4HGWB

Crystal structure of s25-2 in complex with a 5,6-dehydro-kdo disaccharide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
213
Chain Sequence
b'EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment, light chain
publication title Exploring the cross-reactivity of S25-2: complex with a 5,6-dehydro-Kdo disaccharide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 40
structure length 213
sequence length 221
ec nomenclature
pdb deposition date 2012-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgwB01
3G04B 3BKML 5IMOB 3HC4H 1G7QA 5D5ME 5DEZA 3UJTL 5BS0E 4Z7VA 2BNUA 4IOSD 3C2AL 2HLAA 3UC0L 2A6DB 2R8SH 5D2NB 3H42H 3SPVB 4V1DE 4OZFB 4W70A 2D4DA 4XCCL 3U9UB 1M7IA 2P42B 2EYRA 3QDMB 5F9JB 4OZIE 1JGUH 4RGNB 3VRLF 4AZ8A 4X4XB 1JWMA 2J88L 3DUSA 3KPQB 3DX9A 3NPSB 3U7WL 3C2SA 4MXWH 3WEXB 4PRBB 5F21B 3DI3B 3K4DA 5HYSA 5GRYA 1IGCH 1N5AB 4M7KL 4NO0D 5T3ZH 1GCFA 2WP3O 4IRJC 2A6KB 3IJYB 2DIBA 1PY9A 4YLQT 1QA9A 4C56D 4PJAA 1LK3L 4S0TD 4AIXA 1C5CH 3L5IA 1VGEL 4M03A 3VWJC 1U8QB 1BQLH 4PGDA 4Y5YC 2ZCKL 5CWSB 2OZ4H 1J05B 3G9AB 4NRYA 4EXKA 5DDHB 2AJSL 3LS4L 2A9NL 3GJFK 2J5LB 4P3CL 3AMKA 5CJQH 3QQ4B 5DVOA 1U6AH 4EN3B 5JQ6L 5MENB 3EW3B 3OKKA 4NUGH 5K93A 2DLHA 3O41B 2H6PA 4OB5H 1DFBL 1U36A 2LE9A 2VQTA 2YA1A 5SWZE 3QA3B 4JGJA 1HDMA 3BZFA 3G5YA 5T3XE 3I50H 1U3YA 2MQ3A 2EE3A 4HF5L 1N3NA 1FBIL 3ORJA 1MVUA 2F9BT 2IAMB 5E00A 5E2TL 4MZ3A 5HHVL 5GZNC 3VXMB 1I3RA 1PQZA 1UA6L 3M8OH 1MJJB 3BPNB 3UZVB 2HH0H 4OGXL 1TJGL 4IRSC 4ZMAT 1WTGT 3R1GH 4BSJA 2EKJA 4NM4L 1CXHA 5IKCA 2OJEB 1KCRL 4PJAE 1JGEA 1U3HC 2X4PB 4I48A 3ILPA 4AMKH 2MSPA 3HI5L 3HHRB 3PF2A 1I3UA 1T4KB 5D7KE 5D2NC 1NCBH 1SJEA 5TDOB 2A6IA 4UDUB 4MX7A 4RAVB 1P2CA 3L6FB 2XWBA 4FQ2H 4L8CB 1IGIL 4RGNC 1YEFH 3DHMA 1Q9LA 1UACH 1RZJC 5EWIH 3NPSC 2PUQT 3OX8A 1FL3B 5ISZD 3UJJH 4Y5XB 2ID5A 2X4SB 5F8RC 3UTTB 1MCQA 4YK4B 4TPRL 1QFWL 2BC4A 4XI5D 3K1DA 3HI1A 5CIPA 2PR4H 4KKLD 5SWSA 3DROA 4L5FH 1ZGLA 3D3VA 5LXGL 4DK6A 8FABB 1M7DB 1QFOA 1TZGL 2AJVL 4QXTB 4QNPE 3EO9H 1FV1A 4X8JA 4LHUG 4E41A 4WY7H 1QEWB 2X7LA 2J5LC 1LE5B 15C8L 1FYTA 1PFCA 4YFDB 4F7CA 1F2XK 5DD6A 2R0ZL 5LCVH 4XVTL 1E4JA 5CJOH 1KIRB 3QZWA 1YNKL 4C4KT 3BKCH 3V5KB 3TZVA 5FO8B 2J8HA 4JLRB 1EEYA 2IAMC 2OL3L 3T2NH 2NZ9D 4R4FL 3KVQA 1Q9OB 3CH1B 4OD1L 5E95B 4MWFB 3P0VH 3BPNC 1HEZA 1DBAH 4U49A 4YDKL 4J4PA 1OWRM 4FQJL 5AYQA 4Z0BH 4DKEL 1PSKL 3ZZ1A 4NFCA 5SWSE 2R0LL 1T89C 4LPWA 3W9EA 1AD9A 1T0NB 5CKGA 4ZS7H 3LRSB 3FO9A 4R97B 3DRQB 3PUCA 5C09E 4FNLH 1I9RH 2HFGH 1T1WB 3RTQB 3V0VB 4I5BB 3FQUA 1CGSH 4MVBD 4E41E 1WCBB 1QR1B 3T65B 3HE7A 1LP9B 4P2QA 1FYTE 4HWBA 2Y9RT 1AGCB 3MRLB 1MFDH 3QDGA 3NPZB 4G42A 2FATH 3NFPB 5JXAH 2IPTH 1E4XL 5B38G 1OAKH 4Z7NE 3CSYB 4G7VL 3DSNA 3D2UA 2XZCH 1FGNL 4F9PA 4PJ5B 4MB5A 5JHLH 1KXTB 4EI5B 4GRWE 5HI3C 5T3XL 2N7AA 2AQ1A 4NQDD 3VFUA 4NCC1 5EO1A 1YNTB 3BP6A 4LNRA 4OZGA 3AVEA 2IAND 3TYGL 3FN9A 1ETZA 3TFKC 4H0IA 1QNZL 1HKFA 4HIJA 3ZKMD 2GK0B 1HH9B 4JQVA 4JFPB 4X99A 3EYUH 5CEXA 3FO2B 5A43C 4P2QE 4JRXA 4B5EA 4M62L 4YHKH 3BP4A 5HHXL 4PP1D 2C1PA 1KLUB 4FFWC 5E9DE 2RJMA 2AVGA 1PVHA 4TSBL 3EYOA 4OV5A 4NQSB 1J10A 4AIZA 4P23B 5IM7B 2VZSA 1TNMA 3JV6A 2ESVD 4RCAA 2CD0A 2YUWA 3QNXB 1RJCA 5I15H 1AC6A 1QSFE 2VQUA 1BWWA 1RURL 3H8NA 1GZPB 1ZANH 1W0VA 3MLUH 3PE9A 2XN9E 2ZCLH 1WGOA 4OZGE 2L7JA 3AC0A 5EBLA 4K23L 3EFDH 5C08A 2XKNB 4R97C 3MRDA 2BDNL 3CLFL 2WWKO 1HKLL 1YQVH 4HT1L 3RTQC 4U6HA 3H3PH 3QWRD 4L3EB 3ZT5A 4PJDA 3U0TA 2BJMH 4HKXA 4QRUA 1BM3H 4JRXE 4G3YL 2VUYA 4RIRB 5DC9B 1DQDH 4Y19A 1U8HA 3RIAK 35C8H 2R15A 1JGDB 1MJ7L 3F7VA 4HX1A 3TNNB 3HCVA 1ZVSB 2NZIA 1T83C 2Z9TA 4M61B 1NL0H 5HGAB 4HUUB 1BWMA 2I5YL 4KZEH 4E9LA 4MA3B 2XICA 3L95B 4S1RL 1S9WB 5J1TC 5HHMB 2NXZD 3RZWA 1MCWM 3VRJA 3RUGB 1QLEL 1Z9LA 3VWKA 4YAQA 1DQML 3O3AA 3U9PL 2VWEE 4Z7QF 5BZDA 2R69L 2HFTA 5C08E 3ARTA 2GCYB 2E3VA 3MV9B 3LHPL 1OSPL 3L7FB 4MJ5B 1WV7T 1K8IA 2R1YA 3PWJA 4PJDE 2EXYD 4JFDA 5FB8A 5HPMA 1C08A 5T1KB 1ZT4B 3FHAA 3FT3A 4PB9H 2D31B 4JFFD 2APBA 5IWLC 4FABL 1S9XA 4Q6IA 3RUGF 1WCQA 3KLAA 4DW2H 4WI3A 3UBXG 1DBBH 1KGCD 5FYKD 4Y16D 2PYEE 4P23C 4X6CB 5EPMA 5IESH 1KLGB 2HJKA 3H7BA 4ZAKA 5IB5A 4TRPL 3MRIB 1NCDL 4HJGB 3FHQA 4Z77B 1EMTH 1F02I 1AGBB 2IH1A 2R9HD 4OZHB 1MHCB 2LVEA 1IGJB 4N90D 1EEQA 4IRZL 2MPAL 2R4SH 2H1PH 5FOBA 1P9MA 1I75A 4APQC 3O81A 4HKZB 4ZYKB 4WFFE 4X6CF 5FKPA 3KLHC 4DVRL 3KPLB 1F90L 3SDDB 1KTLB 1G7PB 1UH4A 1J0YA 3MXVH 3PQYE 4XCYA 1CIDA 1U8JA 1AQDB 2APXA 1T66C 4JFDE 4L4TA 3U46A 2CDFA 3V0AC 1MCOL 1RUKL 3AS1A 1J9CT 4OZHF 5MI0B 4R4BA 4XB7A 3GMMA 5EC2B 4P2OB 1L7IH 4Z78A 3ZSTA 5CBEB 5TGBA 2P43B 5EZIH 2GJZB 1U8NB 3REVB 5ETUB 1RZKC 4HWBL 5GRUH 3ZDYE 2B20A 1RU9L 4TNVK 1OAXH 2AV7A 3SDAB 3T0WA 3BD4A 1BVZA 1D9KB 3LKPA 2ZJSL 4I0PB 3MGTB 4OLZH 2ENYA 3BN9C 4YBHA 2VOTA 2VISA 3HPJB 1OTSC 5IR1A 2J1KA 5JW3L 2RCSL 3AREA 4R3SA 4M4RA 5T5NF 5I76B 4LSSH 3T08A 4WW1B 3MSPA 3LD8B 2HWZL 1DSFL 1S7XA 2WZPD 2AJZB 5DHVB 2ZUWA 4L4TE 3RPIB 3HI6L 3ZE1E 4WEBH 5H8DA 2FZ3B 1J5OH 1DBKL 5B8CA 4FFZL 4YEFA 4MLIA 1FVCA 3NA9H 1HHKB 1SVZA 3KNBA 3HS0B 1BJ8A 2DQCL 5E1HB 3MLPA 3OKMB 2AI0H 5EU5A 3ULUC 1INQB 