2J88H

Hyaluronidase in complex with a monoclonal igg fab fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
184
structure length
162
Chain Sequence
VTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCTLYYGSVDYWGQGTSVTVSSAKTTPPSVYGCLVKGYFPEPVTVTWNSGHTFPAVLQSDLYTLSSSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HYALURONONGLUCOSAMINIDASE
publication title Identification of a B-Cell Epitope of Hyaluronidase, a Major Bee Venom Allergen, from its Crystal Structure in Complex with a Specific Fab.
pubmed doi rcsb
source organism Apis mellifera
total genus 25
structure length 162
sequence length 184
ec nomenclature
pdb deposition date 2006-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j88H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j88H02
3T2NL 1R3IL 1U93B 3G5XB 2DQUH 2YS4A 1G7HA 5AZ2H 4WUUD 1G6RA 4QRTA 32C2A 2KZWA 4EEEA 3K0WA 4TQEH 5EU3B 3I6KB 4YHIA 1QR1B 1FHGA 4NQEE 1BVKA 4WHYG 2UZXB 5LQBL 4EN3D 3EOAA 4JFYA 4G6AD 3HI1B 3MLZH 3QUXA 3VXMB 1FPTH 1UWGH 5I16A 2YUVA 1JGEB 5D72L 1OSZB 4QRPB 3T0BA 3G6JB 1JHTA 1CG9B 2NY5L 3IT8D 1OAUL 3B9VA 3HFMH 4X7SL 3T3PE 4BUGA 4BFEA 5EBGA 1YN6B 1CE6A 4NC2B 3X17A 3G08B 4OLWL 4PRDB 4K3HA 4Z78A 4NQTA 5IVZA 4YFLF 1UH3A 2I25N 1QVOB 3OKDA 1FNEB 5DVNA 1MVUA 4XTRC 3V6ZB 3VFNA 4L8BA 3WUWA 2IMNA 2R1YA 4JFDD 3MRGB 1G7JA 1I7TA 1YECH 3FCTB 4RMRA 5EZLA 5F9JA 1AFVL 2C1PA 2VQ1A 4JKKA 2XIDA 4EI5A 2BVQB 1X9QA 2DWEB 1F4AA 2V7NB 5BRZD 2WP3O 4Q9QH 2F53A 3W39B 3ARVA 1LHZA 1NAML 4MB3A 4ODVL 5KSAA 1OARL 1OAYL 2FX8H 1LEKA 4LCUA 3DROB 5F93C 3OAZK 2E6PA 3QWRA 3UTZB 3HA0A 4P2QE 1A3RL 3OKEB 3TBTA 5CJBA 1LVEA 4I18C 1HH9B 1QUNA 4PJDB 1XF4A 1EXUA 1XFPA 1T66C 3T0VA 1P4IH 3V6BR 5JOFB 1T20B 1JRHH 4HUUA 3I3DA 1EEUA 1T5XB 4HT1H 5C0BD 3HZKA 4ZXBD 5K9OB 5JDSB 3HPLA 3PWPD 1HCVA 3RZWA 2OMNA 4LP4A 4PUBL 3KXFE 5GSVB 3R1GL 2VLRA 2XI9A 1A6TA 3B5GA 2BNQD 2XRAL 3MBXH 4WW2A 3T77A 4JDTH 5JMOC 2VIRB 2FB4H 1YEJL 4IHOB 4K23L 4N9OB 4HWEL 3QEHA 3QIBC 5E7BA 2CIKB 3VG0L 3VFVA 1KYOJ 4WI9A 5H2BB 2I5YH 1HHKB 2AJSL 2HLFC 3CFBA 2AI0H 4Q6IC 3FN9A 3CFKA 1QO3A 1TVDA 4XP5H 4P5MA 4W4NA 1U91B 5I19L 3NMEA 5DMGC 3QBTB 3BKCH 3MGAA 4A2LA 4DCQA 4X98B 1HYSD 3QDMD 4LGPB 2YZ1A 1ZTXH 1C1EH 2ADJA 4P23B 2AXGB 4U7SA 5I6XC 4KUZL 2YD3A 2DLHA 2Q1EA 1MCPL 2B2XH 3MUZ1 3VH8A 4RZCB 3T2QA 5C0CA 4KQ4L 1TZHB 3CK0H 4GG6B 4MA1B 4K9EL 4OCRL 2XWTA 5E08L 1QNZL 43CAA 1FVCA 5IBTH 1YDPA 4P3CL 1OAKH 4L9LA 2IFFH 3H2WA 4FQQB 4KAQL 4YZFE 5DZOA 5DD3H 3S97C 3FMGL 4YHKL 5F8QC 1MRFH 4G8GB 4XP6H 3WNMA 5DO2D 5DFTA 2D7NA 2AAVA 2FGZA 2BNRA 4I9WD 2OM5A 3HRZA 1NQBA 1VFBB 4DKEH 3MJ8A 1PQZB 3MACH 5FM4A 3H7BA 1YEIH 4KGJA 3NTCH 5H35B 1NC4B 3QXVA 1CDUA 4ELMF 2WIIB 1U8PB 3GI8L 1QSEB 2A0LC 2BOCA 5MHSD 4G8EB 2P5WD 4KKAD 4OAWB 3RWGA 4HKXA 3MR9B 2ZOKB 3M45A 4AJ0A 3VFSA 3IJSB 4G9FB 3BN9D 1RUKL 3I85A 5IVOA 3EJZD 3WIHL 4DJMA 1LNUB 4NQDE 2CLZA 5E2VH 1ORSB 3UTQB 4N8PA 2A9NL 2ICEA 4LKCB 5F9DC 5KBNC 3D69A 4LEOA 1HE7A 2D7TH 1NCTA 3AY4C 2W65B 2KKQA 1P2CB 4X5XB 4OKVB 1KLUA 3UROR 1J0YA 1R3KB 5EZJB 5E1AA 1F90L 5T1KB 3P9MA 2OI9B 3ELAT 3I75A 3WHE0 2GJ6B 1FFNB 5DHYA 1EFXA 5GGVL 5M94B 4PJEA 3OZ9H 5ISZD 3FQRB 4Y5VB 3MCKB 1W0WA 5L6YL 4RGOL 2AK1H 1JPGB 5LKNA 1CFTB 5L2KB 3O2WL 3V5KA 1LO0L 4OGAC 1DBKL 4JFED 1A4KB 5I66B 1FGNH 2DMBA 3BKJL 4Q0XH 2JELH 1GZPA 2Z31B 1UJ3B 5A3IC 1YEEL 3QG7L 5LGHH 4YLQT 4YR6B 1G0DA 2CK0H 3MV7A 4NZRL 1YPZE 3NFSH 3BVNB 4JDVA 3SE3C 3FJTA 1IQWH 3EYSL 2VL5B 1FL3A 4RMTA 4HC1A 2PW2B 5CBAB 2OL3A 4Z7OE 4HUVA 3E8UH 1I85C 3EFDL 4ZUWA 3C6LC 4Y5XA 1KJ3L 4WGWB 2FR4A 5SX5H 4U1SB 4Y1AD 4NKOB 5E2TL 3T8XA 3TNMA 4JGUA 3OGCA 1QR4A 3CUPA 1FFRA 1YYLL 3G5ZB 3QQNA 1KTKE 1LE5B 1OTTD 4CADB 3HLAB 3VXOB 3GM0A 3VD5A 2OL3L 2DQCL 1I7ZA 4TTGA 5DLML 3D5OF 3OAUH 3V0VA 4MMXC 4CN6A 1QD0A 2PYEA 3VFRA 2B1AL 1CD0A 4NNYA 5B4MC 1T5WB 1P9MA 1MAKA 4JB9L 3WMSA 1EO8H 2DKMA 2QQKH 5L2JB 4DFIA 3DXAA 4LRIA 1GOFA 1L4IA 3L1OL 4WO4C 1CD1A 4OZIA 2W9EH 4XAKE 4GXUM 1MPAH 2CIIB 4M6OL 2J8UA 1IGJA 4HEPG 5DJAB 1JP5A 2CR3A 3KPPB 4M62L 3QPQD 4P9HH 2GFBA 4ONFL 1CCZA 1HXMA 3BAEL 5HTSA 4OI7A 1UCBL 4WI2A 1XF2B 4QOKA 5D2NC 1AXSA 2GTZB 3FO9A 4WV1B 1MQ8A 3RWHB 4DN4H 5EIIB 3H9SA 4LGRB 2AJXH 4M6NL 4LVHC 1FL5B 4H26A 4C55A 3O6FD 4NRXB 4AEFA 5DJZA 1N2RB 3SDAB 1LK3L 1XCTB 3W0WB 1TVBB 4OGZA 3CFCH 5D70L 12E8L 3MXVL 3RNQA 5E99L 1LO3L 3N85L 4GKSB 1ADQA 1UM5H 4LNRA 3MUY1 2VO5A 1I7UA 1R0AL 1QG3A 1Q0XH 3FB6A 3PWNA 1G9NH 1TDQA 3KYNA 4IIQC 4FXKA 3CSGA 1GIGL 1Z5LB 3AXLB 4YXKH 1RSFA 3QDGE 4G7YL 4B5EA 4WU7A 2LE9A 1D6VH 3WFCH 4F7CB 4P2RA 2DJUA 5HVGB 3HC0B 3ZDYE 4LOUD 3S5LA 1QOKA 1BJ8A 3OB8A 1UT9A 1IGFH 3P40A 2W0PA 1EAJA 2W9DH 2YPVH 4ODUB 5EZIL 4M43H 1BJ1J 3L9RB 1TFHA 3KPQA 3NIGF 3OJ2C 4Z7UB 2P49B 1T04A 1S5HB 1YC8A 1D6EA 2VDKL 3VE0B 3GJFH 4U0RC 3UBXI 1ZHNA 4LU5H 3GGWB 4KXZH 1S9WA 3VA2C 1DVFB 3U6RB 2D7QA 3ARFD 1F6AB 4PG9B 5C07B 2E5EA 5I8EB 4NRZB 1T0NB 2AV7B 1U8LA 5KTEH 2OQJA 5HHVH 4WI4A 2WBJA 4OZFG 3BIKB 4NQCB 4ELMB 3S36L 5MEOA 3AC0A 4XWGH 1F4XL 2VDPH 1Y0LA 4ODTL 4M7LT 2XTJE 5DVOA 3NPZB 5L9DH 3G5VA 2YUWA 25C8L 4OM0L 5E8EB 3PWPB 4M5YL 4F9PC 4JPKL 2XFXA 5TPWH 3HR6A 5DK0A 4HS3B 4R26H 3OGOE 5JR1L 4XB8A 4YBQD 