2NY4D

Hiv-1 gp120 envelope glycoprotein (k231c, t257s, e268c, s334a, s375w) complexed with cd4 and antibody 17b
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
222
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 50
structure length 222
sequence length 229
ec nomenclature
pdb deposition date 2006-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny4D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny4D01
1RHHB 1T89A 4LRIC 1PY9A 3F62A 4YR6A 4GW4B 2GY7B 1XF3A 4X6CE 5CZXC 2C5DC 4IMLA 3RY5A 5I1GH 3FO0L 5EBMA 1ZT4B 3LPGA 1PX3A 2OLDA 5CGTA 4OGZA 1KB9K 4JFZL 4O2FB 4NKMA 2R29H 3WHXA 1HXYA 2WIIA 4WI8A 2DLFH 4UT9H 2E7LC 4DGVH 5A43C 1YEKL 4KDVA 1M7DA 4UUJA 1QO3A 5GZOD 5FO8A 3FZUC 1TNMA 3MOAH 4OBRA 5T1DL 4PJHB 5JOFA 4PFEA 1LDSA 1F6LL 4JFEA 4CVZA 3KPLA 3O3EB 5DJ6A 4L8BB 3LPFA 3QZWB 4RBPK 5EORL 3QCVL 4NFBA 3QHZH 2NZ9C 4XI5D 3C08L 3UAJD 3WN5B 1W72L 3ZKMC 4EN3B 3OKLA 3KNBB 2G75B 5EUOF 4I3GA 5DI8A 1J1PL 1YY8A 4KJQD 4NO3A 4DCQA 2AI0L 1MREL 4KK6C 5HPOA 1XIWA 3ZTNH 2YR3A 5L2KE 3MV9E 4U1IA 4X6FA 2XPGA 1I85C 3H8NA 4J3VA 1MHEA 3ZTJG 3TPUB 1CD1A 4BFIB 1BAFL 3EOTL 1FFRA 5D7LB 1C5DB 5D9SB 4MXWH 3WN5C 1NGWB 4C83B 4N5EC 1YPZA 4EN3C 2L7UA 3MLXL 4XPHL 3V5HB 1KV3A 1RK0B 1S7UB 5EOTA 2MFNA 1JF5A 1WEJL 5IBUB 3EYSH 1I4FA 3DUSB 4U1KB 1G7QA 2X4OB 1EEZB 4HWZB 4A6YA 3CK0L 4P59H 2GKIA 1N5YL 2XG5A 3ZYOA 3U7YL 5FM5O 4MS8C 1ULVA 3OJMB 4PJFA 4XNQB 4DGYH 2P5WD 4AMKL 5GXBB 1S9WB 5DC0A 4WFGD 1ZVSA 2DBLL 5HBBA 3WJJA 3ULVE 1Z0MA 1H8NA 3KJ4B 2F8VA 4QHNB 4FQXA 3UEZA 3NCEB 3IF1B 4P23D 5E2TL 5CD3B 3X3FL 5JA9A 4Q74A 4R7DA 4ODSH 1EAPB 5BOPA 3WCYA 3G5YA 2WZPD 1IAKA 2ICEB 2HG5A 2NX5D 4Y88A 3K2UH 4JQVA 5IB5B 5LXGL 4F3FB 4PTUA 2VZTA 4RAUA 1HEZA 3HNVH 1WBYA 5HJ3B 5HD8C 5MEQB 3WNPA 1YEDB 1F4WH 1WC7A 1FO0A 2VXQH 2P46B 1J18A 4MYWB 1KSRA 3KJ4C 5B8CB 5JA8B 4A6YH 3OJDA 4XZUB 3WNMA 4RCAA 5J6HB 3FKUS 1AGBA 1FZKB 5F89A 1X5GA 4OAWA 5IG7A 4NRZB 1FLRL 2ADIA 3WS6A 5IESH 1N6VA 5K59E 4ZPTB 1BOGB 4M1CC 1DJSA 1R3KA 5D7KD 4E9LA 4NQSB 2BZDA 1IGFL 1XZ0B 4OLYH 5CZVH 2CUIA 4KHTH 2ICCA 2ENSA 1MFAH 1FFOA 3OR7A 4UT7L 4BZ1L 5IF0A 3DBXA 3I9GH 3HI5L 3IGAA 5ESQB 5DJYA 3DO7B 1SYSB 3MBEB 4J2XA 5B8CC 4GJTB 1S9VB 2NY6B 1C5BL 3RX7A 2JK5B 4QLRA 1SJHB 2DJSA 4JKPH 1J8KA 2VDKH 3TO4B 1FNSL 1T5WB 1W0WA 2WUBH 1XT5A 3UTPD 1XF4A 1FO0H 1WBXB 1IEAB 4HD9A 2P5EE 1D5MA 4JFED 3UTSA 5IROC 2VXSL 1CIDA 2A83A 5EU5A 4GG6B 5C9KA 3T04D 3LD8B 3UTTA 3G6AA 2BNQA 5KSBB 3K8KA 3G5XA 1MCCA 4S1SH 2N4IA 3VXOB 3MBEC 2UWEA 3SY0A 2NY6C 1OAXL 1KF9B 1Q9OA 2DL9A 5INDB 1TZGH 1YQ2A 1JPTH 2LFGA 8FABB 3LAFA 3PDOB 5T3XL 1YMME 4C58B 3IJHB 2NY4D 3V6ZB 1VDGA 2VISA 5E03A 3TO4C 2FRGP 4JZOB 5B4MD 2OSLB 1XIWD 1VA9A 3EO9L 1A4JB 1MFBL 1FNHA 2ILLA 1IAIH 4XCCH 1JI2A 1U42A 3K4DA 3I6KA 5JNYA 2AEWA 3B9EA 3LD8C 4G6KH 4BJLA 1LEKB 1YQVL 4OLUL 2HTLD 2AEPL 1OTTD 1T1YA 2BNUB 3ARFD 1FG2B 3QSKB 1IAOA 4TNVF 1A6UH 5DUML 2BY1A 2ARJB 1KCSL 3QCTL 1PKQA 4NIKB 5C07E 3ARWA 4OCRH 4N68A 3RUGE 1JGLL 4G43A 4K3EL 4Z7WA 4MNGE 3TVMB 1FSKB 5FXCH 4C55A 4N0UB 4U6XA 1GAFH 3S35H 4OM1L 3JTTB 4L4TE 3PWNA 3QPXL 3NABH 3CDGA 3GSXA 2HFTA 4LLVB 5CINH 1OAZH 4LEOA 2VE6A 2ZKHH 1I9IL 3AXLA 4FQXD 4YUEH 1H3XA 5C0GB 4WGVB 4JJHA 2AJXL 3MROB 3MNWB 4KI5F 2F8OA 1ZANH 1ZS8A 1BZ9B 4JHWL 4QWWD 3ZKXB 4LCUB 1IGTB 1JHTA 1G9ML 2I9LB 1NGQL 1Z9SA 4PRNA 2HT3C 2VDLH 5JHDA 1S7WB 1J0YA 3PDDA 3TVMC 1FSKC 4NM8H 4XVJH 1BOYA 3THML 4KJPD 3VFSB 1F4HA 3JTSA 2ADFL 4KGJA 4UU9A 2IFFL 5I71B 3W9DA 5CJOL 4U6YA 2F54E 3CFJA 5GS2D 4EEEA 5FYLL 5IHLB 3HHRB 1LNUA 1J0KA 1QBBA 1WVZA 1E4XH 3ZKXC 4PGJA 3H7BA 1VPOL 3B5TA 5EOCL 2H32B 2FYYA 1M7XA 3HNSL 3IDNB 3MNVB 3E6FB 3PG2A 1P84J 3NCJL 3V6FB 4N1HB 5EG6C 2FD6L 5DJDA 4CKVX 4X98B 2XN9D 4KKBD 3RWJB 1CXEA 4KDTC 4MXVF 5JPNA 4L3EB 5ISZE 1DBAL 4PJ5E 2YD9A 2FDBP 1LDPL 5CMAB 2Y5TB 4WFHE 1CDJA 5L9DL 1QPXA 4PJCF 5DJZA 1UXSA 1P7HL 1YYLL 4RGNE 4GG8B 5I71C 3LMJH 3L3GB 2X10A 5FOJA 5TF1H 3QQ4B 1Q72L 2V7HB 1LE5A 1U8NA 4WEBH 4NZRL 1JBJA 1PDKA 4MZ2A 5GGVH 4MQXD 5FIEA 4E41E 1V3JA 4LLYA 4G9DA 4NBYB 3MRDB 4QXWA 2IQ9L 4H1LB 4YAQB 3BP7B 2PR4H 3UTSD 4HBCL 3S8WA 1U0QA 2RR3A 3HMXL 3MLRL 3UTTD 2BNQD 3ETBF 5F44A 2G2RB 3I50L 3H9HB 2FX8L 2QSCL 2ZSWB 3QWOB 1S7QB 3RNKA 4D9RD 5L0QB 2SEBB 1NKRA 5I1DA 1ZXQA 4N5UA 3GBNH 4C56A 3RIFK 3QULA 4PRIA 3M07A 3PL6B 4XC3L 1CDCA 2DI7A 5IQ9A 3FO2B 4LSRH 3D18B 4WW1A 1CLCA 5CLTA 4R4FH 1QA9B 3VWKA 5EA0H 3OKKA 5I1EL 3QO0A 5BRZA 5MEOB 5DC9B 5FKPA 3DV4A 3VWJB 2C1OB 1HHHB 1YNTA 4ZSOB 3BJ91 5L0QC 4YFDB 2K3TA 1XFPA 5BQ7B 4UV7L 2BOBA 3RZCA 4DKFH 2MPAH 4Z77B 2W0FA 3MXVL 1L9NA 3KWWA 1QEWA 1T89C 3O6LH 2XXMB 3PL6C 4Y5YB 1FL6B 1LK3L 4HK0A 1PD6A 1QACA 1U41A 3C8DA 2YUWA 3HRZA 1H15B 4KKAC 1V5JA 1YY9D 4UDTA 1Z9LA 2FLBT 3L6FA 5D7LE 1MNUL 1TITA 3GSNA 4FQLL 3VWJC 1Z0NA 1ORQB 5BVPH 3Q6FB 3O2WH 3VRLF 2JJTA 1M7IB 3HC4L 2RQ8A 5F7LB 4OSUL 1S7SB 4Y5YC 4Y8AA 5JHDD 1CD9B 3I6GA 4NC0B 3VMNA 3DARA 2HVKB 3BP6A 4QRRB 3PWPE 3HLAA 5GGQH 2W9DL 4JVPA 5GS3A 1EHLH 4ZNEA 2ZG2A 3LRSA 1YPZB 5CILL 3O6KL 1MVFA 1ODAA 1TVBB 5I15L 4J6RH 3WHE1 3EDEA 4AJ0A 4M03A 4AT6A 4Y1AB 2D7QA 1HYSC 3PQYE 3P2TA 5H8DA 32C2A 4YPJA 3UYOD 