2NY4D

Hiv-1 gp120 envelope glycoprotein (k231c, t257s, e268c, s334a, s375w) complexed with cd4 and antibody 17b
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
222
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 50
structure length 222
sequence length 229
ec nomenclature
pdb deposition date 2006-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny4D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny4D01
1CGTA 5TPWH 4ZFOB 4XVTH 1I8IA 3E8UL 3LDBC 2CKBB 3E6HA 1SY6H 3F65A 4TUJB 3EAKA 5D2NA 3QDJD 5T5FH 2J6EL 4BQBA 4HWZB 4NYLA 2BHZA 3VFTB 4JN1L 4YIQB 4GBXA 5LG1A 2DJ4A 2UWEA 5FYJE 1O0VA 4FTVE 1TXKA 2MWCA 3V4VH 3DVIA 1V7NL 1GGCL 4RMUA 5LKNA 3ZL4H 1KG0A 5I1KH 4PG9B 2H32H 4PV8B 1FCGA 4UBDC 4OCYH 3T0BA 5DJDB 5HYIA 4X80L 4XMPH 1TTFA 3U1SH 4MD4A 5E5MA 2E27L 4OCWL 3BP4B 4PRHE 4RAVB 4KMTL 4XB8A 1HH9A 4U1JB 1N3NA 2DQIL 5BCAA 5IG7A 3TT3H 1ZLUK 5BMFH 3W9EB 1J0ZA 1CLYH 2CK0H 1EX0A 5EO9A 1P4LA 3GFUA 3VFOA 5DFWH 4U6VL 4B50A 4JEGB 4XVUD 3U9PH 3ARBD 1DE4B 4Y16D 4JN2B 5IV2B 2EO1A 3MRCA 5DUBB 3DVGB 4HKXB 2LAGB 4Y2OA 3L5XL 4Y2DA 3RL2B 4HUNB 1EAPA 1J1PH 1X44A 1W8OA 4FXLA 3U4BH 1PLGL 4Y4HD 4XVSH 1J10A 5JPNA 5F9DC 4WEMB 2IBBA 3S37L 5F7EL 3O2VH 1VFOA 5IJVA 4W4OA 2FHFA 2GIYA 1JNNL 1P7QD 5GRYA 2IFFH 1IGFL 1ZGLP 5JHDD 1EMTL 4HDIB 3Q1SH 4FXKA 4Y1AB 4IOFC 5D7IF 1DDHA 5EBLA 4GW4B 1KCLA 3SE3C 1RUQL 3NIDE 2DQDL 5DRWA 4F7MA 3LZFL 3HI5L 3MV01 3PL6B 1AO7B 2RJMA 5F9OL 2IMNA 5D72L 5F44A 3U0WL 2I9TB 5DHVH 1QRND 5GRUL 2CLZB 3NFNA 1IFHH 1RMFL 4LLWB 1FGNL 3QQ3B 3LKQA 1AGDB 2A77H 4M1GL 3BAEL 5C0RH 3X14A 3QDGE 4OUOA 5K9KB 1KPRB 1T3FB 3FO1A 4PIRF 4YBHA 4OM0H 5IHZA 4H8WC 2W0PA 5D9SA 2BMKA 1JHLL 2ZUXA 2CLVA 4LEXH 4P2OB 3OKEA 4ZXBD 1Y18A 4KV5E 3OKKB 3ETBF 1H8OA 4FFVC 4NO3A 1NGXA 3Q3GB 1MAJA 5BJTA 3C5JA 2OQJA 2LFGA 2FLRT 4PG2A 1NCNA 4HD9A 1T0PB 3GKWL 2XQBL 4LNRB 1CLOL 1I3VA 2AV1B 2HJLB 4PBXA 1YUHA 1YA5A 5FKAB 4OB5H 2BDNL 5H94A 2DI8A 4Z7WB 3DO7A 4OGYH 1H3PL 1I9EA 3W0WD 1KUMA 4HAFA 3C6SA 2AXJA 2NW2B 4YHLL 2VNCA 4ZSOB 1N7ML 1E4XL 4OGAD 2BY0A 3ZTNH 2JCCF 4FQ1H 1UCBL 4MZ2A 3QEUB 5JXAL 5DZLA 5C0JA 1VFBA 3TO2A 2ITDA 1U2CA 4CNIB 5TE6H 4A2MA 1NDMB 1D5MA 2HMID 2VZTA 3L5IA 1DQDH 3ULVH 2A1WH 3UPRB 5CFHA 2J4WH 2XZAH 3MLXL 4G6JL 3RGVD 3SE4A 4YHNA 5E94A 4BZ1H 2WIIA 4MMXC 4KROC 3T77A 4U1GC 2OZ4H 4QXGH 4A6YH 1IGMH 5D1QB 3IJYA 2IAMA 2IC2A 3HB3C 3IDXL 4O02H 3ROLB 4P9ML 2E5EA 2ENYA 4P46C 2X4PA 3HMWH 1XGPB 3ARSA 3IB4A 4M8QA 1A6ZA 3GMRA 3O4OB 3RAJH 3QXTA 5EN2B 5F89A 4NT6A 2AXFA 1RZ7H 1JCKA 4FZEH 2ICWA 4JKWA 1N64L 3TZVC 3OV6A 4PJ5E 3WFBH 2V9TA 1PKQE 4LGPB 1F4YH 4PJGF 4KZDL 3G6DL 4ZUUB 4XC3H 5I71C 1UGNA 1L7IH 4IRSB 3GJFK 1NGQL 3ZZ1A 5DQDH 2HT3D 5C0CE 1X7QB 2HKFH 1KELH 2ZOKA 4L1HA 1NCWH 1LD9B 4KXZH 1CDBA 3P77B 3REVA 5IVNA 1CF8H 4X7SH 2SEBA 3CXDL 4DJMA 4HIEA 5E9DB 4TTGA 2HT2C 1JHTB 3QXUA 1CCZA 3GSWB 4Y4FD 1B4RA 1CL7L 4YZFE 5BW7C 2XKSA 5CD5C 3BKCH 5TDNB 2C3GA 3ZKQD 2J8UE 4RAUB 1FVEB 2B0SH 5DA0B 2VC2H 1KJ2B 4R0LA 4WFGE 3MRNB 5T1MA 2F5AH 4XMLL 1XMWA 5TFSL 4HPYL 4NHCH 4OF7A 5KVFH 3C09B 3PDDA 4FFYH 3ZDZE 4JFHE 3GHBL 4KHTL 2MQ0A 2I9LB 3V5KB 4U1NA 3U0PB 15C8H 4TVPL 2VXQH 4IRZL 5CSGA 2NMSA 2ZCKL 5I1LB 4LHQB 1EFXB 1YEHH 3LD8C 3QNYA 1X5HA 5F1SA 3TVMA 1GL4B 1RZKC 1ES0B 3BUYB 3ZE0E 4DKAA 3PGFH 3UJTH 2JB6A 1UWXK 3BQUC 2AK4B 4FQQB 1FO0H 2V6HA 1FG2A 2F9BT 2VDLL 2OBGA 1QFWI 5F3HB 1HK6A 1G7MB 4ZS7L 3HMXL 4MJIB 1FORH 4LGRB 3AS3A 1BIHA 4WHDA 4M6NH 1YMHB 1OHQA 3LKPB 1WC7A 4M6MH 4R96A 3RNKA 2P44B 1W0VB 3MRPB 5JZ7D 2DQJL 3FHAA 2H32B 3KPPA 4GKOA 5GGTA 4G8EB 1ZVYA 4JFXA 4X99B 1KXQE 3QAZC 4LLYA 4P2RE 3P9WB 1Q72H 4PD4J 2DLFL 4MAYC 5KVMC 2ZWLT 3E6FB 3AM8C 3W39B 3CVHL 2DS4A 4HWBA 4I0PB 1C1EL 4JKPH 4PY8J 4Z77A 2ADFL 4GW1B 4K3HA 4N8PA 1F6AB 2BVPB 4XWOC 3F58H 1DVFC 1MH5B 4OUUA 2R4SL 1ZGLM 5ACZA 1OARH 3RWGB 3VXUB 3ARYA 1FNGA 2BVYA 1NMAH 5DYOA 5C08E 5EA0H 2BNQD 1RUAH 4JFDA 3ABZA 32C2B 1QNZL 4WFGD 5IBTL 3W9DA 2B39A 1J7VR 1LO3L 4ODTL 4DAGL 5KZCB 2GT9B 5MEOB 4F2MB 2R2EB 1MRDH 4L4TE 1D3CA 4ZNEA 4PY8I 1ZANL 3AROA 4QWWC 5E4EB 1TQCC 2D31B 3GSUA 1UVQB 4ORGA 1PG7H 2JJVA 1S7VB 2IPUK 3IDMA 4FXGB 2NY1C 4JG1H 4LEOA 1WUNT 3VG9B 4DQOL 5IEHB 4ELKB 1A4JA 3LQZB 2R1WA 3OKNA 3QWOB 3B5HA 5SWQA 5DHVB 5FA3B 3DRTB 1MJUH 1XF1A 4LASL 4MB5A 4OQ1A 2GY5A 1KN4H 4LFHD 5D70L 3VGDA 3WIIL 5C0BB 2B4CH 1KYOJ 3SPVA 1RZGA 3REWB 3L9RB 3VH8B 4WI9A 4HGWA 4Z0XA 3SJVD 5K59E 4MSWA 5HHOB 1OAQH 3MRGB 4HJJL 1T03H 5GGSY 3OXSA 3CH1B 4TSBL 1A64A 4JO2H 5J11C 4NZJA 4L8CA 2EYRA 3BYYA 5EOTA 5SWSB 1AKJB 2AJ3B 3MRHB 1YECL 3MV8B 3PV6A 3BGFC 4NM4L 4OZIB 3NPSC 3C60C 5JLZB 4I2XB 1AQDA 2ICES 3ZE2F 1EJ6A 4KKBD 1U8PB 3BYTA 3H0TA 4WW1A 4LPTA 1HXMA 2WM0A 4JFFB 4LSSH 2YD6A 3JTTB 1E4KC 4KK5D 4XP9H 5JW4N 1NUNB 5LQBL 3QEGL 5GGSA 1A3LL 2F74B 1AIFB 1OGAA 3Q6FA 5L2KB 3WE6B 3SGEI 1QG3A 2A9NH 3BPNB 1CBVL 1ERNA 1F97A 2OP4H 1OP3H 1W0WB 3K2MC 2WUCH 1WT5C 1FSKB 5ERWA 1QA9A 4GQPH 4PJHE 4NQEB 1QFOA 3C6LB 4XNYH 3QQ9C 3I84A 4Z76A 4C56A 5KANI 5IM7A 3SCMC 3LEVH 3BP5A 2AP2A 4M03A 5GGVL 4J3TA 3SE3A 4DOHE 1I7ZB 2ZCLH 3UTTB 1CYGA 1PD6A 2MKLC 4WO4C 4A6YB 1E4JA 2DQGL 3L3GA 1MVFA 1MCWM 1T1YA 