1KJMA 1QRNA 4NQCA 3OXRA 4S11A 3D85A 2CGRL 5K9JL 1YMME 2XWTA 4O4YH 4NPYA 5IFHL 1D5ZA 3K2UL 3KPSB 4X6FB 1G9ML 4XWOC 4JVPA 2VLRE 3T04D 3VGAB 2FR4B 4HAGA 2F53A 1BBJA 3L3JA 1IGFL 1MFCL 1OB1B 4HPYL 3O11A 1FFPB 3HMXA 1H15B 5ICZB 3H7LA 5DJDB 5MI0C 1T3FB 2IG2L 2J6EL 3SGDI 4P2OC 4OI9A 3WFHB 5C6TL 4JHBA 2PW1B 4HEPG 1J8HA 4JVWA 4NQUA 2CK0L 3VA6A 2Y07L 2UWEA 2EZ0C 5H94B 5KN5A 3D69A 4Q58C 3U36B 4QRSB 5D7IF 5E8PB 3SDAC 3QXDA 1CLOH 1EVUA 1RUPH 3N1PC 4BKLB 1D9KC 4QRPD 5EO9B 2EDKA 4QRRA 4I0PC 4V2BA 1QRNE 2JELH 1C5DB 4WUUB 3UTSA 4LSVL 3LB6C 3GMNA 4ZSOE 2DWDB 3QUMA 4P2RD 3VDBA 1Q1JH 1WZKA 2EDOA 3FB8A 3SBWA 1RUML 3O3DB 4ZTPL 1ZAGA 3LD8C 3UEZA 4PJ8B 1G7IB 4QHLA 1YEKH 1ZHNA 3MRGB 2AJSH 1RPQA 4PJFA 3DMMA 3RIFK 4FZ8L 3BRFA 3K80A 4PREB 4PRDB 5TFSH 4BJLA 1J8HE 3NBNA 2PYFA 1JF5A 5AAWA 3UJIL 2R1WA 5EU6A 4HF5H 5J6GA 5I8EB 1FBIH 4LSQH 4QWWC 2W60B 3UPCA 3IFOB 1A14H 2EEBA 4CRPA 3BFOA 2E7HA 2R56L 2CKNA 2Z31D 3U30B 4OGXH 2O5ZH 1DLHB 2BK8A 5E5MB 4ZOBA 3KYKH 3EOTH 5IHLB 1IC7L 1UZ6F 2OQJB 4IRJD 1FE8H 5FHAL 4F2MA 3O9WB 3RAJH 1UKSA 4DTGL 4DN4L 1JK8A 3FQNB 1K85A 1EAPA 4M8VA 3VGAC 5I75B 3B9KB 5T1LB 3RP1A 3VWJD 3FRPG 5IOPB 1I9EA 1FSKB 2I07A 4XHJC 3KPPA 4DZBB 1ZV5A 5HGGS 1T7YA 4GW5B 3ZKXB 1NMBH 3EOBB 2R23B 2RQ8A 3VH8A 1CXIA 1NLBL 3FFCE 4JHWL 3ROLA 4KRLB 4KQ4L 3WN5C 1D3CA 3U48A 5GZND 3S88L 3OF6A 4PR5A 1G7HA 7FABL 1H8OA 1JBJA 3AS2A 5JO5B 1EHAA 2O5YL 1YNLH 4WEMB 1F5WA 4CN4A 3BZEB 4KV5E 5CZKA 2VLJB 2BNRB 4KVCL 4IRSD 5GQBA 2W65A 3QWOB 1Y6KR 5DQDL 3OJ2C 3IJHA 3TO4B 2QLVB 5DS8B 2YN3A 3CGTA 1KJVA 5C0DA 3WJLC 4PJ8C 1RJZA 3MTRA 2XFXA 1A6AA 2EH7H 4N8VA 1P7QB 1U3HD 2AAVA 2ADGA 2XQBH 5H2BB 3C6LA 5EA0L 2W0FA 5EUOB 3QXTA 5IROA 4OQTH 1CGVA 4I4WA 4X9IA 4HLZG 1KG0B 5DJYB 3LIZH 4BZ2L 4F3FA 3C6SB 3FO1B 2HT3C 5T1DL 1NUDA 3QCTL 4YHPA 3QDMD 2DI9A 3JWOH 4RGND 4LPVA 3D9AL 3C5SA 2XY2A 4R4FH 3MLTB 4KVNL 4H20H 4OD1H 3EJZC 5EO0B 3U30C 2F54E 5GPRA 1TETH 4FQJH 2VN7A 1PSKH 5BV7H 4JCMA 3SGKC 4LVNB 1RY7B 2ICEB 3O9WC 3MFGB 4ODXB 3ZHLA 4JN2A 5GRWA 4I13B 4GXUM 1G1CA 4ZDHB 3B9KC 5I75C 1Z5LB 3K3QA 2E7LA 2RR3A 5EUKB 2VL4A 2VH5L 3K46A 1FSKC 1PZUB 5C07A 3UPRA 1A1NA 4XNQB 4ZOAA 4F33B 5IT2L 2YSSB 4FQXA 5MEND 3B83A 1CDCA 4F7MA 4NT6A 3MOBH 1QSEB 4AH2B 4MD4B 2P8MB 5LGJB 3O6KH 1RZFL 2DBLL 2NX5A 1AY1H 4G6KL 4W4NA 4DWHA 5MEPB 1KNOB 1I7ZA 4KDVA 4OLWH 1P69B 2IAMD 1JFQL 1RIHL 2ICWJ 5T1MB 1JWUA 3NZHH 3BISA 3VXMD 3K8KA 1PKQE 4N1EA 5T3XH 3IKCB 1MAML 3CFEB 1TZHA 2Q20A 4CU7A 2VSCA 5FAAA 2Q1EA 1ADQH 3JXAA 1DEEA 3ARDC 4JQIL 3QUML 3B9EA 3SOBL 5M7QA 1S5IL 4HIXL 4XBPB 3DO7A 1XF4B 5F93C 5KSAA 2MCG1 2HLFC 1NEZB 1HINL 1MQ8A 2YD8A 5D1QB 4X9GA 1KTRL 5HYJA 4XMLH 1CXLA 3MRQA 2NY1B 4TSBH 4Y4HA 1P5UA 4FQ1H 1FCCA 2NX5E 3EDKA 1AP2B 4IBLT 3NCYS 4KJYB 1MLCA 4KRNA 4LIQH 1MRDL 4F7PB 1S7SA 4BFIA 1G0XA 4AIOA 1CICA 2IBZX 1M05B 5C9KA 2CDGA 2K1MA 2Q3AA 2QKIB 3PV6A 3BO8A 3VCLB 2X44D 1E6JL 4HKJA 1ZVHA 1ITCA 3BYYA 5HI3D 1PY4A 2P8PB 2FEEL 1ZKAA 1EVTC 4K3EH 5F3HB 4OT1L 3O4OC 2VDMH 4NN7B 3O0RH 1GOFA 5K9OA 1MI5E 4TOYH 4H88H 1T1YB 4LVNC 5IQ9B 1EFQA 4ZFOB 2I9LB 3TFKD 5HGBA 5AUMB 2K7PA 3ESUF 2A2QT 4OIIL 2IQ9H 3F65A 2BSRA 1XFPA 3FAXA 5INDA 2OX5A 1BX2A 1RZ8A 3EDFA 4G3YH 3JVGA 1NCAH 4WJ5A 3KJ4B 4D0BA 3RWHA 3MV7B 2NY4B 3CUPB 2VAAB 1CU4L 1K4CB 4KGJA 3RNKB 5E2VL 2ZSVB 1G9NH 3W11D 1QFWI 3VW3L 1W0WB 3M17B 2Q7YB 3PWPB 1HZHL 2K3TA 4EUPB 3C9NB 4OKVA 4ODVH 1LEGB 4S1RH 5ALBH 1LO4L 1HNGA 4HS8H 5C0EA 5IB2A 2MNUA 1UH3A 3QDJA 4NWTL 4U33A 1JGLL 4TNWK 4OGZA 1DQMH 4PJCE 1J0HA 3GHBH 5HGHA 4JRYA 4ONFH 4PTUA 3LHPH 1OSPH 1ZXQA 5E8NA 3STZB 1ZT7A 4HIEB 3RTQD 1FNEA 3C60A 3F58L 3VG9B 3WUWA 1EX0A 3CNKA 1GC1L 4MNHB 2VR5A 1BF2A 5D1QC 4CN1A 3TCLA 3DBXB 3ROOB 4FABH 2DWEA 3ARFA 3ZLQC 1SJHA 4WW2A 4GQ9L 4XP1L 4PBXA 4MXQC 1CLCA 1WIUA 1LEKB 3SO3B 2Y6SC 4XVJH 4RMWA 4PJ5D 4X80L 4PJ7B 4XT1C 5DJXA 4MJIB 1RZGA 4G8IA 5IF0B 4LHJB 1ZA6B 2YKLH 3RWIA 3B3IB 4NN7C 2GSIB 4GRWH 1MREL 4RX4A 2V6HA 4LSRL 4F57L 1FNSH 1IBGL 3LH2L 5DQJB 4NKIH 1I7UA 4KAQH 3NIFF 4PJ7F 3IETA 4GAGL 4RMUA 1E4XI 2M8XA 4JKPH 4IEFB 5J9PA 3WXWL 2DKUA 4I8DA 5D70L 4JR9H 3SY0A 3U4EA 1CD1B 5IEKA 4OCYH 4AQOA 4DK3A 2NY4C 3DXAA 3QUKB 2OTWA 4JPVH 3CXDH 1MRFL 3L3IB 5E5UB 1C8PA 4YIQA 4GKNB 1UWEL 1OP5H 5EU4B 2ZJSH 5F7MC 3B9VA 2C26A 2W9EH 4YXLL 2CR3A 4XZUA 1S7TA 2FGWL 2XTJB 3M07A 2RCSH 5FYJD 1IKFH 5GISL 4APQD 4Y8DC 3GSUA 4G9FB 1U95A 3KLHD 4BSVA 3PHOB 1Q9KA 2JK5B 4L3AA 3FO0L 1CI5A 3GMRA 4P5TA 4PG9B 4OI7A 4LLYB 3VG9C 2V2XA 4L3ED 5DUPH 4OV6F 1FFNB 1T66D 5BS0B 3VXOA 3WHE1 4HS3A 1ZHLA 2FEDC 5TH2B 1DQQB 1F4WH 3CDYA 3M1BA 3TBSB 5JIKA 3C5ZB 3MRJB 1BAFL 1A47A 3C5JA 3MCLL 5E6IB 2HMIC 1RMFL 4L8DA 4WUKH 5DSCB 3RQ3A 2QJDA 2H2PC 1J1OL 4RSVA 1DQJA 4GMSL 2ADIA 4ZFZB 4QHMA 2H41A 4CVXB 1CD8A 5GGSY 3MLXL 3C8KB 2NNAA 3EYVB 3LQZB 3QIWB 3QUZA 4IIQB 3RX8A 1PG7X 5F97E 5C0BB 3OB8A 3BN9D 2ZUXA 4PFEA 5K9JH 3VE0B 1NFKA 3SCMD 1X4YA 3QUXD 3SGEI 1OTSD 5CBAB 5GJSH 3GSXB 2P24A 4F80A 1XR9A 4OFKA 2A6JB 5ELIA 5SV3A 5B21A 1G9MH 1I85C 4U31A 3E1F1 1MCPH 1G7QB 4S1QL 4Z7VB 2BNUB 4K7FA 4N9OB 3KDMA 1SYVA 3T0EC 2HLAB 5BO1L 3F6IA 3WIHA 2Z91A 2XACC 2J6EH 4XMKL 4BYHA 3RBGA 5HJ3B 5C6TH 4XMPH 1GYAA 2R2BA 