2J88H

Hyaluronidase in complex with a monoclonal igg fab fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
184
structure length
162
Chain Sequence
VTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCTLYYGSVDYWGQGTSVTVSSAKTTPPSVYGCLVKGYFPEPVTVTWNSGHTFPAVLQSDLYTLSSSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a B-Cell Epitope of Hyaluronidase, a Major Bee Venom Allergen, from its Crystal Structure in Complex with a Specific Fab.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Hydrolase
molecule keywords HYALURONONGLUCOSAMINIDASE
total genus 25
structure length 162
sequence length 184
ec nomenclature
pdb deposition date 2006-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j88H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j88H02
1CU4L 1XGQA 2Q86B 2XYCA 3GIZL 4GH7B 4MGXA 1XF2B 1MAJA 3RNKB 4IMLA 3OR7A 4NQUA 5CSGA 3O45A 3CCHB 3C60A 1J10A 4KJWD 1ORSA 3FN0L 1YYLL 4YAQB 4N0YL 3LD8C 2EDJA 4DZBB 5EU6A 4LNVA 4H26A 1E28A 3VFRA 1OLLA 4LSPH 1D9KA 3QG7L 3TN0C 4Z5RB 5D93C 3VXSD 3IFLL 2FL5A 4HPOL 4UT7H 1J5OL 2X4TB 4ZDHB 4MD5B 1KLUA 5EA0H 4UZGA 4QTHB 3P0GB 5T1DL 5AZEH 2VSDA 5D1QD 2R2EB 1NFDB 3HZVA 2V7NB 4X9GA 4J3TA 3BKJL 1F4WH 1MIEL 3KS0H 4QRTA 4U3HA 1H5BB 2NXZB 2DBLH 4OLVH 4GRLB 1AE6H 3FKUS 1TNNA 3MREB 1VERA 3C2AH 5FM4A 3SGEH 4EJ1C 3MMEB 3EJYD 5BZDA 3PE9A 3MLTB 3EUUA 3BUYB 3C5ZD 4L9LA 3FQWB 1CGWA 1KEGH 5ICZB 4C4KT 1D5ZB 2DN7A 5CZXD 2BY1A 4N0FA 2C3GA 3FRPA 4TVPL 2ADFH 1CF8L 3G6DH 5C07D 2H26A 4N8VG 1HYSD 4D8PB 4ALAH 2AJSL 4W81A 2ZNXA 5I18L 1WWWX 4FQPA 2W9DL 1KB5H 1EGJH 3HZMA 3MJ8B 5ACZB 4PJBE 3V4VL 4GXVL 1DQLH 2MNUA 4MJ6B 2R69L 2EDRA 1BFSA 4RWYL 5CUSL 2NYYD 5HSFA 1UH4A 1R6VA 1YEJL 5TDNB 3ULUE 1T1YB 1P4IH 1GL4B 5D7LB 1G0DA 3PL6B 4ZS7H 4HUWB 2FEEI 2X4RA 2GTWB 1G9NL 2NY0B 4K23H 3TT1L 4RGOH 4KRPB 4WV1A 2YS4A 2W60A 2AKRB 4HF5L 2GITA 5DT1H 2H32B 4MNQB 4V1DD 1IC5H 3MYJB 2Q8AH 4OLYL 5FO7A 3WJLC 4XVTL 3NMEA 4XZUB 1X3DA 3FT4B 5DQDL 1YNKL 4PGBB 1W72B 1ND0B 5C2BL 5ETUB 5KVGL 4OKVB 1QVOB 2DQJL 4G43A 4NO5A 1OWRM 4W6XB 2DM7A 1YECH 1B90A 3QNZA 1GGCH 2XZQH 3BQUD 4CJ1A 1GHFL 2QSQA 3MOAL 5D71H 5KSAD 1X4ZA 1WTLA 3DJ9A 2KQMA 4PRNB 1UZ6E 2YWYA 1JRHH 1YEKL 1NGYA 1P1ZA 4UU9A 3BP6B 4DTGH 4IOIB 1WIOA 3UPRA 1KBGL 1A6ZA 1AHWC 4KROB 4XPBL 3D25A 4HEME 4TN9A 2F53E 3ARBC 1T6VN 4EDWL 1CT8A 1YEDB 1FFNA 1QEWA 3MNWB 2N1KA 1Z9MA 4HSQA 4I3RL 4LDLB 5E5UB 2JB5L 3FCTB 3FQUB 4QHNA 5DF0A 4JGMA 1VENA 3JSSA 3GKWH 3O2DH 5BV7L 5ID1A 3MLTA 5CHNA 2HG5A 5E8NA 1ZEAH 2LVCA 4UBDD 3QI9B 2NXYD 3RWDA 4G7VH 3MBXL 2YPKA 1JGVH 1U3HA 4G8GB 1RUMH 2Q76A 4U0RC 4WJ5B 2OZ4A 2FR4A 3MCKB 3ZYZA 5C09B 1KLGB 4WGVB 3SDAC 2WWMD 3UBXA 1RPQA 1Q9LA 4R0LB 5D1XB 1JTPA 2I25N 2BVTA 2EDYA 3K81A 5ADPL 5I8CA 1ED3B 1IAOB 1AGDA 2HKHH 5EBLB 3IAGC 1WBXA 3CFEB 4UB0L 5I1IH 3KYOB 1HE7A 4FG6D 2NMSA 3MA7B 3KXFE 3V5KB 4GG8A 4JR9H 1IGJB 5CJXA 4U1JA 5J6GA 4RGOL 4WFFD 5ILTL 5JHDB 3I75B 4JM4H 3MJ7A 5EU3A 1II4E 3P11L 2C7UB 3ZKXC 1K2DA 3DX9A 2X4RB 3MRKA 5DHYA 4YC2C 1J05A 1WEJH 4GBXA 2Q3AA 1IAMA 2IANB 5I8KL 5FYJU 4LVHC 2P5WD 2J1KA 1SM3H 4ZUWA 4ODHL 2EDEA 3TIDB 5T5NG 3TVMD 4NWTH 3FN3A 3LVEA 2IEPA 4P57B 1HEZA 4DKFH 1I9EA 4X80H 4P23A 1YEEL 4LLDB 5CSZA 3L3KB 5I1AA 5I1CH 4GUPB 3WCYA 5ALBL 1LNUA 3C6LD 3Q5YA 4KTEL 3MO1B 4FFYH 5E0QA 3L3HA 1CICC 2PTVA 4G9FE 3QFJA 4NSKB 2J2ZA 2IPKB 3L3OB 1N5YH 4X7SL 5I2IA 3OV6A 1KJMB 3MLYL 1OSPL 3SCMC 1WAAE 1JZ7A 5E9DE 3AU1A 1J11A 2JIXD 4PREA 3GMLB 4XVJH 2XWBB 2IBBA 2JCCF 5DMKB 3LKSA 4NQDD 2JTDA 1FHGA 3G08B 4BZ2H 4EDXA 1FLRH 4NKMA 1DQQB 3UO1H 4LCWD 3LN5A 4XVTH 3VXQA 5TF1H 4OZGA 2FLRT 3RJDA 4QHLA 4YFLF 1MJ8H 4FQQB 4G8EA 4ENEC 1OT1A 4NWUH 5LGHH 5GRYA 4W4OA 5KSVA 2J8UB 3JWOL 2P44B 4LCWB 3IXAB 1ZVYA 4JHZA 4NQXA 5KANG 3RA7L 1XGPB 4MDIA 1ZLVH 5EH1A 5FOJA 4P3DA 4ZXBB 4ZFZA 3PDDA 1XH3B 1S7TA 5D7IF 1ZLWH 4P2QA 1S7XA 5GHWL 2EDOA 1CLOL 4RGMB 2V2TA 2W38A 1CFBA 1FNAA 4WI9A 1XR9B 5EZLB 2G9HB 3OKOA 3BSZL 3HE6A 3X13A 1E4WL 4G9FA 3HC3H 4IRSD 1I3RA 2PETA 1KBGH 2EDNA 1GAFH 4NNPH 3REVB 5CEZD 5FUCE 4LCWE 3C6LB 5F7EH 3TJEH 1CXIA 5D1XA 2AJUL 1OM3L 1OAYH 2BFVL 1S78D 4PGJA 1XCQB 5IJVB 4XX1E 4H8WH 1J8HD 4Y5YC 2HA1A 4X6EB 2HLFC 1MCHA 4ZOCA 4ZSOA 5BV7C 4JKPL 2WBJB 3WUWA 5IVZA 4KUCD 5DRWB 2IAND 3D69A 3LRSB 5IHUH 3SPVB 2CIKA 2X89A 1GZPB 1M6OB 4Z95L 4JQIL 2FJHA 5FDWB 4NC1E 2GFBA 2BHZA 1NFIB 4NM4L 2RQ8A 3QA3A 4DKFL 1FNLA 2Z92B 2FYYA 2O5YH 1NGPL 3QQNA 2KBGA 2X05A 4R97B 3BDXA 4JDVB 3TNNB 3RAJH 2XTJB 4HCRA 1MI5E 2O26U 2DLFL 3UTSE 1J0KA 4YHIB 3O3DB 5T5NF 5DRNA 3D87B 5FB8A 3GNMH 4HDIA 5HHXL 3BEVB 3TO4A 5SWQB 4M6AA 5L6YH 4L8CB 4OT1H 2HWZL 1AC0A 2FX7H 1FFRA 3QQ9D 3ARGB 5TF1L 2ERJC 3G5VB 1YJDC 2I07B 2OR8A 2XTJE 4BELD 4URTB 4YDVB 3DGGA 3MLPA 4OLUL 3ARDA 2AJXL 3RUGF 4RFEB 2IANA 3D2UB 3HI5H 4NYLB 1LE5B 2FX9L 1YJDH 5CGMA 1KELH 4OD1H 4HXBL 1EEZB 3EDJA 4ODBD 1NGZA 1IGYB 1B3JA 4FHBD 5BZWA 4BFIB 4KROD 2R0KH 4Z0XA 3RZCC 3IXAA 1EERB 4LLDA 2HJKB 1EJOL 1H0DA 4ZG1A 4U1NB 4U3CA 1N5YL 4U7KA 1R3HB 3QFDB 3DRQB 1MREH 3ARGD 4GQ9H 4L4VD 1LEKB 2E7LA 3QULA 1OGTA 1UGNA 3F62A 4UNUA 2VL5A 3IF1A 1MAML 1NBQA 4JFXA 3UAJC 1OP5H 3NCFB 4OZIF 5F9OL 1OPGH 4LIQE 5C0BE 2QJDA 1CGXA 2CLRA 