2X5PA 4WFHD 2B5IC 2YD3A 5J6HB 3MRMA 2Q20A 3H9YA 3JXAA 3CFEB 1P4IL 4XPHL 3WKMH 4XPTH 2WP3O 5ANMB 1BX2A 5C92A 1AXTL 3HKFA 2XZQH 4KKCC 1A7OH 4ZUWA 4YHZH 3FAXA 5EO0A 1SYSB 3O2DH 2X1WL 3AS1A 4ODXA 1XR9A 1PVHA 2YN5A 1AGCB 5CKGA 2GUOA 4KVNL 1KJMB 1PY4A 5GSRA 3ARRA 2GHWB 4WCYL 5I1EH 1TJGL 5EUOF 1FZKA 5HPOA 3QXVA 1QVOB 2LAAA 2XWJA 5CCKH 3MX0A 4IJ3C 4LHUD 3OGCB 4XNQA 5I66B 1GGBH 2D4DA 2YRLA 3V8CA 2APTA 2H2SD 3VGAB 4L9LB 5GS0C 1WWCA 2GAZA 3I9GH 3KNBA 2VLME 3SE8L 4LPWA 3VWKC 4APQC 5T1KB 4X98B 4UV7H 3FQRB 5FECB 3QH3B 3TO4B 4OLZH 3FT3B 4K3EL 2X70A 1HKFA 4OZGE 4RGNC 3EHBC 3KG5A 1KF9B 5D93B 4B41A 3VXSE 4JHWL 5JA8B 4MD5B 2WZPD 2HWZL 3GIVB 3TN0C 2AXGA 4YX2H 3DSNA 2E6QA 3EYSL 4XCEB 5MEQB 1I1AC 3MMEB 4YJZL 5BRZE 2N1KA 1YEIH 3VXMD 5BO1H 5DJXB 4DZBA 2XICA 2GTWB 5AZ2L 1ZTXL 4RIRA 1S5IH 1F2XK 2D7TL 1FO0B 3SDAD 1FYTD 4UIKL 1B0RB 4XBEH 4W68A 1O5DT 5T1LA 5CGYD 1CIDA 5IROA 4OTXL 3QDJB 4YNYB 4HPOH 3JV4A 3QFJD 1Z9MA 1OPGL 4JRWA 3TZVA 3GI8H 3LV3B 3S4SG 3DWTA 5BVJB 2PYED 5IFAL 2FIKB 5LGHL 3VMPA 4XP5H 5FO9A 5DT1L 4NRXA 4NKQB 3ZYJA 4BFIA 2ZPKL 3PUCA 4LRNL 1WZKA 1YN7A 3WO4C 1XH3B 3PWVB 2E8YA 4LSRL 1BVKA 4NQDA 5AUMB 3O41A 1PX4A 2DJSA 4G8GA 2L4OA 3S37X 3WFEH 4F7CB 1NC2B 5BW7A 2MQ3A 3BWAA 1JZ7A 1U8IB 5IW6B 1KTDA 5EBWB 3LRSA 3O3AB 2WWMC 1JP5A 1P7HL 1JN6A 2XQYG 3FB7B 3A67H 3QULA 4JLRB 2LABA 4MGXA 3MLSH 4OLXH 4TVPE 4WI5A 5KW9L 3IAQA 4P2QE 5F7MC 2YPKB 3SDDC 1F3DJ 5E2WL 3QDMD 4XPFL 3GSRB 2OSLB 5ICXB 1RJYA 3RHWF 4I0CC 1BJ1J 2EDEA 4JKKA 3OJMB 4H1LA 4Y4HB 5E2UH 4X6EA 4OZHB 1I8LC 1B4JL 1DLHB 2K1MA 4ZFOA 1I1FA 4JPVL 4GS7B 1OTUC 2QQNH 2QKIA 1P7QB 3UAJD 5KSVA 4UOW1 1HQRA 5BQ7A 4I3RL 1A9EB 2VZ1A 2G5BA 1JBJA 4HWZA 3DYMA 3ZE1F 4DKEL 3MLTA 3A6OA 3S5LB 4Z7NE 4PUBH 4U6YB 3GBNH 2QBWA 3U46A 1QRNB 1RURL 4Y8DC 2FATH 4FTVB 1MELA 4KDVA 4PV8A 2IH3B 5DS8B 4MAYA 5B3JE 1EEYA 4CN1A 4R4NC 4YE4L 2X4RB 1I7UA 1J8HE 1WAAE 1E6OL 4HUXB 2O61A 4DVRL 1U0QA 4B0MM 2FYYB 4U1JA 2VIRA 4PRHB 5L6YL 3HI1B 1RFDL 2Z8WC 4ZXBB 3QHZL 2VKXA 4WWKD 1KCUH 3UBXI 4WHTA 1MCSA 5FUCC 3U6RB 3KS0J 5ADOL 2I25N 4UQ2B 4YHKH 5HYJA 1QSFD 1QZ1A 4YHPA 3WEXA 3MCLL 5TE7H 4XP6L 3FO2A 1LK2B 1JWMB 4OF0A 5DUBA 3QFDA 1Y0LA 4JDVA 2W0FA 2AJYL 5HHPB 1DBKL 3OZ9L 4XXDA 1EJOH 2KL6A 3RL2A 4ODWA 4FQIL 2ESVE 4EN3D 1EERB 1Q0XH 4PRNA 5C70A 2DQTH 4Y88A 1WIOA 3W0WB 1AD9B 4KI5F 4IS6A 4ODHH 4FABL 1UWEL 4N1HB 1A6TB 5DEGB 3EYOA 4HBCL 5HYSB 1KB9K 3KJ4B 4H88H 4LCUA 3VXNB 4ODVH 1EH9A 3HN3A 4LFHG 2FSEB 5L88L 3SO3B 4Y1AA 4BQ9A 3E8UH 5SX4I 4K8RD 3LRHA 4P23D 3TFKC 3C5SB 3PL6A 3RGVB 2A74A 1FFNB 1CK0L 2CLZA 2P7TA 4WUUD 1X5IA 2YPLE 1G9MC 3QO1B 3QUXC 4TN9A 4D0CA 1JPFA 2EECA 1FIEA 1FLTX 5D96C 1I4FA 1IGTB 1AGDA 3MGAA 5IJKC 1A1OB 1ZHBB 3IKCB 35C8L 1T3FA 3PGCB 4DUWA 5ETUB 3WJJA 4BZ2H 4NKDA 3HR5A 2JJUA 3KYOB 3QIWC 4RRPA 4OCWH 1FHGA 3SGJC 3OKKA 3VA2C 3C8DA 2G60L 1T5XB 2YUZA 3C60A 4NDMA 1T4KB 5DJ6A 1DUZB 4Z5RA 3BZ4A 3CC5A 2BZDA 4M48L 5HY9B 1KXTB 3MOBL 2ICEA 4HC1H 5GISL 1RHHB 5EULV 1RVFH 3L3IA 4K55A 4PY7A 4HGMA 3R8QA 4PJ8D 1MCOL 5I16B 3O6FD 2NY7L 4OD3H 4ZYKA 5FCUL 3L5XH 3OMZA 2VXUH 5DQ9B 5TGBA 4Y4FB 3WUWA 1WT5A 5J89A 2UVFA 4YHYC 1YJDH 5GJTL 4OFPA 5L2JA 1IAKB 6CGTA 3GRWA 3BI9X 4X6CB 5HGAA 3G04A 4QF1A 1BEYL 3S37H 5F7EH 3HNVH 5J4MA 3SCMA 1ROWA 1V7MH 4UU9A 2Y07H 1S7XB 5CSBA 1KC5H 4WO4A 3UPAA 1IGFH 5IVXA 3BGMA 4L4VA 5EU6D 1QP1A 5CHNA 2ERJB 2E6PA 2LVEA 3CX5K 4GJTB 4HEPG 2W65A 3CNKA 3BISA 3LZFH 3HI5H 1P69B 5D1QA 3H42H 5I17B 1UWGH 3OR7B 5DJ0B 5GRUH 4Y4KC 3HAEG 3CFBB 3X13B 4DEPB 4Z7VE 1FGNH 5B38A 2FEEL 3IETB 1F4XH 4FFWD 3QEQD 3BH9B 4PJ7F 5EN2A 5E8DH 4QRRD 2QV2A 3DETC 4AEHH 3IXAB 1JPTL 2IGFL 4JG0L 1EHAA 1KN2L 1II4E 2F5BH 1IBGL 4HJ0C 4ODUA 4Z7OE 5B22A 2DIAA 3H7BA 3VJ6B 1CQKA 1S7WB 3NTCL 5C0AA 3BIAX 2FB4L 2R2BB 1AE6L 3HE6C 3RVUD 3VWJC 4XX1G 2A83B 4JREC 4J2XA 3PHOB 1LNUA 5M94B 1IM9D 1T80A 1WF5A 1LE5A 1I3RB 5C71A 5C0CB 2DQFB 1VDGA 3B9KB 5EZJA 1CLOH 3P77A 2ZNXA 3DGCR 4JR9H 3VWKA 4APQA 3LN4A 5J12B 2BDNH 3GSWA 4HIJA 1CDCA 1JYNA 3PWPA 1YMME 3H2WA 3LKNB 4LSDA 1H3PH 1N26A 2BCKA 5KN5B 4PJBF 3V5DA 3WL9A 1N7MH 5IFHL 4RAUA 1FVEA 4M93B 4KQ4L 2BNQB 3ARED 5A2LH 2X1PA 2Z93B 1UCBH 1LWRA 3TN0A 4JAMA 4ZD3H 1RIUH 3STLA 4S11A 3U0TB 4JHBA 1R3LB 2NY2B 1RPQA 1IL1A 1QBML 3MLXH 4KK6C 4OBRA 1U95B 2EDNA 4JO4H 4F58H 1A7BA 4GH7B 1CFTB 3OKYA 1U8NA 2PXYC 3TBSA 3I3EA 4FQQA 2NZ9C 4LSUH 1NGZA 3QIUC 1D5XB 4WTZG 3E3QE 4MJ5B 3IDXH 4YGVB 1G7MA 1UKSA 3GMQB 3V6ZB 4JGUA 1ND0B 4R2GD 1OF2B 3GI9H 1NLDL 1GHFL 1FC1A 1PEWA 3B6SB 4F9LC 4TTDC 5IHBA 2NTFB 2H32A 4P3CH 1N64H 3BVNB 1ADQL 2WWKT 4X9GA 6FABL 3O45B 4IOSD 4KZDH 4PR5B 3VGGA 3QI9D 3G6DH 1D7FA 3MRJA 3P9MB 5L7XH 4YEEA 3U4EB 4MA7H 2NY5H 3SJVB 4FQLH 3ARTA 4YHML 1MCPL 1OVZA 2QLVB 2BNUB 2J5LC 4Z7UE 1N5AA 4BH8B 5GGQL 4WENB 1QLFA 1T22B 5F1IB 3EGSA 4YFLI 1EHLL 1ORQB 5BS0E 4X7CC 2Z9TA 4QY8A 1H0DA 2UWEF 2E7HA 4FNLL 4NQCA 1FVDA 2G2RB 1CL7H 1KPUA 4HWNA 2J88L 3F12B 3D0VB 5EH1A 3EO1B 4CJ1A 3MXWL 5D1XD 5TFSH 4DGVL 3SDDA 4I77H 2IPKB 5E6YA 2R2EA 1HEZB 5IMKB 1QFWM 3TNNB 1S5HA 4KHTH 3T65B 2XTJE 2X4SA 1INDH 1UVQA 1HHHB 1I7RB 1FZOA 1LILA 2QSCH 3BO8B 2XN9A 4IRZH 4QHLB 2EKSA 1S7VA 1GYAA 