGC 3V7AG 3G08B 1A6WH 3B5GA 4BFEA 4F3FB 1QSFA 5D7IF 3HCVA 1YMHA 5GS0L 4IDLA 3IDUA 3K8LA 5EA0H 5TE7L 5HJ3A 1JNLL 4NBYB 4RMVA 3T09A 1JJUA 3LQAC 32C2A 3GHBL 2JK5B 1DBJL 2KZ1B 1V05A 3RL1A 3QEHB 1NEZG 3ARDB 4F57L 2VC2H 4QRQB 3C8KA 3BPNB 1X5KA 3E3QC 4UQ2B 5DK0A 3LH2L 5I19L 3VWJB 5HHVH 2E8YA 4POYA 1EJOH 3BO8A 4ELKA 3A6BH 5IJVA 5JLZA 4MAYA 5JQ6H 3BEVB 1D9KD 3TT1L 3GMMB 3V52L 4M6MH 1RULL 5BOPA 1LO0H 3UC0L 2R69H 4BSVB 3QXVA 1ZT1A 4NKOB 5I1LB 4PB0H 1U3HA 5FK9B 4JY4B 5B38G 3KG5A 4NZRL 5JHLH 4MB4A 3AU1A 2BERA 2Q6WB 5GGRY 5D7SL 2CIIB 3VJ6B 3U36B 4GUPB 3TCLB 3LKPB 1PEZA 4NOFA 4XCYA 2BOCA 1S7UB 5I8KH 4YPJA 3FO9B 4Y5YB 1I1AA 4MHHG 2Z35B 5F21B 1UWEL 5CSZB 2ZCKH 1RZFH 3DX9B 5HPOA 5E8EB 1EJ6A 2GK2A 3QYCA 3QCUH 3WNLA 4CBPA 4NFBA 3SDAD 3L3IA 5INDB 4F9LA 4Z7UF 1MH5A 2GCYA 5KSUA 1EEYB 5FGCB 2JB6A 2YXFA 3QPXH 3FQXA 2W9EL 5I1DB 1OLLA 1J7VR 3IXTB 2WUCL 3F58H 5D1ZA 4U1IA 4KZDL 1IAIH 4Y4FA 1U6AH 5JZ7C 3MV7B 1T1YB 2IGFL 2OXHA 3X11A 4P2QA 3TCLA 3O4LD 4S11A 2R29H 3DO7B 3U30B 2Q6WA 5J7CC 1CXFA 1CVRA 3WIFA 5CBAA 4FQXA 1T7WA 1JTTA 3TBVA 3PWLB 3O9WA 1JP5A 4JO2H 4XPHH 1RZ7H 4POUB 3L7FA 1NGWA 1MUJB 2E3VA 4IHOB 3L3KB 5SX4H 3QNXB 3TCXA 3WFCH 3EAKA 1FIGL 2IJ0C 5BS0A 1JMXA 3B2UD 4HMEA 3ZDYF 1U36A 4DK3A 3QNYA 2YZ8A 1JCKA 2Q1EA 1PDKA 4FRWA 2ESVE 4FP8H 4LLWB 2W9EH 3FONA 2OR9H 5CILH 2HJLA 4LSVH 3WIHH 3KLSA 5GRUH 2AV1B 1FNLA 2Q7YA 2EDKA 4XWGH 3WFEL 4UT7L 3O3EB 4AZ8A 4B5EA 4CVXA 1DQMH 3MRQA 4AY0A 5KVEH 3GUTB 4WI9A 4KROB 4RZCB 4ERSL 3WS3A 2FECI 2BY0A 4WVRA 3ROOB 1U93B 1DBBL 2VDPL 3VXNB 3SDCD 2VXSL 3HMWL 1EGJL 5FOJA 4ZOCA 4MJ6B 3QNXA 2LQRA 2ICCA 3FMGL 5F89A 4LDEB 5IB2B 3BJLA 3DPBA 1I8KB 3DVNB 3VD9A 5EORH 3G6AB 4QRSA 3HC0B 1I1YB 1ZVYA 3IU4H 1TCRA 5EC2B 4Q58C 5F1NA 2AJZA 2F15A 3VD5A 1BJMA 3GIZL 5BRZB 3NN8B 1MIMH 3VXMD 4PJ7B 3BIBX 3BISA 3OJDA 4Y4KC 5TE4L 3SGKA 5JPMA 1A6PA 3VGDA 5LJYH 1LVEA 3QQ4B 1F2QA 3CFKB 1KPVA 2HFGH 2N7AA 5F7NC 4QRUA 2EIZB 1GZPB 3QIUA 1YYML 1PG7X 1AI1L 2PXYC 3B8SA 5T5FL 5JW4Q 3MO1B 2OCFD 1PLGL 4YWGL 2G5BA 4UT9H 2CKBA 3VJ6A 2EH7L 4N68A 5F9WB 4PJFB 4YDLC 5KS9E 2B0SL 3LRHA 3X3FL 5KVDL 5HVHC 4XNXL 1FFNB 3MBXL 5H37G 1DBML 1PYWB 4L3EB 2V2TA 2VLKD 3VRJB 1WAAA 4EN3B 3RWJB 1G1YA 1A7PH 3GMPB 5KW9H 4D0CB 5T3XH 1XH3A 4MCYB 1RUQL 5KBNC 3NFSL 4D3CH 4QRQA 3FQNA 5A3IC 5F7UA 4JZJB 3BKCL 3KJ6L 3PWVB 3RWEB 1U8IB 5FUCC 1DANT 3LS5H 1KYOJ 4HWEL 4QY8A 2X4TB 4ZD3L 4U6XA 3QQ9D 1OP5K 4XBGA 4YXHL 3HPLB 3CVHA 3BH8A 1QEWB 1VDGA 4R90H 1IKNA 3GKWH 2PW2A 3CGTA 4DGVH 1F8TH 3QUZB 3ALXA 4FTVE 5DJ0B 4MD0B 1XGYL 4RGMB 5CP7A 4X98B 2VMFA 4JZOA 4P5MA 4MQXD 4PJXA 1ITCA 1DFBH 4NO2A 5HDBE 2GSIA 1BPVA 5IW6A 2IBZX 3SY0B 1QPPA 4G8IB 1GC1C 4UQ3A 1KCKA 2R1XA 3FFCD 3O0RH 4PJBE 3SGEI 4MVBC 1MCBA 2P5EE 5JIHA 2OI9C 4H8WL 2AK4E 4J3SA 3UTTE 3WJLA 5GS0D 4HQQH 1F5WA 1JPFA 3BEWB 5CEXA 5I18H 2NY5L 4MD5B 1VEPA 1RK0A 5I19H 4XMPL 2JKXA 3V6ZB 4Y19A 1QLEL 4R90L 2EDFA 1H3PL 1RU9H 2ITDA 3MOBH 2CJUL 1HSAB 5MEND 4GMTH 2PYEE 3NA4A 2R2CA 4YK4C 1GCFA 2UWEE 2R69L 2DN7A 1EA9C 4J3UA 3DRQB 1CK0L 1XF5A 1V3JA 3FKUS 3HZKB 1HXMB 4FG6D 4GQ9H 4XC3L 2RFXB 2M2DA 2NY0C 2R0WL 4OCYL 3O2DA 3IAPA 1RZJC 1A3RH 4XGZA 3BGFB 1LO4L 2IFFH 4WFED 5CZXC 1I9JL 3ALWA 2AI0L 4JQVA 1AQKL 2I9TA 1CR9L 5I18L 5E99L 1BZ7B 3MRRB 4AIZB 4QO1A 1XGPB 3LRSA 3RX8A 5J1SC 3IF1A 4WNQB 2DKMA 5DVNA 3C5ZD 4CRPA 5D7JB 4N8VG 5A2KH 1EXUA 4YNYA 4Z76A 3GGWB 2KL6A 2A6KA 5HY9A 3FFDB 5FEBA 4LSRL 1FVEB 2VE6B 4W6XB 2H1PH 1AHWB 4PUBL 5CJXA 4NUGH 1FO0L 1KNOA 4LSUL 5JIKA 4LASL 3B5HA 2KH2B 4YE4L 5I71B 4X7FC 1EO8H 3KPLA 3HPJA 3I84A 3TN0B 4F7TB 5IUSA 1P4LB 1AGCA 1T5XB 4NQDE 3BE1H 4P2OA 5FUZH 1HINH 1BOGA 2WK2A 3BHBB 4OCXL 5HD8D 3TNMA 4NQCA 1R3HB 4ZS7H 1ONQA 5EIQA 4WHTB 1A6UH 4LSTH 3W0WA 4XRCA 5HI3D 2VWEC 3FN9A 2YUVA 3VRIB 3MCG1 