5TQ0H 1M7IB 4AEIH 2EYRB 1NAMH 4UNVA 2OR9H 4RGMB 4GW4A 5DK2A 2R29H 3BMWA 2D7PA 2F74A 1B6DA 2A1WL 1OQXA 1JWMB 3GHEH 3TYFA 2Z93A 4KK6C 3DUSB 3DX9B 3G08A 1UG9A 1JPTH 1INEL 4QKXB 4JEGB 4Z7VF 5JPNA 3NAAL 4GLRI 3ULUD 5HYSB 3EFFA 3EO1A 3LAFA 1OHQA 3NABL 2XTJC 1BJMA 2FX7L 4UV4L 2QQKL 1QA9B 1T03L 4GAYA 3TJEL 1CZ8L 4PJAB 5IVXA 3ZKQD 3T0XA 4I9WE 4PGDB 3QRGL 4XWOD 4XPGH 4NRYB 1VB9A 3X14A 4PJIA 3SE4C 4G6FB 2VXQL 2AEWA 2MCPH 1FZKA 5DMYA 3FB6A 3MREA 5JOPD 3OKKB 4NJ9H 4FZ8H 3V7AG 1QQDA 1LK2B 3CXHJ 3JUYA 4HJ0C 2R0WH 3OKDA 4P2OD 3C5ZC 1HDMB 3BZFB 3G5YB 4GKSA 2DM4A 5E6IC 3GNML 1N3NB 3UJIH 2WBJA 1MVUB 5SV4A 5E00B 2EZ0D 4O2EA 2X1XR 1MCHA 3UX9B 4TTDC 4NC1E 3SDAD 4C56E 4J8RA 1I3RB 1JF6A 1PQZB 4KMLB 3THMH 4IIQC 3HNSH 4I0PD 3MRCA 2XZQL 2JJUA 2VE6A 1MFEL 1JNNH 3BP5A 1A1OA 3LB6D 4E5XA 3NH7H 3O6LL 2W9DL 1RIUL 2VRAA 3QG7H 4ZQKB 5IKCB 1DLFH 1A6VH 1AKJD 3AU1B 4FMKA 3U7YL 4G6AD 3BGAA 5IVXE 4ZFGL 1IILE 4DTGH 1JGEB 4PJIE 1N26A 4I48B 2G5BA 2E9JA 3ILPB 3VXUD 3RWDB 1SQ2N 3I75A 5TF1H 4Z8FH 3H9SA 2VDNH 3KPOA 1SJEB 1ZSDA 4X4YA 5GS2D 1MHEA 4MX7B 1P2CB 1IGYA 3L3HA 4ODBD 5F71A 2XWBB 1NLBH 2AEQL 3DJ9A 4RGMC 5I8CA 4PJHB 3VXNA 2FBJL 1N5YH 3ULVF 1EFXD 1Q9LB 4YHMH 1K6QL 4HUKB 5L0QC 3OX8B 2E8ZA 4QWWD 3RIAF 4MMXC 2MJWA 4XPAH 1KB9J 2DQUL 4G8FA 1Z3GH 5CIPB 3NN8A 3DROB 1PG7L 1RUAH 3D3VB 1ZGLB 2C4XA 4MD5A 3P30H 4PJHF 1W72A 4X4ZA 3DX6B 1FV1B 3HKFA 2DTML 4E41B 5CCKL 1KV3A 4PJXF 2X7LB 4F7CB 5TE4L 3GUTA 4KTYA 5DD6B 1OTTC 4L1DA 5BZWA 4XHJD 1EEUA 3QZWB 3VXSE 4LQFL 1GAFH 4LSPL 3SE9L 3TZVB 3UTQA 5IJKA 4I0CC 4BZ2H 1A1MB 1MY7A 1L4IA 1EEYB 1NGPH 5T1DH 4BK5A 1JL8A 3BDYH 1JZ6A 4WI5A 5F7NC 1A5FL 3LQAH 4KVNH 1HEZB 3PG2A 3WE6A 1PBYA 1EHLL 4GW1B 3UTPE 2IPUG 4WUUD 3BRDA 1E27A 1C7SA 3CMGA 3W9EB 4QOKD 1AD9B 1YPZA 3FO9B 1JHKH 3TIEA 1X4XA 3MBEA 4Q9QH 4P9ML 3RL1A 2X1PA 3QISA 3ULVC 3IRPX 3FQUB 4PJ8D 1HWGB 1FZOA 3HE7B 2VH5H 3LMJL 4N8CH 4P2QB 5I1JL 2R1XA 3BGFB 2C3XA 2HJLA 5BRZD 1KIPA 3U1SH 3QDGB 4G42B 4K94L 3EGSA 4Z7UA 1FNAA 3MCKA 5DVLA 1T1ZA 3DOSA 3WHE0 2DBLH 2BRQA 1NGZA 4LARL 2VKWA 2HT3D 4G6KH 3D2UB 1T7XA 3UROR 3WIHL 1B0RA 1JNLH 1MY5A 4YZFE 4MS8C 5TQ2H 1H5BA 2DQJH 4WI7A 3VI4E 4JKLA 1S9VB 1X3DA 5EO1B 3EJZD 3UP1A 3BP6B 4PY8J 5DRXB 1KFAL 3TLRA 5ALCL 4LNRB 4OZGB 4HKBB 3CX5J 3IB4A 4QHUA 1ETZB 3RVVC 3U2SB 3FRUA 5HVHB 3O9WD 3ZYJA 5K59E 3RY6A 2Y7QB 1AI1H 5T33L 1CVSC 2X09A 3EIFA 3WKNA 1E4WL 4OZ4A 4X99B 3B9KD 5CEXB 5T1LD 3FT2A 4FQCL 2C1PB 2R2EB 4XCEA 2VDOL 3QIBB 1QLFA 3EYOB 4Z7UE 4OV5B 3MRRB 3TZVC 4AIZB 5DFTA 1FDLH 1IC5L 3JV6B 2IANE 1A7PL 5F6HI 1LO5B 3PWLA 2Y1VA 2DF3A 2O5XL 4MQTB 4O51A 5F7WC 3FONA 1W0VB 3V7AE 2AK4D 5IFAH 4J4PC 3DGCR 3A67H 4XNUL 1QYGL 2LVCA 2VLJD 4OT1H 2CKBA 4GBXA 2FH6A 4P57A 5C08B 3TCXA 2NMSA 4LKXA 3MRDB 1QBBA 2WW8A 4U6HB 3ARDD 4PJDB 3U0TB 4HKXB 3HE7C 5JW4Q 4QRUB 1XF3B 3S5LB 3BGFC 3HAEG 4JO1H 4Y19B 2DM2A 1U8HB 1RULL 2HLFD 3F7VB 2FHFA 4HX1B 2W38A 1MWAA 3HCVB 1MNUL 4KUZL 1UQSA 3OKNA 2HKHL 3KJ6L 2AK1L 5DJ6A 3WKML 4GG6B 1CTOA 1X5LA 4HSQA 4JM2B 3WNMA 4F9PC 3VW3H 3L3OA 4ZG1A 2HN7B 2QBWA 2JF1A 1HZHH 4FHBD 1MHHA 4KC3B 4YGVA 1CF8L 4OFYA 4G7YH 1JMXA 1R0AL 4XNXL 3DNKA 1LO4H 1WAAF 4O58L 5IFJA 3VRJB 2AERT 3VWKB 4YAQB 4ESKA 5H37G 4MNQA 3O3AB 3I3BA 1U9KA 5BZDB 4M6AA 3ZDXF 1KELL 5HVHC 4GG6F 5IMKA 4TSAH 4WI2A 3CZJA 5FA3A 4JM2F 3MA7A 1K8IB 2R1YB 4JQVC 3O2DH 2VLKA 4JFDB 5CAYB 5FB8B 5DRWA 1C08B 5HPMB 2BY2A 2ZOLA 1I8MA 4OM1L 3FT3B 3SEPA 3T8XA 1W72L 2VDQL 1S9XB 4J3UA 4Q6IB 1G6RH 4UIMA 3KLAB 1Z2KA 2CQVA 5EPMB 4ENED 2ENSA 5L2KA 4N0CC 4XP1H 2PXYA 2HJKB 5DD0L 4FN0A 4FMFA 1JYWA 2P7TA 4ZAKB 1XR8A 2DYPB 5IB5B 3RPKA 4XCNA 4GFTB 4AENA 4Y0GA 5KVMC 3TH2T 2IH1B 3WNNA 3S35X 5FOBB 4XHQA 4MNQE 1HQRA 4JFFE 4X4MA 5FKPB 1MREH 1EXUA 3LN4A 4M5YH 5J56B 5FYKE 3FTGA 1WVZA 1U8JB 1U2CA 3ZKNC 4LQ1A 3FMGL 4L4TB 3R0MA 1GIGH 5GSVA 2CDFB 4N68A 5D7LD 3U46B 1YEJH 3I6LE 1TZIA 4DGVL 4OCMC 4R4BB 3VMNA 5D70H 3HUJA 3GMMB 4UT9L 5D1QD 1J0ZA 5C7XL 4FZEL 2H26A 4Z78B 3T1WA 2J2ZA 4H1LA 3NIGF 5TGBB 2HVJA 1FG2A 3S4SA 4M48H 3UZQA 4X7CC 5EORH 3UPAA 5EC1B 4P4KD 4EXPX 5L2KE 5L7XH 2GITA 1T0MA 2AV7B 4ZFFA 4EQ3A 1A9BA 4UU9A 4MXQD 4WFED 3LKPB 5HHOA 2Y6SD 4YDIL 4L4JA 4WTZG 3ZE1F 4B50A 5B38A 3QRFM 3KYOA 1J87A 1RFDL 2VISB 3RL2A 3VWKC 2GY7B 3AREB 1QBML 3BE1L 4R3SB 2FWOA 2CUHA 3QO0A 5HGDA 5GISH 5E8DH 1S7XB 2RGSA 3MLZL 3FO0H 5GS1A 4NFDA 1OP5K 3MJ9H 2BNQD 4NM8L 4RZCB 5B22A 3HUJE 3IYLW 4Q6IC 5B8CB 4U1IA 3VXPA 1MFAL 3ZT7A 4DZ8A 1FVCB 3QI9A 1RJYA 4M6OH 3MV7D 5CLTA 5GRJH 4M3KB 5IW1B 2NY4D 4JKMA 3KNBB 4ZUSB 4ERSH 3MCLH 4Y4FD 1C16B 3C08L 1J1OH 4ZAKC 2EO1A 4OZFG 5HHOE 2X70B 3SO5A 5EU5B 4W6XB 4JPKH 1KJMB 1QRNB 3WNOA 2KBGA 4NQCB 3OXRB 1J1PL 3NFSH 3D85B 1FNGA 2P45B 3SN6N 2XWTB 5FUZL 4NPYB 3QEQA 1D5ZB 1P9MC 1I1RA 1N6VA 3MRHA 3HFML 1Q9WA 4PTTA 5JOEA 5EZLA 2X1OA 5KOVC 1NMAL 3PDOA 4LCCA 4O2FB 4F7EA 2F53B 1BBJB 2ORBL 1JTPA 2CKBL 3O11B 3IDNA 3REWB 4OJFL 4O9HL 2GFBB 1X6LA 2VN4A 2AP2A 4GUPA 1ZLSL 1YMHA 1J8HB 4U1NA 4OD3L 2UWEB 4LAQL 2YEZA 5KN5B 3D69B 1OSZA 1GPOL 1F3JA 2HMID 3WS3B 3QXDB 1J86A 1QP1A 2H2PD 2GW5A 4HK3N 4QRRB 2DLEA 1INEH 4G6ML 3UTSB 5A2JH 4X9BA 1NMCB 4MHHG 2X2YA 1JPSH 1DP0A 3QUMB 