3CFKA 5JW5A 2IC2A 4K7PX 4OM0L 3TGXA 5C09B 2I07B 1XGTB 5C0JB 2OTUA 2V9RA 3GSNH 1ZLUK 2AV7A 4HCRA 1VACB 4FN0A 1QBLL 1Q9WA 2P47B 2FZ3B 2HLAA 5IJKC 4WNQB 1Q9KB 3MPCA 2FGWH 4MAUL 5ACLA 1FNGA 3M45A 3D39B 1J7VR 2X9YA 4WI4A 1MWAL 5HHOA 1CL7L 3P9MB 4H20L 1CBVH 4JFFB 5JPMA 1DSFH 3WNOA 4FNLL 1DN0B 4NUGL 1LO3H 3FQUB 4M6ML 5IVXF 1QZ1A 4B53A 2Y23A 4NOFA 4FG6D 4NO0D 4HS8L 4QT5A 2X4TA 2R1YA 5F7EL 4UQ2A 3MRGB 2OBGA 4YHOL 3C5JB 2R56H 5E8PA 1EUTA 3MRLA 5ADPL 1G1CA 2F15A 3S7GA 4PJXA 2ZCKL 5HHQA 3S34L 2FJFA 4GQPH 2HFEA 4DZ8B 3S88H 2FL5B 4K3JL 4C56D 2EDEA 1H8OA 2HJFA 3D85D 1FG9C 4P48A 1U3HA 4PRID 4HCRH 3GKZA 3MRKA 3WIFA 4DTGH 1MRDL 4HT1H 2QQLL 4YFLI 1R5IB 1UACL 2W59A 2MTPA 4DN3H 2ATKB 1LO5A 5LAXB 4HKXA 2OL3B 4Q9RL 1NKOA 4IDJL 3VWKD 5L7XH 1I8KB 5KSBE 5I8EA 2VQ1B 4PY7B 4PGCB 1OW0A 5BRZD 2PW1B 4X80H 5FYKH 1S78C 1IAII 2DF3A 3KPTA 1WLHA 5I2IA 2HJKB 3SOBL 4GXVH 4XPGL 4NJAL 4RGOL 1AP2B 4AG4L 3RZCD 3UX9B 3BSZH 3RDTA 1ZA6A 2Y25A 3TEUA 1JZ8A 3B6SA 5FDWB 3B5GA 3BEVA 5E94B 5TQ2L 3SE9H 1DQLL 1L7TH 4XC1H 1MRFH 4XNXH 1CVRA 2J6EA 5DRNB 3OSKA 2UVEA 2HT2D 1A7PH 2V5MA 3G6AB 1JK8B 3AB0B 1EH9A 3FT3B 3RY6A 2VLMD 1NAMA 3KPQA 4WO4B 1RULL 5T1KA 3QWQB 1EVUA 4M9OA 2DIJA 2Y07H 3GB7A 1U6AL 4OF8A 3BWAA 4K94L 1PEZA 3FRUB 5IFAL 4XHJD 1AGEB 2XIDA 4J1UA 4TULH 5TFSL 3MUY1 1X9QA 3LKOA 4XP9H 3ROOA 5SWQB 3AB0C 3I75A 4Z7OF 2VITB 4LCWA 2N7AA 4WO4C 2Y36H 3HUJB 4KFZC 4YC2B 3CDFA 1EJ6A 4KXZH 4TUJA 3ZE0F 4CJ0A 1U36A 2B1AH 3T0VA 1PAMA 1QPPA 5ICXB 1YNLH 2NTFB 4XNUH 2J6EH 4JRXD 1QQDA 3IFLH 4Z7WB 4MQ7B 3WLWC 3PHQB 1MCOL 4XXCC 4CADB 4OZFH 4KVCL 2W0LA 3U0PA 4U6XB 4XCYA 5FA4A 1NAMH 3GSXB 4F8QA 4NZTL 4B41A 1E4XI 1F3DJ 2EDTA 3FO9B 4HG4K 2ESVA 2CDGB 3V52L 3VCLA 4K3DL 2F53B 1MHPL 1CU4L 4YC2C 1UEYA 1NFIB 1UZ8B 2CKBL 1U8LA 2E7MA 5HHOD 3BGAA 2BSTB 3WFBL 2X7LA 4Z7VA 1K8DA 3GJFB 3FB6B 3TF7C 2ZSVB 4Y89A 5CSGA 4XP4L 2ZCLL 4JFOA 1BIHA 1SBSL 5J7CC 1YN6B 4ZTOH 4XNZB 3OKMA 1OSPH 4JDZA 1IM9B 1YECH 1VFAB 3O2DL 3RL2A 1IQDA 4X9IA 4ZFOA 4JPWL 4OLZH 3D87B 3BH8A 2AEQH 3SGKC 4PRHD 2H2PC 3VXTB 5JUEH 1FYTE 4ZTPH 5C0CA 2X4NB 2V2WB 3LKQB 1HHJA 3QXUA 3RL1B 1F58L 1K6QL 1ZTXH 4XVTH 2APTA 2Y06H 3TCLB 3O2VH 4PJIA 3VGAB 3HB3C 2AXJA 1PJ9A 1LQSR 4UB0L 2AS5M 4KGLA 2DM2A 1O5DT 1AJ7L 1PZ5A 2QKIA 4GRLB 4LLWB 4XNZC 2WBWB 5F21B 3RI5K 3QRGH 1P9MA 1FORH 4TSBL 1Z2KA 4IEFB 2XZQH 3AS2A 4AYFA 4PREA 2N56A 3MV7A 5JOEA 1NCWH 4UOW0 5EIIB 1UM5L 5KVMC 2ADGB 3AS0A 3GSUB 3LKRB 3RDTD 3EYQC 5DJ8A 3VGAC 4ELMA 1RUQH 3DURB 5IM7B 4HJGA 3QXAB 1J86A 1S7VA 3RWIA 1OGTB 4GRLC 1IGMH 2FJGA 4G8GB 5KSAD 5HHNA 1HXMA 3ULUL 4C59B 1NDGA 4JKLA 3SBWC 5CBAB 3CVHB 2AXFB 1U8JB 4PS4L 2DDQH 5D7IF 5ABDE 2HRPH 4PJEF 5T1KD 4ZSOE 4AEIH 4KRNA 2R15A 3D2UB 2ORBH 3ARBD 1JNHA 4G6AD 3KPRB 2AK1H 3G04B 3QULB 4M1DL 2VLJA 3L3OA 2A6KB 1CXHA 3STZB 3KPSB 1WAAF 1WF5A 3GBMH 3MRCB 4BK4A 2F19L 3FT2B 3TNMB 1BFTA 5CBEA 5HGAA 2IMNA 1IKFH 4QRSA 2Q8AL 4OCLC 4P9ML 5AZEL 5BMFH 3MLUL 3WFHB 1FNEA 4LCWD 2VR4A 4J4PA 4M48L 1OM3H 4ZFZB 1N59B 3INUH 4Y5XA 3ES6A 3LZFH 2PYEA 1NLBH 1W72A 3TT1L 1PY4A 3PP4H 1CGSL 3RBSA 5E24E 5F1IB 2EO9A 4Z78A 3HE7B 4XH2B 5M94B 2NLJA 4QRRE 1TZHB 1QFOA 1MIEL 3EO0B 3HR5A 4I18A 5IFJB 4NQCE 1FVDB 3AREA 1Z6JT 4PJ8B 3L3DA 4RX4A 3TJHD 2ESVD 4JFZH 2Z35A 1RJCA 4R6UA 4HH9A 1TTFA 4CAGA 1IGJA 1P1ZB 3CIQA 1YEKH 1KT2A 4O2EA 5K33A 4Y1AE 4HUXA 4JANA 5T1DH 2EEAA 4QHLB 4NRYA 5GIRB 3TC9A 2GUOA 3I6GB 2UY6A 4RSVA 4V2CB 5KOVC 3HE7C 1UH3A 1PG7L 2J8UE 5EORH 5CP7A 1IQWL 3QCVH 2IMMA 4PJ8C 3FFCE 1BZQK 1XR9B 4XPFL 3P73A 2V2XB 3C08H 5C0CD 1S7TB 2YD5A 2J12B 3D39E 1AD9A 2GCYB 1W72H 3BKCL 1MCNA 4KUCF 4OLVL 1G6RL 2OJEA 4KROD 2W60A 5EBGA 3FQWB 5TDPB 5MI0B 4ZYKB 1G9EA 2AI0H 1ZT7A 1MREH 2E9JA 3B9KA 5EZJB 5JW5B 3ZDXF 3T3ME 3MRPB 3HS0A 4K7PY 3LEXB 3F7YB 1AXTL 1DCLA 4EIZC 1Q9WB 2HLAB 2HAZA 4YFEA 2Z8RA 4X5LA 1BAFH 3C8KB 3SDXA 3RA7L 2VMFA 1FNGB 2VN7A 4ELKA 4NO2B 4DKEL 4GRWH 3MLXH 4XPHH 3DUHA 2JJUA 1K4DA 5EIQA 3JVGC 5E08L 4JM2F 1QSEE 2Q3AA 4TSCL 1WEJH 4UTBL 5MI0C 3CK0H 3EYUL 1N5YH 4JHZA 4F7PA 4X8XA 3V0VB 4ZD3L 3DMMB 3P4MB 4UINL 5IW6B 3R06A 1WWWX 2Z31A 4AMKH 4GMTL 2DM3A 5EZOH 1MQKL 2EDLA 2GY5A 3O3AA 5LG1A 1B88A 3KLDA 1RMFL 5ACMA 1W8NA 5ID0A 3DIFB 4YK4B 3BZFB 5E2TH 4ZFFB 1DEEA 2DD8L 5J3HD 1MLBB 2CIIB 3X3FH 5C08A 1EMTH 1KIUA 2HJFB 2VLJD 4YXHL 2NY7L 3MRKB 2XWBB 2XA3A 2HN7A 4NKOA 4OZHB 4I1NB 4ORGB 5LXGH 4HKXB 4I4WB 3C5SB 1JJUA 3DMMC 4KKLD 5KS9E 5EZLA 5IQ7L 5C0AB 5JHLL 3MRHB 1GC1L 1G9NC 2XKSA 1QSZA 4OLEA 2OP4L 5I1LB 2FECI 3T77B 1NFKA 2NY5C 4MXQC 1BJMA 3NIFF 4J4PD 1NDMA 3QDGB 3OKOA 3I3EA 4RZCA 4YK4C 3NPZB 3QQ3B 2E9BA 3DX9A 1CXKA 4YFLF 3V7AG 3HZVA 1DBJL 1BQSA 3B6SB 1AHWA 2PYED 5B39B 4AEFA 4LNVA 1JPSL 3IDUA 1D5IL 1FLRH 1EAJA 3W5MA 1C12A 5J9PB 2EYTB 4Q9CA 4KXZI 5DEGA 5E8EA 4PJGA 3KGRA 5E2WL 4DW2L 2NY3D 1IGFH 1MY7A 4OZFB 5HGBA 1JI1A 3ARED 3CUPB 4YE4L 2BCKB 4FTVA 4RX4D 1NAMB 5DD1L 4S11A 4UT7H 4BZ1H 3VRJB 2P8MA 3HI5H 4KI5C 1FV1A 1RSFA 1C5BH 5IK3B 5IOPA 4PJ7E 2NXZB 5HTSA 3L9RA 4MAYA 5DMGD 3FN3A 2PO6A 1FNSH 1G0DA 3DXAE 2R1XA 4J1UB 5GGSB 1VADB 2R39A 1BD2B 2VXSH 3BVNA 3IXAA 1J05A 5SWSB 3IDIA 3RY6C 3DROA 1VFBB 1T20B 4HFUL 2F53E 