1G0XA 4WFGD 3ZE2E 2A74A 1J8HD 1YN6A 3DJ9A 4I0PD 5I1KL 5DC4B 1I8IB 1AGDB 3LCYA 1GSMA 3VFOB 2HKHH 3NABH 3FB6A 1K3IA 4K8RC 4PUBH 5C09D 5LKNA 4JKKA 3QEGL 2X70B 2PYED 2APXA 3C5SA 5D1XD 2K7PA 3D9AH 4J12A 3UPCA 1J18A 4LARH 2DRUA 1XF4A 3THML 4ZDHA 1BBDH 2EDTA 1R24B 3QUZC 3L5XH 4KKCD 2Z4QA 2RQ8A 3MPCA 4HKXB 1G1CA 3HI5H 1ZLWH 4YEEA 4LSTL 4EXPX 2CK2A 1HOCA 3HMWH 3V0VB 2WAHA 3MRRA 4JAMB 2VLJB 4WV1C 3L3HA 3F7VB 2X4SB 5J13C 1DLFH 3KPQA 4DAGH 3D18B 1R3IL 2YPVH 1D5MA 2DM7A 5D7LE 4E9LA 4KTEL 3OL2A 5GGSB 1V5JA 5DMIL 2B7DT 2ATKA 3BN9C 4YDKH 4R7DB 5CJBA 3C87A 1XF2A 2BJML 4GKZA 1XEDA 3G04A 2ZJSL 1DQLL 1K8IB 4MAUH 4D2NA 1A9EA 1UQSB 4HLJA 3QQNA 4UTAL 3NPZB 4HW6A 4KKNA 4NM4L 4P3WA 3WE6B 3CH8A 3GSWA 2D7QA 2DBLH 2WV3A 3KPQB 4KVNH 4EQ3A 4KMLB 1TTFA 1XIWA 3I6LE 3RVVC 3RVWD 1V7ML 3VDAA 4GLRH 4D9QE 4DEPC 2NY1D 4YH6A 4R6UA 3O2DH 2VLME 3AUVA 2VXQH 4PRPD 3GEWB 1ORSA 2LAAA 2IWGA 1H5BB 5IVNA 4HGWA 1NL0H 2DIJA 4ZQKB 1JZ2A 5C71A 4OF7A 2MFNA 2E27L 2FJHB 5IWLA 1GPOL 3QDGA 5J11B 2VDNL 1M7XA 3T0WA 5IV2B 3VFRA 2FD6H 5KVDH 4JY6B 4PJ7F 1ACZA 2R2EA 4F37F 4N0CD 1SEBB 2VXTL 4KFZC 4PRIB 1ZLSH 5KSBF 3IKKA 4YBHA 2NY6C 1T20A 5DQDH 3IETB 1RZIB 3BPOB 3VG9C 4HAFA 3NFSH 3SDDC 2RGSA 1DQJA 1F4XH 4OFIA 1JTOA 3K4DA 4WDIB 1M7DB 2VAAB 5BMFL 3R1GL 4YZFF 3U7WL 1KJ3H 1VESA 3NZ8A 5IEHA 3MRMA 2DQGL 4OZ4B 4JKWA 4NRXB 2Y23A 4Y4HB 4ISVA 1CFSA 3DXAB 3EYSH 3C60B 1NQBA 3OAZH 1KFAH 4HZAA 1KIRB 1F6AB 4F58H 2NY4D 2XZCL 4WTXA 1BVKB 2QQKL 4JB9L 4EI6B 2ATPB 4K3JH 1CE1L 3WEXB 4ONGH 3E6FA 3VDCA 1TZGL 1I7TB 4JRYB 43C9B 1PEWA 3V0AC 3UZQA 2QEJA 1UVQB 5F3HB 1DVFD 3O3UN 1U58B 5JPNA 4PJEA 1CXKA 4WTZG 5DD5L 4IIQC 4L9LC 3CFJB 4BZ2H 1LEKA 3I6LD 1LILA 5C07A 4KQ3L 4DGYH 3FB8B 5AAMA 2IANE 4FQ1L 4CU7A 1Q9WB 2X1WL 1ZA3B 2AK1L 3MOBL 3PF2A 3R8QA 1ZSDA 1CFQA 4MB5A 4M6OH 4LPXA 4ETQB 1TLKA 3V0WH 1IGIL 1KTDA 3VGFA 2YA1A 5MI0B 2UY7A 4OF5A 5F9AC 1SY6H 3IETA 5E8PA 2JCCB 4AIXA 4X9HA 3CZJA 9CGTA 5C08B 3V7MA 2DLFL 4PJ8C 4WI5A 4LLDB 2VITB 3RU8L 2V2WB 3T0EA 3EYQD 3W39B 3DUHA 2YPLE 3T0EE 2FL5A 2A38A 3MLTB 3TEUA 1FDLL 1WWCA 4R3SB 5HYSB 3QUZD 5F7FA 4OCWH 1P4IL 4JCLA 4ODWB 2B4CH 2JJWA 5IF0B 3FQWA 3C2AL 3UBXB 5CHNB 5D2NE 1IQWH 2UY6A 3FFDA 3MRPA 5HYJE 1MJ7H 3S3SA 5C0BE 3I50H 5DUPH 3FTGA 4PJCB 4X83A 5L6YL 5CD3A 1S7VB 2WLZA 3IF1B 3V6OA 4LSUH 1UEMA 3WFHB 2DQDL 5IEKA 2J1KA 5I73C 1HCFX 5LAXA 1TCMA 3S88H 1U8IA 1B3JA 4G8FB 4GAGL 1R3KB 4X9GA 2P8PA 4EVNA 2VDLH 4H0IA 3WN5B 3OKKA 2EYRB 4S1RH 2HG5B 3PQYA 4WWKC 4XBPA 4M5ZH 5TE6L 3N1PC 1F13A 5C0EA 4OV6F 1OD7A 1DN2A 4DUWA 3LQZA 4XTRD 4ELME 1D7FA 5IK3A 1NFDF 3NMEA 3PWLA 3PHOB 1XF1A 4C4KO 5KOMC 2H8PB 4PJFA 3N85L 4LF3A 1EHLH 4R4FH 3DO7A 3RHWK 3WNPA 3O45B 5HI5D 3UTTD 4PTTB 3DETC 5DVMA 3RBSA 1MJ8H 5D7JC 5E2VL 1IC7H 1AGBA 2IPUG 4BFIB 2R56H 5LXGL 1R24A 3TP4A 4LHUD 5FA3B 4LPCA 3X14B 2P8LB 3CAFA 4EXKA 5I1HL 3L95B 2JF1A 3FOLA 4YHYC 1KGCD 1HNGA 1ZXQA 4XXCA 3CFEA 4LVOB 4R7NB 1T3FB 1A1OA 3VMOA 5DJ2A 3RJDA 5DC0A 3DX9A 2EDNA 5HDQH 2VLJD 4LCIL 4LMQI 4M1DH 1MEXH 5FV2A 4P5TD 2XFXB 1I8IA 4QHMA 2Z91B 4HJGB 3LVEA 1NSNL 1RUKL 4XBGB 1AFVL 3SE4A 4DCQB 2ZJSH 5ID0A 1S5IL 4NJ9H 1JGDA 3STZB 5FK9A 2CKBL 1J1OH 5AUMB 2XTJC 2NY6D 5C0DB 1OF2B 2E8ZA 3ULVD 4KVNL 4HXBH 4YK4B 4LOUD 4O5LL 2EDQA 4XVUD 5EZLA 3UPRB 2HWZL 1MI5D 3GSQA 4JFEA 5FYKD 1Q94A 3IDYC 4WTZA 3H9ZA 5D6DA 5TFSL 1HH6A 1T22B 2PR4L 5EOTA 3ARFA 3BGMA 1G6VK 3D85B 4JFHE 4TSBH 1EAPB 3P73B 4BZ1H 3DX8A 4RAUA 4Q9CA 1F42A 5C0AA 2QR0B 5HHMB 1NAMH 1D5IL 1NJ9A 4PRBA 5MEPB 4Z0XA 3R0MA 4OCSL 4P0DA 5IMKB 3TLRA 1N3NB 2I9LA 4KK5D 4JY5H 4S0SD 4GW1B 4LNRA 4XT1C 1A7NH 1M05A 1N59B 5HHNB 4UV4L 5BQ7B 1LK3L 2EIZA 2I5YL 1UXWB 3ZL4L 1QKZL 1DVFA 5I17B 4HXBL 1XT5A 3ZHLA 4GKNA 3BVNB 3QUKA 5ENWA 3ARGA 3S5LA 1CE6A 3PNWB 2FX9L 5F7WC 1DEEA 4LSSL 