1BHGA 4ONHB 1UM5H 3B5GA 4KZEL 4ELKA 3LQZA 4PRPA 3KVQA 3HC4H 1GAFH 3M1BA 3WDIA 3ARFC 2W9LA 5FA3A 3SE9L 1HINH 2DLTA 2PO6D 3K0WA 1F11A 3O8XB 3P4MA 2AABH 5B39G 4S1DC 4HZAA 1G9NH 4NO5B 1KLGA 5C6TL 4QTHB 2FGWH 4K8RH 2V2WB 5I8OL 3HUJA 3LB6C 5I0DA 1NBYA 4Y19D 3B2VH 3U9UB 1KCKA 1OTTC 5IMLB 2AQ3A 4G8FA 3L3DA 5EU3A 1GRWA 1LK3L 1NKOA 1KIQB 4JM2C 3D3VD 3VXTB 4KUZL 4LPCA 5AD0A 4ZQKA 3NIGE 4DVBB 4HKJA 4R97B 1YEKL 4FZ8L 1OY3B 5JLZA 3UO1H 1ZWIB 2QQKH 4XTRC 1MHCA 1TQBB 2R4SH 1QSEA 3SDXA 2QADD 2VRAA 4LHUB 1IC4H 2Y5EA 3D69B 2QHLA 1C12B 3DX8B 2C3VA 2P42B 5AWNL 1MFDH 1F4WL 2PW2A 4U1MB 3BZEB 4JKMA 1HYSC 4RGMC 1AR1C 1AIFA 4P9HH 1U91A 2ZKHL 2QEJA 4UAOB 2VZOA 1J0IA 2VDPL 4JDZA 5I1CL 1E28B 4FQPA 3BPCB 5DLML 1TJIL 2D0HA 1Z3GL 4U6HB 4Z18A 3S36H 1T89A 4PJHB 4K7PX 1OGTA 3GZKA 3KPQA 5DC0A 1TZGH 4UIMA 2XQYK 4Z95L 4YO0B 1INEL 2V7HA 5I1HL 5DD6A 1Z9LA 3VXMB 5GS1B 3FT2A 3QUXA 4HCRA 4GFTB 1JGDA 4PLJD 3MLUL 3EO0B 3FONB 4DUVA 3CFEA 4X8XA 3SDAB 5IJKA 5E00B 2NX5E 3LSOB 5ITBL 3WIIH 2Y5TB 1N5YH 1G7HB 3QO0A 3IJHB 3V52L 3UJIH 4MA8H 1UJ3B 4XBGA 4YC2B 1T1ZB 5FB8B 5GQBA 3QIWA 1IGJB 4BFGA 1LVEA 1DP0A 3QFJB 3V6OE 3SGJA 4KI5E 3T4AA 1HHIA 4RGOH 4NKMB 1NFDE 4NC0B 4PP1D 3LN5A 4YXLL 1X4ZA 2MOVA 1GC1C 1YDPB 4MQ7B 1WEJL 1YECH 4S10A 3MYJB 4LLVA 2PYEB 3HA0A 1EHXA 1YNLH 1CU4H 1LMKA 4BKLB 3EOTL 4NZDA 3MRRA 3TC9A 5I66A 4H25A 5TQ2H 4Z6AT 3EYQD 3I6GB 2NQCA 4YHIB 3P4OB 4UDUB 5D7IB 4NJ9L 4OBSA 4MS8C 4Y7MA 3NBNA 5F7DA 4TVSa 5DJYA 5T1KA 5LQBH 4M61B 1NC4D 3BEVB 3NZHL 3QEGH 3V0AC 1A3LH 4O58H 1RIVH 1LP9E 4L3CB 3TO4A 4D9RD 3VGHA 1JNLL 3RWHB 4X4XA 5D7KD 4NJAH 1E4XI 2F8OA 1VFAA 3IDGB 2KZWA 2MMXA 3I2CL 3DX9A 5EOCJ 3KPSA 4HUKB 1U8HB 1KEMH 1MHEA 3VXSB 4AEEA 4ELME 4XCNA 3B5TA 4MQTB 1HH6A 3EYVB 1G7JB 3QDMB 3VFUB 5FGCE 3VD3A 4NQSA 1R3JA 1NAML 1OTSD 4JFYA 3GSNH 3L7FB 4KAQL 5LAXB 2DLIA 4OF3A 1ZVHA 1X4YA 4EJ1C 3GBLA 1NPUA 4MNGE 1Z6JT 3SGDH 5KVEH 1RIHL 1H15A 3HPJB 3P4NA 2DQUH 4M8VA 2FD6L 1AXTH 1I8KA 5F9JB 1I9RH 4PGEB 5GGRA 2HP4A 1M4KA 4DK6A 2BNRD 3UTQB 2YZ1A 3L6FA 1DEEB 2BOBA 3AB0B 3AXLA 5FGSA 3HZKB 5HGDB 4UOJA 3HE7C 4OZFH 4X4MA 3LKSB 1TJGH 3VWJA 4PRIA 3HHRB 2YRZA 4Z0BH 1OSZB 3P73B 3PWVA 1QR4A 4D9QD 5HI3D 1P1ZB 1H5BC 4WU7A 2IANA 4H26A 5DURB 4LCWE 3EOAA 3K2UL 2P5ED 2Y72A 5E8OA 1NC2A 4NQXA 4WWKB 5FGBC 5F7LB 1HN1A 3NA9L 1G6RA 2PUQT 1MQ8A 2E9WA 1HE7A 1KB5H 5CJOL 3L7EA 1F4AA 1CFSA 1VKXB 5FM8A 1BLNB 2F53A 1M71B 2HWZH 4FMKA 1C5DB 3EYSH 4EN3B 3VFPB 5ICXA 4P2QB 1V3KA 2G9HB 2GSGB 1GPOL 2ZJSH 1NCCH 1IEBB 5T33H 1IQDB 3WCYA 1U92A 1ZTXH 3HZMB 2EO9A 2PXYA 2YD1A 4I5BB 2X1XR 3F6IA 4X7EC 1T7YA 1XEDA 8CGTA 1CT8A 1FAIL 2D9QB 3QIUA 1LHZA 4X4YA 4KK8C 1A9EA 1B0GB 4C59B 1K3ZA 1Y6KR 2R1YA 4S1SH 4HKZA 4P23B 4I3GA 5E2TL 4F9LA 2FBJL 1FL3B 2BHYA 1NCAL 2R0LH 4U6YA 3BDBA 3U7WL 1BM3L 1TVBB 2DYPD 4GG6E 3GK8L 1JPSH 4JPKH 4HZLA 1GIGH 2C7UA 2PYFB 2RHEA 4YGAB 1HSAA 4FTVA 3O9WD 3GNMH 3M8OH 2LU3A 3AMKA 3T0EE 3GSOA 3MZGB 2IH3A 2ZUQB 3WSQH 3UYPA 5IFAH 3PDGA 4L5FL 4ZTPH 1JGVH 4I48A 4N0YH 1MY5A 3RWFB 1IVLA 2BK8A 1X5ZA 4LRNH 4K7FB 1P7KA 3CXHK 4PRHA 3UBXA 1G7LA 2VLJE 1J8HB 2A6DA 3NCCB 5B4MD 3VD7A 4CDGC 1T2QH 4LSRH 1SVCP 2N4IA 2H26A 2F8VA 4YBLC 2JJWA 4G6AC 3ULUC 4TNWK 5D8JL 5FA4A 2XRAH 1FFPA 5E1HB 4KK9C 5C2BL 4XZUB 1HNGA 1LK2A 3FOLA 3MBEB 4JM4L 3M17A 1NCBL 5ESQA 3WXVL 2HYMA 4XPGH 1N8ZA 4LQFH 5DFVC 4PJ8B 3FQTB 3INUH 3KJ6H 5EU4B 1S3KL 2AEIT 4MA3A 3V0VB 1A6TA 3EJZC 4QHMA 1I85C 1E4WH 4XP1L 1Z0NA 1PY9A 2UVEA 1MHHB 4KKNA 2WAHA 5CEXB 5JMOC 1C8PA 1JI1A 2NLJB 4TNVK 2XKNB 4NO0A 1Q1JH 3ELAT 2VAAA 5I8KL 5IIEB 8FABB 3ARFA 4JPVH 4NN5B 5ESVB 3HNSL 3MV9E 2VDRH 5CD3B 3MREA 3SKNA 4MA1B 1CLZH 3B83A 1DBMH 4AENA 1NMCB 2X7LB 5EU6B 5J1AA 5I2IA 5DD0L 4OLVH 1FFOB 1AHWB 3HNTH 4POUB 3MRLA 4MXQD 5LCVH 5DUMH 4RX4D 2EDBA 1XF5B 2O5YL 4HH9B 3MJ9L 3O2DA 4U33A 2BOCB 5HBBA 4XMKH 3PGCA 5ESAA 4HGKC 1RY7B 3CU1A 2UYLB 2VLRE 4JM2A 3LIZL 2R29H 3QDGA 3SDCC 1KJ3H 1DBJL 4DFHA 3MTRA 5DRZA 2BX5A 4EKXA 3GMPB 4QRRB 5FV1L 2CO6B 3CDFA 1E6OH 3GBML 4Z7QE 5L6YH 4RFNB 2W92A 3V6BR 3FN0L 2Z4QB 4AIOA 1MREH 5GZOC 4PJ9C 1C7SA 4JQXC 5ADOH 3QXAB 1JV5B 3MCG1 1IM9B 4GG8A 1TETL 4NUJA 3T0AA 2EYTA 3NOIA 4P5MA 3L5WA 1YNKH 1F8TL 2GJ6E 5EOQH 4CW1A 4LLDB 4CN6A 5IB2B 2KH2B 1SMOA 4FQIH 3F5WA 2UZIL 3V7AG 1IAKA 5D7LE 5CJ8A 4TUOA 3MR9A 2DKSA 4P4KD 1DQLH 1CVRA 3AREB 5HI5C 4I8DA 1I1RA 2XWTA 4CMHB 2B1HH 2C3HA 4HBCH 3QUYC 4U1LB 2VE6B 1B9ZA 4BSJA 2VLLB 3VFMB 1BFVL 1CTNA 1A9BB 3BRGC 2CIKA 5C3TA 4TUKL 3GSNB 3MLWL 1QSZA 1XGTB 4PJCE 1OAZL 3O0RL 2ARJB 4NFBA 4GBXD 3NMEA 4CGTA 2XZZA 4NQUA 1WISA 4I9WE 2BVEA 4XRCA 1L6ZA 3PJSA 4KRPC 1IE5A 2GCYB 4ZS6C 2IQAA 1U8QB 4LU5L 1ZLWH 1KB9J 1T7VA 3ZT5A 3VDBA 4JFEE 4LF3B 1IILE 35C8H 2X4NA 3HTLX 3DYOA 3D18A 1A2YA 5IGXL 4IRJC 3WBDA 2WSKA 1HHJB 4H8WL 4RZCA 4OZFB 4M1CC 4HUUB 2QHRH 4HIIA 3HFML 5DGRA 4ALAL 4OKVB 3JWOL 3DX6B 1MNUH 1ODAA 2G60H 4PJ5A 1IAOB 1PKQA 4QTIL 4BUGA 5JDSB 3FL7A 1J1XH 2V5RA 2AJVL 3KDMB 3PHOA 4ODBD 4NN7B 1EGJH 1S9XA 3IDJB 3NACL 4QXUL 5GZNC 5IBLC 5C0CA 1WIPA 3B9KA 5EU7C 2HA1A 5GRXG 3NGBB 3KPTA 2DWDA 1DSFH 3LAFA 4JRXA 2EZ0C 2IBGA 5L0QB 4UT7L 1JPST 1N6QH 4Y2DD 1KB5B 3CDCA 3IRPX 