2J88H

Hyaluronidase in complex with a monoclonal igg fab fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
184
structure length
162
Chain Sequence
VTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCTLYYGSVDYWGQGTSVTVSSAKTTPPSVYGCLVKGYFPEPVTVTWNSGHTFPAVLQSDLYTLSSSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYALURONONGLUCOSAMINIDASE
publication title Identification of a B-Cell Epitope of Hyaluronidase, a Major Bee Venom Allergen, from its Crystal Structure in Complex with a Specific Fab.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Hydrolase
total genus 25
structure length 162
sequence length 184
ec nomenclature
pdb deposition date 2006-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j88H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j88H02
1B0GB 5D5MA 4MX7B 3ORJA 4ZXBD 3S88H 4QYOB 4D8PB 3WIHH 5JW4Q 3NCJH 4P5TA 5C09B 1TCRB 4FQXD 3VXUD 2BC4A 4K7PY 4K3GA 1A3RL 2R9HD 2CK0L 4M8QA 3RDTA 5I76A 3ARZA 1QVOB 3FQWA 4JE4B 4HV8A 3P0VL 4TSBL 4MZ2A 5DEFB 1CL7I 2QADC 5K9JL 5A16B 5L7XL 4G6KL 5HBBA 3AS0A 2WBWB 4PG9B 5DR5H 1JYNA 5BVPL 1SEQH 3KHQA 5I1IH 4HJGA 4X9FA 5F70A 3C87A 3GEWB 2G5BA 3GK8L 3VE0A 1OCWH 3WIFA 3LQAH 3MR9A 3UTSE 4EDXB 2QADB 4HKXB 2CDGA 4KV5E 5TQ0H 4L4VB 1NBYA 4XX1E 4EBQL 1IAKA 4DQOH 5DS8A 3WD5H 2VYRE 1WAAE 3SKUD 5SV4A 4GMTH 5DJZB 3IJHB 2VXQH 4XAWL 4H1LH 5DMIH 1FNHA 1EUTA 1JGEA 5IW6A 3CSYB 3BKJH 4YHZH 3C9NA 3NPSC 3F65A 2VDKL 4BFIB 5GXBB 4EDWL 3VRLE 3IDUA 3SBWA 4PYHA 3IRZA 1HKLH 5KW9H 1YDPB 5F7HA 5MP6H 3ARDC 4WTXA 4YHPB 2YUXA 3U6RA 3VWJC 3ESUF 5CSGA 3NPSB 5GJSL 4JRWA 4YLQT 1XCQA 4LLYB 2CO6B 4KVNH 1EEZB 1MRDH 5HYEA 1RMFL 2O5ZL 2UZXB 4HWEL 3NIGE 5KS9F 5MEPB 3CVHH 2VISA 1K4DB 2NY1D 3ARDB 3QIWA 3NACL 2XWTA 4I4WA 3VI3F 4UT6H 3VWJB 2OR9L 3MRRB 3OKEB 4P23D 2JB5H 4PGDA 1A4KA 1CL7L 5KVGL 3D3VB 4XX1G 3MBEA 1ERNA 1NFDE 4YQXL 5LCVL 1NGYB 1MCKA 4BFEA 4PV8A 2E9BA 1UENA 3EOAB 1NMAH 1CLYH 4IRSD 3G5VA 4DGIL 3PGFH 3RGVD 1O5DT 2WSKA 5EG6C 1LP9A 4LLUA 5KVEL 5DFVC 4N0FB 1Y6KR 3T77A 5GSRA 4K2UH 4QRRA 1DUZA 2PW1A 2DI7A 3DYMA 3VFRB 4U0QB 3HNSH 1I9EA 1HH9A 3MRNA 1INDL 3S36X 2CD0A 3G6JE 5FO8A 5IHZB 1MCLA 3HLAB 2QQNL 4PJGF 5F7FA 5ITBL 1BJMA 1YECH 2HT2C 3P0GB 2Z31D 3MRCB 4OF5A 1J18A 4X98B 4KZEL 2Q3AA 3EW3B 1YEDA 4I3SL 4BH8B 3NOIA 4DEPC 4PREB 2XNAA 2FX7L 3RKPA 3VH8B 3FOMB 5DA0B 2O61A 4P5MB 2YRPA 3ZDYE 1SEBB 4R7NB 2OS7A 3JV0A 3WLBA 4DEPB 3QDGA 1DQJA 3CK0H 1QSFD 2FLBT 1S5IL 2VDNL 4HFWA 5DD3L 4TNWK 3TBSB 4FRWA 3OKNB 4YDIH 2BJMH 4AM0A 3GZKA 4DUWA 4OZGA 4MD4A 1JGLL 1A21A 3FZUD 4EVNB 5I0ZA 1B2WL 3D9AL 4RNRB 2DWDA 1FVCA 4PTTB 3M8OH 4HHAA 1WBYB 4HKBB 1I8IA 2ADGB 1NGQL 3G04B 5GGSA 4X6BB 4Y5YC 3STZA 1G7PA 4U1JB 5I8CA 3B9KD 4JG0H 3V52L 3MOBH 3QG6A 2EXWC 4O5LL 1FE8H 1EAPB 4G8FA 2OI9C 3CH1B 4TSBH 1N5AB 1YN7A 5DHXB 4FG6D 5BZWA 5ECJE 3F8UB 5C8JB 4M7LT 3HS0B 3MJ6A 4OD1L 4HGKC 4KJYA 4Y5YB 1IL1B 1HINH 4LMQE 3T2NH 1ES0B 4ZPVB 5BVPH 2KL6A 2NY5C 4DUVA 5CIPB 1ND0A 1IEBA 1WC7B 2B0SL 2X4QB 4JQXC 4I3RL 3GK8H 1NANI 2OI9B 4NDMA 5I1JH 2A0LD 2GTZA 3ABZA 2BSSB 2DQTH 2P5EA 3T0BA 3HA0A 1B6UA 1FGVL 3VRJA 1I1FB 3F7YA 1CFQB 1S7RA 3TBTB 5HYQA 2WUBL 2YC1B 4KAQH 3N0PB 1KB5A 1TPXC 1T1XB 1T3FB 4XAWH 4KJQD 2Q1EA 3P11L 3GMPA 4LKXA 4WW1A 2YR3A 3D69A 3TH3T 1PG7L 3WEXB 3BI9X 4U1NB 4R2GC 2HT3D 2VDKH 5HHPA 1MCSA 4OLZL 2IFGA 2ZUVA 3DHMA 4EDWH 2CRZA 4ONGH 2GYSA 3BISA 5M95B 1YEKL 5I1EH 1TPXB 3JSSA 2CR6A 1HXYA 2AGJL 4GAFB 5KOMC 3TNMB 3LDBB 5L0QB 3MLUL 3L3DB 4JVWA 2R4RH 3P4MA 4M61A 4P2OC 4PJBE 5GJSH 1HYSD 5E6IA 1MFEL 4R2GB 4GRMA 4OIIL 4OF3A 1JTPA 5FKAB 5HGDB 5HHOA 3ARXA 2XZAL 4MLIA 3GNML 3NACH 1YNLH 4LSTH 3VGDA 1FYTE 3VFPA 4ZUTA 2OR9H 2GHWB 4P2OB 4UB0H 4DN3H 4BQBA 3G9VA 5LG1A 5DD1L 5FCSH 3LHPH 3O8XD 5CHNA 2ADIB 5KVGH 1J0JA 3JWDC 2DYPB 4QNPF 3GSQA 4QGTA 5EB9A 3DV4A 2IPTL 3VXSE 2VR5A 3QH3B 1CGSH 4JDZB 2IFFL 3WMSA 3C6LC 4EEEA 4RMWA 3AY4A 4U1KB 3RDTC 5KVEH 4MNQA 1Q9OA 1AP2A 5D5MB 4JM2F 3DTXA 4IOIA 3ZKND 4AEIL 1DANT 4ODHL 4BQ8A 5JDSB 4RMQA 2J5LC 4L4TA 5DC0A 1I4FB 1MFDL 3C6LB 2OX5A 2BC4B 1FG2A 3ULUF 4M8QB 4M7JL 4Q58C 3RDTB 1A6PA 3I2CL 3UTOA 5HHVL 5I18L 1OT2A 2BCKA 5I76B 3CFDB 5ITBH 4HV8B 1ACZA 1NJ9A 2OTUA 3MXVL 1KPUA 1JNNL 2PW2B 3VCLB 4I3SH 4W81A 1A7QL 1NL0L 3RWIA 3QFJD 2J5LB 4TRPH 1KF9B 3W11C 3BUYA 1CIDA 4YHIA 5HI5C 3VE0B 5FYKD 3WIFB 2FHBA 3MR9B 4KKLC 3WUWA 2CLVA 4H0IA 1C5DB 2L7JA 3MRFA 4OLUL 2ORBL 2XQYK 2CDGB 4X80L 3MFFA 1NBYB 1IAKB 3SBWC 1F4WL 2VDNH 1S7XA 5DD3H 2Z93A 2JJSA 4UDTA 1CD9B 3QI9D 5JPMA 2J2ZA 2X42A 1MNUL 2Y7QB 1P4LB 2ZJSL 1KCRH 5FYJD 2NR6D 1EMTH 2N56A 4OIBA 5KG9A 5FV2A 3C9NB 4UOW0 1JGLH 3ZTNH 1CD1A 5EIQA 5FYLD 3I3EA 5GGTH 1B2WH 3HUJE 4IDJL 9CGTA 3VXRD 1DJSA 3ZDXF 1QUNA 1KTRL 3DIFA 3EJZC 2EDTA 5TPWH 2R29L 3GJFH 4OKDA 5K9OB 3HTLX 5J4MA 1IM3A 3QIWC 4F2MB 1LEGA 5LGJA 1U8LA 4CGTA 4AJ0A 1HXMA 5LQBH 1XCQB 4ZUSA 3SGEH 2CDEA 3MBEC 4OD1H 3HE7D 2MSPA 2VISB 4UQ3B 2FNBA 3CDCA 1CU4H 3QIWB 5E4EC 4I4WB 5FYKU 2B0SH 2IANE 4I3RH 1QSED 2HAZA 4ZNEE 1NMBL 1MI5B 4KI1A 4J2XA 2CKBA 4PBVC 1QLEL 3MBEB 1OLLA 5TE7L 1I75A 5T1KD 1OW0A 1KCVL 2E3VA 4PV8B 2EH7L 4MMZC 1ZT4A 2WUBH 4LSSL 5T1LD 5E4EB 2OMNA 3LZFH 4W68A 1CDJA 2VDML 4DGVH 