3DMMD 4JFZL 3JWOL 2C3WA 4K94L 3HRPA 3TA3B 2XTJB 1RY7B 2X4PB 4LEXH 2O5XL 1A3QA 4N0YH 5FCSH 2DL2A 1E27A 1S7SB 3DGGB 5F1SA 3FOMA 4ORGB 5K93A 4XMLL 4Y19B 3QB7C 1TQCB 3FO0H 2D7TL 4OJFH 5E8NB 1A0QH 3LKNA 2AXGA 1RHHB 5L8KB 1IEBB 4M1GL 1N5AB 1U91B 1PW3A 2ZPKL 4L9DA 5IB2A 2F19L 5AYQA 4OGXH 3WMSA 3IFNL 1YY8A 4FZEL 2D9CA 3PV6A 4NGHL 3V4UH 3BDBA 3UTSE 3V5KA 2CH8A 5J0BA 1RZJH 4X98A 3CLFH 5LWYL 4R2GC 1NBZA 4XCNB 3OG6B 4YXKL 2ZNWA 2DJUA 3KPPB 4GW1A 1MCQA 4I2XE 5IVOA 4BYHA 2IANB 2P7TB 1K85A 1TPXC 4TN9A 2GAZA 2PCPB 3DUSA 3P11L 5D7LD 3HI1B 4GAJL 3MYJB 3FONB 35C8H 4M1GH 5CEZD 1E4XL 4J4PD 1EEZA 3V6FB 1HHIA 5M95B 5KOVC 4NQDA 4R0LC 1E28B 1MIEH 1MVUB 4MCYA 5D71L 4PREB 1HEZB 4GRLA 2FGWL 1T83C 5D93C 1Z0MA 2HTLC 3K4ZA 1KBGH 2FO4B 1G7PB 1BZQK 1I1FA 4X4YA 25C8L 4LEOA 3QO0B 4Q97A 1M6OA 4R4BB 12E8H 3RY6A 1TVHA 5C6TH 3TBTB 1XR8A 1F90H 3GJFA 3SO3B 3QDHA 4Z7VF 4NQED 1CFVL 4GG6B 4LLYB 3LPWA 4DQOH 4JRXB 4U3XA 1QSEB 4Z7WF 1Q72H 1IQWL 5FO8B 1A7QL 1B90A 2OTWA 1T7XA 3QIUD 2W0FA 1T3FA 4ZOEA 2YPLB 2EICA 3UTTA 4HS6B 3OJDB 2NNAA 4NHUB 1U3HD 4LMQE 1N2RA 1S9YA 1F00I 2G2RB 4OZIF 2DWEB 1KENL 3U4EB 4FTVB 1EFQA 4GG6A 3C6LC 5JDJA 3MGAA 4KI5C 4OLXL 4UOJA 3VWKD 3RIFF 2CIIA 2W9DL 3RX5A 5I8EA 4OF6A 1CD1B 2HMID 2VXVH 4NN7C 4QOKD 5J12C 4K71C 1C16B 3N1GC 3BD4A 4NN6C 5F88B 4OLUH 5EU4B 3F7YB 3O11A 5DMGD 3B8YA 2E6QA 2ARWA 4PREA 5E4EB 2YEZA 3WNKA 3F6IA 4GQPH 4Q9RH 3ARDA 3OGCB 4LCCB 4UILH 5GSRA 5HHMD 4Q6IB 1ZHNB 4JFQA 4CADB 5ISZB 1GRWA 2YUWA 5B4MC 1BQLL 5HJ3B 3OKMA 5BQ7A 4LAQL 3D85D 2X9WA 3RP1A 1NLDL 2Q7YB 5IEKB 1NBQA 1WWBX 3ESVF 5E8OA 4OLXH 4ZG1A 4NKMB 4LLAA 4GOSA 4OGAD 5CD3B 1CG9A 1MCFA 4NHCL 4O4YH 4D0DA 3MRLB 1NBZB 3V4PL 4GRWF 1RMFH 5T3ZH 2ZSWB 2HJLB 3SKUD 3OXSB 1L7TL 1H0DB 3PGDB 4LLWA 4HK0B 5FKAB 2E6JA 2AXFA 2WINB 3PL6A 2APBA 3K2UH 5HYQB 4LCCA 5HHQA 3PWUB 5IFHL 4RA0C 2YKLL 4LCYB 4JN2A 4HKBB 4O2FA 2OR7A 4S1SH 3PJSA 3LKRA 3NCEB 1OPGL 1Y6KR 4LLVB 1OF2A 4PLOB 2AP2A 3CU1A 3TJHC 4YHOH 3MROA 2O5YL 5JORA 4P9HH 1JWUA 4WUKL 5HDBF 3ULVH 4WHDA 1TZIA 1U8NA 1K4CA 4QTHB 2ESVD 2QSVA 3MV7A 3JWDC 1OAKH 2X5PA 3DROA 5D1ZB 1D5IH 5BZWB 4KK5C 4OCSH 2X9XA 3FQXB 3QIBA 2W91A 4R97B 1A7PL 2NY0B 1MRCL 5BVJA 3I6GA 3VFTA 1SQ2N 5IMMB 3RZCB 4NN5C 4CNIA 4PLNC 1G84A 4U7KA 2YKLH 3WJLC 2J8UA 3D6GA 5HYJD 1HDMA 2C3HA 4F33B 1X9QA 1QG3A 5EPMB 1U8PA 2FEDD 4OUUA 3W2DL 1N59A 1VPOL 2GJJA 5KJRH 1TJIL 4JRXA 3JVGC 3ULUL 3HAEB 3OGOE 4XCYB 2FIKA 1C1EH 4PJBA 3OZ9L 4YDVA 3D39A 2IPTL 4G6ML 4H26A 5FGBA 3CCHA 4HPYL 1FO0A 1WZMA 3OXRA 3X12A 3QDMB 2ZOKA 1BFVH 1HKFA 5F7EL 2DQIH 4G8EB 4ISVB 5KS9B 1AQDA 4N0YL 3QO1B 3ARQA 3WLBB 3UJIL 5ITFB 3OR7A 5C0GA 3BPCA 4JREB 5DRXA 4IM8A 2APVA 4IS6B 4MQXC 1IGYB 4PGBB 3RWHB 4J6RL 1J86A 3HI6H 1KIPA 1FZMB 5DI8A 3RVXC 4ZYKA 3MNVA 4B50A 32C2B 3MRBA 3MOQA 4S10A 2GW5A 4G8GE 1O7VA 3AS1A 4NGHH 3V4UL 3C5ZA 4PJFF 2DQJL 2FJFA 3WYRA 3PP3H 4OI9A 4AT6B 5SX4I 4K3HA 3NZHH 4KMTH 1BJ1J 3DMMC 2A6DB 4BUGA 1JGVL 3VXRD 2X9YA 1NC2A 2YD3A 4YXKH 4JPWL 1VADA 3BKYL 4KROD 3FQWB 4TQEH 3EBAA 3HLAB 2W65A 1MVFA 4Y1AE 4KPHH 4RFNB 4EBQL 1MFEH 1T21B 3C6LD 3QIUC 3MLTA 4APQA 4M61B 6FABH 4G9DB 2P8LA 4R26L 1P7HL 2MJWA 4ODVH 3TH4T 5KVEL 3KPMB 5KSVB 4BFIA 3SJVE 1NGQH 3ME0A 4UINL 3RAJL 1VHPA 4G3YL 5CZXD 3D0LA 2UYLB 3QUXA 1G7MA 4C83B 3UTQB 4KI1A 2EZ0D 3DIFB 4LSDA 3MA7A 3GSWB 5JOEA 3I9GL 1A3LL 1J1XL 3ZKMC 1DQQA 4D9LL 5GRJL 3P77B 3T08A 5FYKE 2ZUUA 2EDLA 3Q1SL 2O5ZH 3ES6B 1L9MA 1HYSC 4XNUH 2PUQT 4GBXB 4HIHA 5IVXA 4OZIA 3SJVB 5D2LE 4Y1AA 5KTEL 4R0LB 1KJMA 1S7WA 2NYYC 4XP5H 3GSNA 4YHIB 3RWCA 3TYGH 5JW5A 1CN4A 2XPGB 4URTB 5J06A 3MJ7A 4JFOB 3F7VA 4MQ7A 3LN9A 3FN3A 3NIFF 5C08E 1OTTD 4Z78B 1ZT7B 1MFAL 1CFNB 3HUJA 5I66A 1S78C 3NAAH 4Y89A 1G7HB 3QAZB 4OTXH 1INDH 3LQAH 2MWCA 3MBEB 4HMCA 1RI8A 3GJEA 