3BPLB 1OB1B 2OX5A 4BQCA 2C4FT 3V6FB 4F57L 1UM6L 1VPOH 3BN9D 2NY3D 2J8UA 2FHCA 4L8SB 4PV9B 2OJZL 1Z5LB 2R69H 1IZKA 1LO2L 2OL3A 4O51A 5D6CB 2HTKC 2APBA 5D1XB 1CGVA 5DUPL 1HIML 3QIBC 3K1DA 1CGYA 3G5VB 5DD1H 1HOCB 4GKZB 5ITFB 1NMBH 4KXZI 2HG5B 2KQMA 1WITA 2B2XH 1MCEA 2VDOH 1VA9A 4CAGA 5IR1A 3P0VL 3UC0H 1ZK9A 3KAAA 5CEZD 3T1FB 2XT1B 3D39E 3MROB 3KR3H 1ND0A 2Y1VA 4POYA 4HIXH 1OF2A 2OK0H 3B6SA 4XNMB 4Q9QH 2PO6B 3SKMB 3CMOH 3CX5J 2NY0C 4KQ3H 4HQQL 3S9DB 5F6IC 1G0YR 4ZODA 2IGFH 4K2UL 3HE7A 2DBJA 4P3DB 1S7TB 4OLYL 4Y19B 3AAZA 2IBZY 1AP2A 4ZOAA 1A3RH 1JMXA 3U4EA 4P2RA 2PW1B 1AE6H 2F19H 2BNUA 1S7RA 4WU5A 2V7NB 5C0GA 4BH8A 1H5BA 3MRKB 1VEMA 4P59L 2XOTA 1RJZA 3X11B 1Q9WB 2H2PD 4LVHB 1IKFL 5EFIA 4EI6B 3AGVA 5FGBA 5KSUA 5A3IC 4U1IB 2NXZB 1T1XA 5E6IA 1U41A 4Q6IB 3I6LE 3D2UA 1I1YA 5SV3A 1QPXA 4LQ1A 5C08A 4U7KA 2X4QA 4GRLC 5JDJA 1GOFA 4NHUA 2PTTA 3RZCC 3QHFH 1XR8A 1U8KA 3K1KC 2IPKA 1SQ2N 2EH8H 5I19H 4I18C 1IGIL 3GSQB 2NNAA 4L4TA 1I7RA 1UQSA 1CGWA 1HI6B 1QBMH 5JUEH 3HZVA 4NC1C 2XTJB 1TCRB 3MRFB 4E41D 3GJFA 4HLZG 4PJAE 4IDJL 4FP8L 2IAMD 1YEGH 3MACL 1RZKL 4IHOB 1RV6X 2J6EA 2BSTA 4NZRL 4E5XA 2B20A 3RIFF 3WFCL 5DJAA 5FO7A 1A4KA 4QTHA 3VXPB 1NGYA 1NLDH 1GHFH 3UEZA 3LMJL 3SGKC 4RMWA 4MJ2A 3AY4C 2BVQA 5IMLA 2QSTA 4JFPA 4ODSL 1ADQH 3MA9L 5HHVH 5I76B 3UX9B 2W1NA 4CADA 3SY0B 3GJEB 3ZDXF 1INQB 3O4LA 3FRPG 2VDKL 4ZG1A 3O6LL 4E42B 1D5IL 1TLKA 1P5UA 3BPOB 4DVBA 3P9LA 3HC0B 1NGPL 1E0OB 3KPRD 5GGQH 2A73A 5D4QA 2OTWA 4V1DA 5IQ9A 4WV1C 2W9EL 1JGEA 1AGEA 1T21A 3JTSA 4MLSA 4X6BB 2VR5A 4F9PC 1OP5H 2VH5L 5D7JA 4OJFH 3EKCA 5ID1B 3CFKB 5HVGB 1K6QL 3QHTC 3D9AL 1F58H 5IB4B 2BC4B 4TULH 2APWA 5I75B 1QHOA 5T3ZL 1L7TL 1I85A 2IALB 1UA6L 4LPVA 1UACL 4O2EA 4BFBD 3BPCA 4MWFB 4GMTL 3PF2A 3G5YA 4PJHA 3NCMA 2ADGA 4JANB 1S9KC 2E7LC 5IK3A 1JWUB 1KIUA 2NR6D 3LCYA 3GMNB 5HDQL 3DBXA 3SKUD 5MEPA 3S6CA 3DRQA 3CFDB 4OSUH 4X0KB 3W11D 2RR3A 1LGVA 5C6TH 5E70A 2QSQA 4MDJB 4WUKL 2CDGA 5E00A 5I8OH 4DZ8B 5EZOL 1MFAL 4C54A 1D6EB 1G7HA 4N8VG 2P24B 1GZQA 1XCTB 2NX5B 2XNAA 1ZLSL 5J13C 4MNQE 1T1ZA 1FVCA 4WHCA 4OT1L 4D0DB 1TZIA 4XT1C 4KDTC 4HT1L 3S96B 3P11L 1C5CH 3UTZA 5IW1A 4KUZH 5H35B 5IVXF 4LVOB 3MYJA 1CE1H 1XF2A 4FZ8H 1U6AL 4LCCC 4YK4C 1NLBL 3NFSL 5TH2B 1U8JB 1RQ5A 1LEGA 5KAQG 4UDUA 5IB5B 1CDUA 4JFDD 1MRFL 3T4YB 3MFFB 4PRDA 5AWNH 1F4WH 3K4ZA 2AK1L 4ISVA 1S9YB 3HG1A 4M9PA 3T3PE 4F7EA 1T7WA 2BRRH 3FQNB 5JW4M 1H3XA 4PREB 1BBJB 1MI5D 3HCVB 1NFIB 2VL5A 4S1QH 3GKZA 1VADA 4N9GB 2H1PL 5I1CH 1K4CA 1KCSH 3QUYA 2LQRA 4OZGA 2FR4B 2BSRA 1NBQA 4YR6B 5DLMH 2VQ1B 3V4PL 4C56E 1MFBL 3P40A 1CI5A 1BWWA 1Z3GH 2A0LC 3VXSA 4O2CB 3GRWL 3HLAB 3ZT7A 4OFVA 1G7PA 1Q94A 5J8OA 3PWNA 5BRZA 5F1NA 3G6JA 4RNRB 5EG6C 1BQHB 4ELMB 1INEH 5IQ7L 3KPLB 3K7UA 4P2YA 3L7FA 5FUOH 2A6KB 3CLEL 3MV7E 5LAXA 5KBNC 1YEEL 2YSSB 4LARH 4XPAL 5FGCB 3CK0H 1QBLH 3C08L 5TDPA 2V2XB 4HXAL 1T0NB 4N5ED 4ZUSA 3IFLH 5KTEH 5MERB 3HPJA 1AXSA 5E8EA 3IVKB 4MNGB 5ALBH 3WV0A 2PR4H 2NXYC 4XAKD 1DANT 3E3QC 3O3EB 4OLUH 2FEEI 2I5YL 4IRJA 5DHYA 5CEZH 4U0RC 4L3EE 1PFCA 1UZ8B 2R9HD 4HFUL 5ACMA 4FQXC 2WBWB 3Q5YA 4YXLH 1XZ0A 3K8MA 3KYMB 1G0DA 4M6AA 2J12B 1K9TA 1OT1A 5DA4A 5F1KC 3EOTH 2BHUA 4Y5YC 4WFFD 1GSMA 1JE6A 3D85B 3W5NA 4NJ9H 4D3CH 5GS0L 3KLSA 5ENWA 1Z0MA 1U3JA 5I1DA 4ZUVB 1OGAD 2FJFB 5CZXC 3VCLA 4LCWB 3G08A 1QFUH 2CJUH 5ISZE 2IH1B 2X4UB 3D1MC 1CD1A 1QR1B 2MJWA 1BVZA 3N1PC 3TNMA 1BZ7B 1MHPL 2P8LB 4CVZB 1JVKA 1BD2E 4QGTA 3I2CH 1ZHKB 5GRVL 4J1UA 4C56D 4RFEA 2VQTA 3QIBA 4CDHA 5E8PB 2H6PB 4P2QA 3N1MC 3PV7A 1PSKH 2VLKE 3RPIB 2DICA 2HJFB 4O5LH 1NAMH 3BJLA 4OF6A 4MNHB 3K80A 4PJEE 5DK0B 5A2FA 2MHAB 4NRYA 2FDBP 4J4PD 4OFYA 3SQOL 3ZSTA 5E99L 3HMXA 2HKHL 4EI5B 1QFWL 4TPRH 3A6BL 2NYYD 2YEZA 3ARBC 3F7VA 4Y16C 5ADPH 3RVWD 2AJXH 1KEGL 1H8SA 1FN4A 5CBAB 2WLZA 3MV11 1RUML 3OKOB 2PCPA 1ZV5A 3PP3H 4Q7DA 3MYZA 1MWAL 2NY6D 5CSZA 4LLUB 2B7DT 3F7YA 2A6IB 2JJSC 3CVHA 4NPYA 1DBAH 3PGDA 3RTQC 3GGWB 3BE1L 2Q7YB 2D03L 4HIHB 3FO9A 1AI1H 4P99A 5CS7A 2A6JA 2OJEB 4F7PA 3QEHA 2OLDA 3OKDA 5DTFA 1U8OA 4PB9L 3MLYL 3OR6B 1J8HA 3FT4B 4NQDE 1MUJA 1WAAA 1J05B 4J3OC 2DTML 4S0TD 1YC7A 4EDXA 5CEYB 1IRAY 1YQ2A 2JK5B 4JPWL 5E8NA 2Q6WA 1Z9SA 1AGFB 4FRWA 1F2QA 2EH7L 3NA9H 3HUJF 5EZIH 4XNUH 2AJUL 3MBEA 4K3DL 2I60L 4RDQG 3LRGA 2ZSWA 3KLHC 1EEQA 12E8L 2I27N 1KIRA 1IAII 4I18A 2D7QA 3U36B 5EU4A 5DVKA 2ESVA 5F96H 5DD3L 3DVNA 4KROD 2CO7B 2VN7A 4TQEL 4NSKB 1YEFL 5IVOA 4P4KB 1DANU 3FZUC 1Z2KA 2P4AB 4LLQA 4ZXBC 1TMCB 5F72S 5T1LD 2EDYA 3SDXF 3DGGB 2F58L 2X6MA 3DYPA 1I8IB 3CPLA 5ILTL 3PWJA 5EORH 3E6HB 2X7LA 3IYLW 4M00A 3MV9B 5D2NB 4EUPH 2P5WE 1D9KC 3QPQC 5DSCB 5DO2D 5CP3A 4NYLB 3SGKA 4K71C 3CLFL 4GBXB 3TZVD 3U7WH 3GIZL 2YPLA 3GB7B 3GK8H 3MJGX 3ROOB 2BOCA 3BMVA 4NNXB 2GSIA 3ULSA 3P30L 5FK9A 3HS0B 1JTOA 1FH5L 2D4FA 1KG0B 2JTDA 4O4YH 5GGTH 4MD4B 5E5MB 1J5OH 3RWCA 3V6OC 4WV1A 1MCLA 5C0NC 3V7AE 3L5HA 4G8GD 4XPBH 1N3NB 2Z4QA 4HWBH 1MCDA 3RGVC 4PS4H 3Q48A 4F9PA 5GGVY 4YXHL 5HYJE 1P4LB 5GRWA 4ZAKB 2MKWA 4DCQA 1BAFH 4GKSA 1AJ7H 3T1WA 1NSNH 5C2BH 5T3ZE 1NCBH 1WICA 3RZWA 1XF4B 3MRCB 3OGOE 5IB2A 4GRWF 2MPAL 3CXHJ 3EO9L 1ZT4A 