3UTSB 2X4TA 1F4YH 3VI4E 3KDMA 2ADGB 1ZKAA 3WO4C 5MEQA 1T2XA 3DO3A 2CLVB 1AD9B 1OAQH 1EJOH 5HGDB 3ES6A 1AXIB 1NCBH 3M1BB 1JPST 3RDTB 4G42B 2VUYA 1JYVA 2FECI 2EDYA 1FG2B 2YMXL 3UZQA 2AJVH 3HUJA 3MRJA 1M6OA 3D3VD 4OUOA 4MWFB 3C5ZD 5GGUB 4AEIL 3MRKA 1MLCA 3MNZB 4TRPH 3OG6B 1J8HD 5IK3B 2HFGH 1FFOA 1WCBB 4FQ1L 3QYCA 4D0BB 4EN3A 1KNOA 5C86A 3QPXH 2ENYA 2C3GA 1R3JB 5GRWA 3SN6N 4NKIH 1PSKL 3DI3B 3SO3C 2EDBA 5MENB 2ADIB 4XXCC 3HE7C 3EOBA 4NIKB 3DVNB 3PWJB 3WXWH 4OB5L 1H15B 4H1LH 2V9TA 1HZHH 1FJ1A 1ZT7B 3ROOB 1WTLA 4QRUA 4NKMB 2E9IA 1RK0A 4S0TD 5AG8A 5F1IB 4XI5D 4QHKJ 2WIMA 5TJWK 1G7QB 4KROD 3HZVA 4LLDA 3BEVA 1MWAB 3T08A 4JFDA 1UXSB 5J9PB 3O6LH 3NA9L 2W38A 3MV01 4FFWC 4X99A 5HHNB 4NP4L 4HMEA 5D93C 1EMTH 3QO0B 3BMVA 5BJTB 2AS5M 3S34H 3ULSA 5FYJH 4RIRA 2EDDA 3BPOB 5C1MB 2P5WB 1ZA3A 4NM8L 1SM3L 5BRZA 1V8HA 5IUSA 5I1IH 2KL6A 4HKBB 4RBPH 5CEZL 4PJDE 3TZVC 2MNUA 1P4LB 4GS7B 5JPMA 1AI1L 3EYOB 5IQ9A 4QRQB 2OS7A 4JRYB 4XNZB 5EFIB 3FB5A 3SDDB 1N6VA 4XGZB 2FJFB 2P4AB 2E9JA 5E7FA 4OZHE 4LKXA 1DFBH 4Y16C 2JF1A 3FAXA 5FO7A 4C56D 4CVZA 3FT2A 4YHNA 3AREC 1UGNA 4LMQI 5GS0D 3RGVC 4TPRL 3WFBL 5C0BA 5DJ8B 4ZXBA 2VXTL 3HAEG 4F7EB 4HS8L 4KVNH 3ZKXB 4JRWA 4K94L 4BZ2H 5TGBB 2WUBH 4LLAA 5I9QB 4XC3H 3SBWA 3VD9A 1TLKA 3CSBA 3VFTA 1E4WH 2WUCH 5D71H 3QDAA 3BRDA 6FABL 1L7IH 1IM9B 2BNQA 1RIVH 2F8VA 3DUUA 1B0RB 5E2WL 1N5AB 2UZYB 1E4KA 2G2RA 1ZHKB 5TQ0H 3M8OL 3T2NH 1C5DB 1EEYB 1R3IH 4DVRH 1CDGA 1QA9A 2H8PA 5DC4B 1FNSL 1CL7I 1ZVHA 1TCMA 1NEUA 3MRLB 2C7UA 4XZUB 3A6CL 3C6SB 1DBJL 2IH3B 1XH3A 1KFAH 4GG6E 4E42A 1JWUA 1S9VA 4U6HB 4QTHA 5DQ9A 3QDMA 1HHHA 2HT3D 3NACL 5BZWB 2H2SC 2HRLA 1RJYB 4Z8FL 5IJVA 3FZUC 3VMOA 5AAWA 5GGSY 1A6AB 1MRCH 4KUCF 2K1MA 5C0JB 5EN2A 3FO1B 1V3JA 1XIWC 1U8HA 2Z8RA 2BNUB 3GIZL 3ZKNC 4GSDL 1Q9KA 2QBWA 1MFCL 1QSEE 5I1KH 1UA6L 1WICA 5AYQA 5HGBB 1PD6A 4U05A 1INEH 1ZLWH 5C6WH 1PKOA 2X4RA 5BS0A 4TSCL 4AT6B 4JJ5A 2Y72A 3RTQD 1DZBA 3BN3B 5ACLA 4G9FE 4MZ2A 3DRTB 4KXZI 5BMFH 5FYLE 3HR5A 1CDYA 3WNLA 3W82A 3REVB 1CLZL 5CIPB 2OZ4A 1H0DA 5IHUH 2BX5A 4FNLL 2GITA 4H20H 3ZDZE 4LSPH 1OAYH 3SKNA 4PY7B 3OKKA 4P59H 5AEAA 3FQNB 3MNVA 3QRFM 1MWAL 5TF1H 5IOPB 5JDJA 4KRMB 4NC0B 2VH5H 5SWQA 3TN0B 1PEZA 5JIHA 1FSKC 1D5BA 1QZ1A 4Z7VF 2X1PA 2BY1A 4WIQA 4XVUD 4PRAB 4S10A 2OZ4L 4KK8D 3V6OC 3IAGC 4JRXD 2GJ6E 4F7PA 1EHAA 3WLWD 2AEIT 2DBLL 5BZDB 4JVPA 3N9GL 2BVPA 3MJ9L 1O7VA 1A14H 4DFHA 1JF6A 4L3CB 3LQAH 5DURB 5L2KE 1CE1H 2RAMA 1HILB 1I9JL 3P4LA 2EIEA 2HFTA 2ZOLB 3X3GH 1LP9E 5ISZA 4TSAL 3LQMA 1X5GA 1BAFL 1MJJB 1EVTC 4PGCB 4DGIL 5IFAL 1KEGL 1S7RA 1CDHA 3DSFL 2HKFL 4GRLA 3DX9A 1YJDC 3VG0H 5I30L 5SWZB 2AJSH 4PJHF 3PV7A 1UZ6F 5F9AC 5ACZB 3MMEB 5FUZH 1DBML 2F5BH 4JFEA 4PRHB 5EC2A 5B39B 1SMAA 1Q0YL 3EO1B 4Z77A 1A1MA 1MRDL 3BP4B 3WJLA 5C0FA 2CDFA 1J1XH 5DRXA 1G1YA 1NC2B 3O9WA 3L95A 1DL7L 1G9ML 3GRWA 2WWMD 3JV0A 2YPLE 3IKCB 4IEFB 3CH1A 5E08H 5C2BH 2X4PA 3GMMA 2VLLB 3PL6D 5DRZB 4PRBA 3DETD 2CDGB 4P3CH 4OJFH 1IAOB 3MX0A 4NM4L 4PGBB 1A9EB 3TVMD 4QWWC 1C12B 5D2LB 1BMGA 1CYGA 2NY0C 1MJ7H 3STZB 2V2WB 5E6ID 4DKFL 1C5BH 2UWEB 3FQUA 4GG8B 5IBUG 1EAPA 3Q5OA 3VDBA 3C8KA 4WWKB 4DN3L 3SE8H 1YN7A 4YHLH 1IGTA 5C7XL 4NT6A 3AAZB 3B2VH 3ECBB 1M1SA 3JUYA 4HGMA 2YA0A 4LLWB 1NFKA 3SGKC 4BZYA 1X5JA 4NWTL 1OGTB 2OR8A 1IM3A 1T89C 4AG4H 1ZGLM 5CZVL 5CD5D 3QQ9C 1RUKH 4WU5B 2ZCLH 1JTTA 3IETA 4X5LA 2APBA 1HQRA 4P5KB 4JFOB 1KTDA 4HUXB 4TTDC 5DR5L 1A3QA 5AAMA 4NO2B 3SEPA 3FB7B 2A9NH 4IRZL 3W0WE 1CXKA 1SJEB 1F3DH 1CR9L 3QWQB 5JPNA 2EKSB 4R2GC 3G6AB 1FGVH 3SCMB 1KJMB 3L3GA 2LTQC 1MSPA 2EC8A 4OFKA 3O6FA 1F90H 4Z7WF 5ERWA 5IEHA 1DSFL 2H9GB 2P44B 4EVNA 3O6MH 3DGGB 2CRYA 5J13C 3IU4H 2ICWJ 5EOQH 3IVKB 1OSPH 1HIMH 4LF3A 3U79A 1KJ2A 5MERB 1WCQA 5CEZE 3MGTB 1AKJD 1FVEA 3RUGA 3IDIB 2XKNB 3QUYC 3BZFB 1QRND 4IRSD 2GAZB 1JI1A 5D1QC 2GJZB 2WWKT 1JGDA 2QSVA 4J2XA 2IG2L 5TDOB 3IFNH 1TPXB 2A83B 3W9EB 3OV6A 2F54B 1HQ4A 2J5LC 4Z7UE 1TTUA 4IJ3C 1R5VA 2H6PA 2YEZA 4S1DC 4XP9H 3P0YH 3LH2L 3UPAA 3V95A 3VWJC 2HT2D 1ZXQA 4N0UB 3V6FA 3WN5C 3VXQB 3VGBA 2EECA 2HTKD 2NW3B 4L3AA 4LLMB 3FOLA 5C07E 2FD6H 4OBSA 1KXQE 2H3NA 4LLYB 3QFDB 4PJ8D 2Q7NA 3QQ3A 4IMKC 4J23A 1G9NC 4ZUVA 5F21B 5B8CA 1WITA 1U9KA 4HC1H 2ZUVA 4NQCE 4ELME 1SHMA 3QXAA 4NPYB 1F45A 2OL3H 1BECA 5C6TL 1NCWH 3ARFA 3QH3A 2PO6B 4LIQE 3CLFL 3O8XA 3BZEA 4AQOA 4XCFL 5ESVB 5AD0A 5DS8A 3PUCA 4N8VG 4UAOC 2J6EA 3LV3B 2DQHL 4YAQB 3UTSE 3MRBA 1BEYL 3L1OH 1WSST 1MY5A 3CXHK 3W2DL 4MB5A 1UVQA 5DJCA 2YD9A 5EU6B 4PGDB 5F6IC 1YY8A 4Y2DD 4WRLA 1AIFA 1HOCA 5C0ND 3TEUA 4ZUTA 1OAZH 1J1PH 4HKJB 4M62H 2MTPA 3EYVA 2FJGB 1QBLL 1E27B 3BAEH 2QJDA 4JFQA 2J6EL 1FZJB 5EU7E 4IDJH 3U9UB 1FL6A 5JOPE 5F1SA 3BWAB 3VI3E 4M6NH 1CFQB 1ZT1B 4J4PD 4MS8D 5CGYD 2BMKB 3BQUD 3LKRB 2VDNL 4M1DL 1ZEAL 4M1GL 4I77L 1R5IB 1FRGL 4WHTB 2X4QA 2MFNA 3D3VA 3QISA 1LO3H 1MI5D 1LE9B 4XPTL 3C5ZA 5MENE 4XBGA 1J8HA 4QXUL 1QYGH 4V1DB 1S9YA 5KANI 2BJML 5EZOL 1DQDH 1YPZA 4JPIA 3NCEB 3DO7A 4ODSH 3EHBD 1YNKL 2YWZA 2NY1D 4ESKA 1ZS8B 2WQ8A 3GEWB 1JYXA 4K3DL 4PJHB 4YHYB 5CILL 1ODAA 4HBCH 3RWEB 1ADQH 4XB7A 5T1MB 5HHPA 3QIWD 3RNKA 3PGCA 1A21A 4S2SB 5T1LB 2OSLB 4O58H 3KWWB 3MGOB 3U2SB 3V5DB 