1CXLA 1S7XA 5CUSL 3C60A 3R4DA 1P4BL 1GGBL 2YA0A 2X4RB 4CVZB 3WL9B 1PSKL 4XH2B 5CIPB 1UC6A 5DQ9A 3TNNA 3D39E 2W9DH 3WS6C 1LK2A 2UUDH 3U79A 5DHVB 2EH8H 3LIZL 1KTRL 5D72H 2X7LB 4S1QL 4YIQB 1RZ7L 1EFXB 3D48R 5EU3A 5D96B 1G7LA 2BVOB 4AIOA 4DCQA 3QIWD 1ZV5A 3P9WB 5B4MD 1E4WL 1T7VA 4ZAKB 4QHUA 1D6EA 1JNLH 4NDMB 4P2OB 4ZPTB 2QBWA 4YIQA 4NBZB 3BKCH 2ADGA 2FX8L 2I27N 2HAZA 2DI7A 3OHXA 1QBAA 1WBYB 3MRFA 4APQD 4J3XA 4AENB 5IB4B 3ZDZE 1OY3B 3O3BA 4TNVK 1KELL 1QRNA 1EJOL 2FJHA 2QJDA 4HS8H 3T65A 1IT9H 4F7CA 3U0WL 3EDJA 5GZOD 4FA8A 2XG5A 2VLRB 5E6IA 1UB6B 4PB0L 4WGVB 4G42B 5HYJA 4UAOB 3D0VB 3LN5A 4P4KB 5F3HA 3EDKA 1JGLH 5D7KD 3SEPA 1EZVY 2NY5C 4J23A 4KV5F 2EE6A 3E2HC 5HGBA 1FZJB 5MP6L 3QIBD 4H25B 3TZVC 15C8L 2IALB 2C4FU 2VSCA 3TPKA 4OM1L 1IGTB 2E9BA 5FHAH 2EDRA 1ZHBA 1YPZA 3EYQC 1XGQA 1KPUA 1CGXA 3P9LA 1JWSA 4OD3L 4ZUVB 2HH0H 3QJHA 1LGVA 2EYRA 4PJ9B 1I7ZA 3CX2A 4OBRA 1T89A 3SQOH 2OS7A 4RQQA 3QDAA 3LB6C 1U6AL 3D39D 2NXYD 4IIQA 4L9LA 2BNRD 1FVCB 4DZ8A 4FQPA 1KJ2H 2HFGL 1RAMA 5EBWA 1DBKL 5DZNA 5A2LH 4JO2L 4H1LA 4L4VE 4X5WB 3MRPB 4M61A 5FXCH 3STLA 1LP9F 5IW6B 1RFDL 3RWGB 2A9MH 4LVOC 2DI8A 5J89A 2EDJA 4C54A 1N8ZA 2X6MA 2G9HB 5ACZA 1YPZF 4MD0A 3E6HB 5I1JH 1IEHA 1ZANH 3OG4B 1N6QH 5EOCH 1CLOH 4ZUTB 5IBTH 2F5AH 4I9WD 1T0NA 4N5ED 3QISA 3NA9L 3SKJL 3L3DA 3PWVA 3EYVB 3IKCB 1UWEH 4JVPA 1YDPB 4C57C 1I1CA 4M3KB 4TOYL 3QR2A 4PGBA 3UTPE 4MA3A 3MNZB 5DT1H 1RZGB 5SWZD 3VD3A 3BW9B 5IOPA 1KEMH 3PHSA 4OKDA 1G7JA 1U42A 5EORL 1BGXL 1UWGH 3WSQL 5D1QA 4XNMA 3SKNA 3TJEH 4WI2A 2I26N 5C0NC 4PJEB 3CFDA 3VFWA 1SJHA 2G5BB 4P5TC 3K4AA 4XB7A 1XGPA 5F70A 2W0LA 4O2EB 5HDOA 3MCKB 1FNSL 5DMKB 3EJJX 4HC1A 1MHEB 4R26H 1QSEE 4NPYB 4JGUA 4DGVL 1H3XA 5FM8A 1YYLL 1WBZA 1NC4A 3ZYJA 2J8UF 4TPRL 4OCWL 3NZ8B 5EZIL 3CPLB 5ALBL 4U05A 1QLFB 5T5NF 4RBPH 1GGIL 4JM2B 3P77A 4M7LH 1ORQB 3CVIH 4JQVC 2DMBA 3ZYOA 2E7HA 2MOVA 4Z7UB 1HSAA 4BH7B 2D0GA 4GW5A 4XRCB 4OM0L 4LBEA 4PJGA 4PJCF 3KPOB 4TYUA 1RIUH 5GRZA 5E9DA 1IFHL 2X4UB 4O51A 2MQCA 1P4LA 3U1SL 3IVKA 1LO4H 2IFFL 5T1KB 4K9EL 5JOPD 4H88L 3VFRB 1KJVB 5GZOC 4U6HA 3W81A 3KYKL 2NXZD 1A1MA 4P46A 4GRWH 3PG2A 1A14H 4F8QA 1FYHB 2XZQL 1Q0XH 1F45A 3DUUB 4G7VH 5IHZB 1JZ7A 3RKPA 5CJQH 2O61A 4P48A 3GUTA 5BV7H 4WY7H 3BIKB 2PKDA 5DYOA 1GGIH 3BD5A 1U8MA 4YGAB 1G7HA 1AY1H 3LEYH 1RQ5A 3KJ4C 4NUGL 1EHXA 3U4AA 1YPZE 4YXHH 3TIDB 4Z77A 1WJ3A 1HYSD 4XNYL 4DZ8B 5I8OH 3AAZA 5IMLA 3BP7B 1IC7L 5TDNB 1J11A 3GSNL 3GJFH 1KACB 2JIXB 2J5LC 3GNMH 5IR1A 3VXUE 1PJ9A 2ARJB 3I2CH 1P6AB 5DHVH 4Y1AB 4NRZB 2Y5TB 2EYTA 1KIPB 4Y5XC 4N8VB 4H5SB 4MNHB 3HZKA 1JPGB 5KAQF 3D25B 3INUH 4N90D 5HGDB 1ZGLP 1YPZB 2CK0L 4Y1AD 1ZAGA 1Z0NA 4H8WC 3X12B 5EB9A 1A1NA 2P4AB 5M7QA 2MPAH 5I8EB 1JF1B 3DIFA 4JQXA 4PFEA 1PZUB 3FB7B 1KOAA 3X13B 2DQGH 2B2XL 1CDBA 3RUGE 1NGYA 2HKFH 1T1YA 4NJ9L 3WFZA 3O81A 1C12B 2XA3A 4KRPD 5BVPL 5DJAB 3RDTC 3RWFA 2NY3C 4G42A 1MF2L 3ZDXE 4HFWB 1FC2D 4G8IA 3SKOA 3PQYD 2N4IA 3EUUA 2HP4A 5IHBA 4P9ML 5E8EA 3AMKA 3T1FB 2XWTB 3QIBB 5CEYB 4NM8H 4RNRB 4PRDA 3FO9A 5EU7C 1TNMA 1FBIH 1IC1A 2G60L 1WEJH 4V1DD 2WNGA 4J1UA 2MPAL 5L7XL 3LH2H 3L3OA 4OB5H 4PJ5E 4O58H 4MDJA 4FQCL 3TBYB 4Q2ZB 1L4IA 3W0WB 5FIEA 4R9HA 1AXSA 1R3HA 3RWDB 3H9SB 3ZTNH 2OLDA 1I1YA 2MTPA 2NLJB 3BUYA 2HN7A 4N5EC 5EU6A 1I8KA 4K8RH 5TGBA 3CMOL 4PG2A 1VFOA 1R3LB 2VDQH 4ZUSA 3QUMA 3BJ91 1MWAH 3HE6A 1X5XA 1OCWH 4PBVC 3IJYB 5F1IB 3RZCD 4D0CA 4Z5RA 3MJ8B 3VXNA 1KNOB 4LVHB 1UJTA 2OJZH 4J3VA 5F3BA 3DURB 4RZCA 1IBGL 3JVGA 3GJEB 2WWKT 4G9FD 4L3CA 5DSCA 1QFWL 3UTZA 3DLQR 3QWQB 1VFBA 2DS4A 4D0DB 3EO1B 1RJLA 4PY7A 1B0WA 4PG2C 5IB5A 4F7PB 1A6AA 3IJHB 3FQTA 4OB5L 4KJQD 5F9OL 4ODHH 1W2KT 2YC1B 3LV3B 1QSFE 4P2OC 4UDUB 3VXTB 4Z7VB 2VQ1B 1MCCA 1Z9SA 3VXUB 5J3HD 2HYMA 2FD6L 3HKFA 4KK8C 