1AD0B 4M6OL 3HZMA 4WWKD 4KJWC 4OBSA 5F97E 4LLUB 3T77B 2EIEA 5GSRB 3P11H 4QRRB 2PW1B 4FFVC 3QHFL 4JQIL 1Q1JL 1GGYA 1PG7H 4JANA 4LQ1A 4OLZH 3B5GA 4ZAKA 1J8HD 1MELA 1HH9B 4OCMC 1T83A 4QCIA 2HFFA 3WDIA 1YEKH 4OBRA 4CU8A 1U8PA 2AGJH 1AGBA 5FGSA 4NPYB 1PZUB 4IRSA 2AQ3A 3RGVA 5I75C 1BP3B 1DVFD 4JGUA 1RQ5A 5DEGA 5T3ZH 2FJHB 1YEDB 4OIIH 4X9BA 3FTGA 3K4DA 5C0AA 2XNAB 4PS4L 1U8IA 1CXKA 3HMXA 4HBCL 3GNMH 5AAMA 3HB3C 4LGSB 4XPHH 4F37K 4JKLA 2MCG1 5I75B 5CBAA 1KXTB 5DD1H 5DURB 2B8OT 1OAKH 3QUZD 2V9QA 4IOFD 3QDGB 5FHBL 4KUCD 3DHJA 1DQJB 4U7SA 2Z31A 2YK1L 3FN0L 2VLJB 3KWWA 1FVDB 4HFWB 1EAJA 1X4XA 4NCC2 2IFFH 2A6KB 4AM0B 4OV5B 2NY5L 4QHMB 4OZGB 5C0GA 2AV1A 2VZTA 3P0YH 3BOVA 4M7KL 3LV3A 1FVCB 1CVSC 4HHAB 4LCWE 3D2UA 4KK5D 3U7YH 2YPLE 5TH2A 1T7YA 4HUMB 1G7PB 3STZB 4ZFGL 4PRDA 1OTTC 5IB4A 1MFDH 1QSFA 1SYVA 4PY8I 4M7JH 4AY0A 3I2CH 5I18H 3BKYH 3TA3D 4LCYA 4OCWL 4S11A 3B5TA 2ZKHL 1QSZA 4Y2OA 2EZ0C 1YN7B 1DANU 5BZWB 5EBGA 4TVPL 5JIPA 3IS1X 5F88A 1JNNH 4ELMB 1BX2A 4KJYB 2H2PD 1FAKT 5AAWA 5IEKA 1S78D 2WLZA 3R1GL 2FSEA 4XGZB 1I3RA 1WSST 3MGOA 2QSQA 4NDMB 2GTZB 1DQTA 2P5EB 4LVEA 3TIEA 3I85A 1UEMA 3BZEA 1A6AA 2F53D 3VRJB 3KPNB 3P4NA 1VACA 4N5ED 1S7RB 5HYQB 2F15A 2A9ML 2DQEH 4LFHD 1QO3B 2RIKA 5FYJE 2W0LA 1G0XA 1F4WH 4G5ZL 1KB5B 3ROOA 3C5ZA 5B21A 4YAQA 3GMPB 4LKXB 1KJVA 2CLZA 4WW1B 3S3PA 3D69B 3JUYA 5E6IC 2J6EA 2FIKA 2OBGA 5HHPB 3OV6A 1AD9B 3UZVB 2ZNWA 2R29H 4NUGH 1FFOA 3JWDL 3PL6D 5J13C 2MQ0A 2R1XA 3QXDB 4JFDD 4JFXA 1QPXA 4QXWA 3P4MB 4M61B 1RK1A 1MSPA 3B6SA 4OT1H 1J5OL 3DETC 2VITA 3U4AA 1JNJA 1UACH 2DLHA 3DPBA 3KJ4C 5CGYC 4MXQD 4D94A 4ZO9A 5HHOB 5J13B 2W59A 1FL5A 2FEDC 3GSOA 3VFPB 5BW7A 4H0GA 4CDHA 1NMBH 1UZ6F 3AY4C 1T1ZA 5FUOH 5HDBF 3FOLA 1A1OA 1MHCA 4HIIA 5TE7H 1G6RH 3KJ4B 4RZCA 3MOAL 3NTCL 3P4OB 3WNKA 4CMHC 5C0ND 2EH7H 4LSSH 2OR8A 3SDYL 3FFCB 4MNQB 4G9FE 1AP2B 5JW4M 2DN7A 4IOIB 4HUXA 5HHXL 1KLGB 4JQIH 1Q1JH 2ZWLT 1YQVL 2C4FT 4X83A 4JPIB 4CMHB 4PJ9A 2AEPL 4EUPA 4L4TB 4Z76A 3H3PL 3UJIL 4X8JA 1E6JL 5JPNA 4C4KO 2BCKB 4Z0XA 3RX8A 2ZCKL 1YZZA 2PR4L 1MWAA 2OTUB 3QNXA 3MGAA 4XCNB 2D31A 4DUXA 4XWOC 3RWIB 3WNLA 3BUYB 4PRHA 4MAUH 4P57B 1T22A 4HBCH 4GAGL 3QSKB 1PLGL 2JJSC 5FKPA 3MLSL 1AR1D 5KVMC 3I6LD 2XWJB 2NW3B 1TMCB 3MRFB 3MFFB 5K9KA 5EZOH 1DQDL 1FQ9C 2FIRT 2IG2L 4BM7A 4UUJA 5F8QC 3FN0H 1S7XB 3VMOA 4LGRB 4J3UA 3RWGA 1GZPB 5I19L 2DQDH 3TM6A 1JWUA 1F4HA 4MB4A 4DKFL 5KG9B 1G84A 4PJDB 5EOCJ 1AGCB 3ZYIA 3I75A 2Q7YB 5FECA 4PRAA 3UTTE 3BQUD 1NH6A 3KDMA 3MOQA 2GJ6E 4M3KB 3L3OA 4PG2A 1IM3B 5IHLB 5LGJB 5J57B 2VIRA 4GUPA 1YMMD 1U8LB 1HXMB 2BRQA 5ETUA 3R0NA 4ZUSB 2CDEB 4LPYA 4XRCB 2V2WA 3N1MC 1J0IA 1TCMA 1OW0C 5DLML 2AXFA 1I7RB 4L29B 3VXRA 3AVEA 1WBZA 3QDAA 4DK6A 1FNGB 2F53E 4YHLL 1ITBB 2CKBB 7FABL 1EUUA 3OSKA 5T5FL 2BOCA 1WBXA 3MLVL 2A9MH 4ZAKC 1FL6A 1T83C 1BBJA 4MQ7A 4G5ZH 2LVEA 4M93C 3HE7A 3GSNL 3VMPA 4O4YH 5DMJB 4IRSC 5AYQA 5DJ2A 3KXFD 1FAIH 4FZEL 3RGVC 4D9QD 4L9LA 4JANB 3MLPA 1U8MB 4MMXC 4ZAKB 5E9DB 1NEZB 2KUTA 5BV7L 5IM7A 5GZNC 1GHFL 5D5MF 3QEQA 2NYYD 4M93B 3K8KA 1AGBB 4R8WH 3K8LA 3X14A 5BMFL 5T1LA 4C4KT 2DKSA 1EGJL 5C0AB 3FTGB 3QFDA 4OGAC 4Z0BL 1NPUA 3X11B 2CMRH 2EEAA 2DQCH 2YEZA 4LFHG 3CMGA 5I8EA 5SWSE 4YFEA 1WWAX 4JB9L 1ZA6A 4LPCA 2J8OA 4YBQD 3MOAH 4PLKC 3MA9L 3QHZL 4JKMA 2DWEA 3NZHL 3KWWB 3ULVL 1TITA 4YWGL 2A77L 5A2LH 1U58A 3MV7D 1RVFL 2NY2C 3KYNA 4RAHA 2X89A 1QR4A 2O5YL 4U2ZA 5C0GB 2AV1B 4IHOA 5ACLA 2R0ZH 3LV3B 3QUXD 1Y0LA 3RVUD 4YO0A 1AO7E 3D2UB 1BEYL 1J88A 4FABL 3SQOL 4WUUB 5TH2B 4X7TA 4N0YL 4PRDB 5IB4B 2EC9T 3L3HA 2NTFA 3UJIH 2WINA 5KTEL 1SYVB 2VTFA 2NY2B 2PCPB 4LCYB 3NZ8A 4UTAL 2ATKA 2ZCKH 1UWXK 2I27N 4XNYL 4HIJA 4LEOA 2C4FU 5F88B 3DNKA 4HGMA 1BX2B 5IEKB 3TPUA 3O4LE 2Q20A 4H1LG 3N85L 5F7EL 3OXSA 3BH8A 5EDXA 4L8DA 2FSEB 4K71C 4V1DA 5C08E 1I3RB 1LILA 4GAGH 4OCYL 3MGOB 2E27L 2YRLA 3C5ZC 3DSFH 4NQXA 4JLRA 3MLSH 1PKOA 2H8PB 4IS6A 1NAML 3TIEB 3LY6A 1A6AB 3CUPA 3P4NB 4P5KA 1VACB 4X0KB 3TA3A 3TFKD 3S36L 4X6CE 3QIUD 5EBMA 2QJDA 3CFIC 5TDPA 3KPPA 4K71B 1AQKL 5K33A 2VE6B 3C5ZB 4YAQB 3S5LG 2XTLA 2XWBA 4KQ3L 4BJLA 4PB9L 4Y2DB 2CLZB 5I17B 3DUUB 5CSBA 1IC4L 5DT1L 5FOJA 2FIKB 3K74B 4F80A 4JO1L 3WNMA 3ZKMD 1AHWA 4JFXB 5BW7C 3P9MB 5EZLB 1HNGA 1TVBA 3R0MA 1RK1B 5DUML 2LU7A 5B4MC 5CJ5A 2X6MA 2VITB 5ID1A 3PQYA 4NQTA 4CVWA 5CZXC 4HGWA 1UWXH 3BZFB 3TBYB 1F58L 1B4JL 5DLMH 2BDNL 2W07A 4R4NC 3UEZA 5HI3C 1H0DB 1T1ZB 1YA5A 3FOLB 5IWLA 5FB8A 1A1OB 1MHCB 4HIIB 3DV6A 3H9SE 5TGBA 4HS6A 4LL9A 2IH3A 4PJ9C 4P4RB 2XZQL 5C0EB 2XTJE 1P9MA 1D9KA 1U2CA 2D9CA 4OGXH 5C6PB 2RQ8A 3GSNH 4PR5A 4GAYA 1ZLVH 1SY6H 2A74B 2JKXA 4HUXB 4HUNB 1RZGB 4FZEH 4YFDB 3TN0C 1XZ0B 4LDLB 1CXIA 3W0WA 4Y5XA 5BRZD 3X13A 4FQQA 2GFBA 5DQJB 4PJ9B 5BV7H 1S7UA 4OZGF 1GHFH 4Z76B 1E4KC 4JZNA 4RAVA 4X8JB 4E5XA 1TLKA 5JPNB 1RSFA 5IR1A 2VXVL 1CCZA 5BMFH 3MCKA 1PEWA 2EYTA 1MWAB 2IADA 3UJJL 3TN0B 5E8PA 4GJTB 2D31B 2QSVA 5FCUL 1RU9L 4J6RL 1HDMA 4PRHB 1ZMYA 3MV01 1T22B 4P2QE 5FKPB 3EHBD 3KPSE 3RZCD 5DUPH 1UM6H 1DBML 2WAHA 3TIDA 5GS0C 1AJ7H 1CDIA 5C92A 3MV7E 4OLXH 4X9IA 2CKBL 4AL8L 3LCYA 1HILB 2EYSB 2VAJA 3K1KC 3QHZH 3NZHH 1JTTA 3ULVH 4YWGH 2A77H 4NZJA 4L3CA 4PG2C 