5JW4R 3F6LA 3FB8B 4WRLA 3OKEA 1RZ7H 3AREC 2ZKHL 4GKZA 2UWEF 3S35L 4UI2A 4JFED 4OF6A 3DX7A 5GSRA 3MRFA 1H8SA 4HLZH 1PLGH 4QHLB 4PJFB 3DMMB 1BEYH 2NY6B 2VXQH 2G2RB 1BIIA 4QRPE 3UMTA 3T0ED 4L9LA 1AO7A 5B8CC 4XNYH 3MR9A 3GSNH 3LVEA 4EDWH 5EDXA 4OCXL 2PYFB 4CW1A 3IXTA 5DJ8B 5AZ2H 1R3LA 2R1WB 1EGJA 5EU6B 5J6GB 3GNMH 1E6OL 1DQTA 5ESAA 3UBXA 3T0DA 3MLWH 4L4VA 1VGKA 4GXVL 2B2XL 4KK6D 4PJFF 1NLDL 3L9RA 3S6CA 1CL7L 3UO1H 3ZE0E 2XZQH 3S36H 5ADPH 1RHHA 1V8HA 3BKYH 3D0VA 4OM0L 1H3UA 1EUUA 4F2MB 2XTJD 5E2WH 4WVRA 1WEJL 1X5GA 2GYSA 2QL1A 1FZJA 3ARXA 1FLRL 1AXTH 4PB0L 1YY9C 1JK8B 1EAPB 2D4FA 4YE4L 5EOCJ 4P59L 2HTLC 4P3WA 4U1SB 5C0RH 3ARGA 4HFUL 2I07B 4JPWH 4P0DA 1GGIL 3KPPB 3LRHA 5BS0D 1Y6MR 3VD3A 5I1IH 3E8UL 1TXKA 5F8QC 5IEHA 5F9AC 3VH8B 4HJ0D 4QGYA 4ETQA 1ND0B 4LSTL 3C5ZD 3PDGA 1YEEL 3T2OA 3Q6FA 2AEQH 5FO7A 3ROLB 2F15A 4FXKA 2FBJH 5E6ID 5GHWH 5GGVL 3V6FA 2DRUA 1T2QL 1SBSL 2QSTA 4L4VE 4WFGE 1TDQA 4TTDD 2IEPA 2V5TA 3PP3H 5D7SL 4PGCA 1G7HB 4PR5B 3T3PF 4ELMA 1FP5A 1NMCC 5KSVB 5E2UH 1P4LA 2CIKB 5IMOA 2W65B 3T4YA 3SBWC 4KZDL 3IJHB 1ZA3B 1KJVB 5C0DB 1V3JA 3RI5K 3K1KC 1RJZB 3TGXA 3U9UA 2XFXB 4Z6AT 2DTMH 5CCKH 4N8VB 1NBVL 1XT5A 4YDJA 1EBPA 2ADGB 2IH3A 3DMMC 2NY6C 4IS6B 3C6LB 4K55A 4X4XA 2FECL 2UY7A 4OLXL 2W0FB 3TVMD 4I4WB 2X4UA 3PWVA 4HEME 5FF6A 4JG1H 3WEXA 3RNQA 4PRBA 4JN1L 3SE9H 4UTBH 5SWZD 4JZOA 5HPOA 5DD1H 2DQEH 4YBLC 5T3XD 1ZLUH 3WXVH 1NUNB 3OB0H 4LSUL 1QHPA 2AS5M 4WENB 1EHXA 1GXEA 3C5SB 4B7IA 2C9AA 2BERA 1CBVH 3K0WA 2MQ0A 1K8DA 4ELME 1U8MA 1UZ8A 1R3IH 3VRLE 4JRWA 3G9VA 2CR6A 1TVHB 5ANMA 5DDHA 1QVOB 1BIHA 5D7JA 4JGMA 1KB5H 5EU3A 4EN3A 1AE6H 5F7FA 5FCSH 5HI4D 1INDH 4JN2B 4HAFA 4Z0XB 5D2NE 2P5WA 3RGVA 3QA3A 5E0QA 5C07B 3UPRB 3QDME 1A1NB 1QSVA 2FLBT 4RGNE 5DFVC 5IJVB 4QY8A 1OTTD 2VUOA 4LLVB 4H0GA 5D7KD 4F7MB 4NT6B 4NYLA 4K94H 5F9OL 1FO0A 3T0VA 4CBPA 1MJJA 4H25A 3KAAA 4XPFL 1Q0YL 2NX5B 3IDGA 1JIBA 2FL5A 1I7ZB 4MNGA 4RFOH 5EBWA 5A2FA 5D1ZB 4YX2H 1PW3A 4RRPA 2ZUYA 3EDDA 4XC1L 1N7MH 4QXUH 2NTSP 4EOWH 1TZHB 1KFAH 3V52L 2X1WL 1DEEB 1GC1C 2P5WE 5TDOA 2YK1H 5D1XA 3AY4A 1KIQB 5I1EL 1ULVA 5HDOA 5KSAB 4XC3H 3C6LC 3S37H 3VJ6A 4C4KO 1JN6B 5KW9L 5L9DH 1NKOA 2ARJQ 4H5SB 5IROC 2VDOH 5HYJB 3VXME 5K9QI 3MRQB 4Y4HB 5CJBA 1TTFA 1FL3A 1UWGH 2IWGA 4JKWA 4Y5XA 1FNLA 3UZEA 1U92A 2X4SA 2FB4H 4LDLB 5J1AA 1JPGB 4AM0A 5FDWA 1MLCB 1S7SB 4BFIB 4MNGE 1WSST 4E42B 1UKTA 2CDGB 3BH8A 3HRZA 3PV6B 4MS8D 5E94A 4QXTA 2Q87A 4HKJB 3P73A 1EGJL 1BVLA 4HGKC 4KHTL 5K9OB 5EFIB 4AEFA 1TQCB 5ENWA 5SWSD 5GGTH 4LPXA 1VACA 3D3VD 1F11A 3RVVD 1W2KT 5HGBB 4J3SA 1N2RA 3P0GB 2E7LC 2VZ3A 3IAGC 4PGBA 1S5HA 2BSRB 2CJUL 5FKAA 1JE6A 4E41D 5INDB 3CVIH 4CJ1A 3H2WA 1BX2B 1RZ8B 1Q38A 4FQXC 1FYTD 4HQQH 1C12B 4DKFL 4NZDA 4D0BB 2FIKB 3RWHB 1CXEA 1UM6H 4HHAA 3UTTE 3TZVD 3KJ6H 3QO1B 2IPKA 4I3RH 3CK0L 3WNKA 2KZWA 1ZTXL 3QEGL 1T0NA 4L3CA 3TBYA 4XBEL 4KROB 3IGAA 3LS5H 4OKVB 3KPMB 4RGOL 3V0VA 5JDJA 4NQEA 5C0EB 1ES0B 3F7QA 4KTDL 4O58H 4J4PD 3QDJB 4ODHL 5H35A 5DLML 5HGHB 1AGCA 4JRYB 4FS0A 1NFDA 2O61A 1MVFA 5T5FH 1KELH 5ESQB 2GIYA 1VADA 5DYOB 2D0GA 4PTUB 3PABA 5CD5C 3PHQB 1ZT7B 3NCCB 3C60B 1FNEB 2CK2A 3OJDA 3WUWB 1U8KA 4R26H 2XZAH 1J1XL 3HE7D 5KSAC 4P2QD 2FO1A 4NZUL 5DI8A 4PG2A 3TCLB 4LRIA 5KSUA 1F6AA 1IC4H 3RA7L 3WCYA 5CSGA 2BY3A 4K8RL 4CU6A 4EI5A 5LWYL 2DWEB 4Y4HC 3QDGD 4DN3L 3ARFB 3T3MF 3LEXB 5I18H 4K7PH 1FPTL 1SJHB 3QJFB 4WW2B 2E6PA 2FH8A 5J4MA 1B2WL 4OF7A 3D2UD 5DRNB 1CICC 4O02L 1OARH 4BM7A 4OF8A 3GDBA 3FN3A 5F7YC 4H8WL 5DJXB 3ZYIA 1UGNA 4ZD3H 2WM0A 4LCWA 3FOMB 1RZGB 1HH9A 4G8IB 3LKOA 3RWIB 3FO2A 2XN9D 4NHCL 4LNVA 1TQCC 3VG0L 1OPGL 2OR7A 1KEGL 4B41A 4WW2F 1KLUA 1VCAA 5B39A 5JUEH 4A2LA 3I9GH 4Q2ZB 4X8XA 1I7UB 1AR2A 2GI7A 4PRIA 2I9TA 2LU3A 1QBLH 4QTHA 4JRXD 3JVGC 5C0AB 3QNXA 3MLSL 3U4EB 4U3HA 5IEKB 5KJRH 3IFNL 5C7XH 2G5RA 4FZEH 4QF1A 3DXAB 4FFVC 3W0WA 2OTWB 1HXMA 4YIQB 3KXFA 4K2UH 3MV8A 4N0CD 3ARWA 2D03L 1FO0L 2E27L 1PZ5A 4KROC 4KJWC 4U6VH 4LCWE 1Q0XL 4XZUB 1S7TB 5C0CA 1C1EL 4Y2DA 4RMRA 3QHFL 3IDUA 1NCCL 5DHXB 2EECA 3GSUB 2Z92A 5C08D 1JGDA 3GO1L 3OKLA 1Q9KB 3MLZH 3GMRB 2AJYL 3C60C 2V2XB 2CXGA 4HUUA 3ZKND 2V2WA 3HTLX 3RVXC 1P4IL 3VXOB 5MEQA 5AWNL 4Z76B 1BJ1J 2YPLB 1ZHLB 3UYRH 2IALA 5EU7E 1YJDH 3RVTC 1ZWIA 2QADB 1MFAH 2JE8A 3M1BB 3ARFC 3QCVL 1S9WA 3B5TA 2UZIL 3C5JB 4WW2C 5IB3A 1UCBH 4RQQA 2L0DA 2BMKB 1JWSA 3TT1L 3C08H 3MZTA 2ADIB 4NNYA 4QHMB 5D6CA 3FN0L 2NNAB 2BCKA 3QUZB 4I18A 3OWEA 2YUZA 2A83A 3MV9A 32C2A 3RY4A 4L3EE 5FUZH 2J8OA 5ITFA 2P24B 2PO6A 4NHUA 2JB5H 2ADJA 5C1MB 1XR9B 2EE2A 4WFFD 3W39B 5ID0A 2VR9A 2NW2A 1TJIH 3MROA 3VI3F 4MCZA 3GI8H 4MA7H 2ORBH 3TBWB 2OM5A 4Z7QE 4JO3H 3HZYB 4JFDD 4K7FB 3KDMB 1SYVB 5I0DA 1NEUA 2BXZA 2A74A 3QPXL 2F5AL 4OJFH 3MRIA 5BV7B 12E8L 1D6VH 1KB5A 1DR9A 3PGFH 1ZLSH 4HS6A 4UT7L 4ACPA 1YECL 5HHME 4WI9A 4OD3H 4GW4B 1IGJA 2VJXA 5DK2B 4QRTA 2F74B 3RUGE 3TYFB 2YA0A 2AJUH 2Z93B 4LCIL 3HZVA 3G08B 4ZYKA 1FC1A 3P2TA 2Q76B 1CLZL 4LGRB 3QCUL 4S0SD 3SDDA 5DJ2A 3X13A 4PLKC 3IFLH 3MV9E 4G6MH 5CINH 2QHRH 3EFFB 3EO1B 5F44A 3MA9L 3BYTA 3NACL 43CAA 4K9EL 2C5DC 1L6XA 2XPGA 2VXUL 2AXGA 2ZKHH 1VPOL 4JG0H 4K3DL 