5E56A

Crystal structure of mouse ctla-4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cytotoxic T-lymphocyte protein 4
publication title Crystal structure of mouse CTLA-4
rcsb
source organism Mus musculus
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e56A00
4GBXB 3EJZC 3QPQC 3QQ4B 4OV6F 3VCLB 5FHAH 1CLYL 4Y89A 5GJTH 5GZNC 3VXMA 4M02A 1I1YB 1RVFL 2XWJB 3HG1D 3QEQE 3QXWA 2EE9A 3UYOD 2PTUA 4PLNC 5TQ2H 4ZD3H 2RCSL 4KY1H 3I3BA 1E4KA 3KPOB 5HTSA 2EE3A 4LHUD 5ITBH 3GM0A 5CJXC 5DJZA 1EH9A 5I66A 4NM4L 2Q6WA 3X13B 3C2AH 4HDIA 5D8JL 1OWWA 3VRLE 3ARSA 4RIRB 1GH7A 2NTFB 4M6ML 3WHXB 2BXZA 3UTPD 4XNYH 4TNVK 1JZ5A 1NBYB 1R0AH 4UTBH 3T0BA 1TJGL 1JWSA 4FQIH 5IT2L 4MDIB 4L8CA 1LILA 5IMMB 2H9GA 4LKXB 3VFNA 4PR5B 4ODUB 4PJHF 3B6SA 3D6GA 3VXQB 1SMAA 5DUPL 3QHFL 3O3UN 3QQ3B 2I26N 3G6DH 4B0MM 4PGJA 3MRQA 3EOAA 5SWZA 3C8HA 2DBLH 1BD2E 2BNUB 1Q9LA 4NC1E 4Q6IB 1FZKB 2VZSA 2PW1B 1AQDA 3MX0A 3BSZL 1CDHA 4JHWL 4KDVA 5CILL 2HLFC 1FZOA 5F7DA 3RGVA 1KYOJ 3B5GA 2PXYA 1PSKH 5HYSG 5JDJA 3GSNB 4LQFH 5C0CA 3RX8A 1MNUL 2GK0B 2LTQB 4MCYA 4PJ8D 4P23C 5DRXA 1QP1A 5IWLA 2NX5E 1U8KB 4GKNB 5EUKB 4XP9L 5KSAA 1QO3B 3A6CL 1NGWA 3TA3A 1A9BB 1I7ZB 1X9QA 1NDMA 1KNOA 1T2XA 3V8OA 1FFNA 4XVTH 4LLAA 5T1KD 1NJ9B 3TWCL 4YBLC 1YPZE 4HEME 4LBEA 3LHPH 2EH7H 5IMKA 4M5YH 2AJZB 1W2KT 3V8CA 3MLYH 4BFIB 3K8LA 2ERJC 1HINH 4JFQB 3VFSA 4MLIA 4P59H 2X4TB 4UUJB 4JRYD 1A1NB 3KHOA 3MRNB 3PNWB 2EC9U 3LIZH 4JZNA 4XP4H 4P48A 1PZUB 1G9MH 4X7SL 3U0PB 3HPLA 3D39A 4M3JA 1H8SA 4M8QA 5KS9B 3LPGA 3S37L 1F4WL 2UYLB 3BP5A 3RHWK 1S9VA 3OZ9L 1KELH 5IVOA 5DO2D 1WWWX 4NUJA 5H8DA 3T2OA 5E08L 3P4OB 3EGSA 5D1XD 1A7OL 3DYPA 1NBQA 4KJWD 4R4ND 5DFVD 1ZKAA 2FYYB 3GRWH 4N5UA 5I0DA 1CTOA 4RQQA 5BJTB 5I1AA 1BQHA 1UH3A 1I1AC 5C0FA 3QWOB 3QUZC 1MEXH 5JHDE 1P5VA 2R0KL 5GS1C 2H41A 3VW3L 2AJYH 3T77B 2DWEA 3TN0C 5BVPH 5F7UA 2YPKB 3S3JA 1EIBA 4UILH 1R3LA 1P84K 5FDWA 5EBLB 1EO8H 4G3YH 4KI5F 3BIKB 4PLKD 5C0BD 1EGJH 3RDTC 2DIAA 4RISH 4ZFOL 2VLRB 4N8VB 4FQCL 3W9DA 5IJVB 4XNUL 3ARFB 1CI5A 1MCDA 2FX8L 4MXVF 3NACH 2JCCE 1JPSH 2M2DA 4NT6A 1INEL 2AJSH 3SE3C 3DXAB 5SWSE 3VU2A 3OSKA 3BW9A 3L5XH 3Q5TA 4LHUA 2GTWA 1JWMA 1I85C 