2WW8A 1RVFH 2O5YH 3KLHD 5MERA 3GI9L 3D39D 4MCZA 1B0RA 3EJYD 5DD5L 5T1DH 3KDMB 2JCCB 1C5CL 5HJ3A 3SQOH 2BHZA 4FABH 3L3OB 5C07E 1GL4B 2ESVB 3EYUL 4G6MH 5KTEH 4JO4H 4U3XA 3O6ML 3O2VH 2H45A 2VIRB 3IDYC 4GUPB 4UTAH 4HUKB 3CPLA 5ETUB 4FHBD 5J3HC 1MOEA 4NNPH 2E7BA 3O2WL 5IK3B 3WFBH 2V2WB 4PRIA 5HDOA 1FFRA 5T5NG 1EBAA 2AXFB 2EC9U 5JO5A 1GPOL 4N5UA 1WBZB 1QQDB 3IDYB 4HKZA 3DO7A 4OCYH 2P5WD 4NC1C 1KTKE 5I1DB 3HMXL 3G5XA 1NAMH 4HAFA 3QJHA 4XI5C 2JJUA 4PJIE 1YMMA 2BOCB 1WBXB 4DWHA 4M48L 1BBJB 4Z7WA 5H35B 4Z7OE 1AQKH 4YHKL 4MJ2A 1CR9L 4KQ3H 4PB9H 1Z0MA 1X5LA 2D7TL 3PXJA 5DJ2B 3STBA 5JUEH 1XF2A 2GUOB 4JRXB 2X41A 1SM3L 2MTPA 4PJ8D 4HJ0C 4JO1H 2IQ9L 4G8IA 4O2CB 5IM7B 5D93B 2X4PB 1XF5A 1S9VA 3KAAA 3QEQB 3MV9D 5IROC 5FIEA 5CMAA 5IOPA 4G6FD 1KJ3L 2CK2A 5DUMH 4NQSB 1URLA 4IDLA 3QFDB 1ORSA 5JIIA 2X1OA 3KXFA 5HPMB 5F7DA 4MCYA 2BDNH 2A73A 1RZIB 1OP9A 2YEZB 3DLQR 1ZANL 3UP1A 4NO0D 4NHCL 2AERT 2EH8L 3NCYP 4KKAC 3WBDA 5DFWH 1ZA6B 3RU8L 1W72A 2DWEB 1CFVL 3PHOA 3EYOA 1U58B 5GZOD 3D1MC 2DQIL 1P2CA 1UH2A 3KYNB 3SDXA 3PV7A 5DHVH 5DJYB 4ZYKA 4IHOB 4MJIB 5AD0A 3ARFD 4I5BA 1AY1H 3FT4A 2XIDA 5TE6H 2VLKE 4WGVB 1WWWX 4TOYL 5HYJB 4X7TB 4N0UE 1PYWB 4Y16D 3L3HB 5SWZD 2NTFB 2GK2A 2WINB 1MFCL 3OAZK 2VZUA 1MQKL 4WDIA 3NZ8B 4UAOC 4I77L 2PF6A 4Z6AT 1A9BA 4XP9L 4HIJB 4LEOB 5E95B 1YUHA 4XMLL 1D5IL 4ZFFA 2VWEE 3OXSB 3QUXA 3ZKXC 3BH8B 4J1UA 1JPST 1P53A 4PJ7E 4L8DB 3GSVA 4V1DB 3U0TA 1LDPL 4NQXB 3S4SG 4UAOB 5F3HA 1BAFL 1HCFX 1T21A 4RQQA 3EOBB 4IS6B 4JFEB 1DBMH 3B9EA 3ZYOA 3L1OH 2BNUA 4ODSL 1MPAL 2MQ3A 5EOTB 3CUPB 3UPAA 4KKBD 4EXKA 3QUYD 3H9YA 5TDPB 4EN3A 3EUUA 3ZE2E 1LO2H 1AHWC 1JF1A 4LGPB 4CRPA 5DO2D 2XWBB 4NJAL 4ZSOE 3O0RL 3S96A 5T3ZE 3GI9H 1LO5A 2H1PH 5F1SA 1E27A 2QR0A 2VLRA 3MRHA 5CEZH 3S98A 4LPWA 3CXHJ 4OZFA 1AHWB 4MQXD 4YHML 3QDMA 4I2XB 5JZ7D 5GRVK 1KT2A 3QIUA 2F74A 3CDGA 3PIQA 4MZ3A 4U6YA 2P47B 2MWCA 1TVBB 1T03L 1X5GA 3PF2A 2KPNA 3WE6B 3PQYB 4POZC 1I3UA 2XQYG 3UCRA 3RL1A 3C6SA 3HR5A 4HGWB 2VZSA 1MWAL 4MHHI 1RHFA 1H15A 1QRND 3FB8A 1P9MC 1D9KC 5DDHA 2E9WA 4C56A 5F9AC 1KCLA 3WFCL 1YEHL 5FB8B 2DMCA 5GJTL 3BP7A 3DV6B 4FN0A 5TGBB 4IEFB 4APQD 4HS6B 4PJFE 4Y5XC 2PXYA 4Z5RB 4AENB 1FLRL 3VXPA 1JMXA 4OD2A 1NUDA 3MRGA 3JVGA 4QT5A 1CDHA 4YHKH 1D9KB 1J1XH 3T0DA 2P48B 1HEZA 2ICWJ 3VFMA 2D7TH 4X7SH 4YE4H 5EORL 5GS1C 1MFBH 1SM3H 1F2QA 1YN6A 1DR9A 2DBLL 2CKNA 3BVNB 3W0WB 5MEND 4Y5XB 3IAGC 3F12B 4FQQB 4LOUC 2GFBB 5DJXB 4AYFA 2IQ9H 2FYYA 1M7DB 4K94L 1S7UB 2BX5A 2EDYA 4RAVB 3RUGA 3WXWH 3KYOA 1P4BH 5IR1B 1UB5B 5FA4B 3LKSB 2DD8L 3MCKB 3T8XB 1KJ3H 2EYTB 3EDEA 3LKNA 2IADB 3O41A 5GS1B 3HAEA 5EPMB 4UIMA 1FDLL 5E8PB 1A2YB 2WWMC 5ADPL 4QOKD 5IW3A 3FHQA 1HDMB 4Y7MA 3QUMA 1WAAA 3LPGA 1CGXA 3UMTA 1RI8A 1ZANH 1C08B 1U8QB 3VWKA 4NHCH 4HWNA 4F8QA 2EH8H 5AZ2L 2XN9D 4Q9QL 1P1ZA 3RU8H 3VFOA 3GM8A 4N68A 1G9ML 1FLTX 1CD0A 3BSZL 4QTHA 4ZD3L 3W5NA 3SDCD 4XAKE 4JY4A 4P2RE 5ACZA 2EC8A 2J8UA 4HXBL 5MERB 2HRLA 3TP4A 4MCZB 3PWVB 5FUZL 5B38G 1B0RB 4HMDA 1ZTXH 3EO9H 5TDOA 3RZCA 1FH5H 2A1WH 4RBPK 2D4DA 5FM4A 1OP3K 4TOYH 1T4KA 1OGAD 4BKLB 5A3ID 1PJ9A 1MFCH 3NCFB 4LSRL 1DSFH 4YGVA 1NCAL 3CLEL 3CPLB 4FXLA 4XP9H 4WEUD 3P30L 5FO7A 1D5IH 3MA7A 3C8KB 1Q0XH 3OGOE 4PRIB 3DGGA 4WHDA 4W4OA 1NFDA 3UYRH 43CAA 4PD4J 2ZSVA 1ZXQA 1YY8A 4S1DD 1CFBA 1YEJH 5GS2H 3ME0A 3B43A 5F9DC 1UT9A 5ESQA 5HGGS 4HKZB 3L5JA 1IMHC 3LPWA 4LCUA 4G8GD 2M1KA 4QWWD 1OM3H 5BVJA 4I0PD 3QJHB 2OR7A 3FN3A 2J3SA 3LSOA 3UZQA 2X7LA 5IW1A 2C3WA 4G6JL 4KMTH 4Z7WB 3OR7A 5KSAD 3T0EE 1JP5A 4ZQKB 1CGYA 4NJAH 4JFQA 1XF2B 3O0RH 1T1YA 1JK8B 3TWCH 4ZO8A 2P5WA 3QXTA 2DQJL 5F1OB 1T66D 1IQWH 4G8IB 2EDFA 1S9VB 3QXAB 4WI9A 3VFUA 3BWAA 3JTTA 3BXNB 3RIFF 4YHMH 5I71C 4UV4L 4PJAA 5CMAB 3BPNC 4NUJA 1UXSA 3CZFA 3SJVE 5F1KC 4MNGE 4KVCL 5F7DB 4MCYB 3PWPB 1KOAA 5I71B 1TETL 1RZFH 2W9EL 4S1QH 2X4TB 3BPNB 1ZGLA 1J0KA 5F21B 3WFCH 2YA0A 1V5JA 1DE4B 3MV9A 1YEHH 3MROA 2YSSB 3CFKA 3WHXB 3TNNA 1J10A 5F8RC 3QRGH 1ADQA 4X8XA 4F7CA 4K7FA 1W72B 3LS4H 4GLRI 1FLRH 3EYOB 4Q0XH 1ZS8A 1I3GL 5DQ9A 3D0VB 3BAEL 1P2CB 1FIGH 3SDXB 3GMMA 1FG9C 4J23A 5CJBA 5AD0B 4PRPE 2E7LA 1PKQA 1JRHI 4I5BB 4GG8B 4GW1A 3FT4B 4NO0A 4DZ8A 4MB5A 4PJHE 3SCMC 3H7BA 4K94H 2B4CL 2UVFA 5B39A 1I8MA 1W0VA 3TVMD 1N0XL 2J7LA 3P3YA 4QHKI 4WDIB 2BRRL 5EBLA 1F45A 3IFOA 1A9BB 3CMOL 3LIZL 4JQVA 2NW2A 5CUSL 3HHRB 5J9PB 4D9LL 2Y1VA 4ZO7A 3NIDF 2DQUL 5EU7C 3SCMB 3E1F1 4F7TA 1R5VA 3ARFA 1UCBL 1OVZA 5E5UB 3X17A 5D9SA 2CUMA 3FRPA 4EN3C 5HYSG 1W2KT 4L9DA 5KSBA 3VFNA 2VDQL 3JWNC 2IBZX 2MQCA 5F3HB 1NAKL 1I1YB 1T21B 1F4AA 4RQQB 3GSRA 5I1CL 2V7NB 5SWZA 2OJZL 5F1NA 2KZ1B 5AZ2H 2BNUB 4CW1A 4Q9QH 3W9DB 2VSCA 4NCDA 1CLCA 1G9MH 5JHDE 4EN3B 4H25A 1ORQA 1EV2E 3BSZH 4JGMA 3O2DL 4G3YL 4JFPA 4JY5H 4N8VA 4K8RH 1RZ7L 1JF1B 1CN4A 3UPRB 2ZZUT 5IFAH 2MFNA 5DFTA 5CEYB 2FRGP 4HXBH 4MQSB 3S96B 1L9NA 1OGAE 2I60L 4PJBA 2E8ZA 1LO5B 5T3XL 3RVTC 2P8MA 1E27B 1DLHB 2QR0B 3OX8A 5FUZH 2VLRB 3MRHB 1MLBB 2DLGA 3I6KA 3QPXH 1IJ9A 5LBSL 1OTUD 4OZFB 1A6WL 4XNMB 3QDMB 1QFWI 1RIUL 4TUJA 1I3VA 2F74B 3CDGB 3PIQB 1FYTA 1SMAA 1JRHL 3CLEH 3Q5TA 4Y19D 2FJFA 1RZJC 3RL1B 3C6SB 3HR5B 4UMGA 5K59E 1GRWA 5GRUL 2PXYC 5GRJH 5J7CC 1JHTB 