2ZCKH 5E03A 4M7LL 3RX5A 5L8JB 5CJ5A 3WE6A 2LU3A 5ENWB 4QXTA 3FN0L 3HZYB 5GRJL 1ZAGA 1K8DB 2V5RA 2YK1H 3JWDH 3O3DB 3PGFL 4FQCH 1FDLL 5EC1B 4CMMB 4F58L 3BD5A 1VFUA 3VWKC 4F2MA 5EBMB 4JRYE 4OSUH 4IBLT 5FYKL 2QADC 4QF1A 3LKQB 4M7ZB 4Q2ZA 4O2FA 2VDKH 3LS4H 5JHDD 4PY8I 1P1ZB 2R2HA 4OZ4B 3HB3C 4P4KC 4M7JL 1UXWA 4LDLB 1WBXB 1JPSL 1OGAD 4OF5A 4LCWB 2IQAB 4PV9A 3B2UD 5IEKB 1L9NA 1VEOA 2NNAB 5J0BA 4LVOC 3UJJL 1QFOA 4GAJH 2Q3AA 1IT9H 1F8TH 5F88B 2RBLA 4RX4D 3S36H 4YBHA 4X4XB 4ODTH 3KYOB 5T5FL 3MLTA 4U6XA 3MJ7B 1UH2A 3TF7C 4PLKD 4C56A 5FKPA 2OXGA 4OM0H 4UT6L 4ZQKB 3UTTB 2QQLH 4C59B 1CLYL 4PD4J 2PXYD 4EBQH 1B4RA 1CGYA 1VPOL 2I60H 4EDXA 4PJ9D 4YWGL 1F3JB 4W4OA 1JVKA 2X9XA 4JFHD 3LEYH 3MOQA 1RUPH 1XAUA 4HUWA 4KI5F 4KDTA 1ERNA 2YXFA 2XA8H 4HPOL 1PLGH 2NZ9C 5JORA 3BO8A 4NO5B 2J1KA 2X1XR 2HWZH 3FB8A 5LJYH 4DGYH 4Z7VA 3MRRB 3OL2A 3F7QA 5EPMA 4LVEA 2FIKA 4FFZL 3IJYB 2YR3A 2VXSL 3K80A 4MYWB 1CFNB 4ZUSB 2VLKD 3WIFB 4Z7WB 4FFVD 4P2YA 3Q5TA 1CQKA 4YDJA 4OCYL 2BY0A 2XPGA 4JO1H 4OCXH 3OJDB 5KS9F 4QKXB 2ZNWA 4O51B 4JAMA 1YEGH 3V4UH 1WFUA 2DQFA 5IB1B 5HGHA 3B9AA 5CSBA 3DX6B 4PTUB 3C2SA 4OCSL 2BK8A 4AM0A 2BSRA 1K2DB 2VXVH 1S7UA 1EHNA 3PDOA 4HLZG 3EDJA 4WW1B 4QTIH 4HAGA 1YYML 3KPNA 1U8QB 1OTSC 2Y36H 2VLMD 1NCCH 5IMKB 3RIFF 4LFHG 1KLFA 1AP2A 1F4WH 3GZKA 3UJIL 3CVHL 3TVMB 4XX1G 1JGVH 5F7MC 4UBDC 2QR0B 5CUSL 4ZFFA 1U3HD 1IKNA 1MFAH 3FO0H 1HHGA 4XHJD 5ELIA 5B22A 2PTTB 2YSSB 2I9TB 1MNUH 3NA9H 3QFJB 4NP4H 1I9RH 1I1FB 3QI9D 4YGVA 2ESVB 4ODWA 4HIXL 5F89A 2CUIA 5I15H 4XVTH 1N4XL 1JUFB 3KJ6H 4JFZL 3U0TA 3UYOD 4KKCD 4GKZB 5IF0A 1T0MB 4G80B 3SY0B 3H42L 4QHNA 4IOIA 4GRWB 1F00I 2NY5C 3S37L 1KC5H 1QSFD 2B4CH 4XCEA 3S35H 3HE6B 5IHZA 5INDB 2VABB 4M61B 1KJVA 3TCLB 1MFBL 1T3FA 1IGML 1YY9D 4XPHL 3NPSB 3IRPX 2DB8A 4UT7H 4HHAB 4U1HA 2V9RA 1GSMA 4L3EA 2VZ3A 4NQXA 4Y4KC 4JRXA 4DK6A 3BH9B 3QIUD 4WEBH 4DVBB 4TPRH 3WFBH 2Q87A 4P46D 4RGMC 4KTDL 4K7PL 5DSCA 2YRPA 3DIFB 3HI1A 1A6WL 5GZOD 4XBEH 1CGSH 1U3JA 5GGRY 1VKXB 2EH8H 5SWZE 1Y18A 4P57A 4G8FB 4F37K 4PRHE 4I48A 1C16B 2DF3A 3IDGA 1WAAA 1INDH 5E2WH 3VXTB 1DE4B 2OYPA 2JJVA 3V5HA 1AKJB 4N1EA 4MXQC 3M8OH 1XF3A 3TO4A 4X4YB 4OZFB 3DRQA 5JO5B 1QRNB 3V6ZA 4NQSB 1R3LA 2QSCH 1HINL 5F9OH 4D9QD 5HHQA 2D0FA 4JFXB 1YZZA 1ZMYA 1KBGL 1NAKL 3BOVA 4AL8L 4NQVA 5DF0A 1DLFL 3JWNC 1UM6H 5INCB 3D85B 3VG9B 3K81A 2HP4A 4KJPC 3NAAL 1S7WA 3OXRA 5DK2B 4ISVA 2A74B 1ZOXA 3SDYL 4Z18A 1ZGLB 5D2LE 4FXGB 1M7IB 4IRJB 1Z3GL 2DTSA 1WT5A 1A3LH 3ZDXF 4XMKH 5E4EC 4FRWA 3UAJD 3O45A 1HH6B 3PL6A 4HF5H 2UWEE 1I1AD 5GIRB 3TT3L 4PJBF 3GIZH 4PB9H 5BOPA 4OIAA 3BE1L 5D96B 4JKMA 1HH9A 2CDEB 4P2OB 4FZEL 3S4SA 1X7QA 5E6IA 1J8KA 3B6SB 5GJSL 2FBOJ 5K93A 2EIDA 5C0RH 2XTJC 4NN7B 4HV8B 2JB5L 1N8ZB 5EWIL 5TQ2L 4NDMA 2FEDD 5JIPA 5FIEA 4GH7B 2DQDH 4AMKH 4OM1H 5KSUB 2XICA 5TE7L 1CFSB 5JDSA 4ODHL 2EO1A 1T2QL 4OZHA 3WSQL 5F72S 3VGEA 4P5TC 5DWUL 1FLRL 2ICWB 3CAFA 4F33B 3JV4B 5KSBF 2GK2A 8FABA 5JZ7D 4ZAKB 4YFLI 5HYEA 4K9EC 2VQTA 4M4PA 4I5BB 1QACA 1NFDB 2JE8A 2VIRA 3KPSB 1FBIH 5ICXA 3VRJA 1GVIA 4MHHG 5LWYL 2PCPB 1YC7A 4HULB 2OZ4H 1NBYB 1WBYB 4YE4H 3MBEB 4H25B 1CZ8L 4XMPL 1MCQA 1RZ7H 2FLBT 3DNKA 1QLEL 1DQMH 3BQUB 4ZDHB 5FA3A 2IADB 4X6BA 2XXCB 3BW9A 1G7PA 3CDGA 1UQSB 3HMXA 1MI5B 3GFUA 3QDJD 1MIEL 3F6LA 2R4SH 3RAJH 2P8LA 4OD2A 3QXDB 4TSAH 1FV1A 3MTRA 4UB0L 2GSGB 4MDJA 3D6GA 4PV8B 4AH2A 1HSBB 1HI6B 5E8NB 1QBAA 4MJIB 1NMAH 1YQVL 4UUJB 5FYKE 4QNPF 5B38B 1W72A 2NY1B 5I30H 4NNXA 4G8IB 5E8PB 4G6ML 4WDIB 2DL9A 2F54E 1ZHLB 1MCHA 3U7WH 1URLA 5KS9B 4FQHB 1T6VN 2X70B 5JW4Q 3EAKA 4OLZL 1GZQB 1WZLA 2R39A 4N0UE 1A7QL 4H5SA 4RAHA 4F57L 5CSGA 3U4EA 1K5NA 1MRDH 4GXVH 4MD4A 1NC4A 4FQ2H 4U1JB 5DQDL 2VRAA 1JE6A 4HK0B 4H0GA 1AQDB 1FNLA 4Z7NF 3UPRB 1U2HA 5KVDL 1DL7H 5JLZB 1G9MH 3ZE1F 1T21A 4IMLA 3RX7A 1ZWIB 5H37H 4PREA 3O2DL 4AEEA 1FVDB 4HD9A 3LS5H 4OCNC 5CMAB 2RJMA 2YRZA 3QXUA 4X8JB 5CCKH 2MPAH 1BQHG 3C09B 5CP7A 2NCMA 3J7HA 2NTSP 1JZ3A 2DQIL 2W59A 1D5ZA 3GJEA 4Q6YA 3OXSB 4PJ8A 1OGAB 1MLBA 1S8DB 3GMNB 1WWAX 3GRWH 3JWOL 4U1NA 4NZJA 5C09D 1OAXL 1KUMA 1P7HL 5EU6E 1RZIA 3JXAA 1SEBA 2JIXB 1T6WA 1X4XA 1P2CA 5HD8D 3ZHDA 3RJQB 4LEXH 1CU4L 5JOEA 2H2PD 1YNLL 1VACA 4EQ2A 5T1KA 3F12B 2DBJA 5DMJB 4OQTA 5DFVD 1S5IL 1KCSL 3ALPA 5C0DA 4PJ9B 4JM4L 2APWA 4NC1E 2WZPD 4Y2DA 3MODH 3ZE2E 3GBML 2XTLA 1AXTL 2Z4QA 3S37X 1H3VA 3ARGD 2DM2A 2DM3A 1U8JA 1ZHBB 2BSTA 5HPMB 1MCKA 4IRZH 2GEEA 1N7MH 2EC9U 1LP9A 4U1MB 2AK4B 3EGSA 1NSNH 1T7WA 1OQOA 1RUAL 5CHNB 5DGQA 4FMFA 4HIEA 4Q7DA 5LBSL 1A2YB 3BSZH 2IAMC 4WJ5B 2HMID 4J4PA 35C8H 2NR6C 2L7JA 1RPQA 2GCYB 2Y06L 2JB6A 4MA1C 5FGBC 4V1DE 5ICYA 4UILH 3BEWA 4CNIB 2M26A 4I18B 3ARWA 2SEBA 4N0CD 2NXYC 4CMHC 1U8OB 4L4VD 4OV5A 2UUDH 2DIJA 2VL5A 4K7PX 4PJHE 4Y4FD 1JNHB 3OKLA 3U9PH 4R90L 4GW5A 1P7QD 3ULUD 3WFEH 2Z35A 2BZDA 3GUTA 3F8UB 4YIQA 2NY2D 1KGCE 4I3GA 3E6FB 5KZCD 4TUKL 1J10A 3RY6A 4HJ0C 3VXOA 2YPLA 3DARA 4YFDB 1HCFX 3LVEA 4H8WL 5C0AD 4LARL 2IG2H 5E8OB 2HFEA 3P77B 3V8OA 4I0PD 1KJ2H 3TBSB 3EYQC 3SDCB 2HVKB 4HGWA 1CF8L 5DJ0B 4YX2L 1V7NH 1CDJA 3HAEA 2HA1A 3MV9D 4GW4B 5L2JA 3WS3B 4MD5B 2AJZB 4NCC2 1UC6A 3EDFA 2P5EB 2G60H 3H9YA 3ME0A 3INUH 1C08A 