1J12A 2VSDA 4P57A 3DI2B 4RFEA 4NNPH 2LTQB 4E42B 2NXYC 3SJVA 4ZFFB 2AGJL 2BRRH 3H3KA 2HJFA 4IRSC 3PDOA 2R0WH 3IRZA 2DD8H 1UCBH 3L3KA 3KHOA 4AEEA 3THMH 1T66C 4L8CB 4PJDE 4KVCL 2IG2H 3LKNB 2YRZA 2OK0H 2Y07H 2XA8L 3EO0B 3ZHKA 2A73B 4BK5A 4I5BA 4JHZA 5IQ9A 3GRWH 3WHE1 1A6ZB 1ZMYA 3BSZH 3GSUA 3P11H 1LD9B 4JQIL 1JPFB 2BVPB 4DAGL 5LCVH 1IQDA 2DJSA 3P0VL 4YDJB 1N2RB 1DP0A 1S9YB 3QEQD 5C6WH 1AXIB 1YEGH 3BPNC 4XCEA 4ONFH 1QO3A 4UMGA 3N85H 2HJFB 2HFEA 4YC2C 3PIQA 4HUUB 5C3LD 3PWNB 4LASH 4YO0A 1O0VA 5D7IE 5I75B 1RZKH 4Z7WA 3MRQB 4UNVA 3S37L 1JI2A 2VLMD 2XV6B 25C8H 1BQUA 2H9GB 4JN1L 4Z7VA 4KKCC 1CDIA 5AZEH 3W11D 5EUOA 3QUZA 3CC5B 3PL6D 2YC1A 4MB3A 5JUEH 1HH9A 1SJXA 1JGUL 3U46B 2ZSVA 1N3NA 4PY8J 4XAKD 4F7PA 3QWOA 2QADD 5DVKA 5EZIH 3MYZA 2V7NB 4QXGL 5CWSA 1TZHA 1WT5A 1KTLA 2COQA 4HH9A 4Z0XB 3P4MA 5ISZA 3QDGD 1U3HB 3MUZ1 4Y5XB 5C0AB 5GSRB 1IJ9A 3D3VD 4X4MA 1J05A 3IU4L 1IARB 4Q9QH 5DK3A 4MMXC 3JV4A 3CDFA 3SDXB 5DTFA 2FWOA 2E9JA 3CFIC 3BUYB 2OX5A 3HE7A 4E5XB 5IKCA 4QTIH 1RZ8B 2K7QA 4S2SB 4F8TA 5I1AB 1T5WA 4MA7L 3RVVD 2PCPA 2YSSB 3RVWC 4MDJB 4CU8A 4F3FA 5DEFB 2Y1VA 3V95A 2NX5A 1CL7I 5LQBH 3CC5A 1H8NA 3C2AH 3OKDB 1NGZA 4HV8B 4M43L 5F9DC 5FKPA 4MJ4A 3RX7A 4JO1H 4M48H 2R2HA 2BXZA 3ZKND 1NAML 3BP5B 4QRUB 3IDXH 3KPRE 1U8PB 3MSPA 5DUPL 3T1FA 3HMXL 1CLYH 1HKLL 1PQZB 3LEYL 1PGRB 5GGVY 1MH5B 1HDMB 1JRHI 2AABL 4YBLC 4TSAL 2DLTA 4RGOH 3B6SA 2VDMH 4MCZB 3UZEA 1HIMH 5T3ZD 4MJ2A 2C9AA 3C8HA 5T1KD 1NMAL 2EH7H 5K9JH 1N64L 5FYLH 4XXCC 3ARPA 2CO7B 4LHJB 3TA3C 4GAGH 5C0AE 5FKPB 5FCUH 4U1KA 4QYOA 1EVUA 3QCVL 4ONGL 3MRNB 1MHPL 1NGYB 1XR8B 3EZ8A 1OP3K 2IAND 3L5JA 1N4XH 5C2UB 5JORB 2EDOA 4XPGL 4Y2DB 4KHTH 2VLRE 4KK9D 1IM9B 2H3NA 3GMOA 4ZXBC 1PKOA 1MRDL 3QXWA 4U1MA 5FHBH 2DQUH 1CFTA 1DDHA 4NWUL 5IB3A 1EHLL 5HGGS 1DE4A 1EUUA 5FM5O 4K2UL 4LCWA 1AJ7H 3AXLA 1XAUA 2D31B 4Y4FD 3QDGE 5IHUH 4NQXA 1N64H 5FYLL 4DOHE 1IC4L 4NN5B 5HPMA 3U82B 1B4JL 3HI1A 3LAFA 3DHJA 5FCUL 5DS8B 3VH8B 3AS2A 5I1EL 4L1DA 5ICXB 4UDUA 1KB5H 4WGWB 3Q3GA 1H15B 4PJEE 3S35X 4TNWF 4YAQB 1OAKL 4FQLL 4G5ZL 2WUBL 1DQDL 3HE6D 4ZTOH 1MEXL 4HWBH 1KEGH 3BOVA 4JFQB 4WU7B 3ULUD 4C59B 4IRZH 1T66D 2XY2A 3O3AB 5J3HC 2D03L 1WK0A 2HFFA 5E2WL 5C0RL 5LBSH 1B9ZA 2EXYC 2CJUH 1OSZB 1NANH 4U6HB 1FP5A 5GS0H 4NYLA 4JFEB 3VG9B 3SDDB 1QA9A 1VACA 2C7UA 4I18B 3O9WB 1BM3H 3CDCA 1UFUA 4GXUN 3JV0A 1YEKL 3MBEC 4Z7NF 1A4JA 2P44B 2R4SL 2VDQL 3CK0H 3KPOA 1Q0YL 2AERT 4OLWL 3FOMB 4ORGA 4ZUWA 2WWMC 1WAAF 2X41A 1N5YH 3C9NA 5ESQB 1FFRA 2XRAH 4XPFH 1OGAD 4WCYH 3NFNA 3G6DH 1EGJA 4PBXA 5FDWB 5TF0A 3UJIH 1G7QA 5T1DH 2VQTA 2R8SL 3H7BB 4NRYA 3EFDH 4RISL 2G5RA 1A1OB 2I07A 1AGFB 2GTWA 1I8LC 2IQAB 1MLBA 5FUOL 4LCCC 1OSPH 4PJDF 1LEKB 1T04B 5DC9B 5F6IB 1NUGA 3VWKB 2VUYA 4P5KB 3GSXB 4YHNB 4GKSA 1FH5L 1DQTA 1QQDA 1QSEA 3SGEH 3OKDA 4HV8A 2BOCB 3BN3B 4WO4C 3VXME 2NX5B 3QZWG 4UNTA 1MI5E 2BY3A 3E6FB 3TBTA 1DUYA 2VIRA 4NQEA 1BX2A 2GK0A 4HUXB 1FNEB 2H8PA 2DM3A 1KCUL 3UAJC 5I1HH 4FZ8L 1JGVH 5FUZL 4XC1H 1BWMA 5IFJB 3HE7B 4U3HA 3PXHA 4E5XA 3QG7L 5IKCB 2Y07L 1NMCB 2B1HH 3ARFB 2A9NH 4RX4A 3BO8B 4ELKB 1RK1A 1KN4H 1I85C 4NQDB 4I48B 1L6XA 1OB1A 2VDOL 1ZLVK 5IHLB 2VRAA 4LCUB 2F19H 4IEFB 5D2NB 5EU5B 2X40A 1SYVB 2CLZA 2FJGB 4LIQH 4Z7NE 1CZ8H 5LAXB 1NCBH 4I2XB 4P4KD 1I3GL 5IM7A 2X4OB 1S5IH 1JK8B 1JMZA 4G7YH 2XFXA 1UT9A 4MLSA 2H6PA 3G6JF 5GRJH 5BXFB 3RA7H 3BD3A 2EIBA 1BBDL 1XR9A 3EIFA 3MUGA 4LAQH 3P30H 1NLDH 3V5KB 4ZFOL 1F58L 1X7QB 4ELMA 3NIDF 2JCCE 4DW2H 4EN3C 4WHYH 5C07E 2YPVL 3MLSL 4L29B 5EZJA 5EIIA 2DL9A 3DI3B 3IFLL 3MLWL 1AD9B 5E9DB 1RUML 1CZ8L 1TXKA 2OM5A 5DD3H 4DKFL 2BC4B 1RURL 2XXCB 2CLRB 2P5WD 3D69A 4PY8I 3QQ3B 3WE6A 5I71C 3KPNA 4ETQA 1LO5B 4JVWA 1A9EB 1UQSA 5LG1A 3HS0B 4X4ME 3TYFA 4BKLB 4KK9C 4LGPB 4JANB 