4XCEA 2UWEA 3FB8B 3RNKA 3VXSA 1X9QA 3QCTH 3JVGC 1DQQA 3GSWB 1QOKA 1X4YA 2FDBP 3QQ3B 4C56B 3V0WL 3SOBH 3TEUA 3BX7C 1SVZA 2DBJA 3BP7B 3SE9L 1L6ZA 3HFML 3HC4H 4QRTA 4IMKC 2L0DA 4UBDD 2X4RA 2AJXL 3IF1A 4WI7A 2PXYB 2HG5B 2DRUA 5EWIL 1KPVA 3PHQA 5LGHH 2QHRL 3IRPX 4QT5B 2RB8A 2Y36H 4PV9A 1FSKC 4NQDD 7CGTA 3SKMA 3LRGA 2XPGB 4NN5C 2X4SA 2EDBA 1T04B 4MA3A 3GI8L 4JG1L 1EFXB 3VFMB 5IIEA 1QRNA 3A67L 3NIFF 2VN4A 1LEKB 5ICZA 2LV4A 1YN6B 5E00B 2L7UA 2FYYB 3HG1D 1U91B 4L8SC 4ZS6D 5I66B 4MWFB 3RUGB 1FSKB 4C83B 3R8QA 2GSGA 4APQA 3KYOB 4H88H 5IBUB 3W39A 4NN5B 4P9HC 4D3CL 1INEL 3KPRE 3W82A 3GJEA 1NCDL 1WZ1L 3VWKC 3O41B 3UTSB 4WO4D 5KAQG 2BP3A 4WI4A 3HAEB 4UIMB 3U9PL 4P3CL 1BECA 2A83A 4L8SB 4AMKH 4KRLB 3N1FC 5J6GA 1YPZA 1QFWL 1RUAL 3CJJA 3QUMB 1GC1H 5MENA 4HCRH 1TETH 2W9EH 1FGNL 3DX8A 3VWKB 2YOCA 5EZJB 1MF2L 3WO3B 4TSAL 1YJDL 4KK6C 1GSMA 3VFOB 5CJOL 3HUJA 4HIEA 4QTHB 1BQUA 4PRBB 4JM4L 3GMLA 1JZ3A 4JY4B 4JFHD 2B1AL 2JIXB 4QOKA 5ACZB 2C1PB 3B2UD 1ZK9A 2J8UB 4NT6B 2BERA 1OP5H 4E42A 3IJYA 5TDOB 3SGDI 1X5KA 4LF3A 4WENB 3CXDL 1KNOA 4W4OC 1T4KB 4JVUA 3KLHC 1UA6L 2F5BL 2XN9A 3VXMA 1D6VH 3CX2A 2B4CH 5CP7B 5IBLD 3AS1A 1ZEAL 4I18B 1EHNA 3OF6D 1ZLUK 2OTWA 4YGVB 1B90A 1U2HA 2BRRH 1P4IL 3LEVL 3LIZH 2YD5A 5CUSH 1CG9A 2H6PA 3MA7B 2VO5A 3MYJB 4DTGL 2WUCH 2DQUH 5F89B 3DGGB 3SDDD 1NFDB 43CAB 1IAOA 1YY8B 2ARWA 1JGDB 1UCBH 3U83A 4RFEA 5ESQB 4P9MH 1YYLL 5L2JA 5EUOA 4JPVL 4OD3L 3KPMA 3GRWL 4OCLC 3QRFM 3BFOA 4MJ6B 3LQZA 4DVBB 1VCAA 3MV8E 5E2TL 2I07A 4K23H 2X7LB 5FUCE 4I13B 5IW1B 5EUKB 3UAJD 4Q97A 3O2DH 3OR7B 1UB6A 5C6WH 1RZ7H 1U3JA 3WIIH 5GHWH 1ACYL 3UPCA 2YN3A 4JFQB 5D6CA 1T0NA 4FNLL 4Z7QF 3BE1H 1T1YB 5T3XH 2XZCL 3VGBA 1XR8A 2LE9A 2HT4D 2YMXL 5T33H 3DX7A 2M8XA 4K7PX 1EFQA 4G8GA 5DVOA 3UC0L 5D7JD 5LBSH 1NSNH 3BWAB 3VFUB 3JTTB 3OPZL 1BLNB 2F9BT 1A6WH 5HGHB 5MEQA 1VA9A 4JCLA 3R8BB 3OKKA 1FBIL 4PJAB 2R0WL 1QFWM 3F7QA 4HXAL 2VLLB 5D1QD 5KSAA 3M45A 1BM3L 1ZLUH 5H8DA 2C3GA 3ULVE 5GRUH 1O7VA 4LCCA 4Z9KB 1XH3A 2R2BA 5IB5A 2W92A 1ZGLB 4PGEA 3BPCB 3IFLH 4WRLA 3V0WH 1YEGH 3MJ9A 3KVQA 2HTLD 3MROB 3G08B 4OTXL 3TNNB 3VXQA 1IBGH 3HFMH 1U93B 5JW5A 4ERSL 5D72H 4F7CB 4K7FB 4P2CG 4HKJA 5FM5M 5EWIH 1HQRA 2YBRA 1BD2D 4QRPD 1G7QA 4NNXB 1TZIA 4OJFL 3BYYA 3GMMB 4XBPA 2FJGA 4JG1H 4JQVC 4GW1B 2HKHH 2V6HA 1TZGL 4DZ8B 3A0OA 3Q3GA 3H7BB 1JF6A 5L2KD 5B39B 1I8MB 1WJ3A 4ZPTA 3BRGC 5JW4N 1E28A 5EBLB 4D3CH 1INEH 3LMJL 1W0WA 3IFOB 2C3XA 2QSCL 2NW2B 1WZ1H 4K3JL 1YNKH 5I8OL 1OSPL 1OGTA 2LVCA 3U9PH 1DBBL 4P3CH 1Q9KA 4UOJA 4F7TB 1R5VB 3L3KA 2DI9A 3ZDZF 2AK1H 2X9XA 5D9SB 4EIGB 1QFWH 1RUAH 4CVUA 3AB0C 3VFNB 3S3SA 2QQKL 1WK0A 1FGNH 1JPTL 1MFAL 4GRWB 3GSRB 1S8DA 2H26A 1AR2A 2YPVL 4NQED 5F1NB 4Q74A 5JW4R 5IB3A 1YJDH 3EYFB 3S34L 5EIIA 4JFHE 4ESKA 5CJOH 4P59L 2JELH 4H25B 4JFPB 4JM4H 4LQFH 1PZ5A 1RZJL 4N8PA 4NKQB 3AB0B 1FO0A 5EFIA 4MJ5B 5I1AA 2A6JA 3AAZB 2B1AH 2NY6D 3BEWA 1X5ZA 4Q2ZB 3KYKL 3O45B 2V9RA 5DZLA 3GHEH 4GBXD 4PY7A 2BNRE 2ITCB 3PV6B 4KPHL 1GZQB 4PJBB 4Z7WF 2P8MB 4IM8A 2VXSL 3P9LA 4ISVA 4YHOH 2DICA 2IALA 3I6KB 3ROLB 1TTFA 4XMPL 5IVZA 2WV3A 1UA6H 1PFCA 2WIIA 4TUJB 4Q9RH 4YEEA 4KI5E 3BZ4A 1AFVL 3V0VB 1FYTB 2CJUL 3MGTB 1KN4L 4J3TA 4OQTL 3RZWA 3LEVH 4WNQA 5C0DB 3K2UL 2OQJA 2FJFB 4PD4K 1TZHA 4DTGH 5CINH 2D7PA 1DFBL 1F13A 3MUJA 3GMQB 1CS6A 2IBBA 4XCEB 1IGIL 4OLYL 4K3HA 2VC2L 3VXSB 1DQQB 5HD8D 2CUHA 3KYMA 4LLWA 4F15C 3GRWH 1DN2A 4U4BA 4P9HL 5CCKH 1HHGA 5E2TH 5I1HH 2X4RB 1HHKB 1HSAA 1KPVB 2XACC 3PHQB 3D0LA 4Y19A 1L4IA 1Q38A 2IAMD 4HMCA 4F15B 1L0QA 2NX5E 5K9QG 4HF5L 4FNLH 4MA3B 5FO9A 4E41A 1FNLA 4WFHE 2DLTA 3TGXA 5ICZB 1N6QH 4KRPC 4K3DL 3RWFA 1K8DA 2DQHH 4W6WB 1ZLSH 4DAGL 3SDXF 3UC0H 4O00A 4JFFD 4LHUD 2GSGB 4XPFL 3VI3E 4AIZA 4M9OA 3W39B 2KQMA 2R0WH 4F9LA 4MLSA 3GJEB 4HXAH 4U6VH 4U6HA 5DMYA 3MRDB 4NQDA 5C0CA 1BM3H 4KRPB 1AI1L 5GIRA 5E8OA 5EA0L 3D85D 2A83B 4N0RA 2HRPL 5J6GB 3SQBA 1YPZB 4RAUA 2YXFA 2GI7A 1F6LL 2H32B 2CRIA 3HN3A 3N1QC 4JFYB 4FTVD 4U33A 3MBXL 5E24E 5KSVB 3IFPB 1G0DA 4NFCA 1BD2E 5CEZE 3K0WA 3QUKA 1KXQE 3UTTA 3HUJB 4ERSH 4XP4H 3RIAF 2XFXA 4JM2D 5HVFB 2ADFL 4HIEB 5HVWA 4WO4A 1RPQA 2YKLL 4WI6A 1A8JH 4KXZH 4DCQB 5H2BB 3C60D 4OJFH 3B9AA 1FJ1A 4E42B 4LMQI 4GT7A 5L2KE 4P4KA 1I1RA 3ULUD 1A6ZA 3PE9A 4LF3B 2YHGA 4LPUA 4DKDC 5CWSB 1LQSR 5IG7B 1KNOB 1I1AD 4HQQH 3PWJA 1IGTA 3VXMB 4K3EL 3MODL 4J8RB 3VJ6B 4LSDA 3IS0X 5FDWA 2P8PA 5ALBH 3U48A 3Q1SL 4UTBL 1DZBA 4FFWD 4F8TA 5ITFA 2IANB 1F02I 2APWA 3LMJH 3IXTB 3EAKA 2XT1B 5F6IC 4KMQA 2H6PB 1S7TA 1N0LA 1UQSA 1OSPH 3LH2L 5I8OH 5C0IB 2DOCA 1IAOB 5E0QA 5D7LE 2W1NA 2AABL 2Z91A 4KGLA 1LVEA 4NZUH 3TZVA 1VB9A 3VW3L 2QQKH 3UYOD 5EUOB 3WS6A 1JPTH 3KPMB 2FCBA 2AK4D 3EOTH 3AROA 2YPVH 5F6IB 4X5XB 4ENED 3LQZB 3B4NA 4XNUH 5EO0A 4J3VA 4CKVX 5D2LA 3FQTB 1IARB 4MAYD 2I07B 4P59H 1CQKA 1UB6B 1PSKH 4H0HB 1HE7A 1HHJA 4ZS7L 1J12A 1OLZA 3MRJB 3MC0A 3AS3A 3RL2A 3WFEL 4A6YB 2X40A 2NPLX 2BSED 5D6CB 1RUKL 1LK2A 3X3FH 5JA9A 1XR8B 4XPTL 2YXMA 2APVA 2IQAA 3DXAD 5ANME 1ZGLP 1VADA 3RTQA 4LCCC 1Z3GL 3HZKA 1A6VH 1IQDB 3L95B 3GHBL 4XPBL 1I9IH 4OQTH 4JDVA 3K2UH 3RUGF 2R69L 3WL9A 4IMLA 5JLZA 1DFBH 1T80A 3S97C 1AKJA 1II4E 3MRKA 1EXUA 2VN7A 