2YPVH 4GAYB 5F7DA 3V6BR 1OF2A 1MUJA 3NTCL 4WTWA 1FFRA 1WISA 3AUVA 4P5TC 4PJIB 3X14B 1II4E 1U8NA 1PEWA 4J6RL 4X6CE 4XAKE 1FZKB 3FB6B 4L4TD 4NO0A 3EZJB 3MREB 1A0QL 3HLAA 2YD3A 3PGDA 1D9KA 1QQDB 5FYKH 2QADC 5F9DC 2NXYC 1Q72H 3TJHD 5BCAA 3OKDB 1RUQH 3MX0A 4GKSB 2VZ1A 5IV2A 4OZHE 1CT8A 3LKNA 3CSPA 4YPJA 2WBJB 3HPJA 1UH2A 2AEPL 5FHBH 3MRNA 1E6OH 4PJIF 4J8RB 4M8QB 2OK0H 2CUMA 4GXVH 4YBQC 3QUZC 3JWDC 3MRCB 2VE6B 1CL7H 2Q3ZA 2JCCF 3AROA 5KVEL 3BP5B 4NC2B 1G9EA 1D6EA 4G6JL 4E5XB 2AJZA 2AGJL 3WUZA 5KAQG 4F58H 3RPIA 4OM0H 5JOPE 5GIRA 3T2PA 1KUMA 4XCFL 3ARED 3W82A 2ICES 1F3DH 2FZ3A 4A2MA 1A8JH 2HRPL 5L8KB 1A6WH 2OP4H 5JMOC 3JWOC 1S3KH 1NCWL 3GSVA 1A3QA 2G5BB 4PJEB 3HS0A 1BFOA 5B4MD 5DUBA 1UXSB 1GGIH 5JOFB 3I75B 3EDEA 3HNTL 3H9SB 4LU5L 3DI2B 1ZSDB 4X4YB 1I9JH 1GGBH 1IGYB 3L3HB 1A6TB 3DIFA 1LO2L 1MIML 1YEEH 5I8CB 3VXNB 1DUZA 3O3UN 4PRHA 2OJZH 4PJEF 4P4RA 5JQHC 1G84A 4YQXL 2JLLA 1N64L 1QRND 2FR4A 5D7IA 4M1CC 1GZQA 2H8PB 4G8FB 1FG9C 1N0XL 2Y72A 3D85D 1OB1A 3NN8B 1KSRA 1JRHH 4KZDH 1Y0LA 2DQIH 2QSCH 4MD5B 3LZFL 1T3FA 3V6ZB 3ARBA 1W72B 2K7QA 3TO2A 4L8SB 3D48R 1YY9D 3LEVH 1SMAA 1QFHA 3BPOB 2DICA 2F53D 3N1MC 3QDHA 3GUTB 2HTLD 5H94A 1A2YB 1SJXA 3PP3K 2A77H 4PRPA 2D7QA 1F3RB 4BKLA 1RZIA 5EO9A 4NSKA 2VB5A 3UTQB 3RZCD 3VFNA 5IQ7L 2DWDA 1J8HD 2WBJC 2C3WA 3IDXH 2OTUB 3KPSE 4CADA 3O3DA 5ITBH 2NY0D 1YEIH 4D2NA 2F19H 4JY5L 4QRRD 3WE6B 3RX5A 3I6GA 5D7IE 1YUHA 3UTSD 2V5MA 1P1ZA 5EOCL 5AYUL 2AABH 5F7HA 4OTXL 1YPZB 3HAEH 3TIEB 4JE4B 4JAMB 4I77H 4WHTA 1KJ2H 1ZLUK 3EO0A 3OB0K 4CUCA 3FOLA 5C86A 1FZOB 2XTLA 3OR7A 1XGRA 2HJLB 1KIPB 3DMMD 4PRPE 4OCRL 1Q94A 3EGSB 2ZOKA 4Z7UB 1AGFA 5EN2A 4TVPE 3ZDZF 1YPZF 2BSTA 2X4TA 1KN2H 3MCKB 5FUOH 1T1ZB 2G60L 5K59F 2DQHH 2IGFH 2UYLA 1NGZB 1V7ML 3FFCD 4J3WA 3SKMA 1B0RB 5H37H 3HMWH 3FQNA 5I16B 2DI7A 4GSDH 4YXKL 4OCWL 2I60H 1KEML 5AAMA 5CEYA 4Z7UF 1KCKA 2WUBL 3V52H 4QHUB 3U0WL 3FRUB 3BUTA 5SX4I 1YEDA 4PJGA 5I1CL 4GW5A 4Q9BA 2YZ8A 3U79A 3O45A 1G7MA 1VFAA 1HHJB 4OZ4B 1QKZH 4NQDA 1UZ6E 3BPOC 3BPLB 3FT2B 7CGTA 1R5VA 4JZNA 2YD1A 4XCEB 2P5EB 4LEOA 3DARA 3ZSSA 3O4LA 2Y5TA 5BVPL 5IJKC 4M00A 3WFBL 1T21A 4Z7WF 1KTDA 3SKJH 3SGJA 2CMRH 3WV0A 5JMRA 5M95B 2BNRA 4JFQA 1R24A 3MJ6A 3QWOA 1NSNL 1IJ9A 3TO4A 4O51B 3FONB 1EUTA 2IADA 4M6MH 2MQCA 3OF6D 3MO1A 4N0UA 4KHTH 5TDNA 2ESVA 3CDCA 2CKBB 4GBXB 4P57B 4EUPG 1DQLL 1JYNA 1MELA 2R2HA 4LKXB 1JI1A 4PJGE 5I8KH 4TTGA 2Y23A 3MBEC 2FSEA 2OBGA 2GY5A 2ITDA 5CGTA 3B2VH 3HRPA 4Q9CA 4NWUL 1CYGA 3TPUA 3PP4H 1UVQA 3C6LD 3ES6A 1MWAB 5C9JA 4LLQA 3O4LE 4JDZA 1UQSB 3OKNB 3P9WB 1N6QH 3H0TB 5DJ6B 5DVNA 4M1GL 5DWUL 2BNRE 5I30H 3O6MH 3FZUC 5CP3H 3L3OB 1ZTXH 2EIBA 1H5BC 4YO0A 1MHHB 4XBEH 4YGVB 1UM5L 5FECB 2HKFL 1MQKH 1Z5LA 4JY4A 5IFJB 5EUKA 4KTDH 4YC2B 2FX9L 4DGIH 5DLMH 1CK0H 1A6UL 3WJJA 3Q6GL 4IMLA 5IB1A 2DL2A 5IMKB 2V5SA 4NOBA 3RY6C 5JHDB 5FA3B 3E0GA 1OTUC 1I1AD 3GRWA 4FQQA 4IMKA 3MA7B 2VLKB 1NGQH 1RVFL 3WSQH 1CE6A 3IS1X 5IHUH 2ZOLB 1J1XH 3T8XB 5GRZA 2LV4A 5MEPA 4XX1G 2YR3A 4FQXD 4UIMB 3RA7H 4R8WL 4JVUA 4OZFH 3QT2A 4BH8A 5C0JA 4UOJA 5CMAA 3CFCH 2QSQA 3N1FC 2NX5D 2PXYB 4PV8A 4WGWB 5IGXL 2WWKT 2X5PA 1RZJH 2P7TB 1XR8B 5GJTH 2NY2B 1B4JL 2WLYA 3P9LA 4TVPL 4XCNB 1F58H 4NOFA 1NC4A 3U82B 4O02H 4AENB 2YMXH 4J3OC 4TULL 4XBPA 4NHCH 5EZOH 3VXRA 4GBXC 5BXFA 1NEZA 1IRAY 1A7OH 2EDFA 2C4FT 5FV1L 2JJTC 5A3IC 3LN4B 5ICXA 3FTGB 1QSEE 3WD5L 5BOZG 2D7OA 4HV8B 5CD5D 4PJ9A 3QG6B 5GSVB 1CGYA 1GVIA 5C2BH 2A0LC 5TE6H 4F7PA 5DMIL 4KDWA 3RHWK 3T0BA 5KVFL 3L3DA 2OMNA 3IT8D 1MCCA 1SM3H 1U41A 2H26B 1T04A 3IFNH 2QKIA 4H1LB 5HYJD 2HVJB 1FG2B 3S4SB 1DL7L 4YEEA 2E6QA 2GITB 1T0MB 4JY6B 3OXSA 4ZFFB 1JGVL 3MQIA 2VO5A 1A9BB 1M6OA 4KQ3L 4UU9B 1T1YA 5HHOB 1XF2A 2EEDA 4JPIA 4U1MA 4HC1A 5B38B 1CICD 3KYOB 2JKXA 5GGQH 1H3PH 25C8L 1VESA 3ZHDA 1WBYA 3BSZL 3RL2B 3UCRA 3IF1A 1FC2D 2FWOB 3QO0B 5HGDB 1AQKH 1ZEAH 1MRCL 4KJPD 5C0NC 4FA8A 5GS1B 1R3KA 2CLVA 2GTZB 3CCHA 3OAUL 1YN6A 4PGJA 4LCYA 2HA1A 2YBRB 4FP8H 4WFEE 4P5MA 4WV1A 3OKOA 1B90A 2Q7YA 4U1IB 3VXPB 3WBDA 4ZUTA 2ZP0T 4DZ8B 3C9NA 4KH2A 3X12A 3QI9B 1RJYB 2HFFA 1P7KA 4FFVD 1X7QA 2PXYC 3O3BA 3VFOA 2C1OA 1KC5L 3C8DA 3UBXI 2NY2C 4RAUA 4JFYA 4Z7OF 3BIAX 4YNYB 1FIGH 4OLYH 1EO8L 4PUBL 5D8JL 1ZHBA 3GJFA 3V5HA 1D5BA 1FNGB 4KJWD 4NQXA 1KENH 3QEQB 5CS7A 5HDBF 3JSSA 1T7WA 3MRHB 1AGDA 1Q9WB 4JDTL 3QDJD 3BH9A 4BH7B 4PTTB 4X6DB 1MOEA 4UQ3A 4KKAC 4ORZC 5EZLB 2LTQB 5HYSG 3VGEA 3PDOB 2Q8AL 4LCCB 2JIXA 4F7EB 4YHZL 4EDXA 1CFQA 2OI9B 3X11A 4BA8A 4JJ5A 4EBQL 4ZPVA 3C60D 3EJYC 1PEZA 1LEKA 3RWCB 4KKBC 1DBMH 3QPXH 2F5AH 3PWPE 4GUPB 3GI9H 4P46A 3RVTD 1A21A 1YMHB 4X6DF 4UT7H 2EH8H 4U1NB 3IDYB 4ZUUA 2VYRE 2YEZB 5DQ9A 1OSZB 4G8GA 1DANT 5IF0A 3P4OA 4YUEL 4NJAL 1URLA 2XZZA 5JPMA 1IAIH 3GK8H 2Z4QA 1D5XA 3SKUD 4U4BA 4YDVA 1R6VA 4PS4L 2XG5A 5LGKA 5JR1L 5GRVL 2DLIA 4GMTL 3SDXA 4HUVA 5EIQA 1HYSC 3OKEB 3NACH 4HWEL 4PLNC 4GKZB 5GSRB 3MRFB 4RX4D 2ZNWA 4B0MM 2CLRA 2V5YA 4D3CL 3ZL4H 3NTCH 1F4YL 5KOMC 4UTAH 1HIMH 3AMLA 5GS1C 5DA0B 1MCLA 4HD9A 3L3IA 3QUYD 1BIIB 1U91A 4ONGL 4XXDB 4GKNA 4L9LB 4DGYH 5LQBL 1AO7B 5EU4A 3V95A 2G9HA 3NIFE 4PJ7E 2XI9A 2FJHA 3MR9B 3QI9C 