1JPGB 5DEZA 5LBSH 1WCQA 4Q2ZB 2MQCA 4OLXH 1DP0A 1Q9KB 1WC7B 3NGBC 2RR3A 3N1QC 2I26N 4F7MB 3TYGL 3BZ4B 3KLAA 3DSFL 4X0KB 3PHOB 2DI7A 4TPRL 4KRPD 1A7RL 1LQSR 3OTTA 4O9HH 4NQDA 5IB4B 4U1LA 3BKYL 4F2MA 1JGDB 3Q6GH 5ISZD 1NEZG 3E3QE 4U2YA 1IM3B 4U3XA 5I9QB 3TBWB 4J4PD 2VDNH 4DCQA 2NY7L 2A2QT 4IM8A 1IGCL 4XI5D 5ABDE 1EVUA 1MFEL 1T21B 4FTVE 5EZIL 4XT1C 1N7ML 2PXYB 4JFOA 1P4BH 5D2LE 4DEPB 5DA4A 4MCYA 5EO9B 4OF7A 2EH8H 3PXJA 3C6LA 3V4UL 4OM1L 3VRJB 4BQ6A 4H5SA 3TWCH 1A9BA 1RHHB 2OM5A 4JRYA 1ZS8B 1XCQA 1XGRB 4M5YL 3TVMA 2D3VA 1IFHL 3VJ6A 2X6MA 4RCAA 2VXTL 3HI1B 4LVOC 2H8PB 3WUWB 3Q6FB 1TQCB 1XF3A 1FDLL 4D0BB 5FUZH 4U0QB 2DMKA 4P3CH 5CJOH 2AJZA 3T3MF 3FQRB 1BIHA 4Q6IC 3BDYL 3TA3A 4TTGA 4X9FA 2HH0L 1X7QA 2FECL 4APQC 2VDQL 3JV4B 1YN7A 3PP3K 2BVOB 1XGUB 4QY8B 3ZDXE 4K9EH 2HJKA 4B7LA 1UYWH 4KZDH 2ZKHL 1XZ0A 4K3HA 2VWEC 4OGXL 3FO9A 2GYSA 4OCSH 2SEBB 2A6DA 3QWOB 4PRHD 3K46A 4YAQA 2DJ4A 4NO3B 4ODSH 1DVFA 3NFNA 2RCSL 4R7NB 1CU4H 3O6KH 5L9DL 4TUJA 1GZQA 2LTQB 1Z9LA 1I1YA 3INUL 3GSRA 2JK5A 4YBHA 5E08H 1CBVL 4WCYH 5A2KH 1ZTXH 1IGMH 1VACA 1NFDE 1EAPB 3RVXD 4UV7L 2A9ML 2DIJA 4XCEA 5I15H 1ZT4B 4LSPL 3OAUL 2DQCH 4PP1C 3QG7H 1UM4L 3BGAA 5A3IC 1A1MB 1A6AB 2Z35A 4QRTB 3H42L 1GJIA 1HKFA 4A6YH 2XKNA 1R5WA 2OJEA 4N90E 1Q1JH 3I3DA 1WLHA 4R4ND 1RMFL 4QF1B 4XPHL 5GGTA 4C56D 4Q0XL 3IGAB 3V7AE 3ARBB 4KHTL 3AGVA 3R1GL 1FFOA 4OB5L 4QTIL 3U48A 4ZXBC 1NAKH 1GIGH 3MLZL 4JY4B 1JV5A 2K7PA 4H5SB 3C9NA 3STZB 2R39A 3PWNB 1K4CB 1ZS8A 1CXKA 2OLDA 3BP7B 4G8GD 5HYJD 1S7UA 4M03A 4PRIA 1O7VA 4PRBB 2VTFA 3O4OC 4U6XA 4JFPB 5A16B 3KLAB 43C9B 2XRAH 1CVSC 4N1CA 4X5WB 3S96A 2VDKL 3W11C 4HUXB 4I13B 1OGAB 1IM3A 3EO1B 3QUZC 4S11A 1OB1B 4DCQB 1JRHI 4GXVH 5C0CA 4MVBD 2R69H 2X4UB 5FYLH 3T8XB 5DVKA 4OSUH 3U6RA 4WEBL 2G75B 5D9SA 5JO5A 1C08B 1RUPH 4OFKA 4EUPH 3MGAA 4ZAKC 1F97A 4G5ZH 2GY7B 2R15A 3EGSA 1HSAB 4HLJA 2DRUA 1I7RB 1V7NH 1RZFL 3CFJB 3LKOA 3LMJL 4CU8A 1U8OA 1R5VB 3O4LD 4WCYL 4V2BA 1DVFB 2XN9D 1H3PL 4MJIE 1PJ9A 32C2B 1AD0B 4R7DB 3QH3A 2X9WA 3PG2A 2AJZB 3C09C 2BOBB 5F6HJ 2WWKO 2HLAB 2DIBA 5IFJB 5D5MF 3E6HA 5J8OA 4PJAF 3T0EE 1AD9A 1ZKAA 3AFLA 2VR4A 5CEYA 1A6WH 2AJVH 2D4FA 2E27L 2WLZA 3MBED 4LLUA 5FYKD 5GGSB 1MF2H 5JW5A 3MRJB 4I0PC 1IGTB 1MUJA 2NCMA 4PJGB 3ZE1E 3JV4A 1IC1A 1A0QL 4IS6A 3SJVD 1M71A 3ZL4L 5ENWA 1IM9B 5HD8D 2DAVA 3VXMD 4Q0XH 4E0RA 3VXSA 3HMWH 4OIIH 3BW9B 4GW5B 1U6AH 4KDTC 3RVTC 3RUGE 3E1F1 2FD6H 3HG1E 4IHOB 3S6CA 3SGJA 4OZGE 5C3LD 3SDDB 3TESA 1NFKA 2BMKA 4HZLB 5I1HL 4NCC1 2JB5H 1AQKH 3A67L 1PKOA 2NY4B 3T65A 2CUIA 1BVZA 4EN3C 2CDGB 4O4YH 3NN8A 3FQNA 4MXQD 3ZKND 2ZSWB 1DBKL 4P4KD 1YEHL 3MCLH 2WAHA 5D7SH 1BIIB 2ZUSA 2V6HA 3OKYA 3EOBB 1V3JA 1RUML 4WIQA 3NCBB 2VDKH 4JB9L 2B39A 5MENB 1JZ8A 2VERN 5HVWA 1T89A 4EXPX 4NPYA 4P2RA 4EKXA 2HJFA 4Y5VA 3HCVB 2ICEB 1JN6A 3CC5B 1D9KB 4NHUB 1QG3A 5GRVL 1UQSB 5EU3B 1X5LA 2YXFA 2B5IB 4P46B 1JP5A 4L29B 4LP5A 5AUMB 1Q72L 5JDSB 2Y23A 4RQQA 3GDBA 1WJ3A 4JVUA 3MLSL 3F8UB 3WIFA 3AC0A 4Z7UB 3OKMA 2EEAA 2HTLD 3MLWH 4KTDL 4L8DB 4TUKH 4LSTL 3GJFK 3VGAC 2ATKB 4M1CD 3KXFA 2OZ4L 4L3ED 3EGSB 5D7JD 2PKDA 3BP7A 3PGFL 3MO1A 1I7RA 4PIRF 4HV8B 2IFFL 2OTUB 3W9EA 3P9MB 2IPTL 4WTZG 4LBEB 1VFUA 2YD4A 5E8OA 5HI5D 5SWSB 4R97C 3ULUC 1UADC 4KTEH 2H45A 3RKDD 1U9KA 3AAZA 3OSKA 4PBWD 5IMLB 4YGAB 3DV4B 1L0QA 4XRCA 4DK3A 5ICYB 5FM5M 4GG6E 3ZKXB 1CFTB 4G6AC 5EOQH 4X6CE 4EDXB 3B6SA 2HKFL 1VSCA 3KPQB 1CYGA 1F11A 1IILE 43CAB 4JN2B 3HMWL 1L6ZA 1JZ5A 4AY0A 1HXMA 1PLGL 1PY9A 3CDYA 1ZHKB 5JZ7D 4GAGL 2R29L 1MCJA 5GRWA 1JTOA 3QFJE 4HKXA 3LH2L 4PJ9C 3V0VA 2AERT 5F3HB 4NQED 4LL9A 1C7TA 3N1PC 4CN1A 4M93C 2ICWA 4JJ5B 3VWKD 5BS0A 4U6VH 4S1RL 1TTUA 3BZEA 4Z7OE 3FT4A 2OR9H 3HC0A 3DROB 1AH1A 5INDA 3G6DL 5AD0A 3NCCB 5E4IA 3QXVA 4EZMA 4M4PA 3ZDZE 1U8PA 5CD5C 1LK3H 4LSUH 1LMKA 1YDPA 2LFGA 1G7JA 4MQ7A 4Y19B 1KTDB 3SBWA 3LS4L 4YE4L 1OW0C 4HFUH 4HWBA 1U8LB 2I9LA 1SMOA 3QRGH 3MRFB 1EHAA 1A6ZB 3A6CH 1AQKL 3A67H 5DEFB 3SDDA 3DBXA 4JFEB 1Z3GL 3N85L 4X9IA 3IKCA 2RAMA 4KPHL 2PTTA 3OJDA 4ZUSB 3NBNA 4K23L 1UXSB 1IAIH 1FYTB 4L4JA 5EBMB 4XX1G 3OAZK 3V6BR 3O8XC 1B6UA 3P0VH 1NAMH 3BEVA 3RVVD 1TZHA 1FNSH 3JWDC 5BXFB 5DC9B 1H9VA 3LPGA 5E5RB 4YPJA 3MCKA 1NCTA 4MSWA 4I9WE 4EOWH 2W65B 5D6CA 2H2SD 5J11C 1K8DB 3K8LA 1BX2B 2UWEE 1PYWA 2X5PA 3STBA 4NZRH 5JOEA 3IKKA 4LCCB 2YD6A 4KJQC 1P5UA 1JGEA 5E9DD 1ZVSA 1UB5A 2WUBL 3MOAH 1OL0A 3D2UA 4NYLA 4XTRC 4YEFA 2WBJD 3VFGL 4HS8L 1X6NA 5D72L 1PKQE 5DD3L 5B38A 5E99H 3PL6C 2Z4QB 5H94A 4WUUB 3OB0K 3DX7B 4FG6C 2E8YA 3WNKA 4JRXE 4OJFL 5GJSL 1ND0A 4UIKL 1CWVA 3CDGA 4FXKB 2BNQD 2W0FA 4OKVA 1E6OH 5JQHC 3W9EB 3LPWA 2V2WA 4J2XA 1QPPA 3BPLB 4DGVL 2XXCB 4RRPG 4HZAA 1XCTB 3RWJB 4XPAH 4JFXB 1RUKH 5HY9B 1CFVH 1FG9C 3GO1H 3PXHA 5ICYA 2APTA 2XKSA 4ZXBD 1QLFB 3SKUD 4P4RB 1IMHC 1FZJA 3B6SB 4KAQH 5EN2A 3QNXB 1IGIL 3SY0B 3L3OA 3GSQA 1CGUA 5H37G 3E0GA 3TIEB 1FSKB 1LDPL 5E8DL 1CG9B 4WWKC 1X5JA 3VRIB 4UDUA 5DJXA 1TNMA 5I1IL 1KTDA 2P8LB 4U1GB 1EX0A 3KVQA 1KC5H 8FABA 1NGQL 1MHPL 1IE5A 3NCJH 4ORGB 1OTSC 1ZV5A 5KTEH 4PRPB 3UPCA 4JRXD 1Y0LA 1EO5A 2BC4A 2A6IA 5KN5B 4AM0B 2XZCH 5IFAL 4Y5XA 1Z0NA 3QO0A 3OJDB 4ERSL 4G42A 3EOTH 5I19L 5DJ2B 