5JQ6L 1IGIH 4XCCL 4LCCB 3U2SA 2ICEA 1XH3B 2VC2H 4KV5F 3KG5A 1N59A 3VXQB 4GG6E 2QKIA 4G9DA 1WAAF 3ILPB 2ZG3A 2V2XB 3IDNA 4DGYL 4RA3A 5D1QA 4HKJB 5E56A 4LCWB 3UBXA 1AO7A 3CVHA 1HQRB 2YPLB 1QRKA 2IWGA 3B9DA 2V17L 5ILTH 3RVWC 4EQ2A 1G7QB 1TQBB 4NQCE 3ET9F 1QLFA 1N4XL 5CLTA 2FJGB 4HF5H 2FX8L 1HCVA 5F6HJ 1H5BB 1JGUL 3Q3GB 4DAGH 3U1SH 2J8UF 1UGNA 5C09D 5BZDB 4XB8A 4YX2H 3DJ9A 5D71L 4N0CD 4XPFH 3BWUC 2Q6WB 1E28B 5C08A 5SX4H 3IDMA 1W0WB 4RMRA 1SBBA 5L8JB 4XC1H 4UNVA 1UYWH 1QLRB 1AI1H 2Z8RA 1OGTB 5D7KD 5EA0H 2X4UA 3OKMB 3RVVC 4FTVE 3L3KB 2HRPH 4QNPE 1F00I 4HH9B 5GGVL 2VDOL 3ISWA 2VABA 3NN8A 2ZPKH 2FD6L 1MY5A 5C3LD 1S8DB 2H26B 4JGJA 1NFDF 3RWDA 4BK5A 3M1BB 3NFSL 4I48A 2QADD 1EO8H 3QEGL 5EIIB 2SEBA 1JHKH 4L4VD 3U0PA 1PZ5B 3WS3A 1JVKA 1FO0B 1IGYA 2YKLH 2F54A 4FMKA 2UUDK 12E8H 2A6JB 2BZDA 3MRIA 2YD6A 5I1AB 2OK0L 3D48R 1CICA 3C8HA 4KY1L 2JK5A 4PY7B 1M71A 2WQ8A 5BS0E 1X7QB 1F6AA 4LHUG 3P9LB 3MUGA 4QRQA 4ISVB 1GOFA 2IALB 2HJLA 2D9QB 5IVZB 1DBKH 1BIHA 1MJUL 3VFTA 4CU7A 1TVDA 4HG4J 1T89C 2WIIB 3MODH 4K3EH 1LD9A 5FV1L 5KOVC 4RGNE 3BZ4B 3Q1SH 4UTBH 1T0PB 3DROA 3AXLA 4WNQB 4Z78A 1C5BL 5DJCA 1BJ8A 5GGSY 1KTDA 4JEGB 2XOTA 3LH2H 4OCSH 3E8UL 4GBXA 3V5HA 1WCQA 4YC2C 1KEML 4CN6A 4PJAF 3H9SA 2VQUA 1DL7L 2AABH 1OWWA 1FFPA 4B5EA 5ESAA 3ARDD 2UZYB 4JKWA 3ZDYF 2UZIL 3TV3L 1PX4A 4JKPL 3VWJD 2NY0B 2GQHA 3KYMB 4LLWB 3OAUL 3KLAA 3KJ6L 4C59B 4G9FB 3IJSA 4JHAL 2AXJA 5IMKB 3D3VD 1EVTC 4B7IA 5FOBA 1HHGB 4LAQL 1TQCC 3DRQA 4PJ5E 4YC2B 1GGTA 3ZDXE 5ICYA 4OI9A 2AJSL 1HSAB 2EDQA 2YZ8A 2GEEA 1KCSL 4MXVE 4XPAL 3WFEH 3BD5A 2GSIA 5AYUH 4F9LC 4E41B 5FO9B 1RUKH 4OM0L 2P44B 5C70A 1TQCB 4L4JA 4XPTH 3ILQC 3RWFB 1K8DB 4R96A 4YJZL 4ELKA 2CXGA 4LARL 1JFQL 3CC5A 4HH8A 4GH7B 1YEFL 4RDQF 1Z3GH 2VL5A 4UI2A 2BVEA 2EDWA 3IGAA 3FT2A 1KIRA 3MRBB 4YPJA 2YWZA 3KPSA 4XPBH 2IAMA 5C0CB 4H26B 4NWUH 5CKAA 1KCKA 4Q6YA 5E8OB 3LKPA 3QCUL 5GIRB 2R69H 4PP1C 4OFIA 3S3JA 1B9ZA 1NGPL 1ONQA 1J1PL 2Y72A 5HY9B 2AW2A 5JQ6H 4XCCH 4R4FL 2AXGB 3CFCH 2HT2D 3JUZA 2DJSA 3HC0A 4JFFA 4LHUA 2AP2A 4X99A 3MRPB 4P4KC 2VRAA 3QNZA 3UTTB 1EEYA 3R06A 1HI6A 2XFXB 5DMGC 4DOHE 4GRWF 1JYXA 2GJ6B 3EDFA 5D2NE 3D85A 2V17H 3HC3L 2AJVL 1FJ1B 3MLWH 1JF5A 4GFTB 4P4KB 2HFEA 5HTSA 1A6ZB 1FZOB 4A6YL 2FL5B 1JGUH 1N3NA 2CLRA 3QJFA 3PWJB 1IGTB 1OWRM 1UM4L 5ID0A 2OSLA 4JFOA 4M6NH 4PBXA 4PJBF 5FDWB 2P8PB 5D71H 4JM2A 4QLRA 3TZVC 3SY0A 4JDTL 3WS6C 2R4SL 5TQ2H 3DRTA 3V6FA 2JB6B 3DMMA 3NFPA 4R7DA 1S7TB 3FQUA 1UQSB 3CLFL 5HHQB 2YRZA 3BRDA 2P42B 1JZ7A 3CSBA 4PJIA 4WTZA 3RWEA 1QFPA 1A7NH 3QXVA 1R3KA 4HC1L 3TZVB 2OP4H 2EXWD 2FD6H 1P7QA 2XG4A 1XGPB 3OB8A 4QGYA 4M4RA 4QHUA 4YHYC 3CFEA 3ZT7A 1KG0A 3LQAC 3INUL 5EO0B 3QEGH 4EI6A 4NP4H 6FABH 5CJXA 1BVKA 3QT2A 4YR6A 4TNVK 1S9KC 3RTQC 2LAAA 4YHYB 4QRUA 1JWSA 3IDGA 3RL2B 4KY1H 1WQVT 4XVSH 2E6PA 4LSPL 5F7YC 3UAJC 3NMEA 3OZ9L 3U0WL 4D0CB 4OI8A 2CPCA 1GAFH 2X1PA 2VZ3A 4ONFL 4HUVA 2P4AB 1QKZL 1F5WA 2CH8A 1XGYL 4BSVA 3VFSB 3VXNA 3KS0J 2Y5EA 4DZBA 5DJDB 2IQAB 2QEJA 3GKWL 1MJUH 3EYVA 3MXWH 3RTQB 2DL2A 4H1LB 2C26A 4AH2A 3HZKB 5DVMA 1MCCA 4TVPD 1UJTA 1XFPA 3U7WH 5SWSB 1N7ML 1C5BH 4JDVB 1MUJA 2O5XL 4R2GD 5GGTA 1QFUH 1KN2L 3E8UH 4YBHA 3WL9B 4IMLB 5JLZB 2MCPL 1EJOL 5D1QC 1KEMH 3DUHA 1AKJB 1FVEB 3GJFA 3MRKB 4PRNB 1U41A 4YFLI 1EXUB 2XY1A 3U2SB 2ICEB 2X4NA 1MCFA 4JKPH 3DXAA 1BZ9A 4EOWL 5FYJL 3OAUH 4P2OD 3KJ6H 1YPZF 3T1WA 4JHAH 3K7UA 2QKIB 4G9DB 1BVLB 4KHXL 3UBXB 4DN4L 1AO7B 2VLKA 2AJSH 2DYPD 3PXHA 4WVRA 1NLDL 1QA9A 1A0QL 2YPKA 1RK0A 3VGFA 1QLFB 4XPAH 3HUJF 4GKSA 1FO0L 5J11C 3NFNB 3IDXL 4QHLA 4MYWB 4OM0H 5IBTH 4G7YL 4XPGL 1EHLL 1U8KB 4ETQA 3RIFK 4L1HA 4LVOC 3O4LB 5F9OL 4JZOA 2V5TA 4O58L 4PJCA 4OZIA 4HX1A 3C6LD 4MDJA 2DQFA 1KSRA 5LWYL 3ZTJG 2P24A 5C08B 3RDTD 5KANI 5D6DA 5J11B 3IDMB 1UZ6E 2J6EH 4LU5H 4ZOAA 2NXZC 1OAYL 4XMKL 3CSGA 1JV5A 2X4UB 4OAWA 2PYEE 4LVOB 2GW5A 4MX7A 1NGPH 3LPFA 1IKFL 3QEHA 5JR1L 2YD8A 4QYOA 4X6CB 3RA7L 4LHQB 2D7QA 4JPWL 2VABB 3NN8B 5DJ6A 1DEEA 4R4FH 3WFHA 1CICC 3QR2A 3RWDB 1ZHBA 3VJ6A 2NXZB 3TO2A 3FB7A 4I48B 4K7PL 5E2JA 2SEBB 5SWQA 2AV7A 3U0PB 5EUOF 3W11D 3WS3B 1IGYB 4MD5B 2F54B 3MRIB 2ZSWA 2KDGA 3RNQA 5HI5D 1CICB 5L8KB 3QCVH 4BK4A 1MVFA 3G6DL 3WKMH 5CJQL 1DBJH 3MYZA 4U7KA 1F6AB 3MUGB 1T5XB 4J7RA 3QQNA 2VXUL 3V6OE 4EDXA 3VFTB 3MUHL 4YXKL 1KB9K 1KACB 5E99H 1U3HC 1TJHL 4L4VA 1LD9B 4RRPG 4JDTH 2XTJC 3DROB 2R4SH 3AXLB 1XEDA 3WUZA 4CJ0A 1KTDB 1OQOA 4ODVL 2NMSA 5LXGL 5ABDE 1NDMA 1U36A 5A2KH 3CSYA 2NZIA 3EJZD 3O6KH 4U7MA 5C0FA 3H9SB 1A14H 1P5UA 1L6XA 1U3HB 2Q8AL 3X12A 4LSVL 1I7UA 3QIWD 4HC1H 4AG4L 2XTJB 3KGRA 2FGWL 3KLAB 1MI5D 1YDPA 3HMWL 1ZT1A 3IJSB 3INUH 3MBED 4YHPA 4DKEL 5IVXE 3DRQB 2R0LL 4HS8L 1JUFA 3PABA 5ICYB 2CGRL 5EOQL 2BVYA 4HZLB 4R26L 1FRGL 4LLYA 1ZE3C 4X4ME 5ISZA 3FQNA 5MEPA 2GSIB 4LSPH 4QRRD 3FQRA 3VD5A 2RCSL 3ARDA 4YZFE 2PTUA 1A7BA 4Y1AE 3ZLQC 3OKEA 1XGYH 3ALXA 3GB7A 5F96L 4ELKB 1EVUA 3GKWH 4B53A 3HNTH 4OFVA 3NAAL 1CLOL 4KJWD 5HHMB 1NGYA 2F5AL 4P2QB 3IGAB 1KIRB 5FYKH 1NCBL 2AXHA 4FFVD 3KPSB 3U4EA 5IMMB 4ZOBA 1PY9A 1N7MH 4XP5L 4FQPA 5C2UB 1GGCL 2O5XH 1I8LC 3LKPB 4PJXE 2FX9L 1XIWC 3NA9L 5AUMB 1ONQB 4M7LH 1EJOH 3S88L 4X6DE 2OZ4H 2FH8A 