3K2MC 4UIKH 3DXAD 4ZUVA 3IXTB 4MJIE 1R3LB 3BT2L 4G8GE 1OM3H 5E7BA 1Z0NA 1GGTA 5ESAB 3UBXB 5BVJB 3NVQA 2FYYA 2VXTL 2VZTA 3AM8A 1U8LA 4Z18A 5D72L 3L9RB 3V4PL 1SEQL 4WDIA 3CDGA 1RHHB 3CFDA 5KVEH 2D3VA 5L88L 3L5WA 1CWVA 1FFNA 3X3FH 5CEZD 5DD5L 1T2XA 1HCVA 4U2ZA 1FZJB 4OLVL 4XCFH 1P6FA 1U8PA 2LTQC 4RFEA 3BKJH 4LCCC 1FH5L 3RDTB 3J8F7 2ATKB 3TBSA 4UOW0 3MJ8A 3Q48A 2X4OA 2Z31A 2OI9C 3K81A 3ARGB 5J12B 4NZJA 4P5TD 3V8CA 4P99A 1BQSA 3DVIA 3HNTH 5E08L 4S1DC 4Z5RA 4JZJA 4JDVA 3QXVA 3C8KA 5IEHB 2QADD 3QIWA 2NXYD 4X5WB 5C0BA 4ETQB 3UXFA 3IDYC 3DV4B 1LO2H 1XGTA 3Q6FB 5FO7B 3O2VH 4ODUA 4M43H 1WTLA 3CH8A 4FXKB 4MQXC 4HLJA 3QZWG 4M5ZL 3V6FB 5GGSA 3BAEH 3OPZH 4YHIA 4AT6B 4PGCB 4AG4L 2A6JA 4ELMB 4G9FE 1L7TL 1CR9H 4YBQD 3QUZD 5TF0A 1ORSA 4LGPB 2Q8BL 3QB7C 3DV6B 5FYJH 4ELKB 3I3EA 4LF3B 1MIEL 3T4YB 3DSFH 4FXGA 4HC1L 4ZFOL 4QT5B 2JB6A 5F7LB 3WFDL 3MFFA 3CMOH 3PXHA 1HNFA 4OSUL 5HJ3A 4I9WD 4O2CA 1OAZH 1H0DA 4NNPL 1ZOXA 1ZVYA 4YDJB 2VABB 1GGCH 2IH3B 4ELMF 1FORL 2V9QA 2P48B 3AGVA 5DHYA 1RK1B 2PNDA 4L9LC 4O5LL 2X4UB 1FL6A 3PWVB 5FF6B 3RNQB 5I2IA 5C0BE 1RZKH 4JZOB 3V5DA 1RQ5A 5D6DA 4KK9C 3OGOE 3H6JA 1A7RL 5HDQL 3TWCL 4KGLA 3CXHK 3HC3L 3S34L 5IBLC 3RWFB 1K8DB 1U8MB 1UZ8B 6FABH 1WIOA 3BPCA 5ANMB 4M1CD 5MERA 5EOCH 5AYUH 5D7JB 1VSCA 5EU3B 4WWKD 3STLA 2OCFD 4Z7VE 1WZMA 4OTXH 3CVHA 1HN1A 4DQOL 3QFJA 2P5WB 1LK2A 4OLEA 1WK0A 2XYCA 3RGVB 1IZJA 2NY5L 3ARGC 4JHAL 1IZKA 3KS0H 4QY8B 3AXLA 5KZCB 2KUTA 1MFBL 4NYLB 1MPAH 3QHZL 4RFNC 1FO0B 4H25B 2D9CA 1FQ9C 4A6YA 1AFVL 5L6YL 3IDGB 2G60H 3LKQA 1V7MH 2FL5B 4N0YH 1D5IH 2WBJD 2EIZA 2UVFA 4MNGB 4ZQKA 5EBWB 4LLDB 1S7UA 3ULUH 1H3TA 4OFDA 2NPLX 1MEXH 1UYWL 3AU1A 1JZ5A 5F1KC 2GAZA 3N85L 2GTWA 4YXKH 4M7LL 1JYVA 3RU8L 2WUBH 1ZLWH 1GSMA 3RWDA 5KVGH 1I7TA 1PX4A 1NGWA 3QFJE 5EIIA 1CXFA 4K8RC 1PDKA 1KB9K 5D1XB 5DURB 5GGRY 5ILTL 2QTEA 1I1FA 2B1HH 2BVEA 4PJHA 1FRGH 5CUSH 2Y06H 3VJ6B 4KI1A 2DQTH 2IQAB 4RISH 3H9SD 3DWTA 4PJXA 3VXSD 5BVPH 1JHLL 1U92B 4H8WC 4QGTA 3IU4L 5J1AB 4AM0B 4F37F 2VZOA 4XPHL 5FDWB 5DVMA 2NCMA 1OP9A 5IMLA 1GOHA 1KBGL 3BH8B 3HRZB 3I6KB 4LFHD 5E94B 3DX6A 3P73B 1BVLB 3ULVE 3H9HA 4HJJL 3UTPD 2R0KL 2SEBA 2KDGA 5D7JC 5ENWB 4EN3C 1J7VR 4KJQC 1T5XA 1VACB 8CGTA 1F11B 1TCMA 5GXBB 5E24E 4BZ1L 3SE8L 1N2RB 3RGVC 4HBCH 2AJXL 3VFSB 3QXAA 4U1GB 5AEAA 3OG4B 4PGBB 4PV9A 5DHVH 1S5HB 5E6YA 1A1MA 5FKAB 3GZKA 2COQA 2GJ6A 1CGXA 2BVOB 3CAFA 4PJHE 4FQLH 3ARSA 5GS2H 5M94B 4FQIH 4PJXE 6CGTA 4HMCA 4KI5F 4HHAB 5IBTL 4GW1A 2IPKB 5C0FA 1CN4A 2OTPA 5DWUH 1EJOL 4HCRA 3D3VE 1MCKA 4L3CB 3TBYB 3SQOH 1QO3A 4UB0H 2X4QA 3IGAB 3V4UL 1QFUL 4JJHA 1BD2A 5IMMA 4Y89A 4NQEB 2HKFH 5J3HC 4ODTL 3ZMRA 3TA3A 5H35B 1XF5B 5I1KL 1VKXA 3TNMA 2O61B 1A6UH 1NFDB 5DJCA 2RBLA 1VADB 3MBED 3PABB 1A4JA 4P9HC 1LO3H 5D1XC 1BOGA 3AY4C 4ZO9A 3A6BH 3OJDB 3CFBA 1RVFH 1U8KB 2GJ6E 4HDIA 3FKUS 1G6VK 3KWWA 5F89A 4TSCH 5KS9F 4M6NL 1F4XH 5DI8B 3L5XL 1F6AB 5KSUB 5DJAA 3EBAA 4R8WH 2Y36L 3ILQD 4Y5XC 5AG9A 1VENA 1NFDF 1S9VA 2J4WL 2D7TL 2VDRL 4YK4C 5DRXA 2VQ1A 2WANA 1NUFA 3GB7A 4HKBA 2FDBP 4FG6C 4RA0C 2EDNA 5HVFB 4U2YA 3U2SA 1RD6A 1IGMH 2XOTA 5I19H 2Y7QA 1BD2E 3JV4A 4LCWB 4YHOL 2OLDA 3LKOB 3NCYP 2P4AB 4I2XA 2B4CL 3GSNB 4KI5C 5LAXA 4DOHB 3CDFA 5B39B 1I8LA 1MFNA 2LQRA 2R2EA 3EOAA 1R3JA 3MLVH 3QIBA 3QDGE 1LMKA 3QH3A 2O26U 3P4NA 4U1GC 3MRRA 1OTUD 4HXBL 1OGAA 3GBNL 2UUDH 4PRIB 2Q7NA 5EOQH 3S3JA 3WD5H 2I9TB 3CVHL 4NZTH 4QTHB 1LO5A 4HXAH 3VFRA 1ACYH 5AZEH 5DMIH 3SDYL 4D9LL 4LMQI 4OGYL 4QF1B 2X9WA 3W0WB 1XCQB 2DD8H 1HXMB 1CE1H 1FGVH 1FAIH 3KXFB 3MV8B 3JTSB 1EZVY 3V4VH 4KQ3H 1XCTA 3V8OA 4K9EC 4ODSH 2EKSB 2VXVL 1PZ5B 4A6YL 3D39A 1BGXL 2X89A 1MJ8L 2AKRA 1LHZA 5IVNA 5C0CB 1F8TL 3AFLA 3I2CL 1IL1A 1EO5A 2A9ML 4Y2DB 5CILL 4PBVC 4I2XE 1XF3A 3S5LA 1GL4B 5HHQB 2HT2C 4GBXD 4PD4J 3JTTA 2Z92B 2W07A 1WAAA 4N5EC 4OAWA 3OKLB 3ULVL 1FNFA 2V17H 4XVSL 5A3ID 5I8OH 3KYMB 3U4BH 2V2WB 4NUJB 1AJ7H 4GG6A 3DGGA 5MEQB 3B9DA 4PG2C 3VU2A 4JM2A 4LRIC 1CFVL 1IFHH 2IALB 3SGDH 1JNHA 1ZWIB 2AJ3B 2HN7A 9CGTA 4EI5C 1JP5A 4HG4K 4ALAH 2ZG2A 4IDJL 1YEHL 1AGEA 4X6EB 5IB3B 5D9SA 4RQQB 2ZCHH 3ELAT 1JWSB 4PRNB 3RWEA 2OS7A 4NNYB 2VC2H 3B8SA 5INCA 1A3RL 5D6CB 5ESVA 3IRZA 2BCKB 3HZMA 4I18B 3NCJL 1EO8H 2A83B 3X17A 32C2B 4OFYD 1G0YR 4NO3B 4XAWL 1NKRA 2DJ4A 2BRRL 2VXSL 5ITFB 2PETA 4FFYH 2PO6B 4NHUB 4JDTH 2ADJB 4MNQD 2DM7A 1SY6H 1IQDA 1KPRA 4Y19E 5ID0B 1WAAE 2NW2B 4LP4A 4DAGH 1IAKA 2Q8AH 2ED9A 3MROB 3MACH 4MCZB 3CFIC 5CLWA 5KTEH 3IDJA 1M71B 1JUFA 5C0ND 1LVEA 2VLKD 3ZDXE 2R4RL 2WBWB 3SCMA 4GG6E 4LKCA 2V7HA 2VLLA 3I6LD 2OZ4A 2O93L 3QUXA 2A74B 2DYPA 4YPGA 3LPFA 5EU7C 3DHJA 1A7QH 1KB5B 4HS6B 4PRAA 5EBGA 1SEBA 3RY5A 3EYSH 2FD6L 4QRTB 1W8NA 5L2KD 4QCIA 2PXYD 3HZVB 2NY2D 3MRMA 1YEGH 3G6DL 5DJ2B 3X13B 3T1FA 4PS4H 1U58B 5DD3L 3HPLB 3LOWA 1KCUL 4WGVB 1YY8A 4HCRL 43CAB 4Y2DC 5F96H 2XPGB 2C3VA 2AXGB 3MRKA 2ZPKL 4D0DA 2HT4C 2HTKC 4H0HB 4KPHL 4ONHA 1OAUL 5F7DB 4D8PB 1OF2B 1OWWA 5T3ZE 3LEYH 1MUJB 4KKAD 2QQLL 1QSZA 4XP9H 5DVKA 3O2WH 3VXTA 3TEUA 2OR8A 3WS6A 5EC1A 1HI6B 4XPTH 1CS6A 4JO2L 1RK0A 4NO0B 4UT6H 2ZWLT 5JTWA 4WCYH 2HG5A 3EJYD 3HLAB 2ED8A 3PGDB 2PCPA 3WDJA 4KKBD 