5A2IH 4KDWA 4Y2DB 2GJ6B 2OR8A 2FX9H 3PWLA 2OMBA 3WD5L 1EAPB 2VWEC 4P57A 4WEUD 4J8RB 4OAWA 1AFVH 4KTDH 5D7LB 2E7LA 2NY3B 2YBRA 5IJVB 2Y7QA 1ZS8A 2BJML 4AM0A 1RU9H 3DECA 4GSDH 2DDQL 3BWUC 5FGRA 2HVKB 3QJHB 1XGTA 3HNSH 4FXKB 1A7RH 1MEXL 1DDHB 5EBLB 2HT3C 5DRWB 4FQCL 3BSZL 1NCTA 4F7MB 4U4BA 5E7BA 4QEGA 1RJLA 1P2CA 2DI7A 3OJDA 4RWYH 4HCRL 1G9ML 3NFNB 4G7YL 3ZTJG 5GRVK 4LF3A 4G6KL 3PXJA 1VACA 4Z7VA 3LKQB 3WN5A 4KDTA 4GLRH 5HGBB 3X14B 4LVEA 4XB7A 3FO1B 4UTAL 3LIZH 1DBJH 1LEIA 5IHZB 5K9OA 3QUZC 3X3FL 2BMKB 4XWOD 3O11A 4LDLB 2EXYC 4Q6YA 2CLVB 3DX6A 4H5SA 3OKEB 1CN4A 4LCCA 3B8SA 4NO3B 1NGXB 3IXTA 5BJTB 4XAWL 1ZSDA 4KTEL 1U36A 3H7LA 2OQJB 2K7QA 3RU8H 4NFCA 3MUGA 3BP7A 4X6DA 1QQDB 2VDQL 4XNZB 5AYUL 1YUHB 1TETH 4WI6A 4DEPC 4OF5A 5JR1L 4OCLC 3DO7B 4XCCL 5IVZA 3C2AL 3C6SB 1YMMA 1G84A 3H9HA 2UZIH 3QZWG 1FYHB 1QEWB 4M5YH 4PV9A 1U8LA 1EVUA 2YD2A 1Z5LA 5D6CA 2NY1D 4NZTH 4AMKL 3TO2B 2ITDB 1XT5A 4PGCA 1QACA 4NCC2 4Y1AD 4OCSH 1NANI 2VITA 4L4VE 1BFVH 3RI5F 5CJQH 5DDHA 3G5VA 1NAMB 3PL6D 5JHLH 3IFOA 3MLWH 2ZP0T 4WDIB 3TBYA 4EOWH 1BQLL 2XY2A 4JO1L 5E94B 4YHNB 4OV5A 4RBPK 1DFBL 2DLHA 2WIIB 1F6LL 3O0RH 2E7MA 2M8XA 2EEDA 3T77B 4DN3H 1MJ8H 2X1OA 3I75A 4HX1A 4OF8A 3OQ3B 3WFHB 2Y36L 3P0YH 2H9GA 5AZEL 1A5FH 4RCAA 1MIML 1OOAA 5HDBE 3WO3B 1SMAA 4LU5H 3EFFA 3FMGL 2LTQC 3MXVH 5FAAA 2X4PB 4P5TB 2YRPA 3MLZH 5I6XB 3ARGC 4M8QB 1A6ZB 5J9PA 4P2OD 3GMRB 4FQXA 5KSBE 5IGXH 5F89B 5I1JL 1I8MA 4NT6B 1Q9OA 2AXFB 1SJEA 4H8WH 4M7JH 2ICWB 3C60D 4ALAH 1PG7W 5C9KA 3G6AA 3QDHA 5MENE 2XA8H 4YUEH 4NIKB 3T0EC 1ZEAL 2PW1A 1CGSH 3TCXA 1OP5K 4Y5YA 3PG2A 2V7NA 1GJIA 1NEUA 4MQXC 2AJVH 3NACH 4QXUH 2ZOKB 4Z7UA 5C09E 4X5WA 5CJ5A 3REVB 2SEBB 3UTPE 4Q6IA 4HIEB 4HXBL 5HHXL 4ZDHA 1ORSA 5BS0A 1T0MA 4PJFE 1IT9L 4QXTA 1IGYA 3ZHKA 3QQ9D 3OL2A 4TSCL 5T1MB 3QCTH 2DKUA 2OCFD 3BOVA 1YPZE 2EIBA 3G5ZA 2D0GA 1EDQA 1A6PA 4N8CL 2DIJA 4ZFFB 2YUXA 1HIMH 4U1NB 4LKCA 1TCRA 1K8IA 2HH0L 3OTTA 5D1QD 5T3XD 3G5XA 3MJ7A 5IMMA 2DQEH 4M1DH 3R1GH 5I1GH 1CICC 3TVMB 2X4TA 5I1AA 4NQTA 5FYKD 5KVDH 5E0QA 1RZIB 3MLRL 2CGRL 4KKCD 4EUPB 3P0VH 1JGUL 2JB6B 1G7IA 2JF1A 3IDIA 3D87B 4OZ4A 4Y16A 5K33A 4GXUN 3QPXH 4N90D 3MO1A 1WC7B 1W8NA 4JGMA 4R96B 1PZ5A 2Q7NA 1A7NH 4P48A 5GRJL 3LS5L 1J0JA 1OM3L 2WIMA 3KPPB 1FQ9C 3E2HB 4P4RA 2C26A 1NQBA 3RTQA 4OLYH 4NWTL 5C0AD 4JFXB 2UUDK 3OAZK 4LLYB 1UB5A 2YPVL 3FQXA 4PJDA 4OIBA 1HILA 4MYWB 4NBYB 4APQD 3KYNA 3DX7A 4WGWB 4OUUB 4RA0C 3PWPD 1FNGB 1KTLA 4NKOA 5DYOB 2BFVL 3VXOA 4RGND 3EHBD 3GHEL 3AU1B 4JFDB 5ICYB 4I4WB 4TOYL 2XTLA 3S35L 4JM2F 1N6UA 2VYRE 1WCBA 3QISA 2CDEA 2BSED 4EEEA 2YC1A 1FJ1A 4MWFA 2HFGL 4NBXB 5D2LA 2R0KH 4WY7L 4KV5F 3DUUA 1T20A 1JYVA 4ORGB 3MNVA 3B2UD 5J0BA 1PX3A 3IDMB 1UADC 2W60A 2WUBL 3LDBB 4LEOB 3LPWA 5FYJU 3EZJB 5A1AA 1F90L 2FX7L 1RZKH 3MACH 1T66D 1A4JB 4HWEH 1FNSH 2V2TA 4DW2L 1D9KA 3RY6C 5SWQB 5DJCA 4CBPA 1WGOA 1JZ5A 2H2SC 1TITA 2FX8H 4DGIL 3FFDB 1BBDL 4ZOBA 3QG7L 4U3XA 4AEIH 5JW5A 3TT1L 1N59A 5D6DA 4M02A 4XNXL 2P24A 1KSRA 3NIFF 1X5YA 4ODSH 4LCIL 3VGFA 4NNYA 1DN2A 3MA9H 5I74B 3SPVB 1RZGB 5JXEA 3S98A 4Z0XB 4HGWB 1CZ8L 4MSWB 4WEBL 4G9FA 2VDKH 3V6OA 5F7HA 1R3IL 3O6LH 1V5JA 4L8CB 3PHQA 2EYRB 1NFDA 2XZCH 5HYFA 5C7XH 5LWYH 3VXUD 3VW3H 1QSEE 2W9EH 3SDXE 4U2YA 1AQDB 2AW2A 3ALPA 1AY1H 4NQCD 1FLRH 3T4YA 3H0TB 4H1LG 1HXMB 3LQMA 4KTYA 3R0MA 4QHUB 4OCMC 4W6WB 5KZCD 3SDDD 3JUYA 3K4DA 4NRZA 5GGSB 4N0CD 3LKRA 1EXUA 3Q6FB 4G80A 4X4ZA 3V5HA 3WNNA 3MLPA 5T3ZH 1LP9A 4YQXH 5TF1L 3JUZA 2XN9D 2JJTC 4YR6A 4UILL 3UJJL 5ERWB 3ECBB 1QA9B 3E0GA 4GMTH 4GMSL 4PRPD 1A6WH 4Z76B 3OPZL 4C56B 1XGQA 5CIPA 3RY5A 3ZKMC 3BP5B 1KJVB 4ELMA 4C58B 4QT5B 3O3BA 4RMRA 3I50L 3TIDA 2HN7A 4HEME 1J1OH 1N6VA 4JFQA 4AIZB 3IKKA 3S4SA 3UDWC 4FN0A 1OAYL 3L3GB 4KY1L 4BSVA 1T0NA 1T1YB 3DHMA 3PP3K 5C2UB 4PFEA 3MRMB 4KGJA 3IVKA 1S9WB 4MNGA 4YZFF 5EZOH 4GRWE 4ZUWB 2J8UF 4L8DB 3PNWB 2OXGA 4RMVA 5CZVH 3QUZA 4LRIC 4J3SA 4OT1H 2PETA 1XR9B 1C16A 3LEYL 1AKJD 4NGHL 3ZDZF 4L3EB 4RWHA 2GUOB 5LGJA 5GSRB 4MXWH 3U30C 4FG6D 4S0SD 2X4OA 3TBVA 1ACZA 1GC1L 4YDIL 3THML 3F8UB 2LU4A 4E0RB 4J3WA 3NFSH 2IQ9L 1JPGA 4MB4A 4XNQB 3U7YH 1IQWH 1IC1A 2ENSA 4MLIA 4ORZC 1MRFH 2ZSVA 2EDFA 3SGDI 4QRTA 3ESVF 3KNBB 2FJFA 3UAJC 2Q3ZA 4LCWA 5HTSA 4OD1L 5FYLD 2X4UA 3RIAK 3RVTC 1QR1A 4R8WL 5ISZB 4XP4H 2YKLL 2P8LA 1Q0YL 2X70B 1RK0A 5EIQA 3C6LD 1VEPA 4WHYH 1MFBH 4NOFA 5E8PA 2VISB 1MJ7H 2AXGB 3TFKD 3GRWH 3UTTD 1NEZG 3D0LB 2AQ2A 4JFOA 1KBGL 1FPTH 4R26H 3RPIA 1S7SA 4LSVH 1DN0A 3HPLA 4JFZH 3L95B 4XGZA 4KROB 4DZBB 2IF7A 3QUXD 4U1GB 1JL8A 2H41A 5DK0A 3V8OA 5GGUA 3O6ML 4Y5VC 1XF3A 2E9IA 1QLEL 4PJEB 5T1LB 1YZZA 5T3XH 4ONGL 4GOSA 1Q9LA 1IGCH 3ARGA 3L3KA 3JV4B 1D6VH 2I5YH 2JIXA 2YHGA 1EEZA 2FGZA 3EZ8A 3ORJA 2IG2L 4XCFL 1SBSH 3OKOA 5GHWH 4GG6A 4KHXL 1RZFL 5HHMD 3X3GL 3TZVB 1NGWA 4S1RL 3IT8D 1PEZA 1QOKA 4LLUA 3TBTA 1IJ9A 2Z35A 3T0EA 1BJ8A 2AI0L 5I71B 2ZOLB 3S88L 1MCCA 5FO9B 1HZHH 3TJEL 2OJEA 4NRXB 4BFIB 3WNKA 3BKJL 1YN7B 2G5RA 1J05A 4W70A 2IANE 4JRYE 2VLJA 4NP4H 1BVKB 4NQDB 1F00I 5K93A 5T1KD 3CZJA 4D8PA 3O41B 2JK5A 5GS0H 5L9DL 3MUZ1 2YS4A 1UG9A 1FP5A 5BZWA 2CUMA 3TO4D 4EIZC 