3WIHL 4BQ9A 3SKJH 1ZWIA 1NGXA 3HC0B 5FYJH 1MLCA 1QSVA 3T65B 5DURD 1XIWB 5IHZA 3HLAA 4M5YL 5FYLH 3RKDD 3QDGD 1HI6B 1AXSA 1ZVYA 2VLJD 3RWCA 4HWBL 5C07B 4BH8A 3HB3D 1CBVL 5IT2H 1RHHA 4NOBA 3VH8A 3FOMA 2HFEB 3DMMC 4P5MA 1G6RA 4XPGH 4ZOEA 1EHLH 2DM2A 1N3NB 2BFVL 3W9EB 2H3NA 1SEBA 5F9OH 5ID0B 4O58H 2OSLB 4R7NA 5TQ0L 3FO1A 4JO2H 3LRHA 2NY7L 5LWYH 2P49B 3DRTB 4GMTL 3TBSA 4MA7L 2L4OA 1HZHL 3V6FB 3DMMB 3NFPB 4R7DB 1OAYH 3FQUB 2G60H 3MCLH 4PJIB 4C55A 1Q9WA 1VFUA 3QYCA 3H2WA 4ZTPH 2ERJC 1OTTD 1IKFH 4EVNA 2ED7A 4RNRA 1CIUA 4PTTA 3RA7H 1WBYA 4NBYB 2DLIA 4IRJA 4HKBA 4JPWH 2A6DA 3T0EA 1P7QB 3G04A 3RPKA 3WJJC 3CFEB 2QBWA 1OTSC 4U1JA 2EZ0D 3RAJH 2P5ED 3MZTA 1BGXH 2CUIA 1WIOA 4K7PH 1MCPH 5ELIA 4EI6B 1EAPA 1RV6X 4TN9A 3CH1A 1NUGA 1X5IA 1B6DA 2ERJB 3C2AL 1BVKB 4YR6B 4KVNL 3C08H 1MRDL 3HS0A 1TXKA 1H8NA 3QDJE 4QRUB 1JWSB 3IDGB 4X6EA 1EZVY 1MREL 1ES0A 1RIHH 4ZPVA 2K9UA 4HZAA 2BY3A 3MJGX 4HUVB 4O2FA 4BSVB 3VXNB 2D7MA 2RHEA 4ORGA 3SJVA 4DZBB 3CDFA 4UILH 2BSSA 3BDYH 1HNFA 1Q94A 2AJYL 1YQ2A 4EXPX 1FP5A 3EYVB 4BUGA 1A22B 3TYFB 1CFQA 1TJHH 3TBTA 1RULH 3KLDA 5FGBA 4JQXA 4QY8A 1T1XA 2ZUSA 1MUJB 1T3FA 2VH5H 5E2UL 4D9RD 5LXGH 4K2UL 1M7XA 1CI5A 1I7TA 1GIGL 4KDWA 3GJFB 2UVEA 5DJ0B 5HHOD 1F8TH 2Q8AH 2GK0A 2X4NB 1P7KB 4U0RC 1BZ9B 1JZ6A 3PP4L 2VLMD 3HMWH 3DETD 1C8PA 3FN9A 4PRPA 4DKEH 5CGYD 4RISH 2R0LH 2VLKB 1LP9E 4XNZC 1R3JB 1UG9A 1FRGH 4ONOA 4PJHA 3BYTA 4QRRE 2VWEC 3STLA 2FEDD 2YPKB 4U0RB 3V8OA 4V2BA 3FFCD 5CD3A 3FJTA 4MNQD 1KFAL 4GXUM 4QHLB 2GJZA 2RCSH 4LLMB 4OCXL 4PFEA 3O9WB 3O4OC 4XNZB 3VA6A 2X9WA 1WZMA 3PP3K 4JZOB 4L4TD 1H3WM 4HX1B 5GSVB 3NAAH 1P6AB 1CLOH 2DQFB 1X44A 2P24B 2DYPA 2F5AH 5JOFB 4LASH 1NCBH 2D03L 4E9LA 2K7QA 5JMRA 1GGCH 2BJML 4N0CC 3O4OB 4X5WA 2E5EA 2FX9H 1JV5B 2Q3ZA 4U1KA 1UWGL 4OAWB 4BSWA 3NA9H 3QEHB 5JHDA 3M8OL 2IH1A 2XKSA 5DJ6B 5C0BE 1DEEB 1OARH 3M17A 3WFHB 3QZWA 5IV2A 1XAUA 5JDSA 4M03A 1I4FA 1DQMH 1ZHBB 3ARRA 3C6LA 3DI2B 4ZSOB 1ZLWH 3FB7B 3TO2B 2P1YA 4JG0L 3MOBL 1V8HA 1FE8L 4M5YH 4PBWD 4LLAA 5SWQB 4M7ZC 2AV7B 3CFDA 2GJJA 3J8F7 4XWOD 2AJZA 5E7FA 3V9FA 3H3KA 2LFGA 1JCKA 4X7CC 4JJ5A 2EDLA 2PW2A 2ZSWB 3U4BL 1AGFA 4HWBH 3RNQB 3RPIB 3VCLA 3VG0L 1CBVH 1HINL 4TUKL 5D2LF 3T2NL 1OF2A 1FNEB 2WZPD 4JHBA 1VGKA 1FNFA 4YEFA 5ADOH 4OF7A 4M7ZB 3QQ9C 5I1JL 4YXLL 2DQTL 2HN7B 1C5DA 2BFVH 1WGOA 3GBMH 3DURA 1MCWW 1E4JA 2NY7H 1A3LH 4KAQL 4CVXA 2GY5A 3LEYL 4MA7H 4IJ3C 2OYPA 1ZHNA 1HZHH 1WFOA 4N1HB 2Y7QA 1P4LA 1NDMB 5L88L 5C0FB 5JHLH 1K5NB 4FQ1L 2P43B 4PJFB 2AJUL 3X12B 2RFXA 1I7UB 2EICA 4BELD 4Y8DC 2Y06H 2B5IC 4ONGL 4M62H 5I1EL 3ES6B 1T0MA 4IJ3B 1ZT1B 1IM9A 1WWCA 5BJTA 5K9OA 1V3LA 4U1GB 4F2MA 3VMNA 2R4RL 4TSCH 1JUFB 3PABB 3B83A 3C2AH 5ISZB 2B5IB 4OM1L 3DVIA 3FQNB 4J3WA 1MREH 5DSCA 4UQ3A 4CBPA 3FQRB 4LNRA 1YNLL 4LSTL 5EU6E 2Y9RT 2P7TB 3FONB 4UB0L 4LVNC 1MI5A 4XTRC 4DN3L 3GB7B 4ZAKD 5DWUL 5E9DD 3LHPL 4I9WE 2AJYH 4V2CB 2VKWA 5CZVL 3DBXB 4BFBD 3FCTB 3A6CL 3U4EB 4HUUB 1CGSL 4EI5C 1AD0A 5A2IH 4LVNB 5E2UH 5C0AD 1ZHLA 4XXCA 4WHTB 5GZND 1GIGH 3IAPA 2D7OA 3SGEI 1S7QA 1ZWIB 1NGXB 2VB5A 4P2RB 1FFNA 2ENYA 2YD4A 4EI5B 1NCTA 3PP4H 4KKNA 1MLCB 2XQBL 4YGAB 4D0DA 4X6CF 2FECL 4GXVL 3T09A 2C4XA 2ZG1A 4NPYA 4OGAD 1AXSB 1DQLL 3TT3L 5DGQA 3VGHA 3SDAC 5BOPA 1SJEB 5DK0B 3RWCB 2FJHA 2G2RA 4HIHB 2ARJB 2WBJC 3FKUS 4TRPL 4MVBC 15C8H 1RHHB 3BKCH 1KFAH 4J4PC 1XGRA 4OCXH 1G6RB 4LLDB 2MPAH 4PLKD 3D2UD 1MEXH 3KS0H 3SDAB 4U1LA 2H3NB 4WUUD 3CD4A 5EU5A 1XR9B 1XT5A 3FO1B 2WBJB 3G9AB 4IRJC 2GTWA 4YXHH 2NY2D 1RJLA 3T0EC 2VLJA 3GSNA 2HTKC 1FVDA 4Z7VA 3JV6A 1SY6A 2D03H 1DLFH 4BYHA 2EIBA 3BPLC 1SMOA 1SQ2N 2A6KA 2EDRA 1MIMH 1KCRL 2V7HB 4OV5A 3MLXH 1EMTL 4QHMA 1UWGH 1Q9WB 3QA3B 3ZTNL 1SBSH 1JPFA 4NM8L 5GGTL 3L6FB 4OI7A 4IRJB 3VXUE 3AMKA 2A6DB 5I9QB 3T0EB 3EIFA 5TPWL 2IPUK 4L3EA 2DTML 3BPLB 3AREA 5IF0B 3RIAK 4PLJC 1A9EA 2ZCLL 1EGJA 5DEZA 3MRLB 5LQBL 4UV7H 3NABL 1H3GA 2EO1A 3KPLB 5ESVB 4ELMA 3U4BH 3VG0H 3C5ZD 4X6EB 5D1ZC 4F7EB 4TUKH 4GMSL 4IIQA 4Y8AA 2WP3O 4NRZB 4ODUA 5FGBC 1CU4L 2F58H 3HRZA 4X4XB 1JWMA 4Y2DD 2XKNA 4R90H 2K1MA 4XGZA 4O2FB 3BO8A 5D1XC 5HI4C 5IJVA 4ORGB 3SJVB 1X5YA 4YXLH 5CFHA 3T04D 2LTQC 1IZKA 3GFUA 1CT8B 4CU6A 1Q94B 1EERB 5CILL 2ZUUA 4MNGB 4NZRL 3VXTA 3I84A 5A43C 3KPNA 4PUBH 1VERA 5D1ZB 4S0TD 1QO3A 2BHYA 3BGAA 2ZG2A 3LZFL 3SKOB 4DGVL 4QY8B 3LEYH 5D1XB 2FWOA 2Z8WC 3LDBC 5L0QC 2LTQB 5L88H 2FHCA 1I7TB 3WUWG 4FQ1H 4KFZC 1KJ2H 1FFQA 2AJUH 4GRLC 2LU3A 2GK0B 1AXTH 2GIYA 4X6FA 4LNVA 3ZT6A 3L7EA 4OIAA 1AD9A 3LKRB 5B4MD 3RFZC 1CWVA 4PRPB 2YD3A 3QXDA 1O0VA 1MIEL 5CZXD 3HZYB 4GRLB 1WT5A 4PJHB 4N90D 4R4ND 5T3ZL 3STLB 4N8CL 4ODXB 5HI3D 4KTYA 4MB3A 4OM1H 5CD3B 2R39A 3O3EB 2GJZB 2B39A 1NAMA 4XPHL 1F4XL 5H37H 3MRMA 2IEPA 4UINH 2HH0H 1JNLH 3ARVA 5DWUH 4PJ9D 1RAMA 1OAKL 1T2JA 1KCUL 5JNYA 5CZVH 3P4OA 1OAQH 3A6CH 4F7MB 3WJLA 3L9RA 4X5WB 3TN0D 5M94B 2AI0H 3DUSA 3FFCA 4BSWB 1QEWA 3P0YL 1CK0H 1KLGA 5JHDB 4WWID 2B2XL 4PRHD 5GGQH 2IH1B 3M17B 3U7YL 4JPIA 3QZWB 5IV2B 1CTNA 4PJIF 5E8NB 2XQBH 2J8HA 1F3DJ 5LVEA 4NZTH 1ED3B 2H41A 1RY7B 3BKYL 5F7UA 4GXVH 5BQ7A 1NLBL 1X6NA 3P2TA 3PWUA 1DQLH 1EO7A 1HKFA 2AJZB 3TT3H 3ZSSA 2X44D 3MX0A 3N9GH 3GIVB 4JJ5B 4XCNA 3VFVB 