3X3GL 4JFOA 2VSDA 3HR6A 4M7JH 5IV2B 1CT8B 3LKNB 1FN4A 4D9RE 2MKLC 1IQWL 3MRNB 5GS0C 3MLRL 3NIGE 4M4PA 5F88A 3VH8G 5HHOD 4I18C 4GAJL 4J1UA 4GRLA 3INUL 4P2YA 1D6EB 2NYYD 5E99L 3SKNA 3GIVA 5E2JA 1AHWA 2PO6C 3OQ3B 5GIRB 3VDCA 4RZCA 5LBSH 5C0IA 2ADFL 2Z35A 4YXHH 1LWRA 4D0CB 2DDQH 3GSVB 2XA8L 4LPUA 4UINL 2VNCA 5IW1A 4KK5C 1BFOB 4ZXBA 4ZUSA 5DUBB 3FB5A 5SX5K 3MLYL 1DN2A 1C16A 3W5MA 2E7CA 5GGUA 5E08H 1LDPH 1CD0A 2X70A 3UAJD 4PGEA 1A7NH 1I8IA 4N8VG 2Z8VC 3KR3L 3DIFB 4OBRA 4BQ6A 1DUZB 1S8DA 4PRHB 3ZTNL 1TJHL 5KVDL 1L0YA 4LLWB 1BZ7A 3G5XA 3TBTA 4P4RB 4HZLA 3SDDC 1I9IL 1XGQA 5D7IB 3P0YL 4O2FA 1GZQB 1XAUA 1MCNA 4HW6A 4TUKH 3GBMH 1CLYL 3WLWC 1H3GA 3BKMH 3T77A 5I1HL 1H3VA 3IS0X 3QEQD 1AC0A 1CD9B 3BWUC 2BVQA 3REWA 3UJTH 1Y0LB 1EFXA 3GMQA 4LOUC 3C2AH 4OD2A 3ARBB 3UC0H 2GFBA 3TO2B 2MWCA 3WYRA 5IW6A 4XCCH 4I3SL 1EV2E 5HI5D 4X6BA 4PRPB 4KY1L 3WS3A 2J88H 5CZVL 1RZIB 4HPOL 4J23A 2F8VA 4NSKB 1EO7A 3U7WH 3OJVC 4S1DD 4FQPA 4LCUA 4NQCE 4OCSL 3VFNB 2EC9T 1OD7A 1ROWA 4NN5B 1CIUA 3OL2A 4M7KH 3HC4L 4NRZA 4MQXD 1A7RH 4CADB 3TWCH 4YFLI 4K7PY 4EUPH 1W8OA 1BVKA 2R8SL 1LK3H 3I6GB 3KG5A 1VGEH 4S2SA 1YUHB 2ZCKH 4MSWA 4KRMB 1P1ZB 2F53E 4OI8A 3LS4H 2A9NH 3ISWA 4P3CH 5JQ6H 2APTA 2G2RA 4WHTB 3EO0B 4MXWL 1DFBH 1F45A 3FOLB 2QHLA 4HH9B 3W9DA 4QXGL 4HGMA 4LL9A 2IBBA 2X9YA 5DJ8A 3OR7B 2UWEE 1XGRB 1IAMA 1IGCL 4JHAH 5T3ZL 4L8BA 1NCTA 1VFMA 4QOKA 5E2TH 5HHVH 1Q94B 2ZOKB 3CFKA 4QRRE 1AGFB 5EN2B 1UA6H 5AG8A 3FQWA 1AO7D 2BSTB 2J8UA 2X4TB 3UTSE 1C5CL 2UYLB 1BBDL 1BQLL 1TVBA 1TJGH 1K2DB 2HYMA 2OZ4L 5DO2C 5F1OB 1IEAA 3QQ3A 3SKMB 1M1SA 4KK9D 2FNBA 5CJQL 1U6AL 5BRZA 4NM4H 2QEJA 4L4VD 4WFGD 1WJ3A 1KCRH 4NUGL 3NFNB 5CJ5A 5IBLD 4OB5L 4PJBA 5CEYB 2DN7A 4U1SA 4PJFE 3HI5H 1OGTB 4CAGA 1YEDB 4PJGB 3ARBC 1A9EA 3ARZA 4R4NC 4TQEL 3O45B 1G7MB 1VFAB 4NQDB 5FYLE 1ND0A 2HH0L 3K7UA 3V2AR 1R5VB 4JZNB 1IGIH 4XI5C 5EU6E 4LEOB 3R1GL 3Q3GA 3O4LB 2Y5TB 4U05A 4UBDC 1T21B 2J8UE 1MLBB 1KTDB 1JHLH 3ARVA 4PJGF 5KSVA 1ZLWK 3IU4H 3MV01 4U0QB 4TPRH 1QFWH 1BMGA 3N50A 4JFQB 1R24B 2CIKA 2EC8A 3GSOA 4U1JA 1YN7B 3MUY1 4AMKL 5LXGH 1ZA3A 4GRMA 4ZO8A 1TZGH 4AEHL 5E6ZA 2IADB 2AJVH 3MO1B 4N1CA 4PJBE 4N0UB 3QDAA 5TDNB 3T09A 2YC1A 1QHOA 2R0KH 2ESVB 2WK2A 2RAMA 4FQ2L 15C8H 4IS6A 3F8UB 3T3PE 2R0ZH 2R2HB 1YEFL 4XVTH 2NZ9C 1UACL 2FO4A 2FSEB 1KCSL 4J3TA 1YNKH 3SE8H 1U93A 4YFLF 2ITDB 4K8RD 3UJJL 3MRPA 3GMPA 2W0LA 5CD3A 3CZFA 3TPUB 1OLLA 3WDHA 2PR4L 1UVQB 1WFTA 2OL3H 3ES6B 4GQPH 5C9JB 4LLQB 4JDZB 1WBZA 4FTVA 3IJSA 4YDKH 3EO9L 4MVBC 1TVHA 1QVOA 4DKEH 4WY7L 5K9QG 1BLNA 2R0LH 1EJOH 3NCBB 5LCVL 2VITA 4YO0B 2QR0A 5CJOL 4Z0XA 4JY4B 2HJFA 3BKCL 4Q9RL 1G7JB 5C2UB 1DE4A 1L9MA 1KJ3L 1YYLL 5D7JD 4Q74A 4S10A 4EN3D 4IMLB 3BEWA 4UDTA 5IB1B 4LLVA 5IJVA 2KL6A 4KJQD 3T2NL 1C7TA 3ZKXC 4FQQB 2P46B 2P5WD 3JWNC 3HMXL 3P0VL 1DBAL 1E4XH 2LABA 1CE6B 3KGRA 1X5ZA 3OMZA 4G7VH 3DUUA 4Z0BL 1FGNH 5D1ZA 4ZS7L 5KZCD 4FTVE 4BH8B 5C0JB 5CMAB 4FNLL 2HFGL 4OQ1A 5DTFB 3SGJC 4ZS6C 2J3SA 4PV8B 1BQUA 5GS3A 3TYGH 3P9LB 4PP1C 3SJVA 2ICCA 1NC4B 2BHZA 3TO4C 4XBGA 2AXJA 2C3HA 1DN0A 1XGUA 1S7RB 1MFDL 5D96B 1QNZH 4KXZI 2FATL 4LVHB 2EXWC 2IPTL 4Y16B 2Z8SA 4NQTA 3IAPA 5J3HD 1KIQA 5C07E 1OAKL 3VXRB 4P3DB 2DQFA 5BXFB 4LVOB 4M62H 5HHXH 1JN6A 4H5SA 5ICXB 5JHLL 2AV1A 4PJ9B 3GBNH 1KULA 3GBLA 1ZK9A 1G1YA 2H45A 1HHGA 1JPGA 2WV3A 3VXQA 3L3DB 4E42A 4BQ8A 1T04B 3QAZB 5FYLL 3ME0A 3NCFB 1RURH 1T1XB 3KPNB 3UTTD 3OXSB 5CGYC 1IE5A 1WF5A 2UY6A 1M6OB 4N8PA 5EFIA 5JIPA 4FG6D 1XF2B 4JPIB 4U1LA 4U1MB 4YHKL 4JO4L 4K23H 1S9YB 2UUDK 3MYZA 1VEOA 2BDNH 1P4BL 3CLFH 2E9WA 3DTXA 5DFWH 3MJ7B 1HKLH 1CXKA 3ET9F 4HT1H 1MJ8H 1WBYB 1T7ZA 3IF1B 4P4KA 5CILH 1X5JA 3WJJC 1C12A 1MJ7H 2FIKA 4FFWD 5HYJE 4KKCC 5I15L 4XRCA 5J6HA 3ULVH 3WNLA 4IMKC 4IOIB 4NKDA 1R3KB 1QOKA 1WFNA 2CLVB 3CCHB 1ZANL 1YN6B 5J11B 4LCYB 1CDYA 3QO1A 2I5YH 3MLUL 2ZCLL 4P5MB 4WV1B 3OKOB 2BVPA 3CPLA 3GKZA 4CMHB 4ZUTB 3EFDL 4U6YA 3X12B 4IDJH 3H9YA 3KPMA 5L8LB 4LVEA 5FGCE 2HFFB 1P7KB 1ES0A 3OV6A 3H3PL 1X7QB 3O3BB 3VFOB 2C1OB 1QLEH 2BJML 3LQMA 3U9PH 1BM3L 4RAUB 4JFYB 4WTXA 2R69H 2C7UB 1DQDL 4JFXA 4GLRH 5D2LF 2HP4A 35C8L 5ESQA 2ZUSA 5J7CC 1T80A 1QZ1A 3AS3A 1H3XA 1ZHBB 3GJFB 5DYOA 3V5HB 1D5BB 4LVHC 4NQXB 3PHQA 4MAYA 4M3JA 4EI6A 5CIPH 1LNUA 1P53A 3ZYOA 5I66A 4NQED 1AGDB 3S7GA 1MCBA 3BH9B 4NZRL 4LVOC 4UQ3B 1AD0A 4UV7L 4MDJA 4Y8AA 2HT2D 2JIXB 2NY1C 4N5ED 3CSBA 3LEXA 3QIUA 4EDXB 4YHNB 1CFQB 3X11B 4PJ9C 2AXHA 1V3LA 3I84A 4JJ5B 3QJFA 4Z95L 4ZPVB 3P9MA 4NDMA 2R4RH 4AYFA 4K3HA 2DJSA 5DRNA 1CCZA 4YFEA 4TRPH 4P46B 2CXKA 3QAZC 1NCDH 4RA3A 4EI5D 4KDTA 1I3GL 4J2XA 2W92A 1IVLA 4ZUUB 5A2IH 3FOMA 4TVSa 5DQ9B 2VDPL 4G8GB 2FD6H 5I6XB 4IRZH 2MPAH 3QDJE 3P4OB 5DZNA 1TIUA 5JPMB 3T3ME 2Z4QB 1D5XB 5BJTA 4PB9L 4JRYE 2YD7A 4OKDA 4YDVB 4Q2ZA 4DVRH 1F90H 4UZGA 2W59A 4HUVB 3SDXB 1DBBL 4LCWD 1KCUH 1CTNA 1SJVA 3BOVA 1MCOH 5IESL 1ODAA 5ERWA 2IFFL 1RUKH 1UJ3A 4ZTOL 2XV6B 1F00I 5EG6C 5C0AA 1UT9A 3KJ4C 2CLRB 2X4NB 3JZ7A 1HK6A 2QQLH 4ZPTA 5DMGC 3WFEL 1HWHB 1EMTL 1SYSA 5A16B 2Z0BA 4PRID 4HWBH 1FZMA 4WEUD 4P23D 4P2RB 1RU9H 1U91B 3WIIL 1UB5A 2R4SL 5KANI 3SDXF 4WV1C 2H1PL 1P84K 4CMHC 2G9HB 3J7HA 