4LCWE 4JANA 3QO1B 1RK1B 1HN1A 2APXA 2CIIA 4WTXA 3QEUA 1NCNA 3CPLA 5IESH 4PJBB 1Q9OA 2B1HL 2EXWC 3H3PH 3SKMA 4LSDA 5I6XB 5JHDA 2YKLL 4PJCF 3TWCH 3MROB 4M8VA 2GSIA 4XH2A 1BX2A 1DBAL 2OI9C 4U1IB 5J4MA 5K59F 4PJ5A 1VGKB 3RWHA 3W5NA 4Y19D 3VFOA 3UTTE 1W0VA 2DL2A 4MQ7B 4Y5VC 1KIQA 5HGAA 2JLLA 4RX4A 2DQHH 4J3VA 3AM8A 1BEYH 1IEAB 3DHJA 2VWEE 2HG5A 1ZSDA 2DQJL 5E5MB 5D7LD 1LK2B 1R24A 4P46B 3WNNA 2ZSVB 4YHMH 4EI6B 5KSBB 4QLRA 1IKFH 3LKNB 2PXYA 5L0QB 5CJXC 2W0KA 5HDOA 1UJ3C 3CFDA 3V4PH 2AABL 1JF1B 2J6EH 4WHYH 3ZE0F 4Z7WE 2B0SL 4NOFA 2JCCF 5C0GB 2NXZB 3A6BH 3O6KL 4I2XA 1H8SA 4MDIB 2CRIA 1GH7A 3ULUF 4M1DH 1ZEAH 3FQXB 4KY1H 4MAUL 2VLKA 1FRGH 1PKQB 4V2CB 1KCKA 5FF6B 3GSNA 2R9HD 5J56B 4OLVH 1RHHB 1AE6L 3VGAB 3QCTL 2P8PB 4ODUA 4S0SD 1JBJA 1G7MA 3QAZB 3LMJL 1FYTB 2D0HA 4MGXA 4AEHH 4ZUUA 4HMCA 4NBXB 5D7KE 5LGJB 5ALBL 2WMPA 4N90E 1NUGA 2PR4H 1ZLSH 3FONB 2K7QA 2R0LH 2YWYA 3QFJE 1P84J 1DVFA 4U31A 5FB8B 3OG4B 4PJXF 2ESVE 1ZE3C 4QT5A 2EICA 1RJZB 1U3HA 4NWUL 5EUKB 3HNTH 5A2JH 4QHUB 4HWNA 3TFKD 1KTLA 3PGFH 4OF8A 5ABDE 4YXLL 3CDFA 3QI9A 4GRWE 4U2YA 1MCLA 5GRVK 3SGJA 4JPVH 1PJ9A 2AJ3B 1QFWM 2FNBA 4H1LG 5A16A 3LZFL 1JHLH 5DDHB 4N0YL 1WK0A 2Z0BA 3UTSA 3N0PB 3PP3K 1DDHB 4DTGL 2X4NB 3SDAC 3LN5B 4U2ZA 3L3JA 5I8KL 1AGCB 3X11A 4UTBH 3LKPA 1QSFA 4XPBL 3UJJH 3C6LB 4LLVA 4Z5RA 3MLXL 1IAIH 3C5SA 3B9KD 4E0RA 1FH5L 3IRZA 4RMSA 4J8RB 5HDBE 1CD9B 1FZKA 2GY7B 3ARUA 4HFWA 5L7XH 4MWFA 3TLRA 3QIUA 1J1OL 5AUMA 3GSVA 4ZOBA 3GK8H 4PJ7F 3NZ8B 3QDJB 4X6DF 1QEWB 4HPOH 2CKBA 1R3JA 2YC1B 1EEZA 4GKNA 2MQ0A 2N56A 1R5WB 1QRNE 2Y07L 1F13A 4O2EB 5IVXF 1T7VA 1YA5A 3AB0C 1MJ8L 3TA3D 5GS0H 1LGVA 4JDZB 4P3DB 1IRAY 3ROOA 3B4NA 4ZTPL 1TZIA 2B20A 2CKBL 4LSRL 1XEDA 3GHBH 2ZJSH 2BVEA 2VJXA 4NUJB 1A6ZB 4HQQL 3GKZA 2QKIB 5DD1L 4ELKA 1RMFH 4KK6C 5BO1L 4PGEA 2NY7L 3PWVA 4GAYB 3S7GA 2IBBA 4PP2A 4UQ2A 1D5MB 1ACZA 3ARDD 1QLRA 2YUZA 4K94C 4HX1B 5ESAA 3P2TA 1WTGT 1V7ML 2RR3A 1SYVA 5D6CB 4N0FA 5CAYB 4R7NB 2CO6B 4Q97A 1CT8A 1JYNA 1SY6A 4XRCB 3RWJB 2HJKB 1JF5A 3GBNH 4R4FH 1EHLL 5CUSH 3VFWB 5EFIA 5SX4H 5DRNB 1I1AA 3SDDA 2VDQL 5D7IF 4A6YA 2DLIA 3NVQA 1OM3H 4WNQB 4FFYH 1U3YA 1OT2A 1ETZA 4L4TD 4Y4HB 1NEZA 3SBWC 3FFDA 5MP6H 3E6HB 4PB0H 4ERSL 3G04A 2VN4A 2XQYK 1VFOA 3O4LB 3SKJL 4WFHE 4UNUA 4E41D 1XGPB 4WHDA 4X7CC 3I02A 5IV2B 5DUMH 2HVJB 2R0WL 3FTGB 4F7EA 4JZJC 1N4XH 4JFZH 1NFDE 4A6YL 5FO9B 2AVGA 3KPSE 3C60B 3VXUB 3H42H 3RDTC 2JKXA 3R06B 2DLGA 3CC5B 4PJCB 5DTFB 1S7TB 2R0KL 5FKAA 2ZG3A 1S3KH 3SQBA 2BVYA 4XBPB 4RA0C 3S88L 1IGMH 4XPHH 4EJ1C 3CMOL 4BH7A 1HYSC 3MRQA 3I6GB 1MI5E 4KI5E 2C3VA 4U0RB 1E4XL 5J6HB 1BLNA 1VHPA 4YDIL 3MRLA 2Z92B 9CGTA 1T1XB 2RCSH 3FFCD 1JZ8A 1U8IA 1L0XA 4MJIE 1OHQA 3PNWB 2A73B 4BUHA 1ONQB 4QHMA 4U6HA 1MUJB 1UZ8A 5DGRA 2DWDB 2H1PH 3ZKQD 3TBYA 1I8LA 4JLRB 5DO2C 3MYJB 4LSUL 2XXMB 4PJFF 4Z7QF 1QSVA 5KS9E 3BP7A 4ETQA 1A1OB 1MCSA 1K3ZA 2A9MH 2FX7H 5J1AA 4N5EC 1J88A 1RIHL 5FOBB 5A2KH 5KVEL 1HINH 1XMWA 4ZFGH 4JHAL 3BPOC 3LEXA 4KKAC 2CH8A 1XR8B 4HPYL 1CXFA 3CIQA 3QA3A 4XPGL 2IPUK 2P48B 4I8DA 5HYJB 1VADA 2AQ2A 3NAAH 3BN9C 5EORH 1BZ7B 2R23A 5FXCH 4GS7C 5FA4B 2R69L 4WCYH 4CU7A 1J12A 5CWSA 2LV4A 3EJZC 4LPTA 2XZAH 4XNZC 4DZ8A 2A77L 5D1XB 4UV4L 1OGAE 2R1WB 3LEVH 4XNUH 3DTXB 4JFPB 5GGSA 2PUQT 1WUNT 2ZSWB 3OJMB 3MJ6A 3P30H 3U82B 3VRIA 4APQD 3ARTA 3IJHB 5ITBL 4RISH 2XWBB 1I3UA 3FQNA 2X1WL 3ISWA 3BYTA 3IFLL 4PJXB 1IC4L 4PLJD 4ZO7A 4UINL 1NFIB 4R3SA 5CINL 3L3DA 1Q72L 3L7FB 1N5YL 3QWOB 3SO3B 1WV7T 1R3HA 5T3ZE 4RWYL 5ALCL 4PRID 5C09A 2Z93A 4CVUA 5I1HH 5TQ2H 1F2QA 1VGEH 3O11A 2BOBB 4CJ1A 3G5YA 1AGBB 1JNLH 1N59B 3TO2B 4TVPE 1UWXK 3MLYL 1IAII 4PJGA 4FQLL 3T65A 4MSWA 5DWUH 5L8KB 2BHYA 5I71B 1G7IB 1G9MC 2AK4E 3MC0A 3HI5H 5H94A 2X9WA 3TYGL 5D93B 3NCFB 1ED3B 2XKUA 1EHXA 1AR1D 5GS1B 3ARGA 3RRQA 1MEXL 5T1DH 3C5JB 3WJLC 5E1HB 2MCG1 4G7VL 4IOSD 4R4NC 5J6GA 4MNHA 5DUBB 4DKAA 5DEFA 4OCMC 1RJLA 1GOHA 1VFAA 3GMLA 5DEZA 4OGXL 4RNRB 3KLHC 2GT9B 3ARYA 4PJ7B 1JPFB 5HBBA 1S7XA 4X6DB 4CN4A 4O4YL 3QCVH 1MIEH 5KSVA 4UV7L 5EUOB 1MHPL 3LPFA 1DEDA 1UEYA 2VLME 5E2UL 3RWFA 4L4VA 3ESVF 4QRRD 4UB0H 1OTTC 1N64L 1SBSL 3UDWC 4Y4FA 3QNYB 4IS6A 5IVXB 4UNTA 3GSWB 4U4BA 3OR7B 4RSVA 1YQVH 1IFHL 2VYRE 5I2IB 3BMWA 4JM2B 3HMXH 3DUHA 1P7QA 3BZ4B 5E00B 4YHZH 4OFYA 4J3TA 5E9DB 3H9ZA 3HN3A 4I3RH 3STZA 3G9VA 1ZANH 3TH2T 1MFEH 2V2WA 5CZXD 3LDBB 3DURA 3O0RH 5C0AA 2P5EE 5HHOD 2Q8AH 5FUOH 4LDEB 5D1ZD 1LEIB 4I0PA 1W72H 4WWKA 5D9SB 2F9BT 3PQYD 3NABL 1HHIA 3QPQC 2X09A 3ULUL 1NGXA 5KVDH 4KRNA 3BHBB 2X2YA 4PJBE 2ID5A 5JHLH 3MV9A 3TN0C 1NGWA 4X5WB 1D5XB 2ARJQ 2JK5A 4FQIH 3STBA 5IR1B 4NKDA 1UYWL 4KDVA 3ZTNH 4MA3A 3T04D 5SV4A 5DYOB 5IW6A 1AY1H 3AS2A 5JA9A 2EE9A 3RHWK 2AKRB 4YK4B 1L7TH 4OI9A 3WEXA 1F6FB 2VKWA 3O6FC 1O5DT 3X3FL 5KAQG 4ODXB 3TBWB 4OUUB 3QP3A 1BBJB 1E6OL 5AYUH 4NRYB 5CBEA 1BIIA 1I3RB 1KSRA 5E6YA 1IVLA 5LXGL 1CBVH 3OKOA 4X6CB 2V2TA 4EDWH 4KWUA 4HSQA 2I9LB 4FTVB 5DA4A 3H0TB 5J3HD 4GMTL 1SEQH 1XIWB 3KPMB 4JVWA 5I8CB 4FQXD 3TIDA 2ZPKL 3LRGA 3DECA 1S7SB 5D7JD 2P8MA 2NQCA 5CJOH 1ZT4A 3DOSA 4XHQA 5D7LA 5F96H 5I0DA 4JO4H 3BP6B 1LDPH 3EZ8A 4LHUB 4M48H 4KPHL 1FNGA 1SBBA 2CR6A 1JMXA 3FQWA 5D5MF 1FORL 