3KLSA 3TT3L 3F5WA 3VRLF 2QEJA 1N5YL 2EZ0D 1WBXA 5I19L 3QIWD 1IFHH 4JQIH 3V5DB 4H8WL 3BZ4B 2BVUA 2D7QA 1KTRL 2CQVA 3DWTA 4OD2A 4G8GD 4FQ2H 4NQCB 3K0WA 4I77L 1B3JA 3DO7B 1C12B 5GRVL 2HWZL 2NNAA 5L6YL 4WV1A 1U3YA 3CFEB 4HCRL 3H9SD 1IC5L 3FO0L 4JFED 2C7UA 1CTNA 5E4EB 1WBYB 1OSPH 2P47B 4YC2B 1G9MC 1RULL 3QDMD 4HG4K 3IRZA 4FQXD 4QYOA 1BFVH 2BDNH 3QXDA 3V2AR 2CLVB 1ADQH 1QA9B 4LPYA 2W65A 3IKCB 1L4IA 2X70B 3LKNB 5C07D 3BQUC 5DURD 5GS2D 2F8VA 1MFBH 4CADA 1IGYB 2HJFB 4YEEA 3V4UL 3TZVA 1QFUH 1AHWC 3P0YH 5C0AD 1ZA3B 4KTYA 5GGTL 2QADC 3H3PH 3QUMA 4XBEH 5D96B 4S0TD 5IVXA 1DZBA 1SJVA 4R7NB 4BQCA 5T1KA 4BQ9A 4PP2B 1YPZF 5DD5H 3EO9H 4IOIB 1NSNH 1FGVH 1IQWL 2UV3A 1BQHG 4EN3D 4M93B 5DHYA 4XVJL 4EI5B 4D9RD 1FE8L 1MJ8L 3MV9A 5KVFH 3Q0HA 1HI6B 4HS6B 1OD7A 2X4PA 4GG6E 4CVXB 3BT2H 3S5LA 3HFMH 4XXDA 5IR1B 5C6TH 2J5LB 3EOBA 3PWPA 1UB5A 1P9MC 3SOBH 4DGIL 4DKEL 2QHLA 2PYEB 5T3ZD 4Q9CA 3QHTC 2LVEA 1T0NA 4XBGB 4FXKB 4ZO7A 3LS5L 3OB0K 5C92A 1A7NH 4RGNC 1MLCB 4Q7DA 4WTZA 4PV8A 2DICA 3EO1A 4PJBE 3HB3D 4XT1C 4I9WD 5C0DB 4J2XA 5D1XA 1OGTB 3O4LE 2HG5A 3I9GH 3O4OB 4C83B 2HT4D 2UZIH 3QO0B 1OF2B 1UZ8A 4EI6A 4D94A 1F3JB 5B39B 5JLZB 1OHQA 1PKQE 1D6VH 2H26A 1N0XH 4WFED 4U1HA 1JWUB 5M7QA 1AO7E 1RZFH 4X6EA 1WWAX 5B21A 1WISA 5J0BA 4RSVA 1FFOB 2ICCA 2R2HB 3KPPA 3QJFA 4K07A 5C0BA 3HCVA 2HKFH 1PG7L 3DX9A 3HZVA 5C0ND 1YY8A 3LQZB 1HILB 4UOW1 2Y36H 3TIEA 1OAYH 4XGZB 3SBWA 5IQ9A 2Z8VC 4FQPA 4XC3H 2PO6A 5FFLA 4OM0H 4JM2F 4WCYH 5IBLC 5KG9A 2W91A 2BY3A 3JUYA 3OAZH 3RUGE 5HPMB 2ZKHL 5GGSB 1TQCB 4RMVA 5CS7A 3CXHJ 1X44A 4Z0BH 1IGTA 5JW3H 4Y5VC 2I24N 2BJMH 4JB9H 1XF4A 3SQOL 4YLQT 3OKMA 4ZOAA 1C16B 4LLVA 5I8CB 5IBTL 1JHKL 3RWFB 3U7YL 3VFUB 1QSED 4AG4L 2N7BA 3H7BB 1NGQL 5EWIL 4R4BA 3WKMH 3H9ZA 1OLLA 1YEFL 1NUNB 2CH8A 4NJAH 1FNAA 1NLDL 5FGRA 3MLZL 4G5ZL 1I9RH 2SEBA 4G8FA 5DJ0A 2DIJA 3OF6D 2Y07L 4QY8B 2VZ1A 3C6LD 4K23L 3RI5F 1OQXA 3BKCL 2XKUA 4J23A 1ZANL 3FRPA 4V1DA 1MIML 3WS3B 1X3DA 1M7DB 5FGSA 4JFDE 4OGYH 3QR2A 3QBTB 2F74B 3S5LG 2W38A 3DV6A 2D9QB 3DYOA 4DVRH 1E4WH 1A1MA 1EAJA 1C5BH 3MLXL 3GM8A 3VFVB 2DTML 4Y4KC 3SE8H 5A2LH 3P3YA 4R6UA 5EUOA 1JGLH 3QFDB 4F7MB 4JKPH 5KS9F 2QKIB 3E2HC 