2JJSA 1U41A 3TGXA 5GRUH 2D03L 4BK5A 2NY3C 5BMFH 4R0LA 3F5WA 3DTXB 1QSFE 5ESVB 2WINB 3IDGB 2NY6D 1HXYA 5I71B 4RIRB 5C0EA 4X80L 3TVMB 4UAOB 4MAYC 4Z78B 1YDPB 3KYOA 2F54B 5I66B 1I8KA 4MA8H 5CIPB 1RY7B 4JPVH 4Y19A 5C2UB 4XBGB 4XWGH 1RZJH 4P9HC 4Z5RA 5J57B 3LV3B 5F1NB 4Y4KD 3SDCC 5C6WH 4N90D 3P4OA 1U3JA 2WUCH 1CZ8L 3UYOD 1IVLA 4P59H 3QDMB 3W0WA 1WBYB 5IIEA 1UH3A 4NGHL 1G9MH 3EO9H 3QEGL 1K6QH 3U2SB 2AXGA 2ITCB 4D94A 2PN5A 1FNSL 1WFTA 3QXAA 4FQ2L 3BDYH 4OCWL 6FABH 3SKNB 1JPSL 3VXUB 1C1EH 1F90H 1U42A 1HWHB 2W0FB 3L3HB 4LF3B 5J4MA 4F7CB 1FZMA 4X4MA 1A5FH 1CD9B 4I9WD 2OMNA 2NY5C 1IAKB 1S7VB 4JRYE 4L4VB 4LHUA 4DOHE 2WQ8A 1QR1A 4H0IA 1INDH 3HZYB 1UXWA 4PJBB 1GXEA 3FQTB 4PGDB 1DQLL 3IDNA 1RU9H 4NRZB 5IUSA 3SE3C 2MMXA 4MB5A 3BSZH 2PO6C 3O6KL 4WW2C 5L9DH 4JN1H 5AYQA 4LNRB 5E2UL 2J8HA 3RWFA 5A2JH 2AK4E 1XR8B 5D8JL 5T1LA 5F7EL 1OAXH 3ET9F 4AENB 4EI5B 3HE7A 5EOCL 3QCVL 5SWZA 2F9BT 4KKLD 1WV7T 1CLYH 5IFAH 3Q0HA 1A2YA 4RFNC 1NJ9B 4LK4A 1SY6L 2GT9A 4M8QB 3G6JA 4EBQL 1PW3A 3VXRB 3RIFK 4D0DB 1JPTL 3AY4C 3MRIA 5FHAH 35C8L 5T3ZD 2D0FA 1AFVH 3MYJA 4LPWA 2Z91B 3DO7A 2NXYC 5F7YC 4WFGD 1JPST 4EUPA 3VW3H 5M7QA 1I1RA 15C8L 2NNAA 1FL5B 3BEWB 5L2KD 3X13B 1U8IB 4JRYD 4LSVH 3QQ4B 1ES0A 4JFDE 1IGIH 5DJ2A 3IDIA 1UT9A 3O41A 2MCPL 1BQLL 4PRDA 4FQLL 4WW2B 4O58L 1QVOA 1FJ1B 2AXJA 1RUQL 4KHTH 1ZE3C 3BPOC 2X7LB 4GOSA 1A3LL 4ZNEA 4L3EE 3BP4B 2WNGA 1KC5L 2EDTA 1U8QA 1QBBA 5M94B 2VAAA 1U36A 4M6NL 3BMVA 2P8LA 4YHLL 3P0YH 4HF5H 2NY0D 3G5XB 2APBA 4LPUA 2YKLH 3DXAE 4WDIA 4UU9B 4X99A 1CL7L 1NFIA 2CPCA 4XNQB 3MNZB 3QUMB 2V7HA 3UBXI 3C09B 1KUMA 1YNKH 4OLUH 3O0RH 3TBYA 1T1ZB 2XWTB 5I1KL 3L3JA 3WLBA 5FYLE 4S1SL 1JVKA 1G7PA 3VFPB 5DJDA 3D85B 1HDMB 4GKZA 3H9SD 2XA8L 3PGDA 4DQOL 5DRNB 5C07B 5I75C 4PY7A 3KNBB 2P24A 4U1IA 3LKOB 2YPKB 1EJOH 3VFUA 1MHEB 2DI9A 2IGFH 4NNXB 4K3GA 2VLLA 1I8KB 3KPNA 3RRQA 1IAKA 1C7SA 1S7VA 2KZ1B 3GHEH 4L4VA 1QR1B 3PP3H 2G60L 1JF5A 1MQKH 2A6JB 1MHHA 3RHWF 4HIEA 5EOCH 7FABL 5HGAB 3EYOA 1NPUA 1NCBL 1OPGL 2NXZD 1I1CA 2IG2L 1J0JA 4YEEA 3MJ9H 4XP5H 5CILH 4RMUA 5C0FA 4EBQH 2VITA 5DMGD 5D1QB 3D18A 3ARDD 5F7LB 1P7QB 5GSVB 3ARRA 1FVCB 3O2WH 1CLCA 5EUOF 1JWMB 1VGKA 3VXSB 3K2MC 2AJYH 3MRKB 4U1NA 3QFDA 4D0DA 4OCXL 5D5MA 2F58H 1K85A 2W07A 1EH9A 2ZCLL 1F3JB 5J6HB 1RU9L 1UZ8B 5ESAA 2WSKA 4I0KA 4M6MH 4NJAH 3VFTA 3QDGD 4B53A 1S7SB 4KC3B 12E8L 1FYTE 1VCAA 4N5UA 3NN8B 1PVHA 3RWHA 1ES0B 5TGBB 2FJGB 1RIHL 4HS3A 4QCIA 4F58L 1IEHA 4WW2A 5MI0B 1R5IA 4HUKB 3QCVH 3KPMB 1OAZH 3QFJB 1QSZA 2BVPB 3QJFA 4ODWB 4KKCD 4I5BA 5CMAA 1UC6A 5J1AB 3VRLE 1RUAL 1R24A 4OUUB 4YO0A 1A7OL 4ZD3H 2Y36L 3CC5A 4KJYA 3UZQA 4EQ2A 2IFGA 1U8HB 4LMQE 2OYPA 4AMKL 2BRQA 4OZIA 4HX1B 5F7MC 1HH6B 1W0WB 5B8CA 2V5SA 3RWIB 3QPXH 1Z5LB 2EIZB 2VWEE 1Z9SA 5AUMA 4YUEH 4MA3B 2DQIH 3PGCB 4QRRB 4UOJA 3TT3L 1BD2E 2A1WH 2EC9U 4LPXA 4CVXA 3BJLA 3DO7B 1HHKA 5ITFA 4K2UH 5T1KA 4X7TB 4KUZL 1OP5K 5EUKA 1NDGB 3UTSB 2VAJA 3TCLA 5FO8B 5D7IA 2R1WA 5D1XD 4Z7WB 4HGMA 2QV2A 2QADC 2AVGA 4YFLI 4BFGA 4X7SH 1MHCB 2OJEB 4WI8A 1H3VA 3GMRB 4P2QB 1ZHLB 1V8HA 3P9LA 2OTUA 1OAYL 3HI1A 5JW4M 3SGJC 2BCKA 5E5MA 2VAAB 2WP3T 3ZHLA 2JF1A 2KL6A 3HNSH 4ZTOH 2R4SL 4PJCA 2FZ3B 4PY8I 1LO2L 2VZTA 5E8PB 2Q6WA 3ARTA 2XZZA 1KCKA 3HFMH 5CJ8A 3KPQA 3QDJB 4ZOAA 4K3DH 4M5ZH 1JGUL 2AEQL 1FNFA 1WFOA 4NM4H 4PLJD 3T1FA 1L6XA 5GHWH 5I15L 5FIEA 3L3IB 4QLRA 3PGDB 4ZUVB 1I7TA 1J8HE 2QSCL 3DMMA 5C0CB 1E4XI 1KB9J 1PLGH 3IT8D 4HULB 4XCFH 3EIFA 4JZJB 2FYYB 4O02L 4X6DA 2OK0L 2HFGH 5TQ2H 3LH2H 4NZDA 1LP9B 2HT4D 3Q5TA 2YD2A 2XFXA 3BX7C 4Z7UE 2JK5B 2VXUH 1INQA 4HFWB 5L2KA 3MRHA 5ADOH 1KENH 3MRNB 1BQUA 2OP4H 1XF5B 3VWJB 2Y36H 1DBBL 3CFJA 2PF6A 5DD1H 5I17B 3NZ8A 3V7AG 1LEGA 3ILQD 1A22B 2YC1A 4KQ4H 2ICCA 2VDPL 3VG0H 1DDHB 4QHUA 3EW3B 3L3GB 3SE3A 2W91A 4QYOB 4MJ5A 1FL6A 3QIUA 4HGKC 2EYRB 2F58L 4KV5F 2IH3B 3S35L 5BRZA 2O5ZL 5H2BA 3DBXB 5H8DA 5EORL 5B39G 3WXVL 3OB8A 5IBLC 5HGDB 1RZ7L 3WIIH 1HHKB 5BZWB 2V7NA 1IC7H 1JWSB 4XHQA 1IQWL 1ORQB 4GRMB 5I71C 1WGOA 2KQNA 3U4BH 1YPZF 4YHZL 1ZSDB 4QXGH 3B4NA 5FO8A 5KVMC 5DS8B 4OSUL 2E7LC 1U0QA 5BS0E 5IW3A 5B39A 3SJVE 3T2QA 3MMEA 4ETQA 5F9OH 3PWNA 3DRQA 4P2YA 5FCUL 1T20A 4NJ9L 1EFXB 4AG4L 4M7LT 4YXKL 4I2XE 4GMSH 4S0TD 5FGBA 3RZCB 5HHQB 2DKMA 3AREA 4YO0B 1C8PA 1DQMH 1E28B 4LU5H 3CFKA 5E5MB 1KTRL 2W65A 3LKQA 5D6CB 3O6ML 2R0LL 2H26B 4TTDD 1JPGA 2WIIB 1UKSA 4S10A 2VQ1B 4BKLA 1B0WA 3ARUA 3B2VH 4KMTL 1RD6A 5BVPL 4QRPD 1JGEB 5GRJH 3Q6GL 4G6ML 3FB8B 1M05B 4IDJL 4OCNC 2YPLE 3QDJA 1N5AB 1YPZA 3MRMB 1H3TA 4MA1C 4OZFH 4E41D 3KYMB 1M4KA 1MREL 5TJWK 4WHYG 3QWRA 5BRZE 4LCYB 4P46A 5KSAA 4PJHB 4Y19D 1BJ1J 5CZVL 1R3IH 4OFVA 1H3UA 4F7TB 1MLCB 4HUNB 3EAKA 2DMBA 2YD7A 5T3ZH 1QRNB 1T4KA 4HLZG 4WFHE 2R0ZH 4KVNL 5TDOB 3W2DH 4UT9L 1AKJD 5GJSH 1ZT7B 3H3KA 3DETC 2BNQE 1TQBC 4JG0H 5DVNA 2F74A 4DW2L 1PD6A 1HINL 2R0WL 4OM0L 2HLAA 1QLFA 5IB1B 5E70A 4RNRA 3UTSD 3GRWL 3VJ6B 4J3UA 5JLZB 3PABB 4P2OA 4RAHA 3MQIA 4JRXA 1N64H 4X6DE 5DWUH 1QRNE 2XACC 1EIBA 2F53D 4FQHB 1A3RL 3BZFB 3BH8B 5DR5H 5DJCB 4E0RB 3O11A 1S9YA 2G5RA 4HWZB 3ROLB 5GIRA 1QSEA 4O2CB 4RWYH 1FO0B 1LDPH 2Y6SD 3T77B 5BRZB 4C56E 4XP6H 3MFFA 1UYWL 3ULUL 3HE7D 2A0LC 