5MERA 4LCCB 3JZ7A 4YNYB 3OF6A 5MEPB 1T03L 3K74B 3VU2A 1PKQE 4OQTH 3HKFA 1RUAH 1VB9A 5IMOB 5CEXB 2W0LA 1QPPA 2Z91A 2F74A 4G6JL 4PP1D 1HK6A 3RVXD 3TESA 3HCVB 2DQUL 5AZ2L 4NYLA 3S9DB 1HXYA 1HKLL 2HTLC 4QNPE 4TQEL 4L8DA 1FYTE 4BSWB 4ZNEE 1IL1B 1DQJB 2FO4B 4CN1A 5IIEA 1AO7D 3MLZL 1KCUH 4N1CA 1FPTL 3WHXB 5BW7A 1T1WA 2G9HB 2HKHL 3BUYB 5HHMD 3ARFC 3PHQA 3RBSA 4XCYB 1A4JB 1ES0B 4LAQH 2YPKA 2YA2A 3HFML 4X6EA 3UBXB 4LBEB 5J12B 5BCAA 2YZ8A 5FYJD 5I17B 1B90A 4MJ5B 1LD9B 4KVCL 3W9DA 1ORQB 2V7HB 3SKOB 3RKPA 3T0EB 1JWMB 4QRSA 5HY9B 4H0IA 3OPZL 3ILPB 3ZZ1A 2AQ1A 3RWDB 4WI7A 3X13A 1P6AB 1YECL 3MV8D 4LQFL 4QEGA 1X6LA 2XT1B 4YBQC 1J05B 1EGJA 3DMMB 4G9DA 4Y89A 3QJHA 3RA7H 3RVWC 1AD0B 2R1XB 1AGEB 4Q9QL 3D39D 1H9VA 1YEDA 2HFFA 3SCMC 4RGNB 3Q3GB 2E9WA 4HKJA 2B1HH 4U6VH 3IFOA 2FX8L 4EUPA 3HAEH 2O26U 3TPUA 4KTYA 2V9QA 3HG1D 5D7IA 1EGJL 1M71A 5EB9A 4C58B 4JKLA 3CZFA 3EO0A 2D2OA 5ITFB 4N9GB 3MXWH 1P4IL 3B9KA 1XGRB 5JTWA 1CDBA 1A47A 4I0CC 3F6IA 2EH7H 3C8DA 1D3CA 1JRHL 1FZOA 3EZJB 4X6FA 5IM7B 5JW4R 2IF7A 1QQDB 1A7NL 4PRNB 1T66D 1D9KB 4M7KH 3EYFB 2EE3A 1K85A 2OP4L 2D31A 4D0CA 4NO0B 1DBBH 2LU7A 1BM3H 5IJKA 3IDJA 3LRSB 5BVJB 4JQXC 1MIMH 1BQHB 3RL1A 4V1DA 4KU1A 2BDNH 2V5YA 3Q6FA 4XI5C 2J88H 1TPXC 5SWSD 3MBXL 4KRPD 4KROC 2FB4L 5DD5H 3O6KH 2VITA 1B4JH 3GSOA 1RVFL 1UG9A 3HPJB 5EBLA 3TA3A 2BY3A 3VRLE 1MAMH 2XN9B 1LO5B 2IBZY 3MGOA 1ZA6B 3QRGH 5DD6A 5LAXA 3ETBF 4N68A 2EZ0C 1RULH 3F7YA 3QUXD 3BKCL 2D7OA 1K8DA 5HYQA 3REWB 4F8TA 1LO4H 3O3DA 1EV2E 2A6KB 5F7NC 1UB5B 5BQ7B 1ZTXL 1C1EL 3QEQE 4U1LB 5HSFA 5EO1A 4LDOB 5DMGD 1J11A 5A2FA 2EKJA 2B2XL 2ITDA 1HDMB 1WWWX 3GMRB 5ESQA 3ARDA 2PO6C 4NZTH 3GB7B 5ALBH 3CK0L 3ORJA 3FT4B 1JZ6A 5EU5B 3KS0H 1RIUH 1I8MA 3P3YA 3GSNH 1YNTB 5TDNA 1OAKL 4OF3A 2M8XA 2IFFL 5J13B 5DD3L 2VLJD 1EUUA 4M3JA 3D18B 3O4LE 5FK9B 1MRFL 2ZCHH 2AJYH 2NNAA 3OB0H 1Q9LA 4XP6L 4DOHB 5I0ZA 1WFNA 3CDCA 2A38A 3HS0B 5F88A 1WWBX 4L4TA 3IS0X 4U33A 1NDMA 4DKEL 1YEIL 3VXUE 5C70A 2BHZA 3QEGH 4EI5D 3NTCL 3B83A 2QHLA 1GXEA 4PJCE 2OJEB 1I8IB 1KPVA 2NX5D 4E41A 3L3OB 2F53D 4HIHB 1NCAL 1T1YB 3QZWB 5DJ6A 1XT5A 2ZKHH 3DWTA 3OX8B 4N0YH 2IPKB 5H8DA 1ZLUK 3QWRD 4PY8J 4MNQB 3U36A 4NO5A 5F6HJ 5FECB 5I8KH 2Q6WA 3ROLA 2AXFA 3IGAA 1JL8A 1JWSA 3WN5B 3MLXH 4GW1B 3VFPB 4CDHA 2DS4A 4LLUA 5C0IA 4ZUSA 4ENED 2D7TL 1TCRB 3KLAA 4QYOB 2HT3C 5FDWB 3EJYD 3SE4C 2G75B 2EEDA 3FOMB 3H6JA 2OTWB 1KG0B 3FFCA 4YHYC 1F3DJ 2EXYD 2VLRD 4GLRI 4R7DA 2CRZA 3PGDB 3BDYH 1IKNC 5D5MB 4UAOB 1K2DA 2GIYA 5IW1B 4BH8B 3SJVB 4MD0A 4GUPA 4MNGB 1MJ8H 2EE6A 1FIGH 1IEBA 4AY0A 3RTQC 5HYJE 2CKBH 4LSRH 4D8PB 1FGNL 2W60B 2A6JB 4Q0XL 2JELL 1BD2D 1JZ2A 2E7LC 3ARRA 1AHWA 4Z0BH 3FT3B 3E2HB 5KOMC 5LGHL 5HHOB 3GJFB 4M7ZC 4NO3B 1BGXL 3NFSL 4L8CB 1IQWL 5JW3L 4PD4K 2ESVA 3KPRB 5A3ID 1FNFA 3IYLW 1B6UA 3Q48A 1V7MH 4PYGA 4PJXE 3E8UL 3NZHH 3DV4B 2MJWA 1U8MB 2NTFB 1B6DA 4KK8C 5EO9B 1RZFL 3AU1B 4O00A 4APQA 4LSTH 1N3NB 3RWCB 4DZBA 4UDTA 5IMMB 3UXFA 5TH2B 1WF5A 3DX8A 1V3KA 1RZJH 1UADC 3HC4H 4J7RA 4KQ3H 3T1FB 1I8KA 2RFXB 3DVGB 3BESR 4Y5YB 3MLRL 3OAUL 3VXNA 4D9LH 2EYTB 4PRIA 2VWEC 1F42A 1ROWA 3GSUA 4ZODA 5CFHA 5ID1A 1SY6H 4Z0XB 3OKNA 4WEMB 2R29H 2UYLB 1OCWH 2QQKL 5FAAA 4FQXB 1DCLA 4A6YH 4MVBC 2X7LB 4LPXA 2Q86A 3MNWA 3VCLB 4K7FA 4HIJB 4L8SB 3ARBA 2BC4B 1MPAL 3BPCA 2DLFH 2ITCA 1K8IA 2IALA 1VKXA 1T7XA 3RBGA 2R0KH 4XC1L 1IAKA 4G8FA 4WO4D 4TSBH 4FHBD 4L29B 4P9HL 2PN5A 1XF5B 2FSEB 1FO0A 3VWKB 4WW2F 1DE4A 1RD6A 2IWGA 4YPGB 4NN5C 4DN4L 4X4YA 3ULVD 1FIEA 5EO0A 1FCGA 2YA1A 5IB4B 2AJXL 5EUOE 4NQSA 1KIRA 1A6VH 2PTVA 4UOW1 5E94B 3DV6B 3QNZA 4YDIH 2IEPA 3MOAL 3PDGA 1WT5C 2CRMA 3JBG7 2IANB 3CFCL 3PL6C 4RFNB 3DETC 1A9BB 4H1LB 2Y5TA 5C08D 2JJTA 4LNVA 5GGRA 3TVMC 4H88H 1IAMA 1AO7B 3MRMB 2NYYD 4X7TA 1ZGLA 3CMGA 1Q0XL 4CU6A 4QRRA 2QLVB 5HHMB 1AQKL 2FEEL 5E9DE 3DVFA 5E6IC 1WC7B 2CD0A 3MREB 4JZNB 2W9LA 4B0MM 3P4NB 1HYRC 1CGVA 4MJ6A 4PJAB 1BFOB 1HH6A 4Y88A 4YXKL 1CS6A 4KK9D 4WEUD 4Z95L 3QUKB 4WTWA 3WL9B 4G6FB 4M8QA 3HZMB 1G0YR 3WFCL 1XGTA 2IH1B 1XGYL 3MV7D 5GRUH 2R2BA 4KV5E 3VXRB 4CKVX 1P53A 3O3AB 1OWRM 1IGFL 4U6YB 3QXWA 3DX7A 2NY6D 4R4BA 3ILQD 2VDRH 3PQYA 4CVXA 1MHHA 2W9DL 2FYYB 2YPVL 1GL4B 1H8NA 1HEZB 4F7TA 1C7SA 3NPSC 5ITBH 3D39B 3GMPA 4K3EL 1A5FL 1K4DB 3G9AB 3QG6A 4KZDH 2GTWB 1KT2B 5KN5B 3T1WA 3IFLH 4LU5L 4UINH 4X6CE 1TENA 4FTVE 4NNPH 3MLWH 2NY4D 4HKZB 4NOBA 4GT7A 1NGZB 3QUZD 5KTEL 4YBLB 5HHVL 2APFA 2V5SA 1MH5B 1DUYB 3O41A 3BGMB 5H37G 5JIKA 5GSRB 3RI5F 4TUJB 4XWGL 3ULVF 5KVMC 3S96A 4YO0B 3BPNB 4ZO9A 5DMKB 5L9DL 3W5MA 2BVUA 2VXUH 1QP1A 5D7JA 1IGYA 2AV1B 4PJEF 3JTSB 3D2UA 4D0DB 2MKWA 4IRSC 2GSGA 1F4YL 1HSBA 5T3XH 5F3HA 2A6DB 1GAFH 3VFUB 4M1CC 5B38A 2DIAA 5SWSB 5JNYA 4NFBA 4UTAH 1OAQL 1EJOL 5KAQF 4K8RH 3VG9C 3WNKA 3FN3A 3KLSA 4YUEH 2C9AA 3RZCB 1AH1A 1E4JA 4AIZB 3JWOC 4G43A 1G7HB 2COQA 1M7DA 1YMMD 3EDEA 4JFFD 4PTTA 4QRTB 2HT2C 1T4KB 1KCLA 2QSQA 32C2B 4RRPG 4HH9A 4KMLB 4YHIB 1K9TA 1PFCA 2HTKC 2ATPB 4O4YH 1BVKB 1RI8A 4UV7H 3EOAB 1MHPH 4JFYB 4TRPL 4QXGH 4PJ8C 5I16B 3KPLA 2HFGL 2V2XA 1DLHA 3UPRA 1JHTB 3QPXL 5D96C 2E8ZA 1CLOH 4NKIL 2EIZA 4P2OC 3RVUC 3MZGB 3T0EE 1CE6B 2LU4A 4JY6A 4Z78B 2E7HA 4GBXD 2NY3D 