4BH8A 3PWJA 4OZ4A 1OAXH 1RZGA 4OCWL 2NXZC 1RZIB 2E7BA 4W70A 5T3XH 4OUUA 4YDKL 4L1DA 1WITA 5KSUB 3B9KD 3EO9H 1MFBH 5FA4B 1FH5L 3MLPA 3MRBA 4LRNL 5LGJB 2AP2A 4X7TA 1SVCP 5C8JA 2E6PA 5E1HB 4OLUH 1YQVH 2AEPH 4NC2B 4UI2A 5FECB 3EFFB 4H26B 1K4CA 3RWCA 3EOAA 4JDVA 3O4OB 5DUMH 1N5AB 1KCSH 3MFGB 4NCC1 3QCTH 3GSVB 4S1DD 1T21A 3HI1B 3MFFA 5KZCB 4Z6AT 1F3JB 1P5VA 1JGLH 2EDQA 5FO9A 5D6DC 4K3EH 1FFPA 1WBZB 2WK2A 4DOHB 2DQFB 1X44A 4NC1E 4UTAL 1VB9A 2Z31D 3GFUA 4HK3J 4U6VL 4OM1H 4Q6YA 4Z7UA 4BFEA 3QPXH 1GHFL 1AQDB 3RPIB 1QR4A 3BEWA 1FGNL 4CVXA 2CK2A 3L1OL 3T2QA 4CDHA 5EUOE 1I9IH 5IB1B 4XNMA 1T66D 1J9CT 1UB5A 4WVRA 2G9HB 3O4OC 4AIXA 1B0WA 2AJXH 5DUPL 5C08D 1D6VL 2PXYA 2X70B 5E0QA 4Y5VA 4JHWH 3I6LE 4OZIB 2VAAB 2HA1A 4MNQA 2CRIA 1G9MH 2OMNA 4EXPX 1NGQH 4F7MB 2XZAL 1BVLB 1IGIL 3THMH 4WIQA 4JPVL 4G8GE 4MCZA 3VW3L 2VQTA 4ENED 1A1MA 2ADFH 1NQBA 4PJBA 2GEEA 4CVUA 4MJ2A 1ZLWH 3MV7B 5J12B 2IFFH 2AVGA 4PGEB 1YEFL 5CJOH 1CG9B 3HMXA 2R23B 2NNAB 2GTZA 5GRVK 3TT3L 2C3WA 4LOUD 5FYLH 5BS0A 1RJZB 5LGHL 5IKCA 3BQUB 5DQ9B 3KPSE 1JHLL 1VPOH 3QQNA 4OZGA 5EOCH 3HNSH 4P57A 1G7IB 4JB9L 3RWIB 4F2MB 1BECA 3NCJH 5T3XD 2FD6H 2R1WB 5DSCB 4WTZA 2FJGB 4NO5B 2X05A 2WBKA 3K4AA 1CWVA 1DBAH 2ERJB 1WIOA 1LDPH 1AQKL 3BESR 5BXFB 4FTVD 3BI9X 3IFPA 3QI9A 5L9DH 1UM4L 1T5XB 3VXQA 1P84K 1YYLH 4D0BA 5J12C 1DANT 4X6DF 1Q72H 3MV01 4PYGA 1KC5L 2VDOL 2DYPA 5DJ0B 4MAYD 5BV7B 5T3ZE 2PO6D 3BQUC 4NZRH 5A3IC 2KDGA 5D2LA 4TUKL 1WGOA 2IQ9H 4P3DA 1U8OA 4HBCH 3WXVL 3WE6B 3BYYA 5F9DC 1A2YB 2DJ4A 2UZXB 4JFDA 3BKYL 4RQQA 1F90L 3HMXH 2ERJC 3MLRH 4MJ5A 1XH3B 5K9KB 5TDNB 3I50H 4R97B 2FX8H 3NIGF 3B3IB 2QSCH 4U0QB 1RZ7L 5MEPA 5E2JA 4QF1A 2CQVA 4XTRC 4YHNA 4Q7DA 4BA8A 5IEKA 5BV7C 3B8SA 1ND0B 4KHXL 1Q1JL 2Y6SD 1FFNA 1RZJL 1KOAA 1PGRB 2VC2L 4XC3H 3TNNA 2O93L 4G42A 5F9AC 4Z0XB 4PV8B 3UJTL 4KK8C 4LSUL 4MWFA 5I1EH 1XGPA 2GK2A 2KQMA 5C3LD 1K8IB 1U91B 3W2DL 4R97C 3GSRB 4R4BA 1WJ3A 3K1DA 4UV7H 4G9FB 1I7ZA 2LU3A 3GJEA 3MXVH 5C0DB 3C6SA 3S37L 3KPOB 1LK3H 1MEXL 5FYLD 2Z8SA 4TQEL 3PIQB 2Z91A 2DKUA 1BQHA 3DRTB 1HSBA 4URTB 5EO0B 1KLFA 4ZUSB 3P73B 1MNUH 2GITB 4FQLH 4LVOB 1I1YA 5F1NB 2DWEB 4HUUA 2PXYD 4ACPA 2D2OA 3FRPA 3HC4H 4MNQD 1TLKA 3WKNA 4WHTA 4OSUH 4OF6A 5DD5L 4BZYA 3SO5A 1X5JA 5DEZA 4ONHB 3RTQB 3X3GL 1QD0A 4G5ZL 1H0DB 3IU3A 3M17A 4U2ZA 2FO4B 1XF5A 4PLNC 1E4KC 4NWTL 1RAMA 2W9DH 2UV3A 2EKSB 3GBLA 5CILH 3X12B 3O6KH 4LVOC 1A6AB 4I0KA 2JJWA 5I15H 3TYGL 4MJ6B 3STLB 5I17A 4FQ2L 1T7WA 2QQNL 1X4YA 2VNCA 4OZHE 4H0HB 4F7PB 1TVHB 3BH9B 3P4OB 4WI5A 4OM0H 3RTQC 4Y4FA 4QHKJ 1CE6A 1UZ6F 4P9HC 5BZWA 4NT6A 5I30L 1ZGLB 1QBLH 4W4OC 1YEGL 4P2YA 3QI9D 3SHSA 3RWEA 1T3FA 4KI5E 4PR5A 4MAUH 4ZUTB 5AUMA 3WNNA 4E42A 1MWAH 3FOLA 4P5TA 1CL7H 4H20H 2DYPD 2CRZA 2A9NL 5HGHA 1CICA 1R5VB 4FNLH 4NKOB 4NUGH 5HDBF 5GGTL 4M6MH 1GGUA 1UCTA 3P4NA 4MJIB 2AV1A 1P7QA 5E2VL 1DBBL 4BELD 2E9IA 4JFDD 4HS8H 2XTJD 1MCRA 2JCCA 5F7EH 3JBG7 4MGXA 4YHOH 1NJ9A 1FZOB 1A1OB 4C4KO 2P4AB 5ADPH 4P2QA 2NY2D 1ZLVH 2BJML 2ZCKH 3S34H 2YPKA 1RUML 2ICWA 4QRUA 3G08A 4WTZG 3KJ6L 3TBTA 5DRZA 4K3JH 2EDHA 4KQ3L 2GFBA 4MXVE 5TJWK 1U8IB 3SDCA 1MRDH 3W81A 1MH5B 2QQLH 1BD2E 1UACH 3U30B 3MRFB 5SWSE 4Q9RH 4PJCE 5ENWA 4IDJH 1X3DA 4OV6F 4AK1A 4JJ5A 2AABL 4M61A 4NFCA 1KB5L 4Y4KA 4I77L 1H3VA 5JORA 5FGRA 1RIHL 4L4VB 4R7NA 1LEIA 1J0ZA 2LV4A 4PJDA 3SOBH 4M8VA 4XPGH 1S7XA 4NJAH 4RGOH 2YSSB 4AG4H 1V7NL 3O8XA 2Q8BL 2Z4QA 4B7LA 3ULVL 2Z8VC 3DVFA 5TQ2H 2L0DA 1DQLH 3VXPB 4Q2ZA 3ROLA 2QSQA 1M4KA 2EDNA 3IDMB 3U30C 3VG9B 3D0LB 2YMXL 3E8UL 1S9XB 5D5MF 5GHWL 2QBWA 3QPQC 3HZYB 3O3BB 3ILQD 2IWGA 1RULH 2A77L 3U83A 4PRDB 3CFEA 5IB3A 4OT1L 1DDHB 4MZ3A 1U6AH 3MJ8A 4K94H 3PE9A 4RNRB 5DA4A 4DJMA 1AY1L 5IFAH 1A9EB 3PWVB 3U7WL 5DEFB 4DOHE 1XCTA 5D7JB 1G7LB 2D0GA 5TFSH 3O9WA 1BMGA 4PB0L 3VG9C 3MRRA 4WJ5B 5ESAB 3SDDA 3P11L 3QUZA 4M9PA 1Q94A 1JFQL 5EO1A 3IKCB 4KY1L 1JPGA 1MCBA 2EYSB 1KPUA 5A2FA 4YEFA 4JDVB 2W92A 3B2UD 4DWHA 3QA3A 2DBJA 2B20A 2VKWA 5EU3B 4R26L 4K23L 3WXWL 4NSKB 1AH1A 5F3BB 3QXWA 3W11D 5DVOA 4WEUD 3V5DA 1BQHG 2A38A 5JDSB 2EZ0C 1N8ZB 5CGYD 3O45A 1MCOH 2ITCA 4JY6A 5D7JC 4KVCH 1JE6A 1G9MC 4Y4FD 3G5ZB 3B9VA 5B3JF 4NKDB 2WM0A 3GKWL 3KXFA 2ZOKA 1CFTB 4NZTH 5F8RC 1ZLSL 3CLFL 3GMLA 3FRPG 4XNMB 2CLVA 4NQDB 4TNVK 3VRLE 3OKNA 3C9NA 3V52H 2VIRA 4K3DH 1MHPH 1CU4H 2ZG3A 1Q8MA 1MCFA 4Z7VF 1YDPA 3SDYL 2CKBH 2PKDA 3S96B 4P5TD 2NZIA 3QUKB 3WFBH 3AAZA 1TENA 4WW2F 1CICD 2C3GA 3QFJB 4RFEB 5I1KL 4XP4H 1UWXK 2ZCLH 1SBSH 1YC8A 4FRWA 3L3JB 1QUNA 1P7QD 1XGRA 3O2DH 2A74B 1QSFD 3ZKNC 4GW5B 2BRRH 4JPWH 3H6JA 3NN8B 5DVKA 2NMSA 3LEVL 4IRSA 1IM3A 1MELA 4P2QD 1F58H 1K6QH 1WTGT 5BS0B 4PJIF 4WTXA 4RMRA 1J0JA 4YPGB 1ZHKB 1OD7A 3DX6B 3MV8A 5GZND 3SDCD 5H35A 1DLFL 4UB0H 3H42L 3AU1B 1FDLL 3TO2A 5KJRL 1AJ7H 3KPNA 5HI4C 3EIFA 4MD0A 4TOYL 4WFEE 3ZDZF 2MJWA 5EU4B 3H7LA 3STBA 1JNLH 4L3AA 4TSBH 4KAQL 4G80A 4Y4KD 4LQ1A 5GS0C 3KYNB 3UBXB 3IJYB 4P4RB 3GM8A 1OF2A 3A6CL 1SJEA 4BZ2L 5IVXE 1UM5H 5SWZB 1FL5B 3O8XD 5C0FA 4TVPD 4LPVA 1NGXA 1AIFB 1G6VK 3F7VA 3MUHL 2IALB 3ZLQC 4NNXA 2FH6A 1OP5H 3MGTB 1S5HB 3EDKA 4RGMB 4N0YL 2GAZA 3T4AB 4GH7B 5ETUB 