3MUZ1 1JFQL 5JUEL 1ZHNA 5F72S 4NRYB 3U0PA 5T1LD 4YXLH 4ODSL 4M5YH 1IFHH 1ZSDA 3FQNB 2YMXH 1INQB 4HFWA 3T0EB 3TH2T 1BJ8A 4ZPVB 4DGIH 1HQ4A 3FQUA 4QHNB 3ZTJG 5AWNH 2F5AH 4J12A 2IADB 4ERSH 4LEOA 1IQDA 1MFBH 1KJ2L 1QRND 4RIRA 5E8NB 1I85C 5BVJB 1T03H 4ELME 1PSKL 1MCOL 5E8EB 2DMCA 4R8WL 4HQQH 1KCSL 3N9GL 3ALPA 3BO8A 5KVGH 3RGVB 4IIQA 1A8JH 1UJ3C 3RWGB 3NIFF 1KLGA 3DROA 4U6TA 3B83A 1BQHG 4WU7A 3KJ6L 3Q1SH 1P1ZB 2R1XB 1YMHB 1NL0H 4Y2DD 4ZFOL 1NGWA 2H9GB 3U0TB 4PB0L 4CW1A 2VQTA 3U4BL 1OF2B 3CVHL 1UVQA 5L8JB 4UQ3A 4KZDL 3OKEA 4OGAC 3EJJX 5DRZB 2FX8L 2GTZB 4GFTB 4FA8A 4YFDB 4FFZL 4Y4KA 2WUCL 4KRLB 4GAGH 2DJSA 3W2DL 1J87A 3B8YA 4I18C 3SKNA 5CHNB 4QNPF 1NGXB 3B9VA 3REWB 4PV9A 1PQZB 3QCTL 5D6DC 2DOCA 2J88L 2PTTB 2AK1L 2AXFB 1WF5A 3TIDA 4RZCA 1GC1L 2VH5H 2P48B 5HI3D 3LKQB 1IT9H 5C0JA 3MRLA 1HEZB 4X6DF 2APWA 3B2UC 1JV5B 2DQCL 4PJIB 1NCDH 1BFTA 1FL3B 1MWAH 3LY6A 4AL8L 3TBSA 3V95A 4LARH 1NLDL 3SDCB 3KPPB 1FE8L 1INDL 3JUZA 5C3TA 5J12B 5BJTA 5IEKB 5JLZA 5HYQA 1FG2A 3CH1B 3V5KA 2EYSB 1FZKA 25C8L 4TUOB 1JHTB 5IFHH 4XNYH 4LCYA 1HOCA 1PG7H 2XY1A 1ZLSH 5A40E 4X6FB 4IRJA 5ISZB 1S9WB 3T09A 3KDMB 3G6JB 3K4ZA 5T3ZL 3ROLA 1MFCH 5HYFA 4K3EL 3ZE2E 5I1JH 1A14L 3VXRA 3V52L 1BPVA 4G5ZL 2UZYB 3MBEB 1MWAB 2NW2B 4HMCA 2G75A 2PR4H 2VLME 2X4OA 3SHSA 2EDFA 1TIUA 3LKNA 4EUPB 2CGRH 3K80A 2VLJD 5I8EB 4ZQKB 4HUVA 4MX7A 2J8UF 5IB1A 1DUYB 3U1SL 2EXYD 2F15A 2X4PB 3W39A 3VWKA 4RSVA 1YY9C 4FTVB 2A74B 2V17H 5FO9B 3CMOH 2Z31D 1MNUL 4B50A 1R5VA 4CDGC 2V5TA 1QR4A 3HAEG 3WDIA 3HB3C 3QJHA 4U1SB 1URLA 2X4NB 1CGVA 3EHBC 4M7JL 4XCYA 2CJUL 3UX9B 1KIQB 1N59A 4XP9H 1T5XB 3CDCA 4E5XA 3WEXB 3CXHJ 3O11B 2CDFB 2J6EL 4Y16C 3AXLA 3TPUB 5C0GA 2DLTA 3MNZA 4LEXH 4WTXA 3SDXF 1JCKA 4WI3A 2FHFA 3QPQD 3JZ7A 4KJPD 1MCWW 1V7MH 4KKBC 1ONQB 3EYUL 5F96H 2EDQA 4WU5B 2B4CC 1QBML 5ITBL 3BYTA 4ORGA 3U9UA 1ZGLM 5JR1L 1TVHB 3BN9D 5GZOC 4MWFA 2ZUQB 4PY7B 4AM0A 4TOYH 1TJGH 2NX5B 1N6UA 1KT2A 4G6JL 2QQQA 4LASL 3QO0B 3VFUB 5CGYD 3HRZB 5CEZH 3MRDA 4L3EA 4JDVA 3VFSA 3KXFD 1LO3H 4YBLC 3HN3A 1R3KA 1NANH 3HG1D 5K9OA 1MJUH 4D8PA 2LU7A 4JREB 3TPKA 1XIWC 2ESVA 4BZ1L 2NY4C 2XTJD 2E6PA 3KYAA 2B1HL 3HMXH 4TSCH 1PEWA 5HDQH 2J12B 5HYQB 4X4YB 3D39A 3QZWG 2C3XA 3V5DB 3D18B 5DJ8A 3C5JB 3V52H 4CUCA 1PKQA 2CIKB 1OAKL 1G6RB 1T1YA 1UM5H 3WSQL 5GSVA 1GZPA 1M6OA 2Z8WC 5J12C 3X11B 3FT2B 5I1HH 5EO0B 2OI9B 3H0TB 2ZOKB 1CTOA 4WTWA 1BFOA 3NGBB 3EDFA 4P2RD 4RQQB 2AXFA 3TFKC 3KLHC 4MA7L 1EEZA 3U1SH 2X4OB 3HNVH 4TULL 4XVUC 3UJIL 1NLDH 4GSDH 1EUUA 4OCXH 1HHJB 3P40A 1JHKH 3OKLB 3P2TA 3MBEC 1R3HA 3GSNA 1I75A 4O00A 5BS0D 1QYGL 5C0BB 4UV4H 2VLKA 3V0WH 1V3KA 1NQBA 2BP3A 4D9LL 5DYOB 1UENA 2HAZA 3TH3T 4M8VA 4OZIB 4RFEA 1RUAH 4IOIA 2W60B 5C0GB 3CSYA 4JM2B 1UCBL 2JJUA 1Z5LA 1QBMH 2DLHA 2EIZA 4P0DA 4QHMA 4LVOB 3SE8L 3BOVA 1FVDB 2P1YA 1S5HA 4OCYL 3W0WE 5HYIA 4XPBH 2Z9TA 3LB6C 3MACL 4JM2D 3BDBA 5JIPA 3NPSB 3ARQA 2ZUWA 3ZHDA 1WT5C 4PGBA 4WU5A 3TA3C 5EC1A 3QO1A 1F4HA 5FYLD 3LPFA 4L3CB 5DJ6B 2EH7L 4I3RH 3H9SE 2XN9A 4K2UL 5FYJE 4Y5XC 1ZMYA 4MNHB 4OLVL 5FUOH 5CJ5A 2IALA 1J7VR 4PJ8B 5DJAB 3W9DB 4LCIH 4WJ5A 5DQ9B 1GGYA 3BKML 5MP6H 2XOTA 4TSCL 1N59B 3QCUL 1R3KB 1FIEA 1A5FL 3DVNA 3MX0A 3K0WA 3GZKA 2E6QA 1VFAA 4UBDC 1KPUB 5DEGB 3NIGE 2VLJA 2ZG3A 1UACH 4ONFL 4RBPK 3F58H 2X7LA 3P4OB 1DE4B 3U30B 3U4AA 1F00I 1RIUL 5J9PA 1FFNB 3CVIL 1LO0H 2B20A 5FV2A 5DO2D 4GG8B 1KFAH 3C5JA 4U1LB 1G6VK 3O2DL 4WV1C 3NAAL 1G6RH 4OQTH 1H3WM 5E9DB 1TPXB 4NC2B 4NFDA 3AB0B 2W9DH 3QIBB 2EECA 2C7UA 5K9JH 1JHLL 4FOMA 4NDMA 1G7QA 4X99B 4CBPA 5I30L 1FNEB 1HZHL 3TYGH 1GGIL 2EDDA 4U31A 4XNQA 4L8SB 3F12A 4KQ3L 3BT2H 4DUVA 4F7CA 4PRID 1N2RB 3RVWD 2BNUB 1CQYA 5HYJA 1U8KA 1OTTC 3HRZA 5B4MC 2PYFB 1K8IB 3BI9X 1BEYL 2CRZA 35C8H 4Q6IA 3E3QC 4MJID 1SJHB 1ERNA 5GS1A 3QUXB 1VKXB 1DSFH 5L2KB 3RY6C 3O4LE 1P4BL 4JPKL 2HFGL 1SJEA 3VFWB 4NZRL 1LD9B 4Y1AE 1I3GL 1EO8L 2PYEB 4U6HA 2R1YB 3T08A 1RURL 4NO3A 1OWWA 3VD5A 2BSTB 4QOKA 5I2IB 1IGFL 1J1PH 3IS1X 2BVQB 2VUOA 4ELMB 1KENL 2XPGB 4Y8AA 2FGZA 1FC2D 2YUZA 3WFEL 1A2YB 3DX9B 3FRUA 3QQ3A 1P69B 5LWYH 4F57H 3O2VH 4EI5D 1IJ9A 2GCYB 1SEBA 4PTTB 4EVNB 5GISL 2Q7YB 4FQQA 2XY2A 4DKEL 4FP8H 5DVLA 3RIAF 3BP5B 3C5ZC 1DUZB 4ELKA 1MH5B 3WMSA 2KKQA 4LLMB 1XIWD 4XPFL 4ZYKB 3ECBA 2X70A 2HH0H 2WWMC 4ETQB 4QOKE 2IQAB 3GSNB 5F1SA 1Y6KR 2W0KA 5E6IB 1HKLH 3RTQB 2V2WB 1JI1A 1F3JA 2OQJB 2QBWA 4KK5C 3O4LA 5IVXA 1RJCA 4GMTH 4NQEB 5EZLA 1AP2A 1KV3A 2D0HA 1C12A 3GSXA 4HPYL 5HY9A 1DQDH 4HC1H 4G9FB 1CDIA 3QUXD 4PJAA 5FCUH 3CK0H 1CR9H 1KPRB 2W1NA 4U4BA 3VFNB 3WFDL 3MBXH 2JELH 5LKNA 1BOGA 5ISZE 3QNXA 3CZFB 1UKTA 4HAFA 2ZWLT 1ZT4A 3QUMA 3SY0A 2E3VA 3PNWA 4I5BB 1LVEA 1XF1A 1VESA 2BNRA 3QRFM 3RA7H 2HVJA 1A1MA 5J9PB 3B2VL 3LSOB 3O3EB 1WQVT 1VEPA 4EI6A 2YA2A 1EZVX 1XGPA 4HS6A 1WAAA 3CIQA 4LKXB 1AI1L 3MNVA 4J3WA 4K7PY 4XNUL 4AEHL 2J8OA 2MSPA 4QF1A 3NZHL 3RDTC 3RZWA 3OR6A 1TCRB 5KN5A 3VMPA 4W6WB 3P4NB 5DK3A 3U9PL 2AJSH 2BNUA 1JYVA 1DBAH 1NCWH 3C60C 2AJ3B 4HJJL 1X5AA 3UTSA 1EGJL 3WFBH 2E7HA 1FNGA 3DVNB 3FO0H 1RV6X 2NR6D 1VFAB 4HK3J 1X9QA 4GW1A 4XBPB 2DWDA 1HXYB 3SGKA 4JKPH 2VABA 2YK1H 3KG5A 5E2JA 4BH8A 4G3YH 4BSWA 4MS8C 5IVOA 2V5YA 4G8GE 