1AGFB 1R5WA 2BOBA 1SYSB 2BNQA 3T2OA 5BXFA 1OF2B 2HJKA 4J3OC 5GS0D 4P57A 1VGKB 4JHWL 1MCDA 1WWBX 1ZT7B 2WP3T 3SGKC 4N9GA 1QSFE 3H8NA 1KELL 4ZO6A 2XWJA 2NW3A 3DURB 2ESVD 2DQEL 1WTLA 1G9NL 4U1IA 4CVXB 2YD9A 1SJVA 4K9EH 1ZHNB 1GZPA 2Y5TB 4PB0L 4PJDA 4Y4FA 1AGCA 2Q7YA 4NM8H 3ARTA 2RFXB 1MVUA 1U8NA 2APFA 4XNQB 4NUGL 3FAWA 2DI8A 1QNZH 2F8VA 1T0MB 1N5YH 1IM9B 5BJTB 2DTMH 1I9JL 1BREA 5J3HD 1G7HB 2MMXA 3EZJB 4XBEH 2ZCLH 3K4ZA 3PDDA 4OT1L 4MA8H 4JREC 3NABH 1J0YA 3NCEB 4TVSa 1UACL 3QG7H 1HYRC 4XRCA 1OAXH 5TDNB 4WHYG 3U82B 5DSCB 4GMSH 4B41A 1HIML 1I7RA 4LNRB 1P84J 3KPRB 3L5WA 4L29A 5JQHC 4XI5D 1JHLL 1FNGA 1REIA 4JRXD 4HIXL 2FO1A 5FUOL 1INQA 2F8OA 4JREB 4FXGB 4XXCC 4C57C 2ZUWA 5CILH 1G6RL 4NZRH 1E6OL 3QEQD 5E03A 4KRMB 3OR6A 1D5MA 5F7KC 2EDJA 4OZIF 4PJCF 4ODWB 4KH2A 3QNYB 4HJ0D 2XV6B 1ZHLB 1FZJA 1TJIL 5E94A 1A7PL 3BN9C 4NO5B 5EC2A 1NBZA 4CMMB 4HLZG 1U8MA 1S7QB 3O3AA 3DX9B 5E9DA 1NEZA 4KKCD 4UT7H 1FFNB 3OJDA 1FHGA 4L3AA 4TTGA 4D0DB 1D5ZB 3HRPA 1MIEH 1Z9SA 1JZ4A 3ZE2F 1IKNC 3HI1A 4Y4HA 1EA9C 3FO0L 4OFYD 4N8CH 3RKDC 3JV4A 2G2RB 5DJAB 3IFNL 3SO3C 1VESA 4FS0A 5EO1B 2X89D 4OGYH 4MAUL 4UZGA 3EDJA 5MHSD 1PQZB 3X11A 4KKAD 2ZUXA 4MJID 1WCBA 1XGRB 3QO0A 4OFPA 1F4XH 3RY6A 2IC2A 4U1LB 5EU5B 5HYJD 3REWA 5BV7C 1JIBA 5D7LA 5EZOL 1KCUH 1UKSA 1VEOA 3SO3B 4M00A 2GTWB 1RJLB 3GSNB 1WZLA 4Z7VB 3EYSH 3JV6B 3VD3A 1KIPB 1OQXA 1UH4A 1H8SA 2DQDL 3AREC 4PRHE 1F90L 3VDAA 3MV8B 1BHGA 4QEGA 4MJ4A 2Z9TA 5BV7B 3L3GA 1JPFB 5JA8B 3LKOA 2B2XH 4WFFD 2W0FA 4V1DD 5CKGA 1D5BB 4D0BA 1CXEA 4WUUA 4IIQC 4L3EB 4JFED 3AREB 3GDBA 4FFYH 1A9EB 1W8NA 4CAGA 2PCPA 3B8SA 1NLBH 3QFJE 2HLFC 1IZJA 1VHPA 3ULVC 3HKFA 4JJHA 1JJUA 5FYKE 4IIQB 4ODUB 3HRZB 5GISH 1G0YR 1JWMB 1ADQH 4EUPG 2XKNB 1AGEA 2UYLA 4JHWH 3BO8B 5IJVB 5CP3A 4OKVB 3ARBB 2H8PA 1KELH 5J8OA 3VXTB 3NPZB 4X0KA 4RIRB 1N6UA 4ZG1A 4HEPG 1G9NH 5FYLE 1L7IL 2FWOB 1X6LA 2VE6A 4G6AC 3PQYD 4PB0H 3VXRE 4O4YL 4Y2DA 5TF0A 5I17A 1FAIL 3DUUA 1VKXB 3CCHA 3UDWA 1WT5C 4X6FB 1JPSL 3P77A 1NFIB 3L7EB 1BQHA 2AJ3A 5IFHL 1OT1A 1B88A 1I9JH 2YD1A 4POZD 4R8WL 1HQ4B 3P9MA 5EZLA 3MZGB 5HDQH 2CXKA 3W81A 4M6MH 1QSEE 3QWQB 1D9KD 2HFGH 3BZFA 3TBYA 3KLSA 1HIMH 2CMRL 1NAMB 2RBLA 2DQCL 1JHLH 4WY7H 4HIXH 3WJLC 3MRMB 3W0WD 1H0DA 2Y23A 2R15A 4FFZL 5I73C 5BCAA 4L1DA 1KLUB 3V8CA 1E6OH 4M02A 5JNYB 2A6IA 4AEHH 4P4RA 3V6ZB 5C0EA 1KUMA 3L9RB 3DUSB 1BIIB 5DVKA 4OLWH 5E8DL 4LOUD 4LIQE 5I73B 1J8HE 1TJIH 1QEWB 2A74A 2P8LB 5DYOA 2R0ZL 4MHHG 1RZGA 4OCNC 1A7PH 4ZODA 1J05A 5AWNL 4ETYA 4HFUH 1XZ0A 5DQJA 4XP6L 2A2QT 2QTEA 4KI5C 3DX6A 2Z35A 4X7EC 2BNRB 4FA8A 5BQ7B 2WWMD 2HYMA 4H8WH 3PWUB 3GGWA 1BWMA 3FO0H 4MA1C 2R2CA 3TN0A 4Z7UA 2W0KA 1R5WB 2BOBB 2BNQB 3IFNH 5BXFB 5A40E 1JI2A 2HJKB 1E4KA 1F4YH 5IGXL 3ARGA 3DSFL 4N9GB 5KZCB 3HI6L 4OF8A 4MA1B 3N1PC 4Y4FC 4NOFA 4OUOA 1RZ8A 3SPVA 4NRXA 1HILA 1R5IB 2EYSA 3EBAA 5DC4B 4U1IB 5DHVB 4ODTH 1A1MA 2FZ3B 4FQIH 1MCBA 4K07A 4LLVA 4LRIA 3O11A 1F90H 4V1DE 5FAAA 4PRID 4Y4FB 2IMNA 4H5SB 1MVUB 3H3BC 1U8NB 3RBGA 5JTWA 2JCCA 4PTUA 1DUYA 1N8ZB 2NX5B 2ESVA 2BY0A 3D5OF 3EFDL 2OM5A 1RIVH 3GMRA 1Z9OA 3L3IA 3TH4T 1AXIB 4UT9L 3QO1B 1B0WA 1OAZH 4IRZH 5IK3A 1LO3L 3GKZA 1CDCA 3J7HA 3WLWC 3RGHA 1IFHL 1Z2KA 3KPOA 4IBLT 3DOSA 3L5WB 1FNSH 1GGBL 3O6FC 1CFTA 1QQDA 4PJHF 3FB5B 4UDUA 1LDSA 1INQB 5I1DA 2EE3A 2BY1A 1OL0A 1V7NL 1HOCA 2V9TA 2J1KA 1LHZA 1T20A 2DJ4A 3OR6B 3TESA 2CIKB 5H35A 1D5MB 3O6FB 2DIAA 1L7IH 1R3LB 4OGXL 1FZJB 1SY6L 5E94B 4PPTA 1RZKH 4Y4HC 5EC2B 2GUOA 1NBZB 4JRXA 3SE8H 5HGAB 5HVGB 3PWPD 1FL3B 3O3AB 4JFDE 1JPSH 5D2NA 3BEVB 4O2CA 1IT9L 3B3IA 3OJDB 5IFHH 2X4PA 5GGVY 3S7GA 2ZCHL 2BHUA 4GAJH 5GPRA 3HI1B 3RY6C 4ALAL 4Y4HB 4NQSA 1GJIA 3S37H 3V7AE 4I0CC 3FQXB 4U49A 4KK8C 3JV4B 1A7RL 3THMH 5HPMA 1NC2A 3W0WE 3GBNL 1FV1A 1RZIA 5EC1A 5IROA 4RGOH 1WCBB 3QO0B 1Q9LA 5DUPL 1UM6L 5C2BH 3WCYA 3OKOA 4FFZH 1AJ7L 4UQ2A 3REWB 5D7LB 1JE6A 1MRCH 4OLXL 1QHOA 5E2VH 5TE4L 5F7WC 4OFYA 5DRWA 5K59F 1BPVA 1YEIH 4QO1A 1XF3B 5F72S 4LP4A 5E8DH 5DJYA 3MJ8B 3SCMD 1J11A 1J9CT 2EDEA 3L3GB 3NCMA 4MJIA 3LKOB 4LLQB 4U6XA 4P3WA 2W0FB 5AWNH 2CRYA 3LQMA 5T1DL 5K9QI 4D0BB 4YPGA 5HYJA 4XP6H 1PYWA 4G6ML 5ICXA 4JO4L 4OUUA 3O2VL 2W60A 43C9B 3V7AG 5IQ9A 5ALCH 4EN3D 3CFJB 5ANMB 4NNPL 4HCRA 3WFBL 1TENA 4Z7NE 5L9DL 1JMZA 4YHNA 1LEIA 3CU1A 1UZ8A 2NY3B 3I6LE 1AGEB 2UYLB 3OAYK 5IGXH 2CO7B 5IP4A 1FZKA 1MRFL 4MS8C 1K85A 2VLRD 4E0RB 3HI6H 3EOBA 4JFEA 4Y2DC 3ZDZE 1A6UH 5EOTA 3UDWC 3MO1B 3QDMD 4G80B 2IPKB 1QZ1A 1DP0A 2H2SC 3T3MF 3F6LA 2F19H 3RVTD 1VGEL 4DFHA 4GG6B 3BH9A 5JUEL 3CCHB 4WUKH 2Q87A 5C86A 3P77B 2FH6A 2G9HB 1Z5LB 3RY5A 1BQHB 1YMME 2AJ3B 4JRYA 5B22A 4C56D 4NQCB 3H9ZA 4I2XA 5GGRA 2VZVA 3EFDH 5IUSA 2X70A 1R3IH 4XHQA 4AK1A 5IHUH 2VERN 2PXYD 2A38A 4UT9H 3WE6A 5I0DA 1PDKA 2APTA 3IB4A 1MCWM 3F7PC 1LO3H 3DARA 3S6CA 1T7ZA 1P84K 5B3JF 5GRZA 1IFHH 2IBGA 1EFXD 35C8L 1GGBH 2NZ9C 4I3GA 2H9GA 1N64H 4MD0A 5DVLA 2BVPB 3O2DA 2X1WL 1WICA 4U6TA 1V7NH 3WFDL 1MJ7L 1BFSA 2A6IB 1MAML 2MJWA 4Z5RA 3RI5K 4AENA 3KXFE 3UTSD 4D9QE 4B0MM 4BUHA 1EJ6A 5DYOB 2D3VA 4P2YA 3TT1L 4Z7VF 1AY1L 1S9XA 1J05B 5TE6L 3BVNA 5E5MA 1F6FB 1G7MB 4IOSD 3F12A 5DJXA 1UKQA 1M7DA 1IT9H 5LAXA 5EO9B 