1ONQA 2YPLA 4XRCA 1FC1A 2CH8A 5D71L 3ULUH 4D8PB 4OF7A 2VN4A 2CO7B 2IG2L 4PS4H 4JM2B 2MCPL 4E0RB 4YHNB 1AO7A 4U1HB 5JQ6L 3GGWB 4NPYB 4M1DH 4H25A 3PDGA 3N1GC 3JV6B 1NEUA 3WO3B 1OPGL 4MDJA 2GJ6B 4LDEB 2F19H 3U79A 4RGMC 4ODWB 4YEEA 4HUWA 4PG9A 3SDDD 3WDIA 3DETC 3QUZD 3BZDA 5GJTL 2Q8AH 2R8SL 4P2CG 4P9MH 5AZEH 3MLUH 5A2IH 2OI9B 1QR1B 4M48H 4JM2C 1KPVA 4IDLA 5FM5M 2W65B 5F3HA 4ZUVA 1NMCB 3FO1A 3GMOB 4XAKD 1BIIA 3CFBB 3T4YA 1I7ZB 2NY0D 3C6SB 4EQ2A 1MCIA 3TT1H 4XNYL 4K7FA 2R0KL 3V6OA 1G6RA 4N9GB 1MFCL 4R2GB 3DUUA 5C71A 1MIEH 4H5SA 3D3VA 3KXFD 1KG0B 3JWNC 3BDXA 1R3JA 3HI6L 4U6HB 2OI9C 2YN5A 1I3RA 4QWWC 3MRIB 2FWOB 1MCWM 1NMCC 4HUUB 5I76A 4WUUE 4XAWL 1VGKA 1EEYA 1C5CL 5DURD 5DQJA 1MWAB 3JUZA 3B43A 3TBSA 2D9QB 3TBWB 4JHAL 1JN6A 3OKEB 4Z7OE 1WZ1L 2HLFD 1PG7H 1CL7I 4R2GC 4HIJB 3SKMA 4HUKB 1IQWH 3ZE0E 3VXUB 3QUXA 4XPFH 5C6PB 3LOWA 4RDQG 5FAAA 2EDOA 2DLEA 2HVJA 4IRSD 2WWKO 5EPMA 4HXAH 3BKCH 3W39A 1A9BB 4OLVH 5J6GB 1G6RH 2IBGA 7FABL 3NFNB 2PN5A 5DA0B 4M02A 4U1MA 1CT8A 4X5WA 4N0FA 3EDDA 5I66A 3KDMA 3GK8L 3OMZA 2C7UA 4MJIE 5CKAA 3NPSB 2Q7YA 5J13B 1VERA 2W91A 1IZKA 1AXTH 3RA7H 4PR5B 2IH3A 3PHSA 2EH8L 3EHBC 4HIEB 3GMNB 1J1OL 1ZEAL 4DKEH 3IB4A 2FR4A 4PLJC 2G5BB 5E08H 2LAGB 3PJSB 1U8HA 4TSCH 4UTBH 1J8HA 5E8OA 4HV8A 2GT9B 3EYFA 3S98A 1EV2E 3EYUH 3CGTA 1L9MA 3KG5A 3MRMB 1DEDA 1I7TB 3P4NB 3VFNA 2M1KA 1N6UA 3E1F1 1XCQB 5ALBL 4ZD3H 1GL4B 4CMHB 4UINH 3NPSC 5J13C 1LE9B 5DRXB 3N1FC 4GMTH 1MQKH 2JCCB 3FOMB 2B1HL 1DE4A 1Z3GL 1NJ9B 1RMFH 4L4VE 1EXUB 3UZQA 3V4VL 3VGFA 1A64A 5D1QD 1AO7D 2JB5L 2DD8H 3QWRA 5I8OL 5DRZB 5ICZA 1U3YA 4LCYA 3RVTD 5SX5K 4YXHH 2CRMA 3QEUB 1MIML 2NY7H 1NFDA 2ICWI 4M6OL 3WL9B 3IFNL 3F12A 3MACL 5ENWB 4HPOL 4CMHC 5D6CA 5IQ7H 1TQCB 3FTGB 1J88A 1MAML 3O11A 1M1SA 3B4NA 5JHLH 1GC1H 1F11B 2OP4H 1OTSC 3HG1A 1HDMA 3OGCA 4RAVA 2F8XC 2NR6D 5HYEA 1RV6X 1K9TA 1X5KA 2D7OA 3GIZL 1RZ8A 5EUKA 2R2HA 1RUKL 3P77B 3QIBB 4FXKB 4X4ZA 4ODHL 1T4KA 3F7RA 4UBDC 1DBJH 5I1IL 3LRHA 5HY9A 3EBAA 3JZ7A 4ZO9A 1JPSH 5FUCC 1D5IH 1AGCA 5EU7C 1RJYB 3UTQB 2AJ3A 2Q76A 2PCPB 2DLTA 1QRNB 5D7IE 1A47A 1TQCC 2VDQL 5E2WH 5F72S 4DW2H 3D3VD 4O9HL 2R2EA 3OAZH 2AERT 4YE4H 4FABL 5DD1H 1MSPA 5K93A 3MMEA 5F6IB 4N1EA 2NX5E 1WAAE 3QIBC 1DQQA 3BP4B 3GMRB 3O6FA 4ODVL 4G8EB 3VGEA 4MD4B 1OLZA 2CKBB 4NQUA 1OARL 1EO7A 2UUDK 2A2QT 1T1WB 3X13A 3O9WB 3TBYB 3U9PL 1F4YL 4DZBA 3RVUC 5IMOB 5IVZA 4NQDE 3QUXD 4X6DB 3SKNA 1CTNA 4HFUH 3LN5A 5HHMD 1X5YA 5F6IC 4LVHB 5I18L 4ZQKB 1YNKL 3W5NA 2JJSC 4OCWH 1X5FA 5D7KE 1W0VA 1CZ8L 5AWNL 4YDKH 3FB7B 3QG6B 2ATPA 2VLRB 5BVJA 3O9WC 1G0XA 3TN0B 1FH5H 3IDJA 5A2LH 4LRNH 4O51B 2A1WL 3L3KB 4WI9A 5F71A 3WNKA 5ERWB 3HMWL 3KPMA 2IPUK 4F7EB 1A3LL 4UZGA 1E27A 1KN4L 3D85B 5TE4L 4MD5B 1KLUA 4BUHA 4LVHC 5FYJE 5HGDA 1AR1C 3BFOA 3RWDA 1J8HD 4OIIL 3RVXC 2F5AL 3N1QC 4JLRB 5IJVA 4JRYA 2WNGA 4PP2B 1LEGA 4AENA 3TN0C 4UTAH 1JYNA 1NAKL 2KL6A 4PV9A 3QRFM 3C09B 4U6VH 1EDQA 1GHFH 1GZQB 1MCPL 1FGNH 3L1OH 1TMCB 4XB7A 1FJ1A 1IC7L 5DD6B 4OB5L 4R4ND 5SWZE 2EH7L 2BVPA 3QWRD 4U1SA 5DUPH 1U8KA 1F42A 1ZA3B 35C8L 1D6VH 1T80A 3ZDXE 4I9WE 3BZEA 3MV8B 3WUWA 4HZLA 3ARRA 3WDJA 2AW2A 1JGDA 2XZAH 2YZ1A 1IGIH 4JPVH 3RWHB 3UPRB 5ITBL 3VW3H 2FEEL 8CGTA 3C09C 5FF6A 4FQIL 4MB5A 4PJBF 4LP4A 3TWCL 1AGFA 2NW2A 3CFIC 3HG1D 3VFWA 4V1DB 5ANMB 3ZKSD 1I1FB 4X8JA 2BC4B 3ULUC 1YEFH 4S0SD 2V7NB 3ZDYE 4PGZA 3KLAA 3TT3H 4HJ0D 4OZGF 5LGHH 3KPPA 4KVNL 2COQA 1ZHNA 1JHLH 1ORSB 3HC3L 5KVDL 2GJ6E 4NKIH 1CFSB 1P4LB 4JB9H 3K2MC 2Q6WA 2O5YL 3NGBB 3BE1L 4E5XB 1MCJA 3UC0L 4MJ4A 3WLBB 1GGYA 1BVKA 3U4EA 1A21A 1AQKH 4X7SH 3SE4C 3S4SG 2JIXA 1UM4H 1Q0XL 5I16A 5EH1A 1MCLA 4Y4HA 3HCVA 4P4KB 4PY8I 3VXMD 3FJTA 4J8RB 1EFXA 3LB6D 2IAMB 1KC5H 2VDOH 4BSVB 3O6FD 3RGVD 3C60B 4TUKH 5H2BA 3TYFB 4IIQA 3T0BA 2PTUA 3JWDC 2AQ2A 4JVWA 5A16A 4O5LL 3NGBC 5E1AB 4UAOB 3WXVH 4NYLA 3GMQA 4GAYB 4O2CA 2WLZA 3NIFE 2E3VA 4JY5L 3BKYH 1JF1B 1F90H 4WTWA 2P7TB 1QP1A 5M95B 1FQ9C 4XWOD 4ZUVB 1RZ7H 1OSZB 3IYLW 5E7FA 4JFYB 4P4KC 5TH2A 1U8MB 4X5XB 3O41B 1VEMA 2XN9E 2IAMC 5L2JB 4FXGA 5JXEC 4KHXH 1Q1JH 3C60C 2IANB 2AK4A 1NH6A 1RZJH 3OTTA 2VC2H 1KIRB 4PRHB 3FB8A 3BPCB 4FMFA 4UAOC 4KJYB 4XCEA 1OT1A 2Y7QB 5I6XB 3UJTH 2WQRA 1MHHA 4LSUH 4P2RB 2FH8A 3VXUE 5L88L 1EBAA 2IBZX 4FQJL 3W2DH 3MR9A 4LMQE 1HH9A 5AYQA 1TCRB 3UTZB 5DJCA 4N1CA 2AGJL 4NHUB 4M5YL 4DFHA 2NY1D 4X6CA 1FHGA 1HQ4B 2JELL 5FHBL 3S37H 1KTDA 1T0NB 1MEXH 4BQ9A 4TQEH 4Q9QL 3FCTA 3L3IA 4QXTB 2XNAB 3VJ6B 4D9RE 1QFHA 1D6EA 2X1PA 2J4WL 5I6XC 4YJZL 3L7EB 3FQRA 1QVOA 4P59L 4DVBA 4JFPB 5DWUL 3NTCL 1GGBL 3BGFB 1DANU 1T03L 1KJMA 3QDMD 2FSEA 4F7CB 2CDEB 2E8ZA 3U9UB 1BX2A 3TZVB 5DD5H 3EYOA 5HHPA 5D5MB 4DEPB 1BFVL 2VDMH 3H9YA 3X3GH 3OXSB 4U1LB 4G5ZH 3VD5A 3AGVA 1NPUA 2VB5A 3ARBB 2OCFD 4LF3A 4NWTH 4Y7MA 2IH3B 1QSVA 1T7VA 4HEPG 4XBGB 3IAGC 2C3VA 1P2CA 2XG4A 1UQSB 3ARGA 4XBPB 4I0PB 4K7PL 2QQQA 3HPLB 3TYGH 1ETZA 3HE6A 4FQ2H 4Z9KB 2QQNH 3BGFC 1DR9A 3DVNA 5L2KA 5HVHB 2BNRD 2A0LD 3MV9A 3PXHA 3UPCA 4YGVA 3TZVC 5EU7E 4LSVL 5HI5C 1DQJA 4DEPC 3DTXA 2VABB 4MVBD 4WWKA 5TQ0L 3MREB 3ARBC 1BGXL 43C9A 1ZGLM 2HFFA 1YEGH 3BXNB 4F15B 2JIXD 3WUWG 