5GGRY 2GJZA 4PRPD 5DRWA 4JQIH 3PDOB 5ANMA 4HUXA 4R7DA 4QXUL 2UWEA 1ADQL 2E7BA 2XZCL 1F2QA 2VLKE 1OTTD 3KPRB 3LV3A 1NUNB 2GJJA 4P46D 1G9ML 4UNTA 3V6ZA 5C0NC 5GZND 5HGHA 1NGPH 3IDMA 3VXPB 2X42A 4H25B 3RPKA 5D5MB 4PTTA 4E41A 4ZO8A 1RK1A 3GBLA 5EU7E 3E8UH 1EBPA 3BXNA 3AS2A 4KXZH 3RFZC 1HQRA 2D03H 4XXDB 3WXWH 3LOWA 5C2BH 2Q8BH 4NZUH 5D7KE 4NKIH 4XVJL 5JA8B 4JFDD 3QPXL 3V6OC 5LJYH 4LSQL 3GRWA 3VD4A 3IDYB 1MEXH 4PG2A 2A1WL 4QRPA 5D96B 5TGBA 2RHEA 4UQ2A 2BSSA 1JTTA 1IGFH 2FRGP 2IADA 4AQ1B 1R5IB 2VXVL 2VJXA 4H20L 1BLNB 3HHRB 4C55A 5KJRL 3T2PA 5C0BD 5IP4A 5IB3A 1RZ8A 4LDOB 4KKAC 4POZD 32C2A 1S3KL 1V7NL 1BVKB 1T1XB 4FNLH 4MD0B 5D2LF 1BP3B 1H8NA 3O9WD 5C9KA 4WUUD 4Y5YA 4NKOA 1S7QB 4NP4L 3SN6N 3DGGB 4X7DC 1GOFA 4MYWB 1MPAL 1UWXK 5FK9B 1LEGB 4MLIA 2P5WB 5JW5B 3RX5A 5HGBB 3TZVA 1QD0A 4P2RB 2R2EA 3QEUB 3ZDZF 4X8XA 4YDIH 1BBDH 5BRZD 1KJVA 2C1PA 5D7IB 2W0PA 2E27H 4WVRA 4GKSA 1NC2A 2LAAA 1BM3H 3DRTB 3T0EC 3QIUD 4ZFOB 3GMRA 3U7WH 3BE1H 5D7LE 3ZL4H 2YSSA 3QULB 5K9KA 5HPOA 2FX8H 3MLVL 5J0BA 2A77L 5HHMB 3MOBH 1NUFA 2DDQH 4S1DD 1T89C 4LAJH 4Z6AT 1N26A 3S88L 4L4TA 1MAKA 3A6BH 3GI9H 5CWSA 2M8XA 5DFVC 4HHAA 4N9GA 1S7RB 5GGVH 4M48L 4Q2ZA 1KYOJ 5CBAB 1WC7A 5E8PA 3A6OA 1BBJB 5HJ3A 4PJ8C 3MUGB 4NQCB 1N6QL 3TWCL 3QEQA 3P77A 5HHNB 1AXTH 1IT9L 5I74C 4XMLH 3KPOA 4D9RE 1RZKL 1YEHH 3MCLL 4P3WA 3UTZB 4AL8H 4EI6B 4YNYB 2C3VB 2KPNA 1LK2B 1YEGL 2NY7H 2MTPA 3UMTA 3V4PL 1KIUA 4J4PA 1MFEH 4LKXA 1U91A 3K2UL 1D6VH 1CFTA 4OZFB 1NCWL 3GK8H 3QZWA 4IOSD 4DQOH 1CFNA 2QKIB 1KJ3H 3LQAC 4WFEE 1ZLSL 3MUY1 3I85A 1G7PB 4MCYB 3KLDA 3K3QA 3NH7L 5EFIA 2YD3A 3GMNB 1RUQH 3BFOA 3ZKMD 4QRPB 5CZXC 2DF3A 3UBXG 4G8FB 3V79C 3TN0A 3IETB 5F1IA 3VWKB 1VEMA 4NN5C 1U58A 5DJ0B 5IB2A 3EYFA 5JW4N 3ARBD 3JTTA 4S2SB 2CKBL 3OL2A 2ICWB 1BZQK 4XCCL 5HHOB 3S9DB 5IMLA 1BVKA 5D6DA 1WUNT 4GQ9L 4HIEB 4JZNB 4FFWD 1PDKA 5EDXA 1ZLWK 3PABA 1CBVH 3PWVA 5T1KD 1RK1B 3DHJA 1B4RA 1BJMA 4MNQD 5MERA 4PJEF 3FB5B 4HWBH 2J6EH 3FFDA 2B2XL 3GM8A 5B22A 2BVOA 3PWPB 3OAUH 4GKOA 1RZJC 3SDXA 2AQ1A 4F80A 1E4KC 1SYVA 2XKUA 1G1YA 3OAYH 4FFVC 2X9XA 1S9YB 4HWZA 4GKSB 5FA4B 4A2LA 3N06B 1GRWA 5E2TL 4A6YL 4R9HA 3GBML 3RPIB 3VD7A 3NFNB 4FNLL 1MFDH 3INUH 4JKMA 3IGAA 5EU7C 1U92B 1D5IH 4PGCB 2YHGA 3IFPB 4DN4L 5DFWH 1G7IB 2VLRB 4HKZA 3UTQA 4GXUM 2VZ3A 4DVBA 1Q9LB 3OKNA 3LRGA 3IJHB 3WS3B 2ADGA 3KPSA 1T0PB 4UI2A 4LOUC 3C6SA 1OCWH 3EDEA 5IHUL 2HVKB 4ZO6A 3H7BA 5KVEH 4CL7A 1M7IA 1DLFH 4PJXA 3KWWB 3VMNA 5IMKB 2ARWA 4GBXD 5FM8A 4J6RL 4W70A 3OQ3B 4D3CL 3HR5B 3SKOB 4Y88A 3NCYP 2C1PB 4BZ1H 1KJ3L 2AGJH 1LK2A 2PW1B 2O5YL 3OKDA 2J4WH 1K2DB 1N64L 4P4KC 1P4LB 2OMBA 1AY1H 1CICD 4F7TA 2V5MA 1FORL 3CSBA 4PYGA 5FUZL 4JEGB 1O5DT 3U79A 1BZ9B 2IWGA 5IGXH 4WFHD 3JWDH 4OT1L 3LKRA 2UZIH 5E1HB 1SYSA 4P57A 4PD4J 3UC0L 4WUUA 4IRJC 4MJ2A 4KMQA 1LNUB 1U3YA 1RZIA 1RZKH 4ZS6D 3WJJA 2YPVL 4AJ0A 2BY3A 4Z7WE 4TULH 1D5ZA 4FRWA 5EZJB 5DSCA 4PJ7F 4HJ0C 3KPOB 4DN3L 4X5XB 2AEWA 1MCRA 1FAKT 1I1AD 1S9XA 2DICA 2AJXH 4HJGB 1JNLL 4C4KO 4QXTA 5KVFL 5DUPL 1Q94B 1GGBL 1TJIL 3T0ED 4O51B 4QHKI 1KIPB 1DANU 3QUXC 2R4RL 3N9GH 2RCSH 4LFHD 3IVKA 2GJ6D 2QR0B 2R0KL 5E2VL 2HT2C 5DMYA 3MGOB 1DQJB 5IQ9A 4QHLB 3RUGB 2EE6A 5D9SB 3FB5A 5JO5B 3DVFA 5E08L 3EYVB 4O2FA 5EA0L 4J8RB 4LPYA 4YPGB 5BO1H 2OCFD 4LQFL 2LE9A 4YHMH 3EO0B 2GUOA 4RAUB 4IRJB 3MV9D 5CJXC 1I9RH 5DK2B 3U46B 4PRPA 4WV1B 2XN9B 4JZJA 5IMOB 2FBJL 4BQ9A 2V2TB 3HA0A 3MACH 2BVYA 1AGBA 2DD8H 5FV1L 3QFJD 4GG6A 2DIAA 4PJFA 3BD4A 1JWUA 2AQ3A 5E94B 2VLMD 2X09A 4HMDA 4M5ZL 1T7YA 3CUPA 4CGTA 5L8KB 3F5WB 3M8OH 5ESVA 4G8IA 1T0MA 5IJVA 5FO9A 1MCBA 4JFFB 3SQOL 3TIEA 4NNYB 5D7SL 3QUZB 1GIGL 2I5YH 3MLZH 2QSCH 5KSAC 1UVQB 2HJFB 1FBIH 1VFBA 3S37X 5F1KC 4OZHA 3D69B 3HZKB 4PUBL 4UDTA 3PV6B 3I2CH 3F58L 3MREA 4OAWA 1EXUA 4K9EC 5KS9F 2Q20A 4XMPL 1QSVA 4LRNL 4L9LB 3UROR 5F70A 1A1NB 1NGXA 1FP5A 3BKCL 5SWZD 3TF7C 4TVPD 3WN5B 2YXMA 3QQ9C 1MFAL 2DKSA 5I1JL 4NQSA 2YPVH 3TNNA 5T3XL 3L5WB 4D9QD 2LAGB 4K8RH 5TF0A 2P7TB 3U36B 3O3DA 3JV0A 1WK0A 3QUXA 1VKXA 3QIWD 3BJ91 3OX8A 3FONB 1NFDF 1VA9A 2ORBH 3RDTB 1G7MB 5HHPA 4C56B 4WRLA 4KMTH 5IJKA 1Q0YL 4OZHF 2VR9A 2HTLC 2X4SA 4MMXC 5E2VH 3QXUA 3HZYA 3NFPA 3G5VA 2VQ1A 1YEFL 3O3AA 2WMPA 3WD5H 5DTFA 4BSVB 1KF9B 2GCYA 1I7UB 1ADQA 5C0AE 1X5XA 1J88A 4HIHB 4LPTA 1CGSL 4ORZC 4P5KA 3RUGA 1KB9K 2Y06H 4EI5A 1HXMB 3WIFB 4WO4C 3U2SA 2CIIB 4Y0GA 4RMQA 5LQBH 4ELKB 1N4XH 1J1XH 3MUJA 3WHXA 1T0NA 2R29H 2EC8A 4GLRI 2IPTH 4M8QA 2X70B 1MF2L 3NACH 3H0TA 1DUYA 3PIQB 4IRSB 5EU6D 4PJ5E 1XAUA 4FTVA 1BREA 3GJFB 3I9GH 3IJYA 1CK0L 3BQUA 3SDAB 2M26A 3H3BC 4ODVL 1NMAH 1I8IA 2VMFA 3MXWH 3FTGA 2I9TA 1FH5H 1N8ZA 4UOW0 4PJFB 1FCCA 4KMLB 1IARB 4MJIA 4RGNE 3WEXA 3QUYC 3NTCH 3DX6B 1D5MA 3SGDI 3L95A 2VIRB 1B88A 1FNHA 1MI5A 3MGOA 4ZNCD 1PX4A 5IQ9B 4G80A 3PNWB 4HH9B 4JDZB 2CLVA 1CE6A 2OXGA 4J8RA 4EQ3A 3D48R 1DFBL 1PFCA 2ZUYA 3DUUA 4FQ1L 5A1AA 4YHPA 4J1UA 5CJQL 3OPZH 4I48B 3S5LG 5C08D 2Z8SA 2BHYA 5E03A 2PYEE 4JM4L 4X6BA 1G7HB 1EFQA 5DURB 4U6VL 4OF0A 1FFQA 2NX5A 1S5HB 1X5YA 4HGWA 2CD0A 2VZVA 1YYMH 4Z18A 1Z3GH 3N85H 3M8OL 4XGZB 3QQ4A 1NEZB 2OSLB 3DPBA 4HW6A 3TYFA 4JPWH 1RHHA 4G8IB 1OQXA 1XGTA 3ILPA 1IAIL 