2X4NB 2ICES 1H3VA 3OBAA 3CFBB 2CDFA 4HMDA 2Y5TA 4BSWA 4MVBD 2QHRH 5E9DD 4G9FE 3GK8L 5DJ6A 2ARJA 4HXAL 3V6OC 2OBGA 4XP6H 1QSVA 1ZS8B 3VW3H 1JPSH 4QT5B 4X6CF 1RD6A 1MCIA 1CGYA 3DVGB 1KPRA 4NKIH 2L0DA 5HGBB 3UEZA 4ALAH 1MHCB 3BGFC 1EHAA 3BDYH 3ESUF 4O2EA 3TA3D 1NSNH 1RUKH 2Z4QB 1DUZB 3FHAA 3TO2B 4JLRA 4ODUA 3WEXA 4F9PC 3CFDB 5A2JH 3WUZA 4OI8A 4FFYH 4WW2B 5CHNA 1EBPA 4PS4H 2AJSL 4L8DB 5F3BB 2AKRB 3D2UD 3HE6C 3TH3T 3UTSB 1BD2E 2ARJQ 1T22A 5EOTB 5ILTL 1MAMH 1MI5A 2DQFB 5E08H 1FL3A 2IPTH 1NCCH 3U0WH 4YGVA 3RVTD 5SV4A 3S36L 3FN0H 4E41D 2Y6SC 5F44A 2XY1A 3CIQA 1HWHB 3ARZA 2GEEA 1QVOA 1DBMH 1ZVSB 2WBJB 2ZUQC 1TJGL 3R1GH 1RZIA 4Q9RL 3T2PA 1BVLA 4Z7UA 3FAXA 5EBMB 1F3JA 1IC5L 3FT4A 3WN5C 5TDPB 3ILQC 5GRWA 3QEQE 3D3VB 4GAJH 4ZXBA 1FE8L 2CUHA 4LDOB 3ZYIA 5SX5K 3RZWA 3MRDA 2D2OA 4PRDB 2BHYA 1QKZH 3C60D 5C7XL 3I3BA 4X6CA 4U49A 4HWEH 1MI5B 1NCDL 5CKAA 2R1WA 1SYSB 3UTSA 3V8CA 2X4RA 4LQ1A 2EIEA 5GRVK 1G6RB 4PGCA 3ZE1E 3E0GA 3KYOA 1AHWA 4U1GC 4ZQKA 1ZT4A 4KQ3H 5HI4C 4EIZC 5CJOH 5JXAL 3U48A 3KGRA 5EU6E 1NANI 5D9SB 5L8LB 2APWA 1NMBL 3TIEA 5I8KL 3F12B 1FNHA 1A0QL 1YJDC 3DX6A 3T4AA 3PWPE 1ZLUK 2KQMA 4YHKH 2XWBB 5HHME 2GFBA 4GJTB 2O5YH 4UZGA 4GRWE 4PRPE 1B0GB 1SY6L 4NQVA 1QBLH 1WFUA 4OCRL 1CDHA 5D1XC 5KVMC 5A43C 2HTLD 4P4KC 4NRZA 4WDIA 4KUZH 4NKDA 1AGEB 2PO6D 4TTDD 5C0CA 2ICEA 2XWBA 3D69B 4NQSB 1YMMD 5LWYH 3W5NA 2PYFA 3SGKC 5T1DL 3F12A 4XP4H 1KB5A 1VGKA 2F5AL 1VCAA 1NC4D 4G80B 1F3DH 2B4CL 2QQLL 3I02A 3D2UA 1HSBA 2X10A 4Y16D 3AFLA 4ZDHB 3MV9B 2GQHA 3CUPB 2BVUA 3BIKA 1DBJH 1XIWD 2C3VA 2ILLA 4RMWA 4PGDB 2Z92A 4CVWA 2O61B 3OKOB 4JRWA 4JKMA 2GSGA 5ITBH 3HLAA 3SKMB 3O3BB 3REWA 2Q8BL 2R1WB 3MUGB 2FGWH 4OLYL 4X6CB 4X5WA 4PLJC 1LO0L 1MHHB 5T1KA 3GBLA 3KPRA 4K3GA 2DQIL 4DN3H 5MEOA 1EVTC 3W9EA 3O8XB 4M5ZL 3BN9D 5C0ND 5TPWH 4PTUA 3VWKC 1JWMB 3WNOA 5I15H 4LBEB 1CU4H 1NUNB 2YPKA 2Q76B 4XWGL 5GS2D 3WFEH 1F3DJ 4TUOA 1FFQA 5ADOH 5D72L 1MFNA 1X5LA 4Y2OA 4OCXH 4ZPVB 3IB4A 1CGSL 3MFGB 1NDMB 1BWWA 5KZCB 4ZS7L 3CFCL 4U3CA 4X80L 5ITBL 2FX7L 4G7YL 1Y18A 5DF0A 5ALBH 4OLYH 4JKPH 4TVPH 5AWNL 3QIWA 4Z7QF 3RA7L 3PGFL 4X6CE 3QDME 2IALA 4PJHB 4NT6A 4PJGF 3RIFK 3NABL 4YDIL 2YMXH 5ANMB 2J88L 3DO3A 3O9WC 5DJZA 4PB9H 1MSPA 4HKZB 4I0PA 3ARVA 2VLLA 4PJ8B 4X8JA 2OMBA 5HHPA 5ISZD 3ARRA 4DW2L 4HS8L 1T2XA 1E6JH 3UYPA 3QRGL 2I9TB 5IGXL 4XNMB 3SKNB 1HNFA 3VI4E 5D6CA 3MLSH 3B9VA 3LD8B 4WENB 5E4EC 4F7CB 4OLZH 3ZDXF 4N8CL 5CLTA 2BNRA 3T0ED 3EJYD 1VERA 4G7VL 3MRMB 4OZ4A 2FX7H 1SMOA 1ETZB 4MA3B 1QD0A 3F8UB 2J6EL 4MX7A 5IROA 1EEUA 1RSFA 1GGYA 4O5LH 3G6JB 1F3JB 4NUJB 1IGMH 5SWSE 1T20B 1DVFC 3BP4B 1YY9D 3WXVH 1G7LB 2BVOA 3OZ9H 4JGMA 3AVEA 1RK0B 5L9DH 1MCHA 3TT1H 4YEFA 1NH6A 4Y4HD 5ICZA 4HKJA 3VW3L 5IGXH 1T5XA 1VACB 3H3PH 3N1FC 4U7SA 3MBXH 3KPLB 4JM4H 4NYLB 2KDGA 5JQHC 5DO2D 3RIAF 3M1BB 5D7SH 4HCRH 3TO4B 5F7MC 5I76A 4JY5L 1PAMA 5TQ0H 2P49B 2ERJC 5DJDA 1QTYT 3P0YH 1V7MH 3PL6B 4KI5F 3FMGH 1J0JA 1QSED 2GJ6D 2UWEB 5IIEA 2ZCKL 3W5MA 1HSBB 4JFDD 4PRPA 3D1MC 4MJIB 3KLHC 5ESAA 1JTPA 3HRZA 1LQSR 2HFTA 3T0VA 3WFDL 1QNZH 4IIQB 3LDBC 4L9LB 4TNVF 4PJ8D 3QEUB 2V7HB 3FN0L 4G43A 2CXKA 2FSEB 4LHUA 5D1QD 5ELIA 1OB1B 4NKDB 2PO6C 1MREH 3GSVA 2HTKC 3FT2A 4GBXA 2MNUA 2HRPH 2VZ1A 4U6VL 4FFVC 5DD1L 5DQDL 1VSCA 1KPUB 1E4WH 5C08D 1I7RB 4ZNEE 4X6DF 1FE8H 4K94C 4QRPE 2ZOKB 3LKSA 5C0BB 4KC3B 3NACH 1S7RB 1AI1H 3RAJH 4U6YA 3RDTB 2X89D 2IEPA 1TJIH 4IMLA 3S35H 1XIWC 2HRLA 4TSCL 1DUYB 2VIRB 3ZKXC 4OI7A 1OAUH 5ALCH 2FIKB 4L1HA 2IMMA 2AXJA 2AS5M 2VL5A 4G6MH 5F9JA 5D7LA 2G2RA 2GKIA 1URLA 4L29A 5EZJB 4K7PY 3RGVD 4N1CA 5HGHB 3B9KA 4X9FA 2YD7A 5IESL 3UYRH 3Q1SH 4Z7OE 2GJ6B 2JB5H 3ET9F 1T7ZA 4EJ1C 3NTCL 4XTRC 3O6FA 4G6JH 4K23H 2Y7QA 1A22B 3G5XA 3UBXI 4JZOB 4XP5L 3L3JB 1XGUB 4RDQF 