2FH6A 1BF8A 3OKDB 5J1SC 3WXWL 4P2RD 1MVUB 3VFNB 4L8BB 4QXWA 1C5CH 3UPCA 3WUWB 5FGSA 4GXUN 2WBWB 2R1YB 2X6MA 3HE7D 1I7TB 2EYSB 5EZLB 1MCRA 1BWMA 5F9JB 4Y2DC 5DJ2A 5JIIA 2X89D 43C9A 3NABH 2VQ1B 1NKRA 4ZAKC 3ULUH 3MV8A 4RGNE 4EI5B 2DDQH 4XT1C 5IFHH 3SOBH 4HMDA 3F12A 2BRRL 3MRHB 4BSVA 3S34L 5FYJL 2F53B 4OZIF 2H26A 5I1IL 3L5JA 5KSAB 1LEKB 2YRLA 4LCUB 2J8UF 3BQUC 3CCHB 3TBTB 2KBGA 1XGQA 1LILA 1MHCA 5HXMA 1U8NA 2JJSC 2Y6SD 2DQEH 1E0OB 3HRPA 1VEMA 1EXUB 3HG1A 1E28A 2Y9RT 4F9LC 4KI5C 2RB8A 4O2CA 3ZYOA 4H8WC 3NCCB 5HI5D 2MQCA 3VFMA 3D25A 4HUUB 1KELH 1DFBL 5DJYA 5CLWA 3HZKB 3VD7A 4HBQA 1X44A 4JEGB 5EIQA 5FGRA 4TOYH 3HPLB 3SGDI 5LGKA 4CNIA 2NY1C 4MX7A 2MHAA 2XZCL 3NA4A 4KVNL 4BZ2L 2ORBH 2VLRB 4XPAH 2WUBL 1FNAA 3NGBB 3ARED 4XC3L 1A6TB 3QIWC 4NSKA 4MCYA 1E4WL 2WUCL 3CVIH 3RGVD 3SDXB 2XN9E 1FORH 4WW2B 3T77B 1K6QL 1L7IL 4LSVH 1X4YA 4U1KA 3QEHB 3VFGH 3VFVB 4BFIA 2KQNA 4LPWA 3CFBB 5IT2H 1UKTA 5KOVC 4HLZH 3BZDA 3CFKB 1QO3B 5TQ0L 1BJ1H 3WYRA 4B7LA 2O93L 5DEGA 4DVRL 4P5MB 3AROA 1S7QA 1HKLH 2VSDA 1RAMA 3FHAA 4WUKH 1MCJA 4DCQB 5IHBA 4L1DA 5IB5A 1LMKA 2WQRA 2CPCA 2ADJB 3QIBA 3C09C 1KFAL 4POYA 3X14A 3L7EA 4DGVH 4Q6IA 2WK2A 2HKHH 3VH8B 4PRPD 5C0CB 4BQCA 1UM4L 3LB6D 5ANMA 3T4YA 1WBZA 2XWTB 1G6RL 43CAB 1FVCB 4DOHE 2X10A 1OOAA 1YDPB 4L9LB 1MJUH 5CEYB 1MRCL 5JXEC 2BSSA 1DANT 4MJ4A 2H2SD 4KVCH 2EE2A 2FX9H 1WGOA 1F97A 4NZUH 5I76B 1CD8A 4J12A 4LMQE 2BNRB 3FZUD 2VLJA 5GGVY 1VGKA 4PJIF 3HRZB 2MCPL 3OPZH 3F7VA 4D9RE 4E5XA 2VZ1A 2X1QA 3MJ8B 2PXYC 5JW5A 3H7BB 4HCRA 5I1KL 4LQFH 1L0QA 4PJ9C 1FFQA 1INEL 4HWZA 3UC0H 4M03A 3ZKND 4NN6C 2BOCB 5HJ3A 2DI8A 5E5MA 4JREB 4MNQE 3AMKA 4ZFOA 3RWGB 1OB1A 2OTUA 3HNVH 4HKXB 2UZIH 3U83A 5BMFL 2FZ3B 2NX5A 4WFGE 4EI6A 1NL0H 3VFSB 3LKNA 5IHUL 2EDOA 4H20L 4OLEA 4QGYA 4LSPL 1TVHA 4U7KA 2HYMA 4P59L 2AGJH 3UTPE 1A02N 3GMQA 3B8YA 5TF1L 1EGJH 2CLZB 4UMGA 2VH5L 1RJCA 2ICEB 4M5ZH 3N06B 4LEOB 3J8F7 4KJWD 3QULA 4MDIA 3ET9F 1FP5A 3A6OA 1ACYH 5GJTH 1QBBA 1KLUB 2ED8A 2YHGA 4EUPH 5C9JA 4Z76A 3MQIA 1PKQA 3HUJF 3P9MB 5D5ME 1A7NH 3U0PA 3OJVC 3I75B 1A14L 1WIOA 4XMLL 5DHYB 1EFXB 3LQAL 4KK5C 4PJEB 3SJVE 3D0LA 1KEMH 1CE1L 4WFEE 4MNGE 3NFNA 1QTYT 2OP4H 1D5IH 1J18A 6CGTA 5C2UB 3X3GL 2ZUWA 1W0WB 2IGFH 1I9EA 5HDQH 4HGKC 3LY6A 1XCQA 1DN0A 4XHJC 1A1NA 1JFQL 1BOGA 2X4OA 3V5KB 3SDCC 3CSYA 2PYFA 1RVFH 2ZUSA 3V8CA 3QI9C 1GZPB 4A2MA 4MXWH 5FUZL 3U30C 2F5BL 3KPRE 3MV7B 1BD2A 4JDVB 4KKCC 1NLDH 1FL3B 4XVSH 5ADPH 3OAYH 2X4UA 5EULV 3MRFA 4ZMAT 2OL3B 1J1XL 4HUVB 2F58H 2IAMB 4ZUWB 4Y5XB 1U92A 2FR4B 4ZO6A 1TIUA 3W11D 3P0VH 5EA0H 4LHJB 1YY9C 3TNMB 3OGCB 5C2BL 3SE3A 4CDGC 3CUPB 4R9HA 4F80A 2NXYB 4OJFL 4CMHB 4HZLA 5DRWA 2VZOA 1AGCA 5DVLA 5C0EA 3QIUC 3U7YH 4X83A 4DKDC 3BISA 1MJ7L 1I7ZB 2HJLA 4LK4A 1PW3A 2NY4B 1R6VA 2IC2A 4P46C 3V0VB 3V7AE 2PYEB 1C5BL 3VFRB 5BS0D 4NNYB 5L0QC 5GZOC 2A1WL 4J8RA 2CQVA 3SE8L 2P1YA 5EOTA 4YHLL 3DXAB 3BP5A 4OZIB 1CD1B 2NW2A 1YEFH 3B2VL 1NCAH 3LOWA 4JPWH 2R2EA 1I7RA 4MQXC 2NXZC 4PBVC 4JHBA 1TZGH 1IGJB 2J8UB 3FRUB 3ZO0A 4AG4L 4WHCA 2DI9A 2ZCLL 2Q3ZA 2GFBB 1HXMB 1KLGA 1PG7W 3WFHB 1R5WA 4QOKB 4KI1A 4WO4A 1AXSB 4S1QH 1P84K 3FO9B 3LQZA 4OFVA 5ACMA 4BQ6A 1EZVX 2J4WH 3H9SB 4XAWH 1HHJA 3DPBA 1NLBH 2IANE 4H26B 1H5BC 1FGVL 4DQOH 1I1YA 5DJZB 3VGAC 1NBQA 4OTXH 4ORGA 4HJGA 3I6LD 3QAZC 1AO7E 1MF2H 2CGRH 1RZGA 1A6ZA 4NHUB 2QKIA 1OF2A 3RNQB 1Z9SA 3GMOA 4R2GD 3QUMA 4JVUA 5D2NA 7CGTA 3O6ML 3KYMA 3OR6A 1X5LA 1I7UB 4KC3B 4GRMB 4PJAE 5KVGL 5C08A 3O4OB 3MUHL 1K4CB 3FB6B 3PWNB 5C92A 4NQED 3ULVL 3KYNB 2M1KA 4FXKB 3IU4L 5E8DL 5EOQL 1X4ZA 1OSPL 4J6RH 1TNMA 1NMCC 2G5BA 4GRLD 1HIML 4XNQA 5FGCB 2DJSA 2DM4A 2GY5A 4XP4H 1XGUA 1H3PH 3VXRE 3QEQA 4KJYA 4JE4B 4WU7B 3OQ3B 3ZYJA 7FABH 2ZUQB 1A7PH 4P2RB 3DUSB 3RPIA 3VGDA 4WNQA 4IIQA 5CSZA 4TYUA 1GC1H 3S5LB 3IFNL 1BGXH 3T0WA 3T4AA 1FCCA 2WBKA 1TMCB 3F65A 3QUYD 5IROC 3WJJC 2X05A 1MFDH 3OSKA 5JW3H 4CGTA 3D39E 2WW8A 1EA9C 5JZ7C 2L7UA 3DBXA 3O9WD 5ILTH 4ZPVA 4XP9L 3P0YL 1YMHA 1JJUA 2VAAA 3LIZH 3KPQB 1FNHA 4KHTH 1T04B 4YHPA 5KW9L 1D6EB 1RZFH 4FS0A 2FD6L 2HT4D 1ND0A 5C3LD 1ZHNB 2J8HA 4LSQH 3VWJD 1S9WB 3SPVA 4KHXL 1CICD 2L4OA 2YBRA 4HC1L 4RFEA 1U8LB 4XP1H 2OQJB 2ZUYA 3PP4H 1NCWL 2WBJB 3MLRH 4P2QD 5CD3A 4FQJH 4X4ME 2EYRA 3QUZA 5MEOB 3RWIA 1I8LC 1J5OH 3H9HA 1Y0LB 2YD7A 2CMRH 3L5IA 3G5VB 4Q74A 2E7MA 2A73A 1CFBA 4OZGA 1ONQA 4LPVA 4OFDA 2XFXB 3IF1A 4UU9A 5DK0B 4BA8A 2ICES 2X4TB 4JR9H 4XC1H 3KDMB 3BGAA 3VXSE 1JPTH 1OAZL 1J1PL 3P9LA 5MEQB 1PEWA 4TNWK 1JRHI 3KXFD 2DRUA 3ES6B 5DJXA 4UI2A 2DI7A 4OLUL 4LASH 5BV7H 2I07A 3CLEH 4IDJL 1T83C 1I4FA 4KRLB 2Q7YA 4I1NB 2XQBH 3BH8A 3HUJB 5SX5K 1KPRA 3MRJB 1JNJA 1M6OB 3S4SG 3MOAH 3WDJA 1MVFA 5I1AA 1YMMA 3T3PF 4JFFA 4WUUB 3MRKB 5B3NA 3S6CA 1FO0H 2CO7B 1FFOB 4MAYD 4EN3B 1KNOB 4DEPC 1NBZA 5HYSB 4ZSOA 1IBGH 1FG9C 2XWJA 3KPOA 1AQKH 1QYGL 3M17A 5IB3A 5FHBL 1CXLA 3FAWA 1DQDL 3EOBB 4Y4HC 4RA3A 4B7IA 4ODSL 4WY7H 4XPFH 3NCJL 2ENSA 4Z95H 1FJ1B 1MCBA 4HBCL 1ADQL 4GBXA 2H2PC 1A0QH 3QDHA 4QRUB 1RK0B 1WZ1L 3EFFA 5EBWA 1XGYH 4KMTH 4AQ1B 3HMWL 4O58L 5I1LA 1CGTA 2MWCA 3HZVB 4LLDB 3BEVB 2ZCKL 4JFDB 4XXCA 5DFVC 3C60C 3HE7A 4X99B 4NJAH 2ARJA 3AB0B 3P73A 4RFOH 2YK1L 