4EUPA 1GC1C 2DICA 4M1GL 4N0CC 1H5BA 4I0PC 5E5UB 3U0WL 1QG3A 1KB5A 2AJYL 2VDRL 1IZJA 3QUYB 3S4SB 4MSWA 4N8VA 3VFOB 2A9NH 5HVHC 4YDLB 4NJ9L 5ESVA 5GGTH 2X4QA 4WHYH 3IT8D 2QADD 1NBVL 3RZWA 5D6CB 1QRNE 4CNIB 5E2VH 1DBBH 5MP6L 1HN1A 2C26A 3BOVA 4RMTA 1J1XL 3ARQA 3DX7A 4F15C 3CPLB 3GSOA 1OCWL 1OHQA 1U58B 4DUWA 2OQJB 5DJAA 4Y0GA 5INCA 2BJMH 5JO5B 2OTWA 2W0KA 4GKSB 3OHXB 4IMKA 1RUMH 1P7KB 4OV5B 3V8CA 3QUYC 3KJ6H 5E2UL 3RY4A 1KJVA 2F58L 5EN2B 5J8OA 4KQ3H 5TDOA 2AK4D 4JKKA 4YDLC 1NGYB 2NXYB 1NUFA 4HS3A 1JVKA 1QLFB 4RMWA 3QFDA 5H94A 3QXTA 1N6QL 1G1YA 1I1AA 4GAJL 4EUPH 1U3JA 3VE0B 3HZKA 4X6DE 2AABH 3MRQB 1KB5H 1PYWA 1T2QL 4I77H 4P46A 5GGRB 4GW1A 1RIHH 2OL3L 3C5ZB 2A73A 3MX0A 4TTDD 3SKOA 1TJHL 5GGVY 3EOBB 3OAYH 2BVOA 4LSSL 1ZT1B 1V7NH 4LNRB 1T0MA 5F1KC 2XTLA 2Q8BH 3ULVH 5CHNB 3PNWB 2NXYC 4G6JL 1A7BA 4TUOB 4ZMAT 2YWZA 4U3CA 3S5LA 3NIGE 2YMXH 3E8UH 2E27L 5GHWH 2HTKD 1HKFA 4GBXA 3ALWA 4LU5L 5F7DB 1R3IL 1ED3B 3ARZA 4PRIE 5GS1A 3LN5B 5A2KH 3C5ZC 3RQ3A 3KYOB 3P4LA 2A77H 4Q97A 1WZMA 2NW3A 4OT1H 1X6NA 3SKUD 1P69B 4HKZA 4R96B 2P5EA 2H9GA 4MA7L 3IETA 4KRLB 3T0EB 1AY1H 5F1SA 1WFOA 3U7WH 1FL3B 4JE4B 3AFLA 4UOW1 2HMIC 3IDJB 1KELL 1VFMA 3G5VB 1JUFA 1YYML 3QJHA 3QXDA 5FM4A 3P11H 1U8QB 4Q6IA 1ZVYA 3REWB 1JFQH 4KY1H 4P5KB 3O81A 1RZFL 1RJLA 3OG6B 4OCSL 1YMMA 4HIHB 4XXDA 1SMAA 3ARGD 4V2BA 4NQEB 3OX8A 4W6WB 5DFTA 3U36A 3MGOA 4XVJL 3HE6D 2QR0B 1NC2A 4R26H 4K23H 2BHUA 5BO1L 3WXWH 3F5WB 2FCBA 3VXSB 1PG7W 3ARVA 4R3SA 5L2KD 3MV9D 3OKDB 2Q1EA 5EB9A 3RI5F 3T0EC 3D0VA 3ECBB 4JRYB 5IJVB 1NUGA 2GJZA 4AENB 4FQHA 5D72L 3BN9D 4NDMB 4F7TA 3OXRB 3GKWH 5GRZA 5E5MA 1A6VL 4EDXA 1ZLSH 3HZMB 3CLFH 3VFRB 1CXLA 2HYMA 2Z8WC 3VFPA 4ZUUB 3RVWC 4M7LH 2BOCB 3RUGA 3SDYH 1UJ3A 4GKOA 5E00B 3SDAA 5IW1A 2YC1A 2QSVA 2MKWA 4WHYG 4S2SA 3TFKC 2QHRL 4L4TA 4AQ1B 5I1KH 4FMKA 4MMZC 2A6JA 5DHVB 3R1GL 3LMJL 2D31A 2RFXB 3V4PL 1E28A 1MVUA 3MBXL 4GAGL 2NW2B 1U8PB 2FIRT 3GSWB 1BEYL 4ESKA 2YS4A 4JRXE 1IILE 2CLRB 4G8FA 5IIEB 1N2RA 2NYYD 3LEVH 4PP1D 4YBHA 1RZKL 5DUBB 1I7RB 2NQCA 5E8DL 2IBBA 3W9EA 5FKAB 3H9SB 1UZ6E 5D1XA 1DLFH 2BXZA 4QHUB 2JTDA 3H42H 1FDLH 3GIVB 5KJRH 4EUPG 3U46A 4LKXA 4TOYH 1L0YA 4CL7A 1BVKB 1I1AD 2XZZA 2FX7L 2F54A 3CH8A 2AJZB 5HHOE 4UQ3A 2IADB 2IPKA 4KAQH 4P46D 4N8VG 3FONB 4HUVA 4Y4HB 2MHAA 4K9EL 4ZOAA 1YN7B 4LRIA 1ZOXA 5HDBE 2OK0L 3A6CH 5F9OL 2P43B 4YHPA 4BZ2H 3MUGA 3NCCB 3FFDA 4LLUA 4YDVA 2IANE 4IIQB 4U33A 5ISZA 3P9LB 3BP5A 1WT5C 3J7HA 4KWUA 4PRHE 2NTSP 4N0YH 5JLZB 2BX5A 3UDWC 5SX4H 1F3RB 4P2RE 5D71H 4JZNB 2E7LA 1J11A 1D3CA 3Q5TA 2YD6A 4FFVC 4GBXD 4YNYB 3BHBA 2IG2H 2GTWB 4KRPD 5T1LA 4Y4HC 3PGDB 2MCPH 1WICA 4YGAB 1RHHA 1VSCA 4CW1B 4E41A 3C2AL 4Y16B 5B21A 4GW4A 2P5ED 3CVHL 4KJWD 5JQ6H 2EO1A 4BKLB 4J3OC 3UXFA 3SGEH 4IIQC 1ZT4A 3DRQB 1OPGH 3C6LB 1H9VA 1SM3L 3CLEL 5HYIA 1PKOA 4HJJL 1EJOL 4B50A 4O2FA 5KVGL 3CSGA 4X4MA 3FQNA 4NHCL 5GJTH 2R8SH 5JW3L 1FZMB 3OV6A 4PJ9B 4WHDA 4LL9A 3CH1B 4MCYB 3PV6B 4L8DB 1BVZA 1YJDC 5I1HL 4Y16C 1NC2D 4GS7B 3LKNA 3R0NA 3O3EA 3RP1A 1I85A 4GKNB 1O7SA 4L8BA 3RGHA 1CK0L 3QZWA 4XNYH 2PYFB 2R0KH 5D5ME 4G8IB 3EKCA 2XT1B 3AVEA 3C6LC 1ZHBB 3L7FB 1PSKL 2BY0A 1T66C 1MFCH 3WN5A 2DI9A 5T5NG 4EN3A 3FQRB 3KNBA 2G75A 1WCBB 4DVBB 1KNOB 3HI6H 1CYGA 4PJ9C 1QYGL 4PJAF 3VMOA 5DZLA 3HC0B 2P8PB 2VTFA 4S10A 2X4SB 5F7YC 3SDAD 1KJMB 4XAWH 5DMJB 1YUHB 4GS7C 3NCBB 1C5CH 2QL1A 3T0XA 3TPUA 2BFVL 4G6ML 4L4TD 4BFIA 4W4NA 1IAIM 5BW7C 4JHAH 5D7LA 1C5DA 4EXKA 3QG7L 4ZS7L 1WZ1H 5D9SA 4C83A 5IB4B 5LGKA 2VLKB 2DL2A 4J3WA 3V5HA 3IXTB 1S7UA 4CJ1A 1UJTA 3DUSA 4U1KA 5FA3B 1EEZA 1KCLA 1OD9A 4HWZA 1SVZA 3BGMA 4XNQA 3OAUL 2VXVL 7FABH 2XOTA 1S9WA 2DTML 2BK8A 5B3JE 3GK8H 5D1XD 4PG2C 2ESVE 2DQTL 2DMCA 4QHNA 4WWKB 5DD0L 1J12A 2F54D 5CD3A 1XGQB 3V0WL 3MLVL 4WCYL 1FPTL 1U2CA 2EH8H 2FEDC 5AAWA 1C08B 1J1OH 3QEQB 1ZEAH 2ICEA 3K8LA 3EZ8A 4F3FA 1BJ1J 1CD8A 3ISWA 5CZXD 5HJ3A 3CZFB 1NCCL 4NQVB 5MEQA 5L6YL 2APWA 1YEDA 5ISZD 5C0BB 3U6RB 4OD1L 5DMIL 4WFHD 1AI1L 5ALBH 4IRJB 3K8MA 1JPFB 5B8CA 4WWKC 3BISA 4DKDC 5KW9L 1QLEL 4XZUA 4L29B 1CE1L 3IJSB 5J6HA 1G7MB 2B1HH 1Z3GH 4QRTB 1FZKA 3FZUD 1LD9B 4PJIE 5T1LD 3NFPB 4QYOB 3V4VH 4PPTA 4NRZA 1G9NL 1N64L 2JB5H 5IBLC 5I8OH 2NY5L 4ZPTA 3TM6A 1BOGA 5IROA 5TDOB 3EJZC 3LHPL 5GRYA 1ACYL 3MQIA 1MIMH 4NQSA 3ZDZE 1XZ0A 4M6OH 3K80A 2NZ9D 3IFNH 1DQDL 5DTFB 3MACH 3ULVC 4HPOH 5DK2B 43CAB 5ESQA 3DO7A 3MBEA 1SYSA 4IRJC 3ZKMD 1MAMH 4GRMB 1S9VA 1IKNC 2BP3A 3WNLA 5AZ2L 2JK5A 5IHUL 1XR8B 1P6AB 1ZHLB 2H6PA 4EOWL 1SJHA 4QO1A 4B0MM 3CFDB 2F5BL 3TO4A 4QXGL 3GIZH 1T5WA 1UXWB 4KK6D 1RUKH 2BVOB 1WBXA 3V7AE 1IEAA 4ODHH 1KFAL 3A6OA 5CS7A 4QRPB 4GG6A 5I1IH 2OM5A 3Q1SL 5KSBA 1M05A 9CGTA 5GRUL 2MQ0A 4N5ED 5DF0A 3VXOA 2X4UB 4EN3D 2VDQH 6FABL 4RMSA 4EZMA 4QNPE 4O9HH 5INDA 2MNUA 2GK0B 4FABH 1R3HB 8FABA 3PDOA 4JFHD 3MNZB 3IJHA 3V6ZA 4HG4J 3PGCB 4JZOA 5I1CL 4NQEE 4MS8D 1A4JA 4D0CB 3KLSA 4S1QL 4M7ZB 4ODVH 1HQRB 1OARH 1X6LA 1LEKA 3QUML 2BNUA 3BUYB 3E3QE 5D7LD 1FG2A 3U9PH 1EGJL 4NP4L 2ARJA 3AS1A 1F4YH 3KLHC 1V3KA 2VDNL 2VR9A 4AM0B 3G9AB 3QZWG 1HHKB 3TVMA 5I18H 1YNKH 4R3SB 5HD8D 4M7ZC 4N0UA 1Q9LB 1CZ8H 3LN4B 