3BZ4A 2VWEE 2H6PB 5BXFA 1I1AB 2ZP0T 3NFNB 4UUJB 1NGZB 4KKBC 1V8HA 2B1AH 3LS5L 5EU7E 4AG4L 4TTDC 2V17H 2GJ6E 3MREA 2AJYH 5JIPA 2HH0L 4GRLD 5EO9B 4MJIE 5J56B 5H94B 5KSAA 5T5NG 1FFOA 3FB5B 2D0FA 4JPIB 5EOCJ 1MELA 5GHWH 1VEOA 4JFFE 1IGIH 1WTLA 1QA9B 1I1RA 3C2SA 3MJ6A 4JPWH 3FZUD 2EDHA 5BCAA 4XP4L 1OSZA 2DQFA 4LQFH 1RIVH 4GAYA 4XPAL 5FV1L 1NDGA 5FYJD 1X44A 3FRPG 3MRCA 4KZEL 3OR7B 3TBWA 1JYVA 3WS3B 4NO0A 1S7XB 2R4RH 2VLKE 5BW7A 3VXPB 1HHGB 1JPTL 2D7PA 5L88L 1BX2B 4HUXA 3ECBB 3DYMA 4ODSH 2XN9D 3QRFM 1LHZA 4TVPE 1SBSL 1HH9B 2AV1A 2CDEB 1P69B 4JFYA 1W72L 3RGVB 5IBLD 5IVXF 1RU9L 3AY4C 4F7EA 3JWDL 3ULVE 5CJQL 5DS8A 1OWWA 4P2CG 5LVEA 1ZHNA 1G9NL 1QRND 4WFFD 3UCRA 3IDJB 4JFHD 2I07B 3MLRH 1GOGA 3DXAD 3RZCA 1MLCA 1U41A 2Q7NA 2EEAA 5BVJB 3H3BC 1IT9L 3O41B 4RWHA 1ND0B 5FA4A 3DRQA 3P3YA 4XNZC 4QNPE 2VZSA 1LD9A 2DAVA 3NCYP 1CL7H 5E94B 3T8XB 4YFEA 1CD1A 4EUPH 5F1NB 4D9RE 3EO9H 4P5TB 2VN4A 3MROB 2EDWA 1A4JB 5IW1A 4FTVA 2VAJA 4DUXA 2W38A 1MFDL 2OZ4L 1KV3A 4XHJD 1II4E 4WWKD 3V4VL 1BQLH 1INEL 4HF5L 4XP1L 3KPSE 4KTEH 3LKQB 1KSRA 3BVNA 4KU1A 3SPVA 4YE4H 1WVZA 1EO8L 3IDJA 3MRGA 2BOBA 2HVJB 2YD4A 3GB7B 5LGKA 3T2QA 5CSZA 1L7TH 5FO8A 4I3SL 1HINL 2P47B 3S97C 3EW3B 1FLRH 1U3JA 3ZYZA 5K9KB 3V6OE 3OKEA 1NAKL 1Z3GL 3L7EB 4NO0D 5DQJB 3O0RL 1YUHB 3UTZB 5HPMB 3EOAB 5JOFA 3QPQC 5JMRA 4HWZB 5GSVB 4XP1H 3CVIL 4NNYB 5JIIA 3QI9C 3MJ8A 3OKLA 1CICA 3V5HB 3HNVH 2IBGA 2ZZUT 5DK2A 2VDNH 4UQ2A 3KVQA 2CRMA 3MGTA 1IGJB 4L3EE 1EFXD 4L3EA 2V2TB 3MLXL 4GH7B 5TE4H 1A7RL 2ZUWA 3UX9B 1Z5LB 1IAIM 1OLZA 5GPRA 5E6ID 3L3OB 1AD0B 4M5YH 4X7SL 5EBGA 7FABH 4Y7MA 4OUOA 2QL1A 1PG7L 4LLQB 4NFCA 2EC9T 5BV7L 3GSXA 4B7IA 2NNAB 3H0TA 2CMRH 4R2GD 4OUUB 5FOBA 3DWTA 5BMFH 5KSUB 2EO9A 2OSLA 1CR9H 3GI8H 3UAJD 4AM0A 5JMOC 4JFDA 2SEBB 1GGTA 3QFDA 3TO4D 1VEMA 1WIOA 2EDDA 3K8KA 1A7NL 2GJ6A 5JPMB 4Q7DA 4YFDB 2HLFC 1L0XA 3OPZL 2C4XA 4NC1C 1C5DB 3QHTC 2VZTA 3HC4H 1MREL 1C12A 5ADPL 3LEVL 1J8HB 4P3DA 5KW9L 1HYRC 4OV5A 1TZIB 1U8NB 4ZUWB 4M5YL 4QRTB 2YSSA 4AK1A 3VFUB 1MY5A 3QG6A 3QHFH 2BVQA 4LEOB 2WBJD 4LLVA 1NL0L 4OIIL 1YEEH 3MV8E 1QZ1A 1NUFA 4GXVL 4C55A 5JXED 4TSCH 1TQBB 1FIEA 3KLHD 1QYGH 3JV5A 1J05B 1HK6A 5GXBB 5I0ZA 1QBMH 3MLZH 3ZE0E 1DVFB 1K2DB 1C08B 3HFML 4G43B 3FCTA 2ZPKH 3RNKA 4KDWA 1K8DA 1CBVH 1IAIL 2HKHL 1S3KL 2UV3A 2LE9A 2V7NA 4WRLA 5CWSB 2NW3A 5JOPE 4TQEL 4JO4L 1H15A 1W72B 3TH2T 3HRZB 1ZLSL 1OHQA 1OARH 3WFHA 2ZCHL 3TIDA 4Z77B 1A6AB 3IJHA 4PJCA 4CW1B 3ECBA 1JGEB 2H9GA 3HB3D 5IB1B 5F7YC 1ZOXA 4J3WA 2QSCL 2F53D 5MEPA 2AJ3B 4XPHL 3OV6A 1CQYA 4YO0B 3MRGB 2KBGA 1WEJL 5HVFB 3CVHH 3S37X 4HBCH 1Q9KA 3TPUB 2XNAA 3I85A 3VXMA 4I77H 2YEZB 1DE4B 4PYHA 3HR5A 5KSBB 4MWFA 4ZUSB 3AB0C 2H45A 4OKVA 2ESVA 2HN7B 1S9VB 1WUNT 5DHXB 3O11B 3QUXC 3T0EB 3OX8A 3WSQH 2XZCH 4PJAA 3W9DB 4P5TA 2XWJA 2AXHA 5DZOA 2XZAH 3EO0A 4K07A 1DQLH 4MAUL 2R1YA 2XQBH 3MRNA 4WWID 1E6OL 2VYRE 5A3ID 3VD4A 4JM2A 4NM4H 4MLIA 1I4FA 3WO3B 1YEIH 3IU3B 3I2CL 1AQKH 4OF8A 5GGRA 3IRPX 1G6RL 3ARXA 3IDIB 4I18C 4ZFZA 4E0RB 5CEZL 1DN0A 4RFEB 2CK0H 4GO6B 2BY1A 3SDCB 3LQAL 3VGAB 3TJHD 2UZXB 3ARBA 3DBXA 3BP5A 3H0TB 2XQYG 1ZVHA 3V7AE 5HHPB 4QGYA 1ZLVH 2ADFH 3FZUC 3QHZH 1BD2B 1FZOA 2RIKA 5DJZB 3EYUL 4OM0H 5BOZG 3GJFB 1R5IA 4G8GA 1OQOA 1SJHB 4JRYE 5DEFA 5ANMA 1LMKA 3B43A 4X9BA 1RIUL 4CMMA 2IPKB 1KIRA 5DGRA 4M6NH 2FHFA 5JHDB 3O8XD 4L8SB 4K9EH 4V1DA 3HAEG 5IK3B 4HK3N 3G9VA 3GBML 3MGTB 3LQZB 4QXTA 4RFNC 2W59A 4XVSL 3JV4B 5IVXE 4EI5B 2X4QA 4Q6YA 5C0EB 3EYOA 5AZ2L 1WWWX 4Z95H 5TGBB 1BECA 2RAMA 2A6IA 2VLKB 4KXZI 4EN3D 3V6FA 1GIGL 3CD4A 4TUOB 1YEGL 1FBIL 2G60H 1AR1C 2YPKB 1YMHB 2UVEA 3BP7A 1U92B 4LRIA 2ZUTA 5DUMH 5KVGH 2ZG1A 4UT9L 3OTTA 3U9PH 3S88L 1CXIA 5EUOB 5FM5M 4Z7WE 2M1KA 5D1XB 5C0BD 3FTGB 4TRPH 4LIQE 3T2NL 