1U2CA 3IDYC 4BK4A 4MQXD 5C07A 4CAGA 2VABB 4GSDL 1U8PB 2XZAL 1EZVY 2V2XB 4NNYA 1UB6A 4WEUD 3FO0L 4RDQF 2MQ3A 3KYNA 4DVRH 4PB0H 5J6GB 2YRZA 2BNQA 1LHZA 5C08E 1BX2A 1N6VA 3DECA 1JF1A 5H37H 4TVSa 3WL9A 2IFFH 5CBEB 3ZT7A 3STLB 5IG7A 5JOFA 5HGAA 1CDHA 4D9LH 3IDMB 2ZJSH 1UB5B 3UTTB 4L5FH 2ARJQ 3FQRA 5T3XH 3ULVE 4XP4L 1F4XL 2MCG1 3TBYB 2BERA 5DJDB 5F7UA 3L5WA 2H6PA 3VWKC 2XXMB 5EOQL 1X5HA 1MJ8L 1MRCL 1W8NA 4Y4KB 1CXFA 4I0PB 2IJ0C 3GEWB 5IMMB 3FAXA 4HIXH 4PP1D 2QADD 4Y19E 3GMOB 4HKBA 1MCNA 4UILL 1A4KA 3N1GC 3RTQD 4PJDF 2PYFA 3NFPB 3C60D 2WUBH 4YHIA 5AZEL 5DVOA 3KYKL 1LE9B 4YBQC 2FJGA 3FQXA 4JRWA 3DX6A 1KN2H 1QQDA 3M1BB 1S9KC 3QDGB 4LCUB 1ETZA 3GHEL 3LRHA 1NCAH 2ADJA 4BFEA 1GAFL 2DBLL 4NNPL 1MI5B 5JHLL 5LQBL 3ARSA 3GSQB 2Y5TB 5E2WH 3LS5L 4QGTA 4TSBH 2XNAA 5KAQG 3HNTH 5DURD 1PGRB 2IAMA 2E9WA 5TDNA 3VRIA 1FVCA 3C08H 5L88L 3B3IB 2AV7A 3RVUD 2VDMH 1U8HA 2J88H 1RIUH 1DZBA 3FRUB 2V9RA 3ARDB 1EO7A 2A6KA 3OGCA 4KK8C 4KKLC 1HH6A 5B8CB 3O2DA 3LDBC 2HT3C 4MXVE 3GFUA 1BBDL 3RGHA 3GHBH 2NY2C 1C5BH 1QLRA 1TLKA 1GGIH 4D9QE 3HLAA 3I6LD 3PP4H 1IC4H 2FO4A 4JB9H 2D7TH 4OGYL 4WNQA 3U7WL 3GBNL 3KJ4B 5CWSB 4PLKC 4BYHA 4GKNA 4DVRL 2L7UA 1KPUA 2VN7A 4I4WA 1FLTX 3RTQA 4YWGH 2PCPA 5BMFL 4OGAD 1FQ9C 4JY5L 5CMAB 4AT6B 5HPMB 3N1MC 3ZDYE 5J13B 5TFSL 3SDAD 1A7PL 3QXDB 1QFWI 3CJJA 3B5TA 3WJJC 1T7VA 5DT1L 1JJUA 3H9SB 1PZUB 2EE3A 1YUHB 3DARA 3QISA 1U91B 1T7XA 3BP6A 4XMLL 4XHJD 3UJJL 5L7XH 4CN6A 2RFXA 5I1EL 2A6IB 1YNLH 4MXWH 4ZUTB 1OT2A 4N8CL 3QDMA 3W0WB 3ZMRA 1PEZA 1C08A 3HMXA 3R0NA 5EULV 3SDCD 4NQCE 3ZSSA 2OSLA 4YX2L 1T22B 3D0VB 2NY0C 3WBDA 4HK0A 1SJHA 4DKEH 3MJ9A 4Z7UF 3EO9L 3QEGH 3S3PA 3MNVB 3RL2B 3VG9B 2CO6B 4JZOA 3RBGA 4HDIB 3TO4B 1BGXH 4R4NC 3OR6B 2NX5E 3S4SA 3NH7H 2L7JA 3MV9E 2CJUH 3KYKH 3ZDYF 2PYEA 4U6HB 3O3BA 5EOTB 2VE6A 4JFQB 1YMMD 5HHME 1E27A 3UYRH 3DI2B 3RDTD 1VB9A 1RFDH 4AEIL 4PRAA 5BOPA 2DJUA 3QH3B 3U30C 3VRJA 3AREC 5DK0B 3L6FA 1NMCC 2AABL 3DIFB 4ZSOE 2YRPA 3QHZL 1BWWA 1HHHB 1A7QH 3AY4A 1SEBB 1CFVL 2ITDB 5LBSL 2APVA 5EIQA 1ZT1A 1MRCH 1DDHA 1ROWA 4QHUB 1NGZB 1IGJA 3QHTC 1IBGH 3VXRD 5DJ8B 4JFED 3T1FB 1WBZB 1GPOH 1Y18A 4BFIA 3GSOA 4PGZA 4ZUVA 4OTXH 4KAQL 1TMCB 4M1DL 4W68A 1CQKA 1DN0A 1CDBA 5FA3B 1AJ7L 2GT9B 4ESKA 1F3DJ 3IXTB 2DQUH 2ZOKA 1UWXH 5IBTH 4HC1A 2P5WE 4Q9BA 3MRCA 1MI5D 4LHUB 1AI1H 5B38G 5JPMA 4NUJB 1MHPH 5J1SC 1JGLH 3I50H 5E95B 4QEGA 3LN4A 4WUKL 3T0DA 5HDQL 2FB4L 1OAXL 2NY1C 1TTGA 4OZGF 4L8BA 2NYYC 3D9AH 3C6SB 5FGCB 3EDDA 4DKDC 4QWWC 5DQDH 4GAYA 1CLYL 3E2HC 3L5XH 4NCDA 2ZOLA 1SY6H 3VXUD 3HR5A 1EMTH 3WNMA 1L0YA 3AMKA 1QNZH 2H1PL 5TE6H 1S78C 5GS0C 5EWIH 3IDJB 2F8OA 5EIIB 2NY2D 4XPTH 3VXOA 1EHNA 2CRIA 3TBWA 4KGLA 1WFNA 1TVDA 2KUTA 2P5ED 3G08A 1C5BL 2JB6B 5GGSY 5D5ME 2ZZUT 1WZ1H 5JDSA 1QBLL 3FB8A 1SVCP 5CCKH 2BJML 1P2CA 1CL7H 2DLIA 4MAUL 1JHKL 3WE6B 1SHMA 2CQVA 3MGTA 1MLBA 3S35H 4OV5A 4Y2DA 3QG6A 3IJSA 4WW1A 4Z77A 3WHE1 4HXAL 4ZFGH 1SYSB 3CSGA 3HTLX 1S5IH 1FORH 4S1SH 3VGEA 1CZ8H 5T3XD 1S7TB 3KXFB 4AYFA 3WDHA 5F7FA 1OGAE 3OXSB 5ERWA 6CGTA 2F54D 1NBVH 5IHZB 4LHUG 5C0RL 1TZGL 1O7SA 2UZIL 2NXYB 1NH6A 1QRNA 3DSNA 1MRFH 2G9HA 3UC0H 3QHZH 3QXDA 5EOTA 2WBJC 2YKLL 2GY5A 4EN3D 3BHBB 4H20H 4H0HB 3RWEA 5IWLC 5D7JB 5DHVA 3SE8H 3ZYJA 4XRCB 1U8MB 3KPRA 4M4RA 5DD3H 5CBAA 1ZHBB 1KN4L 2EXWC 1S3KH 2V7HB 1S8DB 4MD4A 5C0AA 1QFUH 3QEQB 4P2OB 2Z0BA 2G5BA 2KZWA 1T1WB 2DQUL 3AS0A 4JFZL 5IVZB 2FSEA 5F7DA 4UV7H 1Y18B 3I6GA 4P2OC 1B9ZA 4YDKH 4TVPH 1CLZH 5KSAB 4YQXH 1FSKC 2ICES 4OZFA 5ACMA 4XVSH 1BEYH 2X4UA 4QRUB 2QQKH 3QZWB 4LLWB 3T8XA 3WO4C 4U1GC 3H6JA 4YHML 3QUYB 4K94H 4YR6A 2VB5A 4CMHC 5ACLA 3RZCD 4JJ5A 1E27B 1HCFX 5ESAB 2AABH 4NUJA 3BGMB 3ZSTA 3T1WA 4LLYB 2YZ8A 4L8SC 1SJXA 2HRPL 1T1XA 4E42B 3VCLA 1WWBX 5D70H 1UZ6F 1RVFH 1E4XH 5FB8B 5B3JE 4RMVA 2EIDA 2DWEA 3W5NA 3WNPA 4L8CA 1EAPA 3CCHA 5FK9A 5IHBA 4Y1AA 4ZS7L 3VW3L 1CFSA 3OHXA 1G9NH 1LDSA 3GMPB 4ODWA 3NCJL 5I1CL 4OUUA 4F57L 1ZA6B 1TCMA 2DQFA 4IMKA 2NTSP 5F9WB 1HIMH 2Q8AL 4YDVA 2B7DT 3QQ3B 4XXCC 3IXTA 4XPGL 1FGNL 4J3OC 2AK4D 4ZFOA 3H7LA 1AD9B 2OS7A 4R96A 1XFPA 3PWPD 3X12A 1YEGH 1DEDA 2JCCA 3MRPA 3TZVC 3QXTA 3MRCB 4MA3A 2RGSA 5K9KB 1CD0A 4CVXB 1DSFL 4V1DE 2H3NB 2J3SA 4UQ3B 4PS4L 5T1KB 4JPKH 1S7SA 1KB5B 3P4MA 1LO5B 1NDGA 5L6YL 4KHXH 2P8PA 3MLRL 1INEH 3T0EA 1OAQL 4M7KH 3VA6A 1YYLH 5KSBB 4YK4C 1KCLA 1JFQH 1B2WH 4Y4HC 1DQDL 3O45B 3F7YA 3S3JA 4R90H 5E6IA 1DL7L 1I1AA 5HVGB 1RZJL 3DYMA 4PV9B 4GAYB 4O2EB 4RRPA 1OTUC 4FQCH 1DVFD 4KK9D 1UM6H 3NCEB 2BOCA 1P6FA 2EXYC 3GKZA 1OY3B 1A6TA 1RZGA 2KH2B 4G6KL 4HK3N 3RTQC 2FX9H 3FHAA 3SO3B 1FYTD 2QSTA 1BZ7A 5BW7C 2WZPD 1F6AB 4PJCB 3KR3L 2B0SL 4MCZA 1NC4D 1CFQB 1WISA 1OSZB 3CPLB 4BSVA 2Q6WB 3HC3L 4CW1B 1OQOA 1K3IA 1GH7A 4XPFH 5LG1A 3BGFB 1C1EL 1F90L 1T1WA 5H35B 3QG6B 5B38B 1FZKB 1Q9WB 4IBLT 2CIIA 3CX5J 3TCLB 1JUFA 4TUOA 3P3YA 4JQVC 4UOW1 3OZ9L 1PX3A 1I7TB 1QLEH 5AAWA 1ZXQA 3I6KA 3RGVD 1LO4H 1ZHLA 1OVZA 1CCZA 4I2XB 5TH2A 2AKRA 1PBYA 1BHGA 4BA8A 1RVFL 4TNWF 4KK6D 2PO6A 3NIFE 4ZMAT 5GS0D 4K3JL 4YZFF 5GZOD 3LKNB 5DZNA 3RWEB 5C0JB 1VDGA 4FQIH 2E8ZA 1IL1B 1TJHL 5I8EA 4DK6A 1QOKA 2FWOA 5I8OH 3M17A 1EUTA 2IQ9L 4JHWH 5MEPB 3V4VH 4LAQL 