2X89A 3CFEA 5JW4N 3JWDL 3ULSB 4RIRB 4FQCL 2YXMA 3IAPA 1ZA3B 2BVTA 5BVPH 5BRZB 3FHQA 2DM7A 3RY5A 4K3EH 3CNKA 3R0MA 4OSUL 1A5FH 5HGGS 4IOFD 3IXTB 5JPMB 3ALXA 3TNNA 3LS4L 3PDDA 5IQ9B 4MHHI 2HMIC 5FYKU 3EYUL 3EUUA 4TNVK 1OL0A 3MFFA 4PJIA 2QADD 3O8XD 2VNCA 3C5JA 4OT1H 4GAJL 4N0CC 3IDNA 4P4KD 4LKXB 1IT9L 4NQDD 4PG2C 3TZVA 1F8TL 4Y4FC 5FO7B 4YHNB 5I74C 1KB9K 4UIKH 3VDCA 4J3UA 5D7SH 2GT9A 3SDXE 4KTEH 5C0BB 4ZXBB 2NZIA 4PFEA 4AZ8A 5B3JF 4B50A 3ULUC 5GGQL 2QQLL 4EBQL 2I60L 3VFTB 4R0LA 1CXIA 3LEYL 4Y16A 1RUPL 1WLHA 3QNYA 1P4BH 2XA8L 1DQLH 1PLGL 3LKOB 3AREA 4P4RA 4YDVA 2BNQB 2HWZL 3RGVA 2OR9H 1NMBH 3NN8A 4I0PC 3DUUB 4DGYL 5GHWH 1UWEL 1RY7B 3E1F1 1VA9A 4JZJB 5B21A 4XWOD 2G2RB 2NZ9D 1E6JH 3RUGF 1OP5H 1QA9B 1GGIH 5E6ZA 2H8PB 4ONGH 3VXME 1CFVL 3K8KA 5D1XC 2C7UB 1FZMB 3GJFK 4JO1L 4QRPE 5C0CE 4OCXL 3G6JE 2Y25A 1XH3B 3Q5YA 4E42B 1S9VB 1YEGL 3V4UL 2ZG2A 4QTHB 4YHOH 5DQ9B 3QDMB 1HHHB 3PABA 4Y8AA 4OIIH 2J2ZA 4YQXH 3BKMH 5IR1A 4JZOA 5IJVB 3SKUD 2FLRT 2P45B 2VXVL 3PWLA 4PRPA 3EJJX 2BNRE 4QTIL 4QCIA 3L6FA 2Y36L 5EN2B 5KG9A 1JN6A 1NCCL 2XZZA 3F58L 2YD6A 2LABA 1WEJH 1F4WL 1U8HB 4EOWH 1JGVL 1Q9KB 4RMVA 1OTSD 1BBJA 3UJTH 3FO0L 1MFAL 4W6WB 3CXDH 3TC9A 3U7AA 4HDIA 2X4RB 3TBVA 2HLAA 5BS0B 5I71C 3RVVD 4JJ5B 1MNUL 1A6PA 1I9RL 4UBDD 2I24N 1I1CA 3MCLH 4TUOA 1YQ2A 3KPMA 3QQ4A 5I1GL 3HR5B 1IC1A 2BRRH 3LKSA 5GS1C 3UO1H 1S7SA 3DYPA 3K4DA 2GITB 3BPLB 3IFPA 3U46A 5I15L 4XVTL 4YEFA 2Y1VA 3KAAA 3KGRA 3KJ6L 3SKNB 3OKKB 3QXTA 3MNVB 1N6QH 3BUTA 4XAKD 2X9YA 1U0QA 3ARZA 3SQOL 5HYFA 2R15A 3LSOA 5SWQB 1KC5L 3FRPG 2B4CL 3S35L 1D5BB 3ZL4H 3U0WL 2QEJA 3PV6A 1XZ0A 4XVJH 3QJFA 4ZPTA 3TIEA 4GAGH 5CEXA 1WISA 2R9HC 3GI9L 1A64A 2Q76B 3L3HA 3I2CL 4UT7L 5FO8A 4UOJA 3O3EA 4BK5A 2DKSA 5DJDA 4L4JA 2BVPB 4TVPH 1X5IA 3LRHA 4WEBL 1NGPL 1C7TA 2D03L 4NBYB 4JM2C 2XZCH 1LWRA 3V6OA 4R96B 5ISZB 1UJTA 4XBEL 1KENL 1CGSL 3S98A 1DEEA 5J11B 2EH8L 3T3MF 3ZSTA 3LDBC 1K6QH 1S7RB 1KPUA 3WD5L 1YPZF 4GRLB 3DX9B 3MRPA 5MI0B 3UBXA 1VCAA 3EDDA 3MV7E 1INDL 5IP4A 2VKXA 5EDXA 3IU3A 3KPTA 3TFKC 4Z7OF 4OD3H 1LD9A 4JFEB 4I4WA 3LPGA 1ORQA 3ZHLA 5EC2B 3UX9B 1JHKL 3K1DA 4RBPK 2FEEI 2QSCL 5F9OL 3RL2A 4B53A 3QDGD 4Z77B 1A1MB 4MXQD 5I73C 1UM6L 2CDFB 3GDBA 4YK4C 1J05A 1OD9A 5DRXB 3O9WB 5FCUH 3L95B 3C9NA 1MELA 3QHFL 5KVFH 2X40A 1UM4H 2YD5A 1T2JA 2R1XA 3GNMH 2W0FA 1G6RH 2X4PB 3GMMB 4ZD3H 4G8GE 4PRBB 3B5HA 4KJPD 3B9KC 1A3LL 4P0DA 2QQNH 4XMKL 4Y1AB 5F3BA 2PYEE 2A6IA 4HF5L 4W81A 4F3FA 1LEGA 1IQDA 1F58L 2MCPH 4PB9L 2OJZH 1EVUA 3DXAE 4OZIE 3FQUB 1EAPB 4N8CH 3C8KB 5IJKC 4HIIB 1YN7B 1IGTB 2JTDA 3B43A 2J8UE 4FXLA 4NT6B 3MRCA 5C0RL 2K3TA 1JK8A 5IM7A 3B9EA 2V17H 3PIQA 4LCCC 2DQDL 1NBVH 4AMKL 4OM1L 1XR9A 2J3SA 1IM3B 3SGEH 4QOKE 2XTJD 3K7UA 4HCRH 3IETB 4ZNCD 1GGYA 3X12A 3H9SE 3C08H 1PG7L 4HS6A 1S7VA 1BJMA 1HQRB 1KTDB 3W81A 2F19H 4BZ1L 1KN2H 3O81A 5JPNB 2E27H 5FFLA 1FBIL 4P5TD 1T89A 1J7VR 1MCNA 2IPTL 3JV6A 4L3ED 4YE4L 1FN4A 1BQSA 2ICCA 1RZ7L 1F2XK 3S36X 1DQML 3O6FB 1YUHA 1T1ZA 5ERWB 2WINA 5IEHB 3CH8A 3V0WH 1AGFA 2F8OA 2GJJA 1CXEA 4EVNB 4XMLH 5J12C 1BREA 1MCWW 5FGCE 1UB5A 3KNBA 4XXDA 2R4SL 3RAJL 2BXZA 2HN7A 4JY4A 1OPGL 3ZDYF 1M05B 3T0EC 1CN4A 3MUGA 4LF3B 1KJ2B 4P2RE 1JFQH 4NQEA 4BKLA 4U3HA 1NMAL 1FVEB 3RUGB 3TO4D 4FABH 1UACH 4WI8A 4CUCA 4DUXA 3DMMC 5CP3A 1JGDB 4J3SA 3U7WL 2BVOB 4MB4A 2OLDA 2YUXA 1HQ4B 4RGNC 5I8OH 2Y7QA 2H6PB 2YEZB 2AXHA 4GXVL 2DYPA 1MCDA 3QUYA 4FQ2L 3TYFA 2P46B 3IDYC 2DJ4A 4U7MA 3V6FB 5D1QA 1CK0H 1EFQA 5I1CL 1INQA 1Q1JH 3FOLB 2H3NB 3PJSB 5D6DC 5DD0L 2IPKA 3L5HA 5IWLC 3LS5L 3QQ3B 4ZUVB 5CCKL 2MPAL 5B8CB 4MCZA 3LAFA 5GRYA 4HWBA 3LHPH 3QXAB 2VERN 2WLYA 1NGYA 1PYWA 4FZ8H 3VWJA 2YN5A 4OCWL 5FHAL 3WN5A 1CICA 3ARFB 2WNGA 3QH3B 1P7KA 2C1OA 3GRWL 1D9KC 1U58A 4RRPA 5AD0B 1RZ8A 4OIBA 3IDXH 2A1WH 4S11A 5DS8B 3VI4F 1U95A 4P2QA 3Q0HA 4IMKA 1TXKA 3NOIA 3MRBB 1ULVA 4LEXL 3FOMA 3T0XA 1UVQB 5DJCB 1P6FA 1H3UA 5GRXG 5TDPA 5IHLB 4N1HB 1YY8B 2RIKA 5IGXH 1AIFB 5DHXB 1T0PB 5E56A 3EYVB 4R8WL 1L0YA 1B2WL 4ZTOH 2VUOA 3MODL 4JFQB 4BH8A 1AHWC 3B8SA 5TE4H 5JXAH 1F5WA 3PHOA 2X42A 3HUJE 4LLQA 3WIIH 1JZ7A 3S35X 3KXFA 3VJ6B 1FL6B 1N7ML 4WUUE 1WAAF 5EU4A 4S1SL 1NSNL 4OF0A 3FO2A 4HK3J 5FUCE 3BSZL 1KB5A 1NEZG 35C8L 3IDMA 2X4QB 3K2UH 4XNMA 3D3VB 1SQ2N 1IJ9A 1X5AA 3C5ZB 4P23D 4RAUA 4UILL 4XBGB 1YEHH 5BXFA 2VDLH 2YD2A 2X4SB 3A67H 4P3WA 4L8CA 3BXNA 1J8HB 1SYSA 3GSQA 5KVGH 2NR6D 4MAYA 4F7MA 4PLJC 1S9YB 3ULVH 3B3IA 3FL7A 2XZQH 4JPIB 5E8DH 3U9PL 3DO7B 1QFUH 1KB5L 2DD8H 3GSRA 5SV3A 4LSSH 1MAJA 1QBMH 3QNXA 3QUMH 5CJQH 4JFDE 3WFEL 4P9HC 5HHPB 4JG0H 1X5XA 2XKSA 3RNKB 3PGCB 4FN0A 3CFJA 1QKZH 4RQQA 2VR5A 5T33H 3KG5A 1BIHA 3KR3H 3WE6B 4QXTB 2NLJA 5BRZE 5ID0A 4KROB 1NC4D 1KJ2L 4BM7A 1CVSC 4UQ3A 4CW1A 5K9KA 4MA8H 4JCLA 1QSED 1H3TA 1V7NL 3PHSA 1AR1C 1IC7L 4O9HL 4AENA 1A7RL 2BP3A 4F2MB 2G60L 2P7TA 3INUL 4QF1B 4G9FD 5KW9H 4Q2ZB 2BC4A 4O2FB 4OZHF 3TT1L 2E3VA 5FYLD 2R2HB 1KN4H 4KHXH 5IESL 4PV9B 3H3PL 3TGXA 2UVEA 3TWCL 3Q2CA 4UDUA 3SGEI 5C0BE 2JJTC 4X4ZA 3WXVH 4ZS7H 1MREH 1PBYA 4P9MH 3PWPE 4P4KA 2V5MA 3MLTB 4NQDA 5E94A 1AC0A 4U6XB 1EBPA 1TJIH 4JQVA 5T1KD 3D0VA 4C56B 5FKPB 3I9GH 5IBLD 1KIUA 2GJ6D 4WFFD 1Q9WA 2BNQE 