3VWKD 4RGNC 3DX6B 2ZCHH 1DEDA 2Z35B 4P46A 3TO4A 3OG6B 4RFOL 3ARGC 5BS0B 1UB5A 5FA4A 2APXA 5DMKA 3LKSA 3UZEA 1MCEA 1QP1A 1UH3A 3GGWB 4ALAH 3T8XA 5GS1A 3BKMH 1D3CA 3V6OA 5EPMA 4Z7UB 1A2YA 1A7RH 2JIXD 2VQTA 1MFNA 4RGNB 3GBNH 1B3JA 2ADJB 4LRNL 3ARGB 4KK6D 4LRIC 1EEUA 4ELMF 1C08A 1U8QA 1U92B 1IC5H 3L1OL 4JFZL 4K94C 3T4AA 5BOZG 1RZ8B 3SPVB 2EDXA 1K4CA 1ZVHA 4NRXB 2BY2A 2XXCB 5TE4H 1A1MB 3DWTA 1LO2L 4LLVB 3O11B 3ULVF 3NCBB 5IVXA 4PJ5B 2H1PL 3PWVA 1L0YA 5CEZL 1CDBA 4P49A 4L8CA 4PTUB 1DUYB 2EDOA 4BKLA 3X3GH 5D7IA 4WU7B 1J1OL 4Y1AA 3GMRB 4NO2B 1GGUA 3L3IB 2XA8L 4RMSA 2DLEA 1CE1H 1G9MC 5F7NC 2CQVA 5E8EB 3KPTA 4K8RC 3C8KA 2ZNXA 5AEAA 5L9DH 4YH6A 3KPOB 4XVJL 1JYWA 1CFTB 1ZOXA 3LS5L 1EX0A 1MRFH 4PJXA 4UDUB 2JF1A 3CH8A 4G7VL 1S7SA 2AAVA 3E3QC 1EO5A 4ZDHB 1HOCB 4X6DA 2UY6A 1CVRA 1T20B 4QKXB 5D2NC 5D93C 4AZ8A 2IPUG 1GCFA 2VR9A 3IDIB 1J1XL 4ZQKA 1VGEH 5DA4A 3MNVB 4JY6A 1SVCP 5IVOA 4X7SL 4YE4L 5EOCL 2OL3L 1JK8A 1MFBL 1MCRA 3TCXA 3TBWA 5D2NB 1FORL 3B3IB 4ZFZA 3F58L 3QXAA 2B1HH 5H37G 3WXVL 3MSPA 3BXNA 3WXWL 3P73A 3L7FA 2WM0A 1TNMA 1P4BL 1LO4H 4XT1C 1LK3H 1CLZL 4KKCC 1VDGA 1JNHB 2AEQL 5GRVL 2BVTA 5IQ7L 3ZZ1A 3OMZA 2FR4A 2DKUA 3V2AR 3H9HA 2ITDA 3HE6C 1NC2B 1FV1B 3GRWA 3PWPA 4BSJA 3QIBC 4OZFG 5EC1B 4Z8FL 2G75A 35C8H 1S7VA 1BZ7B 1Q9LB 2X4TA 3RUGE 4JN2A 3OKOB 1RJCA 4UQ2B 1DE4A 1HSBA 2YSSA 3QP3A 4KI5F 3WHXA 4HS3B 3WFDH 1MJ7H 3GUTA 3HE6B 1MAMH 3IYLW 4GXUN 4NQUA 2COQA 3QIBB 4LPVA 1T1WB 5DRWB 4HD9A 1OSZA 1WV7T 3RP1A 3D0VA 3Q6GL 3GM0A 5BRZE 3UTZB 1KENH 4ZUVA 1MHEA 3EDKA 4HT1H 4KQ4H 3T08A 3TT1H 1XGQA 4O9HH 4U6XB 1ZTXL 3EO9L 4GG8A 5F44A 1GC1C 1YYML 1IGCH 4UNUA 1FH5L 2A1WL 3MREB 5H94A 4YPGB 3I6GA 3QDJA 2VDLL 3BMWA 4PJDF 5ICXB 4FP8L 4OUUB 3OWEA 1DSFL 4RFOH 4FQLL 2ICCA 2W60B 1G7JA 5IQ9B 2DDQH 2J8UE 5J9PA 1VENA 1Q0XL 2OCFD 2W9DH 3UYRL 3SCMA 4YHNB 1LEIB 5E1HB 3ZE1F 1M6OA 4AEFA 3SGJA 1YEJL 1UZ8B 3HZVA 4LRNH 1MY7A 1FZKB 3WFZA 2VAAB 5IBUG 4RMUA 3WSQH 1I1YA 5L6YH 2PKDA 1OM3L 2V7NA 1OD9A 1H3VA 4JFZH 3HAEG 3W9DA 4XVUC 2B4CC 4NRYA 2A9NL 2HFTA 4GO6B 5F9JB 5IMLA 3OHXA 3JTSA 4PLOB 1FYTD 4KMTL 3JWOL 2GKIA 5I2IA 5GS3A 3D39E 3UPRA 3E6HA 5FA3B 4LPTA 3BH9B 5CEYA 2EE9A 3TWCL 1DLHA 3CDYA 4LSUL 1MLBA 1IQWL 3VXSD 2JJTA 4JRYB 4RX4A 2FBJL 2J4WH 1D6EA 3T3PE 4XNMA 1FPTH 5GGRB 2X70B 4M1CC 1J1OH 3ULUL 4OZ4B 1IEAA 5CAYB 2X4OB 2XA8H 3ARQA 1U8JB 3OAZH 4KZDH 1V3JA 4X9HA 4U1SA 5E4IA 5DK2B 4RFNC 4WI2A 1UFUA 2R8SL 2P5WE 3T0AA 4EQ3A 1JHTA 4XVJH 1RZFL 1ZHKA 4S1QL 3LS5H 4NKDA 1NBVL 2H9GB 3GSWA 3O3UN 5DZOA 3QQ3A 3AFLA 2V5YA 4G7VH 4DJMA 2PYEB 4PJAE 4MD0B 3TBVB 3QRGL 4RFNB 4XNXH 4PJEE 2MHAB 3QWRA 4F7PA 1RFDL 3W2DH 5C0BA 3LS4L 2HG5A 3PGCA 4Q0XL 3TYGH 3E0GA 4KRPD 1FIGL 4Y4KA 4P46C 3TO4C 2XPGA 1T04A 3FRUA 1EFXA 1MQ8A 1S9XB 1QBLL 1HH6B 2OJEB 2OL3H 5EOCH 1LEKA 4IMKA 3V6OC 3MV9E 5E00A 5E5MB 5JXEA 1FORH 1U91A 3EFFB 1L7TL 5LAXB 3MMEA 2YUZA 3F58H 5I66A 4OQTA 4MWFA 3WXVH 4C83A 4P46B 3TO4B 1QPPA 1JBJA 4QHNA 3SE3C 5DMKB 1CLZH 3BHBB 4Q9BA 2Y25A 1PX3A 2AEQH 3UTSA 5IQ7H 1A3RH 2CK0H 1PKQE 3P0VH 5HHNA 4L8SA 6CGTA 1ZVSB 4QXGL 4PGJA 5L7XH 5K9JH 4G6KH 4Z8FH 3O3BA 4PY8J 5EZJA 1RUPL 4ZNCD 1FC2D 2G5RA 4ORZC 2NNAA 3T4AB 3VXMD 1K4CB 4KTEL 2ZOKA 4JY5L 4PRBA 2IAND 4K8RL 4EBQH 4LSQL 5JDJA 5IFAL 2JIXA 3LN4A 4QF1A 3Q6GH 4A2LA 5KSBE 2C1PA 2E6JA 4NT6A 5IVXB 5DTFA 4GRWE 3RHWF 3G6AA 4CNIA 3NGBC 5SWZE 1YYMH 1NC4A 3QPXL 4L8CB 4GG6F 2VDLH 4X5LA 3DVNB 5CP7A 4FP8H 2PO6A 5D7IB 4EZMA 4I18A 4Y1AB 1YJDC 5EU6A 3TJEL 3OL2A 4FQLH 3NGBB 1ETZA 3BGMA 3BP5B 2VUYA 5CZKA 4R6UA 3V4PL 4RDQG 3MYJA 1CDGA 5F89A 2DF3A 5GRJL 1JGDA 2E9JA 1NEUA 4XWGL 1NDGA 4O02L 1RMFH 2O5ZH 3QCTL 5B39G 3I02A 4HWEH 3ARSA 3SOBL 3C5SA 4PJXB 1S7SB 4YBLC 4MJ6A 2ED8A 2HVJB 4DVBA 3HC4L 4X6DB 4BH7A 2N7BA 3LB6C 2A9NH 1CL7H 3VD7A 5LGHL 2Z0BA 2HLAB 5GRXG 5EUKA 3JWOH 3FRPG 2Y36L 4YQXH 8CGTA 5LCVH 3SN6N 1X5XA 3G6JA 2ICWB 3U7AA 2UWEE 2WANA 1R24B 2D0FA 2P46B 2M2DA 4P5TC 4YBLB 4JY6B 4DGIH 2I5YL 4U1MA 3VDBA 4LSUH 3TBWB 2O26U 2FBJH 3GJFK 4ZFZB 3QB7C 4N8VG 2LABA 5E70A 1BLNA 5HGHA 3P73B 3L7FB 4M1DL 4H88L 3I50L 4RBPH 1OP3H 4P5TB 1INDH 3ULUH 2VLLA 4HK3J 4LCWD 4GQPH 4BZ1L 5J1SC 2CR3A 2QQNH 2YPLD 3FQWB 1QRNE 2EIDA 2NXYC 3ZYJA 2FR4B 4AMKL 3DYPA 1TTGA 3GMNA 2R8SH 3H9HB 2ITDB 1GH7A 2R23A 1GC1L 4KZEH 4HCRL 3BD4A 4LP5A 2G75B 1G7LA 1S7VB 4Z7UF 1NBVH 4ZXBA 4HJGB 3LRSA 2JJVA 3BPCA 2QQQA 4JN2B 2FX7H 2G5BB 1HSBB 2PNDA 3G08A 2NXYB 3RVWD 1U93A 3LOWA 3GUTB 1HHIA 4FQXA 3VXUA 2PUQT 1RFDH 4WFGD 4RMVA 4S2SA 1OSZB 25C8L 1YPZE 5DS8B 4Z77A 4NNXA 5MENE 1S5IH 3JV5A 4ZUVB 2I9TA 1MHEB 1BVZA 1XGQB 1JGEB 1QBLH 1JGVL 2Q8BL 2R1YA 5IW6B 1CXFA 4XBGA 1A3QA 5H94B 5F7LB 3I6GB 3QDJB 5DI8A 1CE6A 1QG3A 5L8LB 3D9AH 3QPQC 3K81A 1L7TH 1D6VL 3SGJC 3EZ8A 1NGQH 3VI4E 4F58L 2QQLL 3RVVD 1G7JB 2JCCF 3MCG1 4QOKE 2VDRL 2D4FA 1JZ8A 3V52H 4MXVF 3U6RB 4O5LH 3OTTA 2WUCL 4I1NB 1M6OB 4QXGH 1MH5A 2V5RA 1FCCA 3HZVB 1L9MA 3MPCA 4P9ML 2XN9E 3VXME 2PYFA 3D18A 1NKRA 1YY9C 2XWTB 3O3DA 1RUPH 4HSQA 3EYFA 4PGDB 1A4KB 1L0XA 5LGKA 4NRYB 4K23L 4KTEH 2JJTC 5IMLB 3U79A 3OHXB 3JTSB 4CVZA 2WBKA 1FGVH 5C71A 5I2IB 3WIIL 4FOMA 4MJ5A 2C9AA 3AAZA 2HMID 3E6HB 4LSQH 5GHWL 1FC1A 1OB1A 5J06A 4Q2ZA 3O45A 2NY4C