1REIA 3RX7A 4ODVH 2IPUG 3LHPL 3RAJL 3QB7C 5HYSA 3P9MA 4O9HL 3NZ8B 3PWVB 1CFSB 3OHXB 4NKDB 3U7YH 4YDJA 1DBKH 1KIRB 2CLZB 4YDKL 1WEJL 1IGTA 1MUJB 5HHVH 1ZA6A 4HCRH 4NHCL 4ZS6C 2HTKD 5HHXH 3MV9B 2R56H 4X8JA 1HOCB 4O51A 3DMMD 2UWEB 2P5EB 3QIUB 1FL6B 1KG0A 3WNOA 5ISZA 2NY2B 3EDKA 5E24E 3ZKNC 3X12B 2IC2A 2EH8L 3HUJE 4UTAH 1J8KA 4O58H 2ZUVA 5HDBE 2VXUL 3VH8B 2VXVH 5GJTL 3R06A 5I9QC 1L0XA 2CXGA 5DS8A 3KLHD 4P2QE 4UQ2B 3TYFB 5C0IB 5J11B 3T2NL 2X44D 1A1OA 1GGCL 4OZ4A 4CADB 5B21A 1XGTB 1TETL 3ILPB 1BIIA 3RVTD 5L0QB 3F6IA 1BLNA 5EZOL 3QNZB 3H2WA 1UB6B 3RZCA 5D2LA 2OZ4H 1AGBB 2Q3ZA 4QYOA 2APFA 3S37H 3GSRB 2EYRA 3SDXE 1FV1B 3DUSA 3OKDB 1U3HC 2NZ9D 4A2MA 1NMBL 5IOPB 1JNLH 5IG7B 1CD1B 5JOFB 4XCEB 3T0WA 4WI2A 1K4DA 4TSAH 4KHXL 1BMGA 3HAEB 1N5AA 3MRMA 1CGTA 2MFNA 2LQRA 3ARGC 5ALCH 4F7PA 4GRWB 3EJYC 5C0AD 1AHWB 4KROC 5HI5C 4TQEH 2A77H 3T3ME 5LGKA 1EA9C 2R8SH 5HGGS 2I9LB 2J7LA 2EC9T 5C70A 1BFVH 4WFED 3BUTA 1UM6L 3R8QA 1EHXA 1YEIH 5DHYB 4M02A 5E6ZA 3CD4A 3GSWA 4LLVB 3QXWA 4JAMB 1R3IL 2IF7A 4X6CA 5GS2D 4YJZL 4LSSL 4LAQH 1DLHB 4KUCF 2D9QB 4JQVA 5EPMB 3NPSC 3VI3E 2P4AB 4R4FH 4XC1L 1ZT7A 4U1KA 3TO4D 5F3BA 3BRFA 3NABL 3P4LA 4KDWA 4BKLB 1MRDL 3C9NB 3STZA 3UZEA 1F6AA 4CNIB 3ZLQC 1KXVC 3R4DA 5CEZL 1AGDB 4LHQB 1AO7E 4U7MA 2E7MA 4F15C 3H42H 4OLEA 5ID0B 4Q9QL 1B0GB 3O2WL 4OCRH 4OM0H 2OL3L 5IWLA 4U6XB 1A6UL 4OCLC 4OLWL 4LRIC 1NAMA 1WVZA 3CVHA 1QLEL 2QQLL 3CH8A 1K8DA 4G9DB 5GGUB 4YIQB 4YLQT 1FGVH 2DQGH 4OF6A 4XPHH 3UJTH 1KG0B 3O3AB 1NUGA 1IM9D 1FYHB 3K8MA 5EO0A 1FBIL 1FO0A 2O93L 5C0DB 5EO1A 1RJYB 2NY3B 1UA6H 5F88A 3A6BL 3GI9L 2C4FU 3MA9H 2P47B 4I77L 5GGVL 1CVRA 2MQ0A 4KFZC 4LRNH 2X41A 3A6CL 3HLAB 2MKLC 3TVMC 2IQ9H 3VI3F 2ZCKL 3FO2A 3VH8A 2GK0B 1L7TH 2ZNWA 2FX7L 4FFYL 3BAEL 3O9WA 1XGQB 1AXTL 2Q86A 5C07E 4LVNB 1I1FB 3OKLA 2DTSA 4GKNB 3L5HA 3WO4B 3MRGB 4G9FD 3OBAA 1CIUA 5C0BA 1FVEA 4NKDA 2D7TL 3Q3GA 4EXKA 1T2QL 1OHQA 3N50A 3BZDA 3K2UH 2CK0H 5FECA 3TJHC 1GGTA 3W9DA 1D6VL 5DLMH 1EGJA 4JHAL 4W4OC 4IIQB 2ENSA 2A83B 5FF6B 3GMLA 4HWEH 3G5XA 4NCC2 2AI0L 3ARWA 3FFCE 4WEBH 1U8JA 4Q9CA 3DXAB 1GCFA 4Z7VB 5DEGA 5JUEH 4PRIE 1WFUA 3NPZB 4JFEA 1IEAB 4UT7L 1DE4A 5GGSA 4YXLL 4JDZA 4ZUTA 3MCG1 1BFVL 8CGTA 2BZDA 3FT3B 4JY6A 5T1DH 4ZUSA 3WO3B 4DGIL 2EZ0C 1KXTB 4NQXB 5CSBA 3LRSA 4DGYH 2IANE 5EC1B 3GUTA 3OB0H 1YNLL 3BKJH 4NRXA 4ZFZB 5JXAL 4NDMB 3K4AA 3S3SA 4Z7WF 5E99L 3H3PH 4YXHH 2ZUUA 4PJIE 4R8WH 3FHQA 1HH9B 4HQQL 4R4FL 4XC1H 3B9DA 3C8HA 3UEZA 2P24B 1PQZA 3HNSL 4NQCD 4FS0A 1XR9A 5HYJB 3WFCH 3UYPA 3T65B 3S8WA 1DLHA 3LKPA 5GGQL 1E6OL 3OGOE 4ODUA 3P73A 1D9KC 1J9CT 3ULVL 3CDFA 4OCRL 1KCRL 4U1KB 4H8WL 2VDLH 5CP3A 3S36L 4IEFB 5GS1B 3CNKA 5AAMA 2YD5A 1CD1A 2VUYA 1EEYB 1X5KA 1YQ2A 3SDCA 5MENA 5KOVC 5ALCL 3LZFL 2AEIT 3D5OF 4UT9H 4CN4A 1NFDA 3GJEA 4JKLA 4JVWA 1SEQL 1TVBA 2R0WH 3BYYA 2BVQA 1UACL 5IW1A 4M6OH 2ARJA 1CXLA 3QDGE 3DX7A 3QIBD 1WTGT 2GTWA 2PTUA 5DWUL 2BNRD 3MPCA 4O4YL 1JZ2A 4DJMA 2VH5L 4L9DA 1JNHA 5IIEB 4R3SB 1N0LA 5ADOL 1JHLH 5KANI 3ZE2F 4WI7A 1A4JB 4J3XA 3V6FB 4F7EB 4GAJL 4OZFG 4RFNB 4G7YL 2A9NL 1CD8A 3MLUL 3O9WB 2HWZH 3VG0L 1R0AL 4J6RH 4WHCA 3MOQA 5DLML 4JHAH 5E7BA 3L95B 4LHUD 3BESR 1FZMB 3KPMA 3HZMB 4YGVB 4LIQH 2J8UE 4PJ8D 4HH9A 2FO1A 5IVXB 4FQXD 1Q38A 2EE9A 3CMOL 4P5TA 2X4NA 4WFGE 2XZAH 1RZFH 3HI5L 1XIWA 4KZEL 1EO8H 3O6LL 4PRNA 3KDMA 5F93C 3IVKB 5BO1L 4PR5A 3UPRB 1F42A 4QT5B 1Y6NR 2CGRL 4GXUN 4JFYA 1D5XB 2IH1A 4CVWA 3GI8L 3O4OB 5I75B 5SX4I 4GS7B 1EBAA 3F7VA 1VGEH 4I18B 4ONGH 4MNQE 3O3EA 2WV3A 4OV5B 2P5EE 4NQDB 3JXAA 4OD2B 5IB4A 5HDLA 3QT2A 1RHFA 4ZYKA 4HKXB 1U3ZA 4MA1B 1ZA3A 3HC4L 2WANA 4L4VE 4M7LH 1A0QH 4G43B 4NO5B 5F9AC 2DQDH 2HFEA 5C0EB 1OGTB 1IGML 2OQJA 4JG1L 4ZO7A 5TDPA 3BPNC 2NW3B 2P45B 3IDXH 3O3UN 4JJHA 4PG9B 3HC0B 3NIDE 4H8WC 5DHVH 3PWLA 1WCBA 3IU3B 5GGTH 1AO7D 1U8MA 2FZ3A 4I3GA 1CF8H 2IPUK 2FHCA 5JNYB 4ISVA 5A3ID 2AS5M 5CEXA 5T5FL 4WTZA 1CT8B 3BZ4A 3OG6B 4JY6B 3WFDH 3MA7A 2G5BB 3Q2CA 1ONQA 2B1HH 1XF4A 3ULUD 4QRQA 1L4IA 5DGRA 3PDOA 4F2MB 3FRPG 2XN9E 3IRZA 4P23C 2OL3B 2PUQT 3GB7A 2VZSA 4J3SA 1TJGL 4WDIB 1AR1D 4XTRD 2R0ZL 4KVNH 3DWTA 5F8QC 4RAVB 4AIZA 1N7MH 5IMMA 1TCRA 4GAJH 5FXCH 3P30L 4RMSA 4K07A 3P4NA 2OR9L 1MJUL 2Q76B 3HKFA 1BVLA 2CKBB 4PJCE 1JE6A 4NQSB 1X7QB 1UXSA 5C09A 4AEHH 5SX4H 1HDMA 1FNGB 2C4XA 4K3EH 1A4JA 3V6FA 3TT1H 3RL1A 3ZZ1A 3VCLB 4RFOL 4PJ9D 3TM6A 4XBPA 3WN5C 3PP4L 4G6FB 3MRNA 4WI4A 4HJJH 4K94L 1YEEH 2QQNH 2IBGA 2R23A 2GAZA 2OXHA 1DJSA 1MHEA 3I84A 2MJWA 4JPIA 2QHRL 4P3CL 1E6JH 4K7PX 1E4XL 1RZ8B 2NX5D 2DLEA 4NO2B 3MJ7B 4GBXC 4DFHA 1BOYA 3TC9A 1I1YB 2YEZA 5E6YA 2ARJB 1XIWB 3L6FB 2O61A 1I4FB 3GGWB 3QWQB 4OIBA 2YBRB 3PQYE 2FATH 3IS0X 1PG7W 4R3SA 5D1QA 5C1MB 2ZUTA 1GOGA 1LGVA 2FEDC 3OJVC 1T83A 3D2UD 3LMJH 2BRRL 1JWSA 1T03L 3DXAD 5EU4A 1AO7A 5LGHL 3IDIB 3C8KB 4MDIB 3WXWL 5JPNB 1ZA3B 1XH3A 1MSPA 5DUBB 4NKIL 1JZ3A 3FMGH 3X3FH 1ULVA 5IB5B 3ESVF 3RY5A 2O5XL 5M95B 2ED9A 1SBSL 4O2EA 4HPOH 5HHQA 5HPMA 3SDYL 2V5RA 1HI6B 3WD5L 5ITBH 1YY8A 2Z31B 1A6WL 2AJVL 3FZUC 4R90L 3GSUB 3IRPX 2AV1A 3CFDB 3FN9A 1UCBH 3T04D 1QSFB 1F6LL 3VXME 3RVXC 1IKFL 4WWKA 2RFXB 4S1RH 5C8JB 1AE6L 4H88L 3GJFH 2C3HA 1M05A 2BDNL 3CFCH 