3FTGA 3BWAB 3NAAL 2AEQL 2Y06L 4MVBC 3DURA 2OM5A 1JN6B 3KPSD 1MHPH 2ZNWA 4WFEE 3QULB 4R3SA 1JHKL 1MFCL 3TYFB 2C3WA 4PTUA 3JVGA 4I3SL 1QO3A 3AFLA 5HHQB 4NSKA 3VFGL 1RJYB 2J3SA 4MCYA 3LD8B 3ULUF 5DD5H 1CICA 4UNUA 3Q6GL 4X6EB 3DGGA 1I1FB 5FDWA 3IS0X 3DV6A 1DLFL 3BQUB 1W2KT 2QKIB 5KSVB 5MHSD 3MV9A 1HQRB 5BQ7B 5I30L 4LSPL 2G5BB 5DSCA 1SJHB 3VI3F 4X7TA 4CVUA 3MLTB 3DETD 4ZPTA 4M43L 3GB7A 5KVGH 2Q8AL 3U2SA 4HJ0D 3ROOA 3U46B 4CU7A 1NFKA 3MNWA 1CXFA 4FQ2L 4XVJL 4NNXA 5CINL 4BK4A 4CRPA 5IHUL 1KNOA 4YDJA 3O6FC 3HS0A 1RUMH 2DQCH 4KJPD 4UV4H 1FL6A 3FRUB 4K3GA 5C86A 5J57B 3VWJD 1MWAH 1KGCE 1P4BH 1UCTA 4PRID 1OAUL 3AUVA 1KENH 3FFCE 3U83A 4MAYB 1EEYB 4PJHF 3BE1H 1R5IA 2D03H 2VLRA 4V2CB 1NCUA 1I7UB 1IAIM 2O61B 3UTSE 3OB8A 2R0ZL 4U1KB 1DVFB 2CMRH 1N0XL 2VIRB 4K94C 3T2OA 2CKBL 2RFXA 1NC2D 4Q0XH 4ZAKA 2BP3A 3T08A 4WHTB 3ULUL 1J11A 1FL5A 3IGAA 3HRZA 5HYJB 1S78C 3IU4L 3DPBA 3MODL 1R5WB 9CGTA 4YHPB 3WEXB 1FIGL 3NCYS 1R24A 1XF4A 4R6UA 3VI4E 1RZJL 3FO2B 3BX7C 3QFDB 1Y0LB 2F53D 4JDVB 1JIBA 2W0FB 4XXDB 4KI1A 5H2BB 2GJ6A 4ODWB 3T09A 4PRNB 3VFNA 1KLUB 1TQCB 1LDPH 4FFWC 5FHBL 4J8RA 3WDHA 3ZKXC 4ZUTA 4IS6B 5IB1B 5D7LA 1W72A 4PYHA 1D5BA 4JY4A 1YEFH 3EYOB 3HAEA 4LSTH 2NZ9D 2V17L 2NY1B 4LCUB 3QIUD 4O9HH 5F70A 4C57C 4NWUL 2HVKA 3MRBA 3QJHA 4OCXH 5JW4R 2GI7A 5IHLB 3SDYL 5MP6L 1G0XA 1JFQL 3J8F7 1MVUA 4PJCA 4IDLA 3SEPA 2A74B 1BFTA 2LU7A 5C1MB 4AH2A 4JQVC 5TDOA 2A38A 2P7TB 3QWQB 3CSYA 4FFZL 5FYJD 5F88A 4FTVD 4D0CB 1JPFB 2Z92A 4UDTA 3FQWA 1I4FB 1DL7L 5HGBA 1FH5H 4OZGF 1KCVL 3CFCH 5ID0A 4JFEA 1MRCH 3QR2A 4UINL 2ZCHL 4JDTH 3NZ8A 4NKDB 4I13B 3HR5B 5J11B 1ZOXA 5T5NF 1T04B 3JWOC 4PRHD 3SBWC 3ZSSA 3NH7L 3BGFB 3OB0K 1ACYH 3C60B 2AJZA 4NDMB 5DJ6B 3ARPA 3QSKB 1UZ6F 4Z5RB 4QYOB 1GGUA 5KSAC 1JYXA 3BZ4B 1EEUA 3B9VA 3CC5B 3LKOA 3T3ME 1QQDA 4JY5L 5D1ZC 3VXRE 2CR3A 1K2DA 2ICEB 2GEEA 4HK0A 4YDKL 3KXFE 3NABH 1XGYL 2Y6SD 3RPKA 5K9JL 1MCHA 1XIWC 3L3IB 4PY7B 3KPMB 4U6TA 2DLGA 3JWDC 4ZYKB 1K85A 2ADJA 4LNVA 4R2GC 1VGEL 1QEWA 2OR9L 3NIFE 4W6YB 5TGBB 4WW2C 1NBZA 3WUWB 1RUPH 3DI2B 2JJTA 3EJJX 3W5MA 5L2JB 5FYLH 2R56L 4OD2A 1ETZA 1TZHA 4NO0D 2JLLA 5HGAB 3G04B 3C5ZC 4QF1B 3QBTB 3SCMB 3ARFD 2AEPH 4PJIE 4UU9B 1NAMA 4LAJH 5GIRA 3QI9C 2DDQH 2JKXA 3VH8G 4WDIA 4WO4B 2DL2A 3BGMB 4M62L 4L4VB 2I07A 4NN7C 3WFDL 3QJFA 4S1DD 5CHNB 4YWGL 4AL8L 1LO4L 2WBJC 3BSZH 2VXTL 2W65B 4R90L 2MCPL 5D5ME 3WFHA 5EBMA 5A43C 2B5IB 4JO3H 1GGIH 3NVQA 1DBBH 5FXCH 3L1OH 4HCRH 1CXIA 4XHJC 4TRPL 5D7SH 2AV7A 5EOCL 3D39A 1CFQA 4P5TA 1A14L 4G6KH 5DWUL 5B38B 4JM2D 4XI5D 4LRIA 3QDGD 7FABL 4MMZC 3EIFA 3QXDA 3VFWB 1MQKH 1UYWL 4RSVA 2OI9C 4GRWH 1L6XA 4XH2A 4ODUB 2ZZUT 5D71L 3H7BB 4YPJA 5IESH 2DM3A 4WJ5B 3RDTC 4IJ3B 5C0AB 4XAWH 5MENB 5L8KB 5IWLA 5KG9B 3S35X 4G42B 1MSPA 1IC7H 2BY2A 3H9SE 1LNUB 1HYSD 5TQ0H 1UXSA 1AR1D 4JRXE 4KJWD 1LE5B 4NNPL 2YR3A 5EZJB 4JB9L 3QCVH 3N85H 2DBLH 3VWKB 4APQB 3LN4B 5C09B 4HIJB 2QTEA 3DXAE 4UTBL 4Z7NF 4U0QB 3PWPB 4XCCH 4Z78A 3C2AH 2BCKB 4M7ZC 4MJ4A 2YMXL 3V5DB 3WL9B 3MBXL 4RGNB 4XHQA 4PJFB 5I15L 3TP4A 1ZGLA 3RUGE 2WQ8A 4PTTB 3TN0B 4JAMB 1RAMA 4KRNA 4MDIA 2EEBA 3STLB 4AMKH 2X2YA 1I1AB 5B3JF 5JW3H 2WMPA 4ZFFA 5B39A 5INDA 3NCYP 5IT2H 1IL1B 1WAAF 1JUFA 4KPHL 2O5ZL 1JK8A 1WBYA 1DFBH 2EDRA 1T1WA 5ELIA 4Q74A 3KWWB 1M7IA 4PJAA 1RZIA 5EDXA 4EUPA 2OTUB 1U8NB 2HRLA 5AZEH 3TBSB 1MIMH 2YOCA 3VG0H 3IAGC 1HCFX 1NGZB 4S2SA 1NCDH 1OAXL 2QADC 4OFIA 3QNZA 4AEFA 1CDHA 1QSFA 4KVCL 3H6JA 1CD8A 1PZUB 3BD3A 4MCZB 4C4KO 4H0IA 1E6JH 2WBKA 1KJ2L 4CVWA 1MWAB 4PJ5D 3DMMC 2EEAA 5BV7C 3UP1A 1ZT1B 1ONQA 4AT6A 3IFNH 3MRJB 1ZEAH 3MJ8A 5F9WC 5C0CD 3WO4B 1MAMH 3B9KD 5HPMA 4MS8D 4XWGH 1SEBB 5LBSH 1N5AB 1SY6L 3VRLE 1QLFB 3EGSB 3RIFK 5T5FL 1NAKL 1DUYA 1VGKA 5B21A 2QR0A 4QY8B 1H0DB 1A47A 2EDKA 2ZG3A 3AU1A 4NQCB 3V4VL 1FVDB 1DQTA 4I4WA 4YDLC 4F37F 5ICYA 3QUML 1KPUB 4PLJC 5CUSH 3P3YA 4NZUH 3KHQA 2AEWA 5DJ2A 1AD0B 3ZL4L 1G6RH 3V9FA 5TE4H 4OCYL 2NY2D 3FO0H 3IDYC 3SDDB 1R3KA 4XMPL 3IU3A 3U1SL 4JFHD 1FZJA 3DLQR 1UKTA 3HC3H 1S5HB 2FO4B 4N8CH 2X4SB 1QLRA 4M6OL 5DZOA 1FZOB 5CMAA 2XN9B 3TT3L 2EKSB 5BMFL 1F45A 3R0NA 3PIQA 1CLYL 1J9CT 2CK0L 4HWUA 1C5BL 4PRPB 4ETQA 3M1BB 3U9PL 2LV4A 1DCLA 2KBGA 1RK1B 1UEYA 3FFDA 1F11B 3P4MB 4D2NA 5ALCH 1WFOA 3MJ9A 2KPNA 1KLGB 2F54E 3RL1A 5KS9E 1F3DH 3O6FA 1J1PL 3HUJB 3HE7D 4NOBA 1NBYB 5GRJH 2GK0A 4ZTOH 1OM3H 2CRYA 4XVSL 1BJ1H 3BKYH 2H45A 2G75B 4G8FB 2ORBH 5FYJH 3O2VL 1OW0C 3L3DB 4NWTH 4P2RD 3BH8A 3O4LE 5EU3B 4JZJC 4MNQA 4HF5L 3UTOA 2DWEA 4N68A 2IFFL 3Q1SL 2DM2A 1CDIA 1QHPA 5AD0B 4V1DE 4GUPA 4QRQA 4ZQKB 5CILH 3ULUE 4HKJB 3TBWA 2DD8L 5E6ID 3TIEA 2FCBA 1A22B 1MHCB 3U82B 4YH6A 3QA3A 2UY6A 1QSEB 5C08D 3SDXB 4BSWB 5J1SC 3SO5A 1IFHL 3MRDA 1NL0H 1ZLVK 3VI3E 3MOAH 2D7NA 3GHEH 4QHUA 2C3VB 2A77L 2PW2B 4Z7VF 2BVOA 5C0RL 3EYFA 2XG5A 4QHNA 1U91B 4HJGA 3JV5A 4OM0L 1HQ4A 3Q5TA 3QEQA 4L4TD 4HMEA 3Q2CA 4JHAH 3S5LG 1QPPA 2XXCB 4JDZB 4CUCA 4Q9RH 2OMNA 4LCYB 3ECBA 4BK5A 4Z7OF 4WY7H 2WQRA 4NM8L 3CZFB 1PDKA 4HFWA 4CVXA 1Q9KA 1OGTB 3KPQB 3MUY1 1KJVA 4OIAA 4UIMB 4X6DF 5SX4H 2WUBH 4QT5A 3CDGA 3O8XD 1F90H 1ZT7A 2FX7H 3K74B 2V7HB 2NPLX 4AIZA 5SWZE 