1L6ZA 4JFEA 2FJHB 3X3GH 2CIIB 4ZUVB 3MXVL 1X5YA 5TJWK 3WHXA 5HY9A 1IQWH 5JW3H 2FYYB 2C3GA 1U8LB 3PL6A 1KPVA 2HWZH 4GAJH 4WDIB 1DSFH 3CDGB 3CFDB 3WL9A 1PX3A 1L7IL 3VFTA 3RWJA 1NCUA 4DUVA 3INUH 5E99H 4LFHG 4XNMB 2NY5C 3L5WB 4NN6B 1RI8A 5FOJA 5GRUL 5C0CD 1K4DA 3HI6H 4Y2DD 4Z76A 2YD6A 2YPLA 5C0AE 1U8PB 4LLUA 1DTUA 1NBQA 4MB4A 1DBKH 2HTKD 4RFEB 5MEOA 1FFOA 5B3JE 2H3NB 4FFZH 4NKOB 3DXAE 5C0GA 4X5XB 3MJ8B 2X4OB 2Z31B 4OLZL 3O6FA 3FJTA 3TPKA 3F5WA 2BMKA 2DQCH 3SO3C 1K3IA 4Z5RB 4JZJB 3F12A 4P46C 4JDVB 4LSSL 3BW9A 3PHSA 3MCG1 2W9LA 1XGPA 2P49B 3LKRA 5ADOL 4OQTA 1XGTB 2CGRH 4ODUB 5HHMD 5I6XC 5DJZA 5CEZE 5GGSB 5IFHH 3K2UH 3ZKSD 3F7YA 4HUMB 4WEBL 4YHIB 3PWUA 3W39A 5CJXA 1J5OL 3HE6A 3JV5A 3ECBA 1ORSB 3MV9D 4V1DA 2XT1B 4NC0B 1IGFH 3TBWA 1MFCH 3NA9L 4HPYH 3HZYA 1O5DT 4OZIA 4FXGB 2DB8A 2JB6B 2PO6D 5T1KD 2AI0L 2YPLE 2IG2H 4NO2A 3MFFB 3GM0A 4QTIL 1A4KA 4O2CB 1H0DB 2BOCA 4PIRF 3TIDB 2CK0H 4KK5D 2Y07H 2WINA 4XAKD 3CFJB 1UFUA 4O4YL 5DHYB 1NQBA 3D25A 3VI3E 1FL6B 5CZVH 4CU8A 2P1YA 2Q76A 5I2IB 1R5IA 1T5WA 3RX7A 3V5DB 4LSVH 3DYPA 1T7VA 1U3HB 2FGZA 1IM9A 2IMNA 2M1KA 3S3PA 1L0QA 4J12A 1RUMH 2X40A 3AM8C 4ZTPH 1RAMA 1NUGA 3TVMA 4M9OA 3AB0B 3SDDD 3BPCB 3QXWA 4G43A 3TF7C 5MERB 5TPWL 5SWZA 3LN9A 4HMDA 4NN6C 3WLWD 3STLB 3CLEL 2MKWA 3CVHB 2JCCA 3QFJB 5JLZA 1CLOL 1RUPL 5HXMA 5FGBA 1PG7W 4LOUD 1DCLA 3ABZA 1YC7A 1ADQA 3RVUC 2Z31C 2JELL 4QXGH 4BQCA 3KYNA 5F7UA 1Q1JL 3AXLB 2VDLL 2UZYB 4M8QA 1T22B 4JZJC 3DVGA 1EAJA 1D9KD 2R39A 3QIWC 4UAOB 2R56H 4A6YB 5D4QA 1KF9B 3PNWA 3WLBB 3HR5A 5I1AA 1JPST 4P2CG 1BBDH 3LKQB 1H9VA 1YEKL 1TQBB 2EIZB 1GGUA 2EC9U 3L5JA 1IC7H 1KN4L 1S7UB 5FHAH 3EAKA 4YWGL 3SQBA 4I0KA 2GAZB 2YHGA 1XIWA 4QHKI 4DN4H 4MCYB 4X0KB 2GTWB 3ZE2F 5TFSL 3EYFA 1X5IA 4PJEA 1UXSA 1YC8A 2VR4A 4U1KA 5JOFA 2V7NA 1I7TB 2JCCE 1NGWB 5EIIB 3BP7A 4LSQL 1ZS8A 1A14L 4TQEH 3VFPA 1IAII 2VL5A 4RMSA 4C59B 1A6TA 2H9GA 1I1FB 1WFOA 2YA2A 4P5KB 4JHWH 2O5ZL 5E8OA 3K8MA 3EOTL 3KYKL 4KQ4H 2AEIT 4NIKB 1FE8L 1H3WM 2DLTA 3RAJL 4PJXB 3AS0A 3S88H 4IOFC 7FABH 2O5YH 2H8PA 1BQHA 5D6DC 4KVCH 5DO2D 5IMLB 2B4CC 5DQDH 4PRHD 1IT9L 3KPSD 3V6ZA 4L8SA 2E7MA 4LIQE 4AEHH 3A0OA 3AB0C 3H9HB 3RKPA 1NMBL 5CEZL 2Y25A 4U6TA 2SEBB 1LD9A 4PJEE 1A2YA 3QFDA 1T5XB 5JW5A 4R96B 2LU4A 5EA0H 4GT7A 3H9SE 1KCSH 3ARBD 3QXAB 5IG7A 5KG9B 4PV9B 4R4ND 5MP6L 4NBXB 4HFWA 2GJ6B 1YNLL 2JJSA 4TUOA 3QCTH 5IIEA 2YPKA 3RRQA 1KOAA 4PRPD 2OTUA 1EA9C 3D9AH 3RWGA 5C6PB 3OSKA 5GZOC 1NJ9A 1I4FB 4UAOC 4TVPD 5C09A 4UBDD 4P49A 5C0FB 5DRZA 2EH7L 2Q86A 2BSSA 1TQBC 2FJGA 2VLME 1NGXA 3LPWA 2XQBL 5LVEA 4C58B 3JWDL 1QO3B 2X4QB 4JAMA 4NNXA 1BD2B 4OQTL 5IMMB 1S7WA 3KYAA 4C83A 2LAAA 4NCDA 3LIZL 2NW3A 4LLAA 4J3VA 2B39A 2X05A 4Q9RH 3TA3B 2DLGA 1KJ3H 1YYLH 5IK3A 2XNAA 2XQYG 1HQ4A 1VKXB 3TNMB 3V6OA 5IT2H 5DJCB 3JWOL 3DECA 1EERB 1A4JB 4RBPH 1BOGB 2VZUA 4H20L 1RZFH 3HMXH 3CFBB 4U1HA 2XKSA 4HDIB 5FEBA 4MZ2A 3KWWB 5CP7A 5F89B 1TETL 1ONQA 4Q6YA 5BV7L 5DJAB 4URTB 1JFQH 1RIHH 4F9LA 5HHPA 5I16A 1MAMH 1GH7A 2N1KA 2VQ1B 3GB7B 3L1OL 1EEZA 2EDJA 4H1LG 3ZDZE 4TNVF 2EDHA 1YPZE 3VRIA 3S4SG 4Z7WA 3GSWA 4GOSA 5E9DA 5E4IA 1G7LA 3JV4B 3MOBL 4JQIH 1WLHA 3QUMH 1HHJA 3O6KL 1J8KA 3SOBH 1S5IH 4I2XB 4HIXH 1AY1L 5LAXB 3V6OE 1HINH 2P5EA 3EOAB 1F42A 1R3JB 1DVFA 1KLFA 3MOAL 4OLWL 5C8JA 2ITCA 3QH3B 1QSFA 3P4NB 2V5RA 3NIDF 4F7TA 5J89A 3NZHL 1LP9F 2CRIA 5ACZA 1OGAB 3A6OA 3TT3L 3L3GA 4DFHA 2XN9A 1MRDH 1B0GA 3VFRB 3L3KA 5J0BA 3DX8B 3IXAB 1W0YT 3TH3T 1ADQL 5FYLH 5J06A 3O4LD 1E6JH 1WZ1L 4U6XA 4E0RA 3GKWL 4OUUA 2ZG1A 2OXHA 4ZS6D 1KT2A 5FO9A 2BNRD 1XCTB 3G5ZA 4JO4H 4Z7WE 1TFHA 2JJTA 5D93B 3SDCA 3D39B 3TO4D 1P4BH 4Y4KA 1JYXA 4XMLL 4NKMA 2AKRB 3S9DB 4OIIH 2EXWD 1IL1B 4DKDC 2QSVA 4FQ1L 5E5RB 3TA3C 1P7QD 3Q1SL 1FL5A 3W11C 4LIQL 3JTTB 2V9TA 2P5EE 2CSPA 4OAWB 1BPVA 2EDBA 3H0TA 4GKOA 43C9A 1CU4H 3DGGB 2YOCA 4K3EL 5E2VH 2VDML 3B4NA 3O0RL 1NCNA 1JNHB 4TOYL 4WHYG 1X5XA 2BP3A 4H88L 3TC9A 4APQB 3P77A 3QEHA 4UMGA 4LHQB 1AGEB 5FECA 3QR2A 5D9SB 2J6EA 4NRXA 2IQ9L 1R5WA 4NWTH 3RWEB 5CGYD 1A3LL 1JGLH 5JDSA 5INCB 5ESVB 1NAMA 3HZMB 1NCAL 4LASL 4HK3J 5JHDA 1T20A 3IAQA 4FQHA 2EDWA 1E4KA 3I85A 4F8QA 2PYEA 4ODWA 1D7FA 3F58H 1GC1H 4NZRH 1IQDB 1G9NL 1I8LC 1KPRB 2CDEA 4UV7H 4LHUA 3QIBC 1IAKB 4TN9A 4KKCD 1QSED 4ODVL 3VFWA 5ALBL 3IDJB 1JUFB 2E8YA 4HS8L 4GQ9H 4NO5A 4Z95H 3SCMB 4AY0A 4LKCB 2V7HB 2VLLB 3W81A 3QUXB 4YPGB 1S7VA 4ZODA 2LFGA 3GHBL 3RIFF 2QQNL 2XKUA 5DZOA 2DI8A 4PRAB 4X80H 2FJFA 3GJEA 4ONFL 1SEBB 1I3GH 1NDMA 3ZO0A 4D9QE 4EQ2A 5DMKA 3WFZA 3PQYA 2VDPH 2J12B 4QCIB 4OF5A 1UWXH 4LSRH 3MRMB 1HSBA 2NQCA 4F57H 5D93C 1NC4D 1IBGH 5I17A 3LH2H 3T1FB 5JHDE 1NANH 3SKOA 5CKAA 3MGAA 4MD0A 4HV8A 1YY8B 2VLKE 3QG6A 4GAGH 2C3VB 1ZLVH 1BFVL 3MRKB 4D0DB 1QRKA 3WXWH 2IFFH 3VXRD 4ZTOH 4NQVA 4ONHB 4WNQA 1HCFX 3R8QA 5DC0A 4XVJL 2BXYA 5B3NA 5CZXC 4XGZA 1UXWA 2X4RA 4Y1AA 2GUOA 3WFEH 2NY1D 3VXTB 2PKDA 3VGFA 3V9FA 1MRFH 4PJ9D 1RK0B 4JY6A 2HG5B 3WIIH 2YKLL 4JM2C 1JF1A 1R3HA 1UWEH 2PCPB 1FNSL 3BZ4A 3MGOB 4JFOB 4MJ6A 4YXLH 3VD5A 1FN4B 4U7KA 4NKIL 2D7NA 4Y2OA 3BMVA 4ZOEA 5F3BB 1F4HA 2HFEA 1OT2A 2FGWH 4KAQL 3ULUF 4EEEA 1JV5A 4JKPL 3R4DA 1QACA