3GSNH 5GGVH 4JN1H 3BKJH 3GIVB 3K81A 1JBJA 4AEHH 1FLRL 4PRAA 4S1RL 5FGCE 2JJTA 4K7PH 2F54B 2PR4H 4FXKB 3WIHA 3MRJA 4MJ5A 4YBLB 1EMTH 2YD8A 3M1BA 3TO4A 3GK8H 1MAJA 5AD0A 1N6UA 1V7NL 5EBLB 3W39A 2VERN 2Z31B 4JG1L 4KDTA 4LKCA 4MA8H 4PD4K 3PP4H 3TBSA 1MFCL 2ZUSA 1A6ZA 3FB7A 1HQ4B 1JNHB 4KTYA 4WO4B 1JNNH 1JNJA 5E8DL 5IQ9B 4MAYD 1D6VH 2P5WB 3VFNA 3BZEB 5EO0A 4CL7A 4E41B 2MCPL 4BA8A 3MLXH 1ORQA 2EECA 4TRPL 4NZTH 3WNNA 1AGEA 5C0CB 4DFHA 1QLFA 4ZS6C 4X99A 4YHOL 4KDTC 5I1GL 1K8IA 5EO1B 1JWSB 3FQUA 4IOSD 1IEAB 3JWOH 3SGDH 4DVRL 1V7NH 4KQ4L 3O2WL 1R3KA 4K94H 3V5DB 5E70A 3F5WA 4JG1H 3PHQA 4TNWK 4OLVL 2L4OA 2VZUA 2R2BB 1PY4A 5C09E 4PR5B 4XMPH 1PVHA 1QFHA 1IM3B 2FH8A 1BFOA 4HKXA 5K9JL 3OB0K 1YJDH 3I6KA 3TESA 3MJ9H 1U8MB 1WBXB 2MCPH 5H35B 3SDAB 4B7LA 4ZO9A 2GI7A 2EDYA 3HZVA 3ILQD 4QRPA 4PV8B 1G7JB 5C7XH 3UJJL 1A7OH 1N6QL 2EDXA 3R0NA 5HYIA 3P73A 1XCQA 2EE9A 5INCB 2V2XA 2MHAA 5HGAA 1CT8A 3EYFA 1A1MB 2DTMH 4GAYB 3FO1B 1A47A 4XC3H 3QUMB 4BQ6A 1RZKL 3MJGX 1G7IB 5MENB 1MPAH 2A1WL 2Y5EA 1D6EB 3KAAA 4PP2A 4NWUH 2HLAA 4EDWH 3D3VE 1BVZA 1KJ3L 3QEQB 3IDNA 2OTUB 5FF6B 3GMLB 3L1OL 5IBUB 3QUYC 5L2KE 3TFKC 1D9KB 5JA8B 3EFFA 3O9WD 3RY4A 3FRUA 5D2LA 5MENA 1ZHKB 1B0RA 4N1HB 2QQKH 1OL0A 1SEQH 4JB9H 4OSUH 4GSDH 5F96L 3UJJH 1UB5B 3LEXA 3LDBB 2V2XB 1NCBL 1KLGB 5E7FA 4XH2A 5CIPA 3B2VL 2BX5A 3MXVL 1PKQE 2DIBA 1CLZH 1S78D 1KBGL 1ZGLA 1IGFH 1MPAL 1WISA 2A1WH 3C08H 1WLHA 1YYLH 4RCAA 4M9OA 2O5XH 4QCIA 2VABB 3PL6C 4GG8B 2VL5B 1BFOB 1AIFA 2EO1A 4HBCL 1I7TA 3MV7E 1CFVH 2P24A 4FS0A 3BZDA 1KPRB 2GUOA 3K3QA 4JJ5B 1FVDA 1KTKE 3WS6A 5IFAL 5KVFH 5SX5H 2W0KA 2J12B 4MXQC 3V0WL 3RWCB 4TUKH 3MLVL 1Q9OB 2R4SH 4R0LA 4ONFL 4Y5VA 4N0CC 1IAOB 1RZGA 2QQNH 1WC7A 3MNWB 4JHWL 1AXTL 1HXMA 3C8DA 5DO2C 4LPUA 3U0TA 2ATKB 3VWJD 2H26A 1XGQB 3SDDD 1R5WB 1LO5A 1D9KC 1NLBL 1IM9D 4XZUA 1T4KA 3VA6A 4FFWD 4H88H 4CN1A 4RX4D 2P5WA 1BFSA 1VGEH 4P23D 1MHPH 3RFZC 4JQXC 3RTQB 3C09B 3HI5L 1HQ4A 4WO4A 1FZJA 3OF6D 1F11A 2DIAA 2BHUA 1CU4L 1HOCB 5FGBC 1P9MC 1DZBA 4QXGH 1QR1A 4XPBL 5F97E 4MNQB 5B39B 1AO7B 1MRDH 1MHHA 2QHLA 4PRHE 5C0IA 2OR8A 2V9QA 1VFAB 2MQ0A 4DKEH 2DYPA 5BZDA 5L6YH 4NKIL 1CGTA 5IF0A 1CDYA 5CP3H 2DQDH 4FABH 1L6ZA 1AXTH 3SE3A 1SYSA 3QIBC 1B2WH 1NGXB 3OF6A 3O8XC 4XHQA 5DJCA 3NAAL 4JKPL 1T1WB 4O2CA 4RWYH 4QTIL 4QNPF 1JZ4A 2ADGB 1OTTC 1HZHH 3QG7H 4YDIH 2A74B 3HE7D 1OAZH 4P46D 2XYCA 2PW2B 4MA7H 3MX0A 4JO3H 1VGKB 1H3GA 3BP6A 4FQXC 4PJGB 4OT1H 1C5CH 5HHXL 5HBBA 4BH7A 2AQ2A 1KLFA 5FYLD 3V4PH 3DVIA 3S36H 2UUDK 3O4OC 1OAQH 4WHYG 1YNLL 3IAGC 5EZOL 3LKOA 1NCTA 4OLZL 4YGVB 1CD8A 4HG4J 2AW2A 1LK2B 2AV7B 4IS6A 5C0RH 4OZIE 5DUML 3CLEL 4FHBD 3B9EA 5C8JB 1DEDA 4RWYL 2NY2D 4X9IA 4A6YA 3DX6B 3T4AB 4UDTB 1LO2L 1S8DB 2WP3O 4V2CB 4PJBB 1HHHA 5FYKH 4PJ8A 1P84J 1X4XA 1YC7A 3VFSA 1N5YL 1YA5A 2CGRL 4ZUUA 1RHFA 3VFWB 4GKSB 2VXVL 4APQC 3QIUB 1AKJB 4MQ7B 2D9QB 2W92A 2AEQL 3DVGA 4PJHA 3PWPB 2HA1A 4A6YB 3QT2A 1WAAE 4K3EH 3KYOB 4MA8L 4YQXL 2JJTC 5DJ6B 2RFXA 4TTGA 3RI5F 3CFKA 1KLGA 1AR1D 3EDDA 2CR6A 3LEXB 3K2MC 4OD2A 5L2KA 3F62A 3TYFB 5CKGA 3NCJL 5C2BL 4Y2DD 3VD7A 3KPNB 3IKCA 4YHKL 1I3VA 2FH6A 3EFFB 1DQQB 4PJ7A 3IJSB 5J9PA 3DRTB 3C9NB 4GW4B 1TZGH 1U8OB 2OTUA 5FF6A 3VGHA 3D0LB 1XCTB 4G6FD 5CEXB 1I3RA 3HG1A 2AEQH 4I18A 5J8OA 4BZ2L 5D5MF 2IPUK 2G9HA 4MWFB 5D1QC 3NBNA 3EYFB 2W9LA 3MRJB 1JUFB 5FYJH 4FXGA 1CI5A 4FFVD 1H0DA 3PGDA 4OCLC 1MAKA 4U7MA 2YUXA 3PP3K 3CUPA 3MV9A 4BQ9A 1A2YB 2QSQA 2YRLA 1PZ5B 1DUZA 3S35L 1HE7A 1E4KA 3LRSB 4WHCA 3L6FB 2VXUL 4G80A 4OCMC 4OLWH 4Z78A 1IRAY 2O93L 4P59L 4AIZA 2NW3B 1FV1B 4MS8D 1WCQA 5E95B 1WT5C 2F8OA 3DX7A 5EOQH 3VXOA 2BSED 2DQTL 4HIEB 5IESH 1PG7W 2OK0L 2XA8H 4XHJC 1GOHA 1ED3B 1ZE3C 2HJKB 3RWHA 5EOCL 1FDLH 4NP4H 1OT1A 1EIBA 5EWIL 3KYNA 3BPCB