5AWNH 3JTTA 1EVTC 3BT2L 4X4YB 3VXRB 5E6YA 3QNZB 4LLVA 4FFYL 4QY8B 1KTLB 4YXLL 4HF5L 5D96B 5C0GA 2A1WH 1S7RB 2AJUL 3MROA 3MNWA 3HMWH 4JFQB 3VDCA 4Z7NE 1A3LH 5HHXL 5C07B 1BZ9A 1KN4H 5TE4H 4WU7B 1GH7A 3H0TB 4M3KB 4LCUA 1IGTA 1HWHB 4YXKL 3RUGB 2I9LA 4NZJA 5FB8A 4U1GB 4MNGB 1S7WA 4TVSa 4JFXB 1F2XK 3EDJA 2I25N 3FHQA 4M1CD 1QNZL 3BRGC 4KDTA 5E9DB 3VFSA 3P0GB 3H9SE 4OIIH 2F5AH 1NCBL 2VERN 3QT2A 2EC9U 5IBUG 1NAKH 3UP1A 4PD4J 1FVEB 2BRQA 5D96C 5DGQA 5EU6B 3MCLL 2Z92B 1MCPH 3BIBX 3LKSB 1QBML 4NBZB 2CR3A 2H32A 1IC7H 3IDNA 3MNVA 3E6FA 4OB5H 5HYSB 5SX4I 1VCAA 1NCAL 2EH7H 4U1GC 3V6FA 1JGEB 1UKTA 35C8H 4X98A 3RWJA 4L3EA 5CMAA 1WFTA 2Y5TA 3ZZ1A 4GG8A 3H2WA 4AL8L 3FT4B 2GIYA 2IH1B 3MBED 5ITBH 3L3GA 4HZAA 4IOFC 2NY6D 4FQIH 3QQ4A 3SGEI 2V7HA 3TWCH 4WY7L 4P99A 3DOSA 4EI5A 3TO4D 4ZS6C 2BERA 5DHXB 2XKNB 3ARYA 3MRDA 4H1LA 4YAQA 4YDVB 1LP9F 1UWGL 3BP7A 2LVCA 4KVNH 1MUJB 5I74B 3BP5B 4PJ5B 3BKJL 2LABA 3HC3H 5KVDH 2GSGB 4IJ3B 2G2RA 2O5YH 3BE1H 3H9HA 4KKCC 4RGNB 4ZUWB 1EERB 3MYJB 3UC0H 2ZSWA 1AKJB 1ZKAA 1RFDL 1K3IA 1S7QA 3QWOA 2SEBA 4PRPB 5C08E 3RKDC 3NA4A 4PTTB 1DUZB 3E2HB 5HHVL 1Q0XH 2DMKA 2YA0A 2XRAL 4UMGA 4E41B 3PL6A 2X1QA 2AKRB 4PY8J 2HJLB 3ARDB 3FO2A 5F1OB 2K9UA 3D18A 1TTGA 3ZE2F 3Q48A 5I74C 1QA9A 3FMGL 4K07A 1JWUB 4IJ3C 4O5LH 5MEOA 2DLHA 2C4FT 5DS8B 5BV7L 1C7TA 5IBTL 4RGNC 5HYJB 3EYVB 3FQNB 2HFGL 3VWJA 2C1OA 1HHHA 4ZSOA 4JY5H 1K85A 3G6JF 5BQ7A 3LIZL 4H1LH 3GDBA 3PP3H 4Z77A 3E2HC 3WMSA 4EQ3A 1I3GL 4FFZL 2HT3D 4Y5YA 1FL6A 3ARDC 3LKNB 3TH4T 3TVMD 4KKNA 4ODXB 3DX8B 5GSVB 1H15A 1QSFB 5AAMA 4OGYL 1FAKT 4FTVE 2PW2B 4Y2DB 1UFUA 4LSPL 1G7PB 4KK5C 3GNML 4CGTA 2B5IB 2VLKE 5HSFA 1JNNL 4U3XA 1OTUC 1ORQA 3Q6FA 5L88H 3I02B 5I19L 4FQJH 4Y8DC 1M7IA 1MCDA 4UDUB 4YIQB 4L8CB 5FK9B 5J56B 1TJGL 1GVIA 3QNXA 2CIKB 4LHJB 1S7SA 2AGJH 2R0ZH 1U93B 1DL7L 1KJ2B 5BOZG 3I85A 5JOPE 4M5YH 2X42A 1HE7A 4X6CF 2HVKA 2VZOA 1D9KB 1QFPA 4QRRA 2JELH 5FHBH 1Y6NR 5IJKA 4H8WC 4Y2DC 1Y6MR 5FO7B 2CRYA 4Q9QH 2B5IC 4L3CB 3KVQA 1UA6L 3E6HB 3FQTB 1DUYB 1JWSB 1TVBA 2J4WH 3TH2T 4KV5F 2A9ML 1EIBA 3CU7A 4Y1AA 3QEQE 3U0TA 3UPAA 1KUMA 5DWUH 3BGMB 3OB0K 3NTCH 1CI5A 1GGBH 5C09A 1T03H 2I07A 1XGTA 3LQAL 5C0JA 5EZOL 1D9KC 4L3ED 5C0BE 1VACA 3PWPB 1YC7A 2J8UA 5JR1L 2FZ3A 4WNQA 1Q9KA 1BFVH 5DMKB 3WO4B 5CLWA 3D39A 4XVSL 1EMTL 3HPJB 3P9MA 1P5UA 4BH7B 1HNFA 4JFFA 3SKJL 1DN0A 3FQUA 3PQYB 4P9HL 2J88L 3W82A 4D2NA 4K7PH 5I1AB 3DV6B 1OT2A 2FB4L 4YDIL 2J7LA 2HH0L 3BPOB 5ID1B 1I75A 5EC1B 5FHAL 5D1ZB 4MA1B 4X7FC 3MJ7B 3MRGA 4LSVH 4UIMB 3C5JA 1OGAB 5CWSB 1SBBA 4NQXB 3VD9A 1XEDA 3MRJB 3WO4C 3D48R 5TQ0H 3RKPA 1BGXH 1SJXA 5CD5C 6CGTA 2I9TB 1QSEA 4DZ8A 4MNQE 2FL5A 1S5IL 4JHBA 1QHPA 4S1RL 5DYOB 4M1GH 15C8L 3PL6D 5KBNC 1R5IA 3U0WH 2AJYH 2VDRH 2ATKA 4QRPE 4HLZH 5LAXA 3BPOC 4LPYA 2OL3A 1IBGL 4HAFA 4LSDA 1MAKA 4KKAD 4NJ9H 1I8KA 3O4LB 5D1ZC 2VQ1A 4IM8A 4MA1C 4PY7A 2J5LB 4PGCA 2PW1A 1NBVH 3REVB 3VWJD 5MP6H 3EDFA 2H6PB 2HJKA 4H1LG 1U95B 4HKJB 3U4AA 1AP2A 1J1XH 3MLYL 2I24N 1OCWH 5FDWA 2ARWA 4XGZB 5E94A 5JW4R 4PLKC 4LIQE 1A1NB 1INQB 4HEME 3MLSL 5DRNA 5E2UH 2F58H 5KS9A 3D9AL 1JK8A 4XP5L 3KAAA 2OMBA 3QISA 3FT3A 2J5LC 1M05B 4OLXL 2J1KA 4WO4A 4KZDL 1N6QH 4WI3A 4GAJH 2DQCL 3BD5A 5HDOA 3SEPA 1WWCA 3TJEL 1RIVL 4LPCA 1T2QH 3FRUA 2OL3H 5DDHB 1HYSD 4HGWB 4ALAL 1AGEA 4QOKB 2BY3A 2DJUA 1TJHH 5ELIA 3QH3B 4XXCA 2MCG1 4LSSH 4X7EC 4LHUB 4OQTL 4X6BB 4KK9C 1V3MA 4JFDE 3VXRE 5SWQA 2YRZA 5F7NC 2P48B 2XTJE 5J06A 3DI3B 4G6JH 2VITA 3ARSA 4I2XB 2J8OA 2WBJB 4QHMB 4FA8A 3FN9A 5E6IB 5FYKU 3HUJA 1I1CA 3S9DB 4XX1E 2Z0BA 2E27H 2A6DB 4LU5H 4AH2B 5ICXA 2H41A 1R3IH 2NTFA 5T5NF 4Y1AD 2VXTL 4LLMB 4MQ7A 1P4BL 3PHQA 5GRWA 4CADA 4GFTB 5E9DE 5C09D 4MA7H 4FQQB 3EAKA 5B22A 2VYRE 2AQ3A 1HSAB 5H37H 3FO9A 3SGKA 2CDGA 4OQ1A 1ES0A 1KELH 2WBJC 4U0RB 3T65B 2BVQB 4U2YA 1YYMH 5E6IC 2F53A 3LH2L 5EU6E 3D39D 1NFIA 1UZ8A 3CMOL 2KUTA 3QQ9C 3JV4B 3SO3B 2BSTA 1RZFH 4JFFD 3GJFA 3FB6A 4OCSH 4NNPL 5C7XL 2ZSVA 5FB8B 3VGHA 4AY0A 2FEEI 1PBYA 1N26A 1YN6A 5BO1H 2W07A 2MQ3A 1IM9A 2XWJB 4RWYL 1VFAA 1CLOL 4OKVB 4W81A 2X1WL 4HWEL 4WDIB 1S78D 3LS5L 2R2CA 3MA7A 2DIBA 1EZVY 5D72H 1UVQA 3VXTA 4U0RC 2X4NA 2V2WA 3LKQA 2VRAA 3RL1A 4D9LL 1A6VH 1G7HB 3SO3C 2W9LA 3TCLA 1BJ8A 2DN7A 1ZLWK 3QIWB 1F6FB 1I9JL 1OB1B 4HLZG 4K2UL 5SV3A 3WFDL 4GRLA 3PP4L 4KTDL 4LLWA 1CFBA 1FNFA 2YD3A 3VFVB 1PG7X 2QHRH 2GSIB 1O0VA 3MA9L 3SBWA 1HOCB 3R1GH 3V4PH 1FYTB 3GJFH 4KPHL 2WWMC 3MBXH 4GAGH 4PRPE 4PJAB 4YDJB 5EIIA 5K9QG 1RIUL 2ADGA 3LKRA 3GSUA 1BEYH 4EI5B 4NFDA 3Q3GB 5C3TA 1A6TB 1BF8A 3QIWC 3DURA 5IM7A 1M6OB 1RZKH 1Z9OA 3QXAA 5GS0L 1OGTA 5E8DH 2DM4A 1NCUA 4G8GA 3CSYB 1LK2B 5T1MB 4LASL 5EULV 5CBAA 3CVHA 5FYJL 2AXFA 1U8JA 4WO4D 5HYJE 2ITDB 3GMMB 3WKML 1EEUA 2FX7H 3D2UA 3I2CL 4KQ4L 4MMXC 3RJQB 3KPRA 3G04A 3ILPB 4EI5C 2PF6A 2A6KA 2AXGB 3STZA 2VUYA 4K9EH 3KPSA 3MRCA 2WAHA 3R8BB 2KPNA 3IRPX 4ZAKB 3WLWD 2OK0H 2ZOLB 5F9OH 3TA3B 4ZPVB 2X4RB 2BMKB 3FT2A 3TNMA 4OD2B 5JIKA 4ZXBB 1QSFE 2AJSL 5DO2C 3WFHA 2AEIT 3V7MA 4MQSB 4ZFZA 1N59A 1OOAA 1Y0LB 3N9GL 5F1IA 3W0WB 3C2AH 2DQDL 3DYOA 4ZAKC 5F97E 3TA3C 2EDXA 4YQXL 3CVHH 4JZJB 3HE7A 4XH2A 