3TZVB 4HEPG 4I18A 4OFYD 5IROA 3RI5F 4ZSOB 1NCBH 2GIYA 1I7ZA 4MAYD 5I76B 4GW4A 4QRQB 3ARZA 2GKIA 2CMRH 4JO4L 2GJ6B 4ODTL 3THMH 4JFFE 3SPVA 4DEPC 2Y07L 3QO1B 1AIFB 1NCNA 4UB0H 3NA9H 5BOZG 4PJHA 3RY6A 1MY7A 2JB6A 3D39D 4U0RB 4WHDA 2X40A 3F12B 4FQXA 4CDHA 2R9HD 3S4SB 4QHKJ 4UAOC 4PJ8A 2J6EA 3T4YA 3QR2A 5D1XC 1FFOB 2ESVD 1T5WA 4OZIE 1NKRA 2Y1VA 1YY9D 4BJLA 1NANI 4FQJH 5IR1A 3S35X 4HLZH 3HG1A 1IL1A 4TRPH 3QIWA 5IVXE 5J13C 5DK0A 3DIFA 4R6UA 2VXQH 3TBTB 5E8DH 3VFMA 1JI2A 4RDQG 4PJIF 1R3LB 1SJEB 3CVIH 3VFWA 3P77B 3ISWA 2NR6C 5DJ0A 5IB2B 5D1QC 4JPIB 43C9A 4HIJA 3BH9A 2ZJSL 3BGFC 5I30H 4XBGA 3C5SA 1RULL 2C3VA 4NO2A 4QRRE 2EDKA 1P7QA 1N6QH 5D1ZC 1V3MA 4RISH 4S1QH 1VGKB 4J7RA 5INCA 2BRRH 2WP3O 5IF0B 4ZD3L 3UTTA 1QNZL 2H1PH 3EYSH 3LQZA 2EYTA 1RIVH 5JMRA 3V2AR 2VLJE 2Q7YA 5SWSE 1LEIA 3PWJA 5EFIB 5MEND 2Y72A 4NC0B 4LKCB 4FXGB 4M62L 2JIXB 2XQYK 1A6VH 1QKZH 1F45A 3IFOA 4P4KB 2VLRD 4YHYB 4OQTA 3RP1A 3UZVB 3NA4A 2R1YA 2VZUA 4FXLA 1AXSB 4HMEA 1NMCB 1V3LA 3AROA 5EU6E 4DTGL 1R24B 1MCWM 2DS4A 5EUOB 5FKAA 5HHOA 1NBVL 2EEBA 1C12B 1AD0A 4KJPC 3VD3A 2VDRH 3F6LA 3G04A 4F37K 4PJEE 4KI5C 4GMTL 4JM2F 3FQXB 5EB9A 3IJHA 3WS3A 1CDUA 2X4TA 1ZANH 4KK8D 4NGHH 4ZDHA 5ICXB 5I17A 1NGWB 2CMRL 3RWIA 4EVNA 1UWGL 1CE1H 2WM0A 4PGEA 3HE7B 1A6PA 4CVZB 4DAGH 2AJUH 1OM3H 1I7ZB 3SDXB 4F7PB 1KB5L 3HUJA 5EU4B 3L5IA 2FD6L 2JJTC 4BSJA 5FA4A 4JGJA 3LEXB 2P42B 1A9EA 3F7QA 1A47A 3REWA 4LLVA 2ICWJ 1HI6A 4PJ7E 4U6YB 5GS1C 1MVUB 1AP2B 2JELL 3U4EB 5IV2B 4WNQB 1Q8MA 2ZUXA 3T0AA 4P48A 2P49B 3TV3H 4DVBB 3H8NA 5E4EB 1ZGLB 5C7XL 4JR9L 1CS6A 3TBTA 1G7LB 3BPNB 3V5HA 2E6JA 3H7BB 5ID0A 4XC3H 3HPJB 2Z93A 2VDML 3H9HA 1ZLVK 4Y5VB 1FG2B 2CO7B 3CH1A 3FL7A 2H8PA 1F5WA 4N68A 4MXWL 4NHUA 4KQ4L 1CICA 3I02B 1FN4B 4MVBC 1QZ1A 3AUVA 5D7LA 5ELIA 3VXMA 2ICWI 1N3NA 1OP3K 1EHLL 3RWCA 4WWID 3SJVA 4Y4FC 4NUGH 4QRUA 3UTPD 2N7AA 4JPVL 3SCMD 5CJOL 1OLZA 1H8OA 3QUZD 3WFBL 4E41B 3MBEA 3WKML 1T7ZA 1ZHKA 4JANA 2NY6C 2GK0A 3QUML 3VGGA 5LWYL 4RX4A 1TENA 4N0UB 1I8LC 1IAIM 3MLYH 2HJLA 4JZOB 4LSQH 2NTFB 3X17A 2EDHA 1IQWH 3ULVC 2FJFB 4K9EL 4ZUUB 4KH2A 2A6DB 2PO6B 3EZJB 5DA0B 3PJSB 4C83A 2VE6B 5DI8B 3G5YA 5SWSA 3MSPA 5EUOA 4QXTB 6FABL 1JPSH 1BD2A 2HT4C 4Y8DC 4OIAA 4QXWA 5GGRA 4MNGE 3M17B 1RIVL 2GI7A 4XB7A 2DQTH 1DQML 4K71B 1T04A 4WO4B 4RA3A 2MPAH 3VXPA 3GMQA 3TPUA 3WIHA 4G6KH 1DVFC 2M2DA 2XG4A 3SOBL 4HWNA 1A6VL 1QKZL 5CP3H 1FAIH 2AI0H 1GOHA 1UJ3A 1XGUA 1ORQA 4GRMA 4OLXL 4PJFE 4M9PA 3TEUA 3HUJB 3H9YA 4CVUA 2CDEA 4OLZL 5FOBA 2D9CA 3LIZL 4M7ZC 4NRXB 1EXUB 3DRTA 3VMOA 3PUCA 1C16A 2HTKC 3ULSA 4YDLB 1I1AB 4NQTA 2FH6A 5KZCD 1I8MB 1UG9A 1L9NA 4OF8A 5CZVH 3VFOA 3OJMB 1NKOA 4PRHB 2NLJB 1Z9OA 1MCDA 5IV2A 3ZHKA 3NZHH 3BQUC 4NN7B 3TN0D 3U36A 3MJ9L 5CILL 4N9GB 2N7BA 3CUPB 1CE1L 4M61B 3QHFH 1ZLUH 4NWTL 4MCZB 1IBGL 1T0MB 4LEOB 2MHAB 4NQDE 1G6RL 2XA3A 4M48H 4KRMB 4OI9A 3B9KA 3MUGA 2Z31C 4C56A 4M1DH 5HGBA 1AR2A 3QUYD 4CU7A 1YPZB 4OM1H 4X4YA 3MV8D 5TPWH 3FB6B 1ZOXA 3ARPA 1YNTB 2R2BA 4OZHB 3BT2L 5JHDA 2VKXA 5CCKL 4YNYA 5KSUB 5IW1B 1FV1A 3QWRD 3I02A 2YK1L 2QHLA 1A7NL 3WKMH 4GRLD 5DDHA 3EO1A 4LGSB 3B43A 5GGVY 3RWCB 4QTHA 5KS9A 1SEQH 1F4YH 4M6NH 3HRPA 1K4DB 1FDLH 4MLSA 4MDJB 1X44A 3TV3L 4ZFFB 5ITFB 3GNML 1D7FA 3QEQD 3ARDC 4FN0A 4JGUA 1OAZL 4ZOBA 1HHIA 4OZHE 1MHCA 1T0NB 4XC3L 4YC2B 5DD0H 3MLXH 3DURB 1UWEH 4E9LA 4AIXA 5TE6L 3L7EB 3IJYB 2UV3A 1KIRA 3T2NH 2MPAL 3OG4B 1J5OH 2H41A 1R0AH 4X5WA 2H2SC 4PJHF 3SO5A 2BY2A 4EIGB 1FZOA 2DQIL 1OGAA 5DYOA 4OCSL 4OF5A 4Q9RL 1YMME 4CNIA 5KJRH 2IAMC 1N3NB 1NC2D 4PJFF 5IFJA 3CLEL 4PV8B 4PJXE 5CD3A 5GXBB 1S8DA 4MD4B 1DQQA 7CGTA 4FQ2H 4HIHA 3U6RB 3TZVD 4YHKL 1HKLL 1NC4A 5JQ6H 4UDUB 5DJXB 1RK0B 5JHDE 1XF2A 4IDLA 4YHPB 1MCIA 1HSAA 1UEYA 2H2PC 4ZPVA 3O6FC 4JLRA 4XH2B 2XG5A 3GJFA 4Y4HD 4Q7DA 4Y2DC 2E5EA 2BMKB 2Z8VC 3VXTA 1M7XA 1U6AL 5EBGA 1PZ5B 4F15B 2NQCA 5D2LB 3SE4C 2NW3A 3FTGB 3VFOB 1LP9A 1E4KA 5D8JH 1GSMA 4XZUA 5E6ID 1CXHA 4NKQB 2BVUA 3ZDXF 3JUYA 4DN4H 3DUSB 3OKNB 3R8BB 4X7CC 3MRGA 5I16A 5K93A 3OWEA 3MJ6A 2H9GA 5E7FA 2RIKA 4KTYA 12E8H 4JFDA 3S34L 3QJHB 4PJXB 5IQ7L 1FGNH 1H3GA 4DOHB 1G0XA 1QHOA 5DUMH 3LIZH 2UYLA 5SV3A 1M71B 4Z8FL 3KYNB 3LEYH 4GS7C 1YNTA 2ICEA 4WUUE 2AK4A 5IK3B 3VE0B 4X98B 4NFCA 4KU1A 4GRLA 3MC0A 3WL9B 4I48A 5F1NA 4RAVA 4AIZB 5H2BB 3K7UA 3FQWA 3D25B 5I0DA 5K9QG 3VGAB 3MJGX 3FB7B 1MVFA 4KK9C 1U8KB 1DL7H 4NBXB 5D1ZA 1MFCL 2BNRE 2K1MA 4S0SD 4XMKL 5FYJD 1UWEL 4NO0D 2L4OA 5MEQB 3IAQA 1G7IA 3P4MB 1EJ6A 2DQJH 2VXTH 4HBQA 3EJZC 3RL1B 5FYLL 5DZLA 4LGRB 3DTXA 3QXAB 4NFBA 1AC6A 3MRQA 2HN7A 3P0YL 2HG5B 3KPPA 2FHBA 3I6LE 2V2XA 3CU7A 2DQEH 4HG4J 4X7EC 1ZWIA 4XNMB 5ACZA 4UT6L 1U3HB 4X5XA 5I66A 2XQBH 3CLEH 3FB6A 3HCVA 1S9XB 3LKPB 3SKOA 1A6TB 3ARGA 4JO3L 2A73B 3FO1B 1RZKC 1P7KB 3IFNH 1X4XA 5DD6B 2J5LC 2I60H 5I8CB 2CK0L 1I4FA 1WWAX 3GGWA 3GMMB 3QYCA 2YPLA 1HILA 5CKGA 4H0GA 2YBRA 1WBYA 5I1GL 4AZ8A 1PG7X 2BSED 2F8XC 1B2WL 3X14B 2H6PB 1J8HB 2IAMB 1HCVA 4PJEA 3DYOA 5FYJL 1TQBB 1AO7B 1CN4A 3QSKB 4WFFE 4K3JH 1WIUA 4Z7OF 1J05B 1NDMA 1SBBA 1JMZA 5DUBA 4I2XA 1MCFA 4AH2A 3ZYIA 3T0XA 5TDOA 1UXWB 4U49A 2V9TA 4F3FA 1BWMA 1VFOA 2OJZL 4XCNA 1KIQA 2F74B 3PHQB 4HIXL