5DD6B 2KKQA 2VSCA 4OB5L 3ILQC 3FT2B 3MV7A 3QUXB 1C08B 2YXFA 5C9JA 1BBDH 1JGDB 4LP5A 1S9WA 5I1IH 5D96B 4LOUC 5DJZA 5DQJA 1BIIA 3ZTNL 4ZFZB 4FQ1L 4L8DA 4G9DA 5AG9A 3PHSA 3PNWA 2NZIA 3QO0B 2ID5A 1MPAH 3WNMA 4GRWB 5TE6L 4XBGB 1OSPH 1GVIA 3QIWB 3ULVL 2A1WL 4JJHA 2DMCA 4WEBH 4L3EA 2J4WL 2PTUA 3T4AB 1HHIB 1H3VA 1U58B 3LN5B 5HHMB 4HG4K 4V1DD 2B1AH 1AO7E 4BZ1L 5KSAA 3BUTA 4LBEA 1TTUA 4LLVB 1FV1A 3A6CL 3WHE0 4E0RA 5JQHC 2OZ4L 3FAWA 4A6YL 5D1ZA 3L3HA 3MRRB 2RCSL 1IGML 3QCUH 5SX5H 5D7JD 2Q86A 4UB0H 4H25B 5HI4D 5HYSG 4J23A 1D5ZB 5I8EA 1XIWA 2OTPA 2NTSP 4O02L 3VGBA 1RJCA 3HG1E 3OKMB 5DFVD 4P0DA 3VFSA 3HMWL 3RKPA 5F7DB 5DJYB 4UT6H 4IOIA 4WW2A 3EJZD 5ISZA 3RAJL 4YXKH 4YHYB 1UC6A 1RZ7L 1QKZL 4ETYA 1QD0A 4X4XB 3WFBL 1F4YL 3C5ZA 2FJGA 3LH2H 1VFAB 5F7NC 2MTPA 4ZOEA 3UJJH 1PAMA 3O9WC 3DX9B 4XC3L 2VISA 3KPSB 1L7IL 1BD2A 1WIUA 1EO8H 1QSVA 2YUVA 3D0LA 3QI9A 5DQDL 3ZKND 4GMSH 4M5ZH 4UNVA 1MHEB 2VB5A 25C8H 3G6JE 3OPZH 1KELL 4XCNB 1DTUA 3LEXA 4ZO9A 1HH6B 2WBJA 3L95A 1UZ6E 4Z7UF 2UY7A 1FZMA 5JIKA 2VLKA 2VDNH 1NCWL 3I50H 3U48A 1CF8L 4NQSB 1R3JB 4X7SL 1TVHA 3TA3C 4JFYB 3DI3B 4KY1H 4PJEA 2KZ1B 1N4XL 4HS6B 1ZLUH 1EO7A 4P46A 3BKCL 3R8BB 1H15B 3P4NB 2VC2L 4B7LA 4GAGH 1I8KB 1A1MA 2F5AL 4K7PL 1R0AH 4NHCL 5KVFL 1Z9OA 3FB8A 5GGRB 1P53A 5M7QA 3L6FB 3LEYH 5I8CA 2BOBB 4NGHH 3X12A 3AXLB 2ZOLA 3RDTA 3DUSA 2VXQL 3VWJB 4YDIH 2HFFB 5EU7E 4PRIB 3EDDA 3OXRA 4JREB 5EU5A 3THMH 2ICWJ 3PGFL 3UJTL 4L29B 4WU7B 2VLMD 2IANB 4H26B 4FQHA 2RBLA 4KJQD 3EOAB 1FORL 5E8OB 1FBIH 4M6NL 2CRIA 4NQXB 4U1HB 5HGHA 1G6RB 4R8WH 1P5VA 1CFNA 4M7LH 3N9GL 3QUYD 1MIEH 3L7EB 4MXQC 1CFSB 1ZHNA 3VXSD 3H3PH 1Q72L 2F53B 3TYFA 2ICWI 2X42A 3C9NA 4PJDF 5BRZD 3FOMA 3WS6C 5HHQA 4ZO7A 2OL3H 1CXEA 4JKPL 3D3VA 4QXWA 5F6HJ 3PP4H 3F58L 5DJ8A 3NIGF 4OCRL 4ZPVA 5E9DE 4KRPD 1U92B 5DF0A 3RWEA 1OARL 4ZS6D 2PXYB 1NMAL 3BQUA 3W82A 4AQ1B 1CT8B 3QIUB 1CR9L 1RUAL 4X4YB 5E56A 5JOEA 1LQSR 1SJHA 3HI6H 3OG4B 2R1YB 4ONGH 4QRSA 4HKZB 3CJJA 5F7UA 5KJRH 1A7QL 1X5GA 4IRJD 2P5WA 5K9QI 3O3DA 3CX2A 4HZLB 1MRDL 2C7UB 2IG2H 2R39A 3DMMA 4XCFH 5C07E 1FNAA 1FNEA 1HSAB 3FRUA 3DSFH 3KPNA 3QNXB 5F6HI 1TNMA 2PN5A 3GSOB 5D2LF 1TVDA 1CG9A 4G6MH 1WBXA 1LE9A 2EDLA 3AM8A 4X8JA 5IBLD 3VD5A 3TJEH 2Z91A 4I48B 4L8BB 4LIQL 1ZXQA 2J5LB 2AK4E 5DURD 4U1KA 2EZ0D 4BA8A 1DVFA 5A2KH 4EIGB 1P7KB 3UBXB 1G7LB 1HKLL 3DV4B 2A6DB 4HUVA 5L8LB 2GK2A 4MJIE 2DB8A 1MJUL 1KOAA 2H26B 2VDML 1H3TA 3WNLA 4YDVA 1KN4L 5C6WH 5J7CC 1R5WA 2GQHA 5FA4B 1FFPB 2P48B 3SN6N 1NDGA 2XY1A 5F71A 3FOLB 5FIEA 4BELD 2Y06H 2B4CL 2HTKD 3M17B 5C0FA 1I75A 5ESQB 1EHNA 5H2BA 1JF1A 4TVPD 3QIBD 1N8ZB 1OAQL 3CCHA 4P2QD 1T03L 3EDJA 1MFCH 1KLUA 2Z31C 2FWOA 4NC1E 2Z8SA 3LQAC 2R23A 4YFDB 5IB1A 5EC2A 4MA3B 1FGVL 1NFDF 4QHMB 4OQTA 4EBQH 1JZ3A 5C0IA 2EIEA 3ARDC 5FOBB 1I3UA 5JW4Q 4NO0B 3Q6GH 3MRQB 1J8KA 3D6GA 3BRDA 1BOGA 2VAAB 3ARFB 4MXVF 1RZ8B 3GJFH 4LSSL 5F3BB 3MREB 3SKNB 4AENB 5J1AB 5I2IB 3MNZA 1U93B 2J6EH 1TCMA 4JN1H 1VB9A 3MRLB 4M43H 3GSVA 5JOPE 2A9NL 1LP9F 4XVJH 1JZ4A 4GQ9L 5IHUH 2WUCL 1V7NH 1GGCH 1BOYA 1OW0A 2EKJA 5EUKA 1HWHB 2VZVA 4JZJA 5ESAB 5DRXB 3IF1A 4NQVA 2P46B 3VRIA 4XNYL 4JM2B 3QDGB 4X80H 1T04A 3PQYE 2E27H 5DRZB 3ARQA 3LEVL 5DK2B 1J8HD 2R2CA 5B8CC 4KMTH 4ELMF 2ZCLL 4JKLA 5EC1A 5A3ID 2R0ZH 4QYOA 1L4IA 4LVNC 2DQIH 1U3HC 4EXKA 1KT2B 4J6RL 1VSCA 4K3JL 3ULUH 3MBED 5GPRA 1E4KA 4U6VH 4Q2ZA 3WKML 4Z9KB 4XPTL 3IU4H 5CAYB 2XZQL 4GG8B 1A7OL 4NUJB 4RGMB 4YHZL 2EYTB 3KPMA 4P5MB 1UWXH 3L5WB 5HHOE 1J88A 2ESVD 2W0KA 4CW1B 3WLWC 3RWIA 4GLRI 5EO1B 3F5WB 3TPUA 1BECA 1F5WA 5SWSE 2BNRA 3MV8E 4OGXL 1PLGH 1UT9A 5FHBH 4TUOB 3MR9B 1I9JL 4I2XE 2XWTB 1V8HA 5DMYA 2CPCA 5CCKL 5F7KC 1T6WA 1JNNH 2V17H 4JFFE 1GGBL 1EMTH 2CIKB 2VAJA 4PG2C 5GSVA 2YD4A 3VE0A 1RUQH 3I9GL 2DQDH 4D0BB 3ISWA 1AR2A 5F9OH 4K9EC 5D72H 5L2KE 3U0WH 2YPLD 1EZVY 2P5EA 4XRCB 3PJSB 3DIFA 1JMZA 2Y23A 1RMFH 2IQAB 3ULVE 4UUJB 3MGOA 4LHUG 4NQEE 1IM3B 4M1GH 3BAEH 2EDOA 3QG6B 2X4NB 3D18B 1N0LA 3VFWA 1A2YB 1FE8L 1K5NA 1XCQA 2ZCHH 3TJHC 5HJ3A 2Y9RT 4JVUA 5I73C 3FB6A 5EZLA 1JHLH 5KSBA 4QRPE 4RZCB 1X5LA 1TPXC 4HIIB 5F7FA 3RI5K 1YEIL 3P0GB 4WJ5A 4PJ5B 1PKQB 2VABA 1JRHI 5MENA 5KG9A 4G42A 1S5IL 4X6DE 5F7YC 3TCLA 3KLDA 4WNQA 4F8QA 3GKWH 4XBEL 1BFOA 1DZBA 1S9XB 2XQBH 2GJZB 4G43A 4JY5H 3OG6B 3ALXA 2IAMC 5HVHC 3CIQA 4YDKH 1J86A 2DWDB 5C09A 4JRXB 2C1OA 5JOFA 3ZMRA 1GH7A 4QOKE 4GG6F 3R4DA 4YHLH 3GI8L 1E4XH 4PJFA 3LHPL 2GITA 3TPKA 5JXAH 2D7PA 4PTTA 2J8UB 4HAGA 2R56H 3MA7A 1I1AA 4O51B 2OL3B 3CGTA 4N1CA 2VXSL 1YPZA 1CE6A 5DEZA 4G6JH 4G8IA 5DVOA 3WFDH 3TA3A 5IFJA 1LO4H 1CS6A 3KWWA 3WFEL 2OTUA 3B9DA 2MCPH 1MLCA 1CVSC 5IR1B 3NN8A 1VEOA 3AS0A 1MJJA 2EYSB 4KKLC 3FRPA 4P9MH 5EOCH 4MCZA 3BHBA 5JPMA 5IB3A 3A67L 3WKNA 3MLSL 4Y5XC 4Q9CA 1P6FA 4R0LC 5DFTA 1EV2E 1MWAA 3EFDL 1M6OA 1UB6A 1UYWH 4HHAA 1ZT1A 2R1XB 5J6GA 5HD8D 3HE7B 4PJXE 3AAZB 1G7QA 3R06A 4P5KA 1AP2B 3A0OA 4X7DC 3OHXA 1NGQH 4P2RB 4KUCF 1SEBA 3N1GC 4E9LA 4WU5B 1S7RB 2X9XA 1SHMA 5C0GB 4RQQB 1H5BB 4ZFGL 5IEKA 3EOBA 4WRLA 1RJZB 3QDJE 5EFIB 3CXDH 5KSUB 4PUBL 4X9HA 1T1XB 1YMMD 5E6IB 1OP3K 3D2UB 3GBNL 1I1YB 4UTBH 4YHOL 5C08B 