3VH8A 1D5BB 3O6ML 4ZXBC 1TZHA 4RRPA 3EO0A 1ZMYA 5IFJA 1NUNB 1FVDA 5H37G 4OF3A 3DECA 4P3CL 3L5JA 4PJ8A 1SM3H 3CLEH 4HFWA 4HJJH 1EJOH 2H2PD 2DOCA 3V4UL 5KVGH 3S36X 2F53D 2YEZB 4NHCH 4I48B 5E95B 4KMTL 1P1ZA 4TVPE 5JW3H 2I26N 3DGGB 4PJHF 2H8PB 4JM4L 3QNXB 5DJ2B 1AXSB 4QHLA 3FL7A 5GIRA 5I1HH 3TBVB 4JZJC 1IM9D 1DLHB 1DVFB 3BAEL 3RVVC 1I9EA 1CK0H 4NQCB 5ECJE 2H3NB 1XR9A 5C6WH 1JV5B 2V2XA 3QNYB 1CXIA 1PSKH 3IDGB 1S7TA 2GCYA 4L5FL 1IMHC 2APBA 3JVGA 4AIZB 4HKBB 3WJLC 2BSSB 3EYQD 5LCVL 1WV7T 3U0TB 3FQWA 4C4KT 3NIDF 5TDPA 1QYGH 3M8OL 4ZYKA 1FGVL 4XVUC 3OWEA 5EZJA 2LTQB 3MRPA 5D7SL 3DLQR 4GRLD 4HMCA 2V6HA 3L5WB 4GUPB 4O02L 3LEXA 1T83C 3F7YA 1DVFC 2J8UB 4I3RL 1INDH 2BFVH 4G6MH 5FFLA 5I8CA 3RWGB 4LSQL 3C8KA 2XICA 3FFCB 1OGAE 1L7IL 4KZEL 3QG7H 4ZS7H 3VXMB 4NO2A 5CGMA 5JQHC 1PVHA 1HCFX 5TGBB 1MCSA 1IEHA 3RGVB 4WU5B 4OTXL 1I8LC 3V0VA 2KBGA 4JDTL 3OAUH 1BLNB 2LTQC 2VXVH 3DMMA 4EVNB 3P4MA 5IW6A 4HX1B 1C16B 2FO1A 3KXFE 4G8GD 2DTMH 3O4LE 4X9FA 5K9QI 5HYQB 1UENA 3WUZA 2DQTH 3F6IA 1YEEL 4TSAL 2I60L 5DD0H 5DQDL 3D2UD 3DIFA 5E6ZA 3BZFA 1QHOA 4ZFFA 1GPOL 1BWWA 3KPRD 3V0WH 1MLBA 1QSEB 2CIIA 3MLVH 3KS0J 4WCYH 1HHIB 3RGVC 1FPTH 1JPST 3KPSD 4G7YL 1A4KB 2XWBA 4OZHA 2O61B 3MZTA 2WP3O 4ORGA 5F88B 3PABB 4I4WA 3C5SA 4P2OA 1NCCH 4XP1L 3CX5K 5L6YH 2PETA 5C0AA 3MRHA 3GSQB 5KANG 2DQGL 4OD1H 5I1LA 3T77A 3VFTB 5DMIH 2HT4C 1BP3B 1AI1H 4BFGA 3QDGA 2ZNXA 5KW9H 5BJTB 1QLEH 3QQ3A 1CE1H 3A0OA 1E6JL 1SEQL 4ZODA 5CEXB 2H1PL 5KTEL 4QOKE 5B39A 2EDFA 4HQQL 1G9NH 1N64H 1L4IA 5J9PA 5C0IA 2EYTA 4HHAB 2NY5H 1UH2A 3HE7D 5KS9B 5MENB 3LHPH 1ACYH 4OZFA 3CUPA 2DQEL 2BCKA 4I2XE 2P45B 3QP3A 4PJ8D 1C1EL 1DQDH 1F3DH 5DMYA 3VRJA 4XCFL 4LPWA 5AZ2H 1AGDB 5IHUH 5IK3A 3QUMA 4POUB 4EOWH 5GSRB 1R3LB 3Q2CA 5DGRA 4ONFL 1XAUA 1F6AB 2F5BH 1BBJB 1EGJA 4QXGH 5FGCB 3F6LA 5GGSA 3ARXA 3RNQA 1VADA 5IUSA 4GG6F 1BD2A 1KFAH 5DFVC 4DKAA 3K7UA 5SWSA 4X7DC 2I5YL 5ACZA 3TIEA 1MFDL 3Q1SH 3FHAA 2AXHA 3PWUB 5KVEL 3SCMB 1VFBA 1T20A 2I27N 4DQOL 1UWEL 1DN2A 5GRUH 2BDNL 5MERA 2H2SC 3AM8C 1CGXA 6FABH 4Y19B 1IEBB 2X2YA 4PJ7B 1RZIA 3VH8G 2DQIL 4RRPG 2XA8L 3NZ8B 5I1CH 5KSUA 3DXAB 2PTTB 2R69L 5D6DA 3IKKA 3V9FA 1CGUA 4CDGC 4S1QH 4QKXB 3IS0X 4YBQD 2X41A 3BMVA 5JXAL 5LGJA 2P44B 1SMOA 1RUAL 2CGRL 2EIZB 3QUMH 1ES0B 3SCMC 5FECA 4RA3A 3EFFA 4H26A 4UILL 5E4IA 1Z5LB 1EGJH 4NP4H 1N5AA 5FYKD 4HWUA 1U9KA 2VDNH 3DWTA 3VXNB 3ZE1E 2K7QA 4G3YL 2VZVA 3GSVA 5HDLA 3HI1A 3QB7C 1F3JA 1EEQA 5HPMA 1MI5B 1WBZA 2DQFA 3DMMD 5EFIB 4MVBC 4F33B 1YMHB 2BRRL 4M5ZL 2R4RL 2EDWA 3BT2H 3RX8A 1AQDA 1R0AL 3RPIA 3CMGA 3MA7B 4FFYH 4MXQD 1UVQB 3G6JB 1PLGL 1NC4B 5IB1A 5DK3A 4YXLH 2G9HA 4HF5H 1I9RL 4PJAE 2AJUH 3K46A 4JPIB 2Q7NA 3GI9L 2C9AA 2X70A 1IC5L 5HHXH 1U3HD 4M62L 4OZIA 1FN4B 2VAAA 3SPVB 1MJJB 4YXKH 2R2BB 4F7MA 1BVLA 1QNZH 2YHGA 2N7BA 3T1FB 1JNLL 5C0AD 1RZKC 1NCBH 2Z9TA 3R0MA 4XMPL 5EUOB 2VH5L 1RQ5A 3QDGD 4LFHG 4KI5D 2A6IB 4PGEA 1CG9A 5EO9B 2EE2A 2R23A 2NNAA 1REIA 3MCLH 1HZHL 4JCMA 3JSSA 1RJZA 5DJXA 3BQUA 5DQ9A 1RURL 1OP3H 1QBMH 5KANI 4M4PA 4JPKL 1G7IA 2VO5A 1S3KL 4HK3N 4PD4K 1NCAH 4F2MA 3EOYG 1F8TL 2R1WA 5DSCA 3X14A 4K9EC 4NC1C 4NO5A 4ZO7A 2Q87A 2X4PB 4EJ1C 2ZPKL 5BXFA 1T5XA 4OFIA 4AL8H 1MY5A 5GRJL 4I5BB 1N7ML 1MHCB 4H0IA 4WY7H 3NAAL 4KI1A 2NXZD 5DJ0A 4KDWA 5I0DA 4YH6A 2ZUSA 2YOCA 2BHZA 3QBTB 4UV4L 3W0WE 4J3XA 1F13A 2EC8A 4ISVB 1UWGH 1BD2D 3WE6A 3MCKB 3WFZA 5SWSD 3GUTB 4L1HA 1A2YA 1EPFA 3BKJH 5K9KA 1XH3A 4NUJA 2HTKC 5TDNA 1G7JB 1B0GB 3GO1L 5D8JL 3WIIL 1FVCB 3QR2A 5EDXA 2KZWA 3B3IA 3QIUB 5B39G 1RUPL 5DT1L 1RFDH 3JWDL 4XP6L 5IVXA 5CSZB 1R5WB 3CCHB 1ND0A 5HHVH 3CC5B 4XCNB 2XRAH 4OZFG 3NCFB 4M43L 5EBLB 5FUOL 1K2DB 4Z0XA 3P0VL 2B0SH 3MLTB 3VH8B 4RISL 5FV2A 4PV8A 3ZHKA 2MSPA 3FMGH 3WSQL 2IEPA 4HFWB 1K8IA 1U91A 5GPRA 4NBXB 5BV7H 1B9ZA 3QIUC 5IBTH 3GSRA 2HFGH 2L4OA 3VI4F 4NWUL 3LIZH 4G9FA 1A7QL 1I3GH 4CVWA 5KZCD 5C0DA 3KPOA 4FFZH 4Z5RB 4LAQL 3RRQA 4OGAC 3PIQA 3OL2A 2W38A 4TNWK 5LJYH 3JV5A 1E4KA 3GHBL 3DRTA 4OGYH 2DQUL 5EO0A 2ED7A 4ZUSA 2E9WA 5SX5H 4LSPH 3GNMH 3VXME 2GITA 2ZP0T 4HXAL 4POZC 4WUKL 1JNNH 2YXMA 2R9HC 5F1NA 5ICYB 1A6ZB 2DWEA 5I19H 1Y18B 3PWLB 1KIPB 2FHCA 3SN6N 1TJGH 3S97C 1DL7H 3D69B 4ONHA 3RTQA 1H0DA 5F7MC 1LO4L 3QO1B 5I8CB 2FO4A 2XYCA 3I3DA 4Z95L 4W4OA 1C7SA 3OPZL 4RFOL 1YPZF 5EZIL 3O0RL 2EKSA 3MV7D 5DHYB 3X12A 1WISA 2CLZB 1A6AA 1UA6H 1D5XB 4ZDHB 4MJ6A 3STLA 2D7MA 3LKPB 3BQUD 5A3ID 3BIKB 2IGFL 4OBSA 2A9MH 4PJFF 1VKXB 4L8SB 1NBQA 4S0TD 1IL1B 2CK0L 1CR9L 1TVHA 3NACL 3BH9A 3P4OA 2BXYA 3LQAH 1DTUA 5M7QA 1FRGL 1ZGLA 1QKZL 1U92B 3CFCL 5JR1H 2XKUA 4J3SA 2WINA 3MUJA 3F7QA 4ZUTA 1GZPB 4X99B 2C4FU 1H8SA 4X0KB 1Q0YL 1ERNA 4ODUB 4XVSH 1YA5A 4XTRD 4IOIB 3MLWL 4WEMB 3SKJH 2MQCA 1KJ3L 2C1PB 1R5VA 4L8SC 2ZUTA 4P9HH 2J88H 3MOBL 1BZ7B 4FFWC 4P2OB 2FB4H 4YDIH 5EIVA 2HH0H 4MJIA 5MENE 2YUZA 3CDCA 3JXAA 4KK8D 5E70A 2YXFA 2MKLC 5FHAH 2VL5B 1H3PL 5SV4A 1FZOA 1CCZA 1A1OA 2YWYA 2V5YA 5A40E 1ZWIB 4APQB 3QDME 5FGCE 1S5IH 4LGRB 3DYPA 4S1RH 15C8H 1U8IA 5C0IB 1MH5A 3DVGB 4P2OC 1R24B 3SJVB 3MRFA 4JGUA 1IBGH 2IQAA 3FB5B 3VFGL 3V5KB 1ZV5A 4ODBD 1KYOJ 4QTHB 1T1ZB 4L4VA 1HI6B 1N3NB 