4EDXB 1TTGA 4YHML 2QV2A 1Z9OA 4HUWB 4CAGA 5A40E 1IKFL 4K2UH 4ONHB 3FB8B 3ZTJH 2UV3A 4LAJH 1KCRH 4Z7VB 3V4PL 4G5ZH 3VXPA 5L8LB 2FWOA 5EPMB 3BT2H 3E2HC 3P4NA 4OLUH 1MCOH 2FIKB 3MRIA 4JJHA 2R0ZH 3MRDA 5D1ZC 2FL5B 4PGJA 3A6BL 3QUKA 4HXBH 2Z31D 5LG1A 3WL9A 5DI8A 3QDME 4YDJB 3GIVA 2XPGB 4KY1L 4NJ9H 4M6MH 2DQFB 1N0XH 5HGHB 3CVHB 3RU8H 5IB2A 2DICA 2B39A 4AM0B 4PS4H 2BSRB 4OLVL 1IGCH 1S7UB 2HRPH 3PDOB 4NHCL 4L1HA 4LCYA 5FHBH 1F6LL 5F7UA 2N7AA 4OGYH 4UIMA 3KPNB 3OHXB 4AEHL 4Y5YC 1T7ZA 2GK0A 3NCJH 1AP2B 4I9WE 2PR4L 3E0GA 2YPLD 1ZLSL 3WCYA 5F9WC 2XV6B 5J3HC 3STLA 2R0LL 1KIPA 4ZFFB 4GQPH 1WZ1H 3L5WA 5DHVA 1HHGB 1RZKL 4K7PY 1W8OA 4FQXC 3HMWH 4HKZA 5AWNL 3ZDZF 1IE5A 3WS6C 4L8SC 2P47B 5MHSE 2P5WE 1MH5A 3HNTL 1NANH 5DFWH 3VMPA 5F7FA 1DUYA 5B39G 4CU8A 4ZYKA 4TUJA 3RVTC 3RTQB 4RAVB 4ODWB 2Y5EA 5IFJA 5F89B 5FOJA 4FQPA 1BFVL 4L5FH 1NUNB 3P4MA 4X4MA 4JPVL 3U0TB 1JV5A 3C2AH 5IF0B 3BDBA 3HI6H 3N1QC 1SJHA 2D0GA 2AV1A 1JHLL 4QHNB 4IOIB 2C3WA 2ADFH 4C83A 1G7LA 3RKDD 5ECJE 1BQLH 3EYUH 4MA7H 2A6DA 5IHZB 1BBDL 4PJ5D 1QLFA 1KJVB 4UTBL 5HVFB 1T3FB 3MOBH 3I3EA 5J1TC 1L9MA 4RFNC 3RQ3A 3VXSA 1IAIL 1LP9F 1NCDH 1TETH 3SDAD 4L3EB 4NQXB 4AIZA 3W0WD 4JRXB 5ISZE 1T4KA 3VD3A 5L7XL 3OAZH 1BZ9A 2IMMA 3BYYA 2ATPA 5DSCB 1NJ9A 2Z8VC 5GGQH 2GUOA 2P24A 3GK8L 1BFSA 4ZFZB 1NUDA 3PWUA 5IKCA 2XNAB 1Y18B 4P57B 2FGWH 4FG6C 4Y4KA 3WHE1 1WZKA 1RUQH 4JFEE 4I48B 5C71A 4F15B 3IDGB 3MA9H 2HH0L 1UWEH 1CTNA 3V5HB 5ICZA 3NFPA 1SVZA 1XF3B 3TO4B 5GS0L 4GFTB 1QHPA 3DRQB 4KKBC 3O3BA 1D7FA 2EO9A 1R3LB 5HHQB 2EDTA 1CFVH 5CEZD 1HSAA 3MO1B 1NAMA 3GHBL 2ZJSL 4NQVB 1T22B 2EYSA 3QDGA 3TV3H 1UENA 4YDLC 4D3CL 1RMFL 4NN5B 1S7WB 3OXRB 4ISVB 4XNYH 4Y1AE 5JQ6H 2DLTA 5ADOH 3DYOA 5I1EH 2Q8BH 3MRHA 4JN2A 4LRNL 1J87A 4KK6D 2J8OA 3LN9A 4LPCA 1U2CA 3O45B 4YBLC 3PL6B 3F58H 1DVFD 3CCHA 1U36A 1DUZA 5C07D 3GBNL 3CU7A 4R4FL 3BPNC 3BD3A 15C8L 1CQYA 1PZ5A 3S4SB 1X7QB 5E6IB 1EK3A 1OM3L 3RJDA 3NIGE 4FFYL 4NQCD 1F11A 5MP6L 5F71A 4PB0L 4XCNA 1Z0MA 3P4OA 4NDMB 5I1GH 3LN4A 3DLQR 5CLTA 4OZHB 5EIVA 2QQQA 1BZQK 5DUML 4KRPC 5C8JA 1NDGA 3F7PC 3UTSD 3RZCC 8FABB 5IMLB 2HJFA 1A6UH 3SQOH 1GHFH 5C3TA 3SDXA 1UB6A 3BIBX 2CXGA 2XY2A 1S3KL 5GISL 5ICXB 5DUPH 5L88L 3VRJB 3U0WH 2GI7A 4OF6A 4F37F 5B3JE 2ZZUT 3RDTD 2CLRA 3GI9H 3QUXC 3WLBA 3BWUC 4P5TA 3I2CH 5HHXH 2ATKB 5FA3B 4BJLA 1U93A 3G5XA 4X6BB 3BW9B 1Z9LA 1G7PB 5JOPD 3CDGB 1Z6JT 2ARWA 4ODBD 5EU3A 1NGPH 2D03H 3I6KA 1QR1A 4L9DA 2RCSL 2XQYG 2P8LB 4OD2B 2EDWA 2VDML 3VXMA 1FV1B 1KENH 3RUGE 1JGEA 4MDJB 1QSZA 1N6UA 1OSZA 2H1PL 4QRPA 4AH2B 1JNNH 3G6JA 5LVEA 5MEND 3WD5H 1CG9A 1W72B 4Z7UF 4GQ9H 3VGHA 1SMOA 1YN6A 4NNXB 4GJTB 4EUPG 4J3XA 2A9ML 2FX7L 3G08A 4PRDA 4KKNA 5CEYA 1W2KT 3Q6GH 4EI5C 1QFWH 1QVOA 1FNEA 3MLSH 5I76A 4IRSB 1JHKH 1EUTA 4ZFGL 4JG1H 4J1UB 4H5SB 3MRGA 2H32B 3U4EB 3FCTA 4N5ED 4Q9RH 1K5NB 4MD4B 5KSAC 1RUMH 3EIFA 3WIHA 4JKPH 5EORL 1KTRL 1WJ3A 4WCYL 3QHZH 3QHFH 4BFBD 1T21B 2BVQA 4IMLB 4DUWA 2DWEA 3LQAC 2V7NA 2OTPA 4ALAH 2XZAL 2FZ3A 4PREB 5F1OB 1RQ5A 3W39A 3LEVL 2G5RA 4XNUL 2EDJA 5CP7B 1NANI 3P30L 1YJDH 1D5ZB 3GJEB 4RISL 4ENEC 3DROA 4PJ8B 2IQ9H 4JRYD 3UTZA 1MLBB 3SDDD 3OKEA 2FO1A 3EJYC 1F58H 5K9JH 1RU9H 4Q9BA 4U1NB 3TH3T 4PJDA 3HNSL 1I3GH 1RZIB 2LQRA 1SEBB 4BSJA 5AZEH 2EXYC 4CJ0A 3U4BH 1B0GB 1BFTA 2DQTH 1T20A 2O5ZH 5JOFA 3NGBC 4AYFA 5HDLA 5I1HL 1VACB 3PE9A 1T5XA 3N1GC 1VGEL 4WW2C 4IM8A 5K9OA 1JNLL 2IPUG 3VI3F 5C0DB 2QTEA 4Y2DB 5K9QG 3ZYIA 5GSVA 1PG7H 2Z4QB 1IM9D 3HI5L 3R0NA 3MRNB 5I75C 1U8JB 1KV3A 2BSTB 3T09A 4BZ1H 4H0HB 3GBLA 1LP9B 4IHOA 1AJ7H 3EGSB 3D3VE 5T1DL 2IPTH 2XG4A 2CIKA 2VN7A 4HIEB 5H2BA 1HHKA 4HG4J 2YD1A 1J8HE 3CX5J 3JVGA 2JB6B 3T3ME 3ZSSA 2H45A 1U91A 2D3VA 5ICYB 3BEWB 4ZOCA 4GO6B 2SEBB 1M4KA 4X98A 4OV5B 4L9LC 1X5FA 4R4ND 1UCTA 1FFPB 2CUHA 1U8KB 2ZNXA 3QCVL 2AXGA 2W91A 4P23A 4K71B 3OKLB 4X80H 1OPGH 2IAMA 3KLHD 4LGSB 4NUGH 4RZCA 1JGUH 4GW5B 1TZHA 4GG6A 4U3CA 5FGBA 2Z35B 3GUTB 4YIQB 4FQQA 3HMXL 2XYCA 3VW3L 2DQGH 2VZVA 1SJVA 2YPLB 3Q1SH 3QIWB 4YHZL 4G8GA 4JREC 1WIUA 4I3RL 1ZANL 3N1FC 2HFEB 1MFEL 1OD7A 3O0RL 1VFBA 1WFOA 4HGWB 1PQZA 2Q8AL 3MLUH 5FUOL 2C3XA 3HAEB 1W72L 5H35A 3D9AH 1QRKA 2WIIA 1U8PA 2PW1B 5CP3H 2BFVH 1QSEA 1C08B 4G8EA 4JANB 4OAWA 5JHLL 5I1CH 1CTOA 2BCKB 4ETYA 3MR9A 4FQIL 2ZOKA 4RCAA 1TQCB 2NMSA 5I18H 5DD0H 3FRUA 3QEUB 3ZTNL 4CBPA 3IJSA 3CPLB 4G9FA 3ULVC 1Q9OB 5F70A 2R4RH 1AY1L 3SKMB 2APVA 4EZMA 5JHDB 3TN0D 1L7TL 3WFHA 2GSIB 4XH2B 1BX2B 1KULA 1LNUA 4OCWH 1CIUA 5FHAH 4PJ5B 1ORSA 4OKDA 3UTQA 4C56E 4LKCA 3WKMH 3VFOB 5DT1L 1I3VA 3H7LA 2ILLA 1W0VB 5AYUL 2QL1A 1KIQB 2W65A 5HGAB 5T3XD 4X5XA 1CBVL 2NYYC 1BVLB 4OKVA 4EDWL 4HWBH 4X0KB 1R3KA 2HG5B 1ZSDB 5FYLL 4NHUA 5DURD 2AERT 1SEQL 5EZJA 4K8RD 1R24B 5HVHB 4YDKH 4Z7VE 3CSPA 2GJ6A 3QT2A 4KKLD 1FFNA 4W6YB 3KYKL 2PXYB 5CJOL 5F96L 4GRMA 4POZD 4R8WH 4JO4L 1LDPL 4M48L 3FQRA 4KK9C 1B2WH 4Y5VA 3MCKA 1K4CA 1CL7H 3CFDB 1T7YA 1JPGA 1X3DA 4NN6B 1CFTA 1EERB 2C26A 5L2KA 1EO7A 3OKYA 2VC2H 5SWZD 4S1SH 4I2XB 5EOCL 4OQTL 2NY6C 1A4KA 4PRHD 5F7DB 5CJXA 5I66A 4S1RH 2WSKA 3DUSA 4Y7MA 5GGTA 2BERA 3ILQC 1OTUD 2VLKB 2Z31A 3RPKA 1UJ3A 4Y5XC 4KJQC 1T80A 1OP9A 4YR6A 3KJ4B 1ITBB 4OFPA