5A16A 2X4QB 1AD0A 2YMXH 4K07A 3UCRA 4NHUB 2PTTB 2A0LD 1VENA 1IAIL 4ENED 4KU1A 5I15H 5E24E 1XR8B 4WTXA 4XMLH 5FO8A 3V79C 4HPYH 1U8KB 2E7CA 4J3VA 3WYRA 5DI8A 1UXWA 3WS6A 3GHBH 2FO4A 4PBWD 2NNAB 4L4TB 1UQSB 4GKNA 4TVPH 1I8LA 2HT4D 4WTWA 3HZVB 5I9QC 2ZCKH 4JZNA 4Z7QF 3GJFB 3FCTA 2GY7B 4N8VA 4YHKL 2NXYD 2BSTB 4IIQC 4E5XB 3DTXA 1RK1A 2VDLH 5DJAB 5FO7B 1A4KB 3B3IA 1F3JA 4ZS7H 3ARWA 3HMXH 3CSBA 1CD0A 1NGYB 4OI7A 4OFDA 2QL1A 2DQTL 2VERN 3T2NL 2DQJH 2BVQB 4GXUM 2G75A 4JFPB 4LIQE 5H37H 1G1CA 1JTPA 2J8OA 1MCFA 4OZHE 1PQZA 4CADB 4H88L 4PJDE 1IARB 4ODVL 2DLFH 3VMOA 4OCNC 3O4LB 5IBUB 3NCJL 2EE3A 3DJ9A 3CVHH 5JHDE 1C1EH 3RX8A 3P9LB 2ADFH 5CZXD 1LEKA 4YBLB 2A73B 2NXZD 2OTWB 3BZFA 3OJVC 4PJCF 4V1DB 5IQ9B 1JGEB 1IEHA 2GFBA 1AGEB 1T21B 1WJ3A 4UI2A 1NAKH 4BSWA 4TNWF 3JTSB 5BS0D 4YPGA 1QRNE 4BQ6A 5LXGL 5D7JB 4ONOA 3QUMH 3RWJB 4F3FA 1AC0A 4N5EC 1QNZH 5IBTH 4BZ2L 2AS5M 1LO3H 2Z31A 3DARA 4ODTH 2QQQA 3ME0A 4DAGH 1A1NA 5I74C 5IF0A 1WWWX 3ZT6A 1RI8A 4LCYA 5D2LE 1ZANH 2XTJD 2ATKA 3ARDA 4O2EB 5CKAA 2R9HC 5H37G 1AGBA 4M6OH 4Y8AA 4TNVF 3CZFA 1V3MA 3G5YB 3IJSA 1W72L 2ADGB 5IK3B 4LK4A 2XWBA 4DQOH 4NBZB 3UZVB 4HC1L 1C5BH 5DRNA 2KQNA 5KOMC 4QGYA 4DOHB 2J7LA 3DBXB 2HRPL 1RVFL 5MEPB 4HV8B 1C08A 1DQJA 3DRQB 1IEAA 4LASH 5SWZB 4OD3L 3W0WE 3DROB 1YNTA 2VXUL 2CIIA 5D70H 2CDGB 5J56B 4ZFZA 2ITCA 5CP3H 1YJDL 2XG4A 4UMGA 3RTQD 3IDNA 2OXHA 1GZQB 3SDCB 2XNAB 3HNVL 1FVCB 4G9FE 2VKWA 1TZIB 1V7ML 2Q8BL 4JZOA 4HJJH 4HF5H 2CDFA 5B8CA 3D48R 2Y07L 1BVLA 1KC5L 1U58A 1ZA3A 4N9OB 4TSBH 3UTZB 4CKVX 5IW1B 4IBLT 43C9A 1U3HA 4ZO6A 4NM4H 4PGDA 1XF2B 2DD8H 1CD9B 3H42L 4MXVE 4PJ9B 1UWGL 4OM1L 3CFJA 1D5ZA 1LEGB 4JCMA 3WJLC 4HMDA 1PW3A 3KLHD 3OKMA 4PRDB 5E08L 4J4PC 3C2SA 2FECI 1CDYA 1NEZB 1F4XL 5HHNA 4ISVB 3HG1B 2VWEE 3ILPA 4F7EB 5E8DL 3RWDA 4C55A 4AEHL 1CBVH 2NYYC 2VL5B 4GAYA 3RVWC 1VADB 2F5BL 3FZUD 2VZ3A 2W9DL 3FJTA 1K4CB 3QUYB 4OZGB 2BSRB 2H8PB 1CFBA 4NM8H 2NY6C 5GGRY 2ZUTA 1G7PB 2Z8RA 5GGVH 1Q94B 2X89A 3PWNB 1D9KD 3QPQD 5BRZB 1QBBA 5F1NB 3G6JB 2M26A 3D25B 4JR9L 2DQGH 3RJDA 4Y4KA 4KRPB 4U05A 5TDPB 5HXMA 1PG7X 4HS6A 1QBAA 3S3JA 5JMRA 4ZUSB 1P4IH 4XPHH 5DXWA 2NX5D 1AXSB 4X6CE 5E8EB 2BY1A 1A6UL 2NW3A 5JXED 4ZD3L 2ATPB 1RIUL 2RAMA 3I02A 4G9FD 4IRJB 5DHYB 4F15C 4KI5D 2DMBA 5C0ND 4AIXA 1KIPB 4FQJL 5IOPA 4TYUA 2EC8A 4KVNH 3Q5OA 1XZ0B 4WCYH 4HS3A 3BGAA 2C3XA 3HE6A 4JO4L 2HFFA 3KPOA 4F58L 3MGTB 3A6CH 4PJAF 4E41A 3MZTA 2RCSH 1OLLA 4L29A 4NKIL 4LSUL 1T5WA 3K3QA 4WI7A 4JRYA 1X5XA 2YK1L 4BH7A 1S9VA 5IROC 5ENWB 2RB8A 3SE8H 5I1DB 3GI9L 5JORA 3CFIC 1MFEL 2HLFD 4HG4J 4U1HA 4MZ3A 5E1AB 5EWIL 2V5YA 3VCLB 3G08B 2XKUA 4HH8A 2APVA 2HTLC 3M07A 5TJWK 5C0EA 2NY4C 4R4BA 1CD1B 5DO2C 1OWRM 4K3EH 4NCDA 1QKZH 4P3CL 4FOMA 3TNMB 1EK3A 4XC1L 3O2WL 2HJKB 4GAFB 4JHWH 4J1UB 5L7XL 4RFEB 4CMMA 4CJ0A 4MA7L 1HYRC 2NY5L 4BM7A 3QIBB 3PABB 4FQLL 1BFSA 4U7SA 3KPRA 5F9AC 4HK3N 4OZFG 5AZ2H 1H3UA 2XA3A 4ZNCD 2D7TH 3PWUB 4NRYB 3SKOB 4UIKH 4OLWL 1N4XH 2BNQE 2XYCA 4GW5A 3MUHL 3SQBA 4OTXH 4ESKA 2DIBA 3RNQA 4Y5XA 3B4NA 3QUZD 4L9DA 2YD9A 2YEZB 4K7PH 2NY0B 3F7VB 2EXYD 4I77L 5F1OB 5F6IB 2E7BA 5E95B 1OPGH 2FZ3A 1FAKT 1FN4B 3QNXA 3WHXA 1TFHA 2PCPB 3KGRA 4ZMAT 3RVVD 1INDL 5C07B 3EW3B 5LGHH 5ICZA 1KPVA 4F8TA 2QSCL 5CSZB 3CMGA 3F7YB 4G7VL 1XGRB 3CVHB 4NPYB 3OX8A 3PGDB 5DT1H 1YEJL 4L8BA 2WNGA 3DVFA 3ZDYF 3FFCA 3FO9B 3IFPA 1BQUA 1UM5L 2A6JB 4U3HA 2ZPKH 2HLAA 4F7PB 3QEHB 3MCKA 3D85D 3V2AR 3OKDB 5DTFB 2D7OA 3HC4L 1MCKA 1GAFL 1JTTA 1U8OB 3DV4A 5CLWA 2C5DC 1MUJB 1YY9C 3UTSA 1HINL 4EDXB 4LCWD 2AABL 4KKAD 1B2WL 1G9NL 4PLOB 4R7NB 5E8NB 2Q6WB 1GOGA 2FGWL 4K8RL 2IWGA 3QUMB 4GRLB 3WIFA 3WIHA 1WZLA 1RZJC 3B2VL 3RZCB 3N9GH 2ZSWB 4UT9L 4H20L 7CGTA 2FO1A 1JNHB 1KIRB 1MCWW 3SJVE 4I18B 1K4DA 3EJYC 5KW9H 2BXYA 2ESVB 3P4LA 5E2WH 3DVNB 1DJSA 1MCRA 4XPFH 2P49B 4NN6B 2H3NA 4XCYA 5FOBA 3UO1L 1EIBA 2QQKL 4OCRH 3MRQA 1TJHL 1L0XA 1N2RB 1B4JH 3BFOA 4LLQB 2BSSB 4G6FD 2AXHA 4IIQA 4EI5D 4JHZA 1IC4L 1RZ8A 5CP7A 3CPLB 5F3BA 3PWJB 3MPCA 1CR9H 1A6AA 4I3RH 1U93A 1MFDL 3QRGL 3ARGD 3EDEA 3UYRL 4DKEH 4P9HL 2JIXD 4D94A 1A7QH 3TWCL 1BP3B 1ZVSA 1YN6A 3T3PF 1WWBX 2IADA 2YPLB 1RURH 3VRJA 1MI5A 4HBQA 3T0ED 2GSIB 3ULSB 5FK9B 5DRXA 2X09A 5FOJA 4XXCC 4H0HB 3NCEB 4MQXD 4PGBA 2VR9A 1L0YA 4YE4H 2LE9A 2DI9A 3S36L 5DK2A 1JNJA 1TZGL 4LIQH 3X17A 1URLA 2P8PA 3OF6A 3PQYB 4DVRH 2VLJD 4KJYA 3RWCB 3QUKA 4WV1B 2J1KA 1HKLH 1RFDH 3QHZH 5FKPA 4K94L 3QZWA 3PL6C 1KT2A 2HFEA 4LSQL 3LOWA 2VDMH 2EDWA 4WFHE 1HDMA 4DCQB 1EUUA 2XI9A 4M3KB 4JJ5A 4GKSB 3VXRA 3MCLH 1N5YL 4UQ3B 4XP6H 2C4XA 3KXFA 4IMLA 3T0WA 3FQUB 2AJYH 3UJIL 4MA8L 1DBKH 3OZ9H 5EO1A 1ZT4B 4DKDC 4AQOA 3WJJC 3PWLB 4RGOL 2VUOA 2HVJA 2QJDA 4QNPF 2YUWA 4P57B 4WI4A 4NCC1 4FABH 1UWEH 4P2OC 1FGVH 1MF2L 4OAWB 5C3LD 1R3HA 1CICD 5DVNA 3PDOA 1YNLL 1CU4L 2YBRB 1GZPA 4KUCD 1BPVA 2Y7QB 1ZS8B 4AM0B 1XAUA 2M1KA 5TQ2L 5L88H 5FF6B 5JO5B 3MV9D 4PJIA 4QRUA 5GRZA 5CWSA 4D0BA 2QQLL 4MJ6A 4MX7A 1M05A 1CK0H 1RJLB 3EOYG 1P2CB 5D5MA 5LJYH 4O58L 1RIVL 4WW2F 3OJDB 1KV3A 4XX1E 1RHFA 4UUJA 2D3VA 4NJAL 3VDCA 4GQ9H 4Q97A 1IM3A 5J13B 3QG6A 3G9AB 1VACB 3F6LA 4Z7VB 3JV6A 3WN5B