5J57B 4Y19E 3QUMB 4CBPA 2YSSA 5K9JL 3OAZK 3MLYH 3PHOB 4G9FD 2EYRB 2BNRE 4BFBD 4APQC 1NL0L 4IBLT 1LP9E 5BZDB 2ZUXA 2OX5A 4FZ8L 3RNQB 1UB6B 5CJXC 2V5TA 3VXPA 3IDMA 4H0GA 2V2TB 3MLSH 3D0LA 2RBLA 4PJCB 5GGUB 5ACZB 3TIEB 1S9XA 3D9AH 4JG0L 5J1AB 4XP5H 5KSVB 1KLGB 3HZYA 3O3BA 3QDJB 2UWEF 4OLXH 3ABZA 4KZDH 5MERB 3VD3A 1LO0L 3QJFB 4PRDA 2DQCH 3TJEH 1DDHA 1RIVH 2D3VA 1NCNA 4RNRA 1A9EA 3PWVA 1T6VN 3ZE2E 3UO1L 4ALAH 5F96L 1MI5E 5DEFA 4JQXC 2VWEC 5D7JA 1G7LA 4G7VL 4OQTH 5ESAA 4WJ5A 1EHAA 4PBWD 5HVWA 5D70L 3IKCA 3IS1X 3R4DA 2EYSA 3G6JE 3HUJF 1J10A 5DK0B 4M7LT 5JZ7C 1TCMA 3IAQA 4U1NB 5FM8A 4BSWB 2X40A 1AE6L 1WAAA 5EU3A 3WDHA 4NSKA 4Z7WF 5F3BA 3FQXB 5C0NC 5HPMB 5JDSA 2VXTH 1N8ZA 1P4BH 4JO3L 5IMMB 4RFNB 2EICA 3EJYC 3G5ZA 3P30L 4NKDA 1CDYA 2B7DT 1CFTA 4NQDA 1HK6A 3LH2H 4JAMB 1B2WL 3JWOC 2Z93B 3CMOH 3S96A 1GGTA 5I1JL 1X7QB 3HNTL 3QUKA 5IHBA 3L3HB 4NNPH 3V0AC 5C7XH 4TRPL 1MCWW 3QFJA 1WIPA 4RFEA 1MPAL 2CXKA 3BZ4B 2YD7A 3L3JA 4MJID 2APXA 4RFNC 2XQYG 4OCYL 4RWYH 2A74A 1KCUL 1CLOH 3LV3B 4GW5A 1FE8L 5D2NB 4HWEH 1IFHL 1T1XB 1T04B 3LS5H 3NN8A 4KV5E 4LLAA 4NZUL 2JB6B 4QXUL 5E4EB 4D9LH 4RIRB 5DJXB 5IMLB 3OBAA 4YPGA 3L95B 1ZHKA 1ZSDB 2IPUG 4NKIL 3DX6A 5HI3C 3HR6A 5FGBC 1FIGL 1I9JH 1K3ZA 4K2UH 3X14B 3WFDH 3SE8L 3AU1A 2V17L 4ERSL 3KYAA 4KTDH 5EU4A 1TETL 1QTYT 4X7SL 3QPQD 3MA9H 5IV2B 1T2JA 1BM3L 5D2NC 3KYNA 3UBXA 4L4VD 3IJYA 4KPHH 4P4RA 4R0LB 1E6OL 3DHMA 4CU7A 5E4EC 5SWZA 1RIUH 2Q86B 4M8QB 1FL5A 4HC1L 3SGDH 4D0DB 1AIFA 2IALA 2DQJL 4OIAA 1SEBB 3MGTA 1S5HA 3GHEL 4M3JA 2IFGA 3ARFA 3VGDA 5GS0H 3T4AA 5ETUA 2N1KA 4MA3B 4WI7A 3NFSL 4NUJB 1UKQA 4D8PA 4X6EB 5JMRA 4LASH 2EEDA 5FYJH 1B0RB 3TIDB 1UYWL 4JM2A 3WKMH 4LCIL 4R0LC 5DLML 3LS4L 3KHOA 5T5FL 3I2CH 4KQ4H 4E0RA 4U1HA 5EC2B 2V5SA 3DPBA 5IVXB 3GGWA 4NPYA 4EDWL 1JWMB 2EXYC 3JV6A 2LU7A 2EZ0D 4TYUA 3U2SB 2IJ0C 2GJ6A 1SYVA 5D7JD 4ODWA 4M6AA 1L6ZA 2AJSH 5E8NA 1PW3A 5B38B 4GXUM 1SY6L 1CIUA 1QR1A 4GKZB 5K9OB 3LQZB 4MDIB 2W65A 3GMOA 3U48A 4FOMA 3CFBA 1T0PB 3N9GH 3DSFL 2CKNA 3VU2A 4M00A 2CUHA 2DQDH 1BWMA 3HA0A 3HAEB 5GISL 4YQXH 4N9GA 3O6MH 3QDHA 1QFWM 3ZKND 4G6FB 5FOBB 5CJQL 1YJDL 2BSRB 1KG0A 4P3CH 1BFOB 1NEZB 1ZGLP 3UCRA 4HBQA 4U6HA 3V4UH 4NQDD 2FHBA 3MRIA 4NZDA 1JMZA 1RU9L 3JUYA 2FWOA 4EI6A 1SQ2N 2YN3A 4KMTH 5IEHB 4MHHG 2XN9A 1FZJB 4JM4H 3TLRA 3QFJD 3ZL4H 1MWAA 4R8WL 2XQBL 2VDML 5TE7H 3TBWA 1TPXB 2DKSA 2EEBA 4LLQB 5HI4D 3OKEA 5C6TL 3CDYA 3BAEH 3IVKB 2WQ8A 2ZCHL 1EHXA 4HIJA 2DWDB 4N8CL 4R90L 5MHSD 5GS0D 3VXUA 3LQAC 3EGSB 3VFUB 1WTLA 1S8DB 4AIOA 4L5FH 5J6GA 1A9BA 4WUUB 5BS0D 5FYJD 1TQBB 3NFNA 4ORZC 5LCVH 4YO0A 1M71B 3M8OH 4N9OB 1D7FA 4CU8A 5GS2H 2VLLB 1FGVH 3RU8L 3KYMB 3U82B 1AFVL 5D7SH 1TPXC 3H3KA 4YBLB 4CMMB 4O02H 2XWTB 5DRWB 2H26B 4I3RH 4PGBB 5IHZB 4ODTL 2CD0A 2EXWC 3BIAX 4LSQH 4AEHL 2WINB 3T0DA 1L7IH 2WUCL 4KZEH 4KUCD 4XPTL 1UGNA 4QRQB 4U1JB 3SGJC 4HIEA 3GMNA 5IB2B 1U2HA 3CD4A 5SWZD 2G5BA 3TV3L 3O3DB 3PJSA 1TQBC 5CJ8A 5CIPB 4I9WD 1W8OA 1LILA 2GT9A 4OTXH 2C3HA 3MRMA 1HHGB 4HAGA 2LE9A 1K5NB 1I7TA 1AXIB 1KPRA 3SJVE 4JDTH 4YBLC 1XCQA 1LE9A 3DETD 3S6CA 5DRXA 4K8RC 3FOMA 4PJXF 2P8LB 1YEEH 4MB4A 3GMPB 3VFMA 1EXUA 4TSAH 4JM2D 2I60H 1Q38A 5DQDH 1KCVL 1GPOH 2GW5A 1KEGL 2D7NA 1PX4A 4OZHF 5F9JB 3ALXA 2GQHA 2V9QA 2X5PA 3QEUA 4G7YH 3AY4C 2VWEE 3WL9A 2GJ6D 3UBXG 2Y5EA 5CJBA 3DGCR 4Z8FL 1NCDL 2IQAB 4F9LC 1NGZB 4PGDB 3FTGA 4XP1H 3DI2B 1T2XA 4IOSD 2CDFB 1F11A 25C8L 3QDJE 2DQGH 5CFHA 1BBDL 5GZOC 3RWFB 1I7UB 4P3WA 3LSOB 5CEZE 4OFDA 4BQCA 3QIBA 3P77A 4FXKA 4L9LB 3IFOB 2CSPA 1E6JH 4D9QD 1SEQH 4NNYB 2FIKB 4F9PC 5KTEH 2H1PH 2F74B 4PYHA 4IS6B 2UYLB 4AQOA 1JGVL 1RK1B 1X4ZA 4HQQH 2EKJA 4XMLL 5IWLC 4XI5C 1RJYA 3UTQA 4Z76B 3UAJC 3OAYK 2PCPA 4R2GD 1QRNA 3WEXB 2ZUWA 1MFEL 1OLLA 3WS3B 4K71B 2DQEH 3H9ZA 4GMSL 4JN2B 1CFQA 4GQ9L 1C1EH 1OAQL 4KJQC 4XCFH 3T3PF 5HDQL 2P5WB 4L9LC 2JJSA 3BP4A 3GMRA 4ONFH 4G8EA 4MD4A 2CKBA 2B2XL 3V6BR 3X11B 4F80A 1T1WA 3UMTA 3TBYA 1CDUA 1NBZB 4P23B 5D7IB 2I5YH 1MLCB 3QCUL 4PJEB 4QCIB 1MFDH 4MHHI 5IMOA 4WRLA 4K71C 3BO8B 5FUZL 3VXUD 4M6NL 5KVEH 2FJHB 4X6DA 12E8L 3O2DA 3EHBD 4DQOH 1UWEH 2BDNH 1IVLA 2E6JA 2NX5B 2DAVA 4PLJD 4ZQKA 2YD4A 4LBEB 5CKGA 2YBRB 1CFNB 1XF1A 2DQIH 4ETYA 2XA8H 1S9YB 4NO0A 3VG0L 3FB7A 3QG6A 5ITFB 4X4XB 1RPQA 1LO2L 2R69H 2VLRA 3MRNB 4X4ME 3TN0A 1I8MB 4ZO6A 4YHIB 5JXAH 4P23C 1A5FL 3M1BB 4NN7B 4O51A 5J1TC 3T8XB 3L3KA 5ILTL 2BSED 1FLTX 1I8IB 1RUAH 4UNTA 5D2NE 1CLYL 2CGRH 5ERWA 1KGCE 4F7EA 4LIQL 1IGYB 4M7LL 1ZK9A 3D85A 4MD5A 4PJHE 4UILH 4YR6B 1XF3B 3MUZ1 4JQIL 2JKXA 4IMLB 3GEWB 4G3YH 5EBMB 2VZ3A 4LKCA 2E6QA 3R8QA 4JLRA 4PP2A 4NKMB 3WHXB 1HXYB 2WIIB 1X4XA 2EECA 3ZO0A 4M5ZH 4NN7C 2R4RH 4UUJB 3SGDI 1M7DB 1R0AH 1QO3B 1OTSD 2M2DA 2YPVL 1GZQA 4JFHE 4ZOCA 5FO8B 1PLGH 5JOFB 3NIDE 5DD6A 1I9RH 3EJJX 4JFEB 4CVZB 3KPLB 4OZIF 3GI9H 5DJ6B 4UBDD 2VQUA 1G84A 1ZA3A 4A2MA 1IC5H 2VDPL 4M62H 4KMQA 3ELAT 4H88L 4XB8A 4OD3L 3MODL 4UIKL 3OKLB 3RWHA 3UPRA 4JRWA 1FFQA 1JTOA 3IU4L 4XMPH 3SE4A 2NY4B 4V1DA 5DI8B 1YY8B 4NO3B 5ANMA 2VH5H 5F7WC 1I1FA 4DCQB 2BC4A 4LLDA 4HULB 3NOIA 1XIWB 2V7NA 2WSKA 3QIBD 3UBXI 1HZHH 4ELMF 2O5ZL 4U1I