5D1QC 4R96A 3HC4L 5JZ7C 2PYFA 5HHVH 1ES0A 2FX7H 4HWUA 3SKMA 4WTZG 4I0PA 5DTFB 5F72S 4RMSA 3D0LA 3N1GC 3V5HB 1H3GA 2NCMA 1LO0L 5BVJB 2I27N 4MD5A 4HFWA 4MNQD 4PJCB 4WW2F 4EN3A 1A6PA 4ERSL 4OCSL 1XGRA 2WQRA 3LDBC 2P49B 5LGJB 5J11C 4L4VB 1J11A 4GG6F 3HMXA 2WM0A 1DQDH 4ISVA 1QFHA 3QIBB 3B9AA 1KYOK 4NHCH 4G8IB 3WE6B 1AIFA 1I3GL 1CICB 3MMEB 1ZHLB 1RZIA 1JPFB 2VITA 2XT1B 4NZRL 3WFBL 3V6OC 2O61A 2HAZA 2OYPA 5I1LA 1KCVL 2Z4QB 5AEAA 4PJBF 2BCKB 4X9GA 1OP3K 5HDBE 3MLVH 3QHZH 1FO0L 1S9KC 3GSUA 5LAXB 5JXAH 1SYVB 4HBCL 4AIZA 1S7WB 1FN4A 3WDHA 1L7TH 3IXAA 4HJ0C 3LRHA 4LCIL 1AXTH 4LSVL 3P77B 4P5TB 2ZCHH 3U46B 5FUOL 5HDOA 3BEVA 4YQXH 1W72B 1BX2B 1PD6A 4PG2A 1URLA 3ZKNC 5DI8B 3QULA 2VDLL 5ALBL 4U6YA 2DWDB 4PJ5D 6CGTA 1V7NL 3INUH 5ALCH 3LVEA 3O2VH 4Y1AD 3U83A 4POYA 5IQ7L 1AI1L 4U7SA 1B2WH 5T3ZL 3MFFB 4LNRB 2VXTH 2WBWB 5CBAB 3ZE2E 2YUZA 5DMKA 4HK0B 3RUGF 1S7RB 5E95B 1LD9B 2X4QA 4WUUA 1UM5H 3SDYH 3J8F7 2YOCA 1J0KA 5JW4M 3PDDA 1SQ2N 2ITDB 3CFKA 3FQNA 3B9VA 4IS6B 3BX7C 4E0RA 4L9DA 2OZ4L 2J8UE 2DQTH 4MCZA 1CD0A 2YEZB 5C0GA 3T1FB 4KFZC 1N5AB 4ZFZA 4I1NB 1NAKH 4PS4H 3DUSA 3IJSB 3WV0A 4X6FB 5I30H 2BMKB 1TVBA 2RFXB 5IW6B 4M1DL 2HRPL 3VH8B 1QLFB 4J4PC 4WW1B 2C3WA 2X4SA 3BMVA 4PRIE 5I1CH 4QXWA 2B1AL 1KCLA 2ZUUA 3FRUA 1GIGL 1ZHKA 3F12B 3GO1L 4LPTA 3ZE0E 4JFHD 2WW8A 5IOPB 2EDKA 3CLFL 4PBWD 1H15A 5FEBA 3SGKC 4S1SL 1HQRB 5E2JA 1YEKL 2JB6B 5I9QC 5AD0B 4TOYL 3U79A 4M7ZB 5I1HH 3IGAB 4EXPX 2OCFD 5KAQF 4HUXB 2ED9A 3OGCA 1IM3B 1L9MA 1M6OB 3QDGD 4V2CB 1BFSA 4JAMA 2Z31B 3FQUB 4YWGL 4MJIA 4PJ9B 4X80L 4DEPC 2JELH 1R3IH 3SGJC 5ID0A 4F2MB 2YUWA 3QI9B 3SCMA 2L7UA 2LV4A 4O2EA 3DMMB 2AJ3B 5EU7C 3VWKA 4LARL 4XAKE 4D9QE 4Z0XA 4HAGA 3WLWD 3U48A 3FQRB 5D9SA 3P73B 1Y0LB 4QTIL 3BGFC 5F88A 1Y6KR 5J1TC 4OZIA 4CN1A 1XT5A 4HIJB 1JZ2A 1IGJB 3DRTB 1ERNA 5IB2A 3UTSB 3ZO0A 4D0BA 4UINH 1YEJL 1IKFH 4O51B 1X6LA 4PJXA 3CZFB 5FO7A 4JDTL 5A2FA 4ZFGL 3BZFA 4NJ9H 3ETBF 1Z9MA 1RMFL 2ICES 2ADFH 3U0TB 5ISZB 4NKDB 4PGBB 1NCBL 3KLHD 4KK5C 4N0CC 5DC9B 1AGFB 3CSYB 5CGTA 4UIMB 1SM3L 2IFGA 4R8WL 3TBTA 4KXZH 3O6KH 3BD4A 1D6EA 3U30C 1RUKH 5EO1A 4Q97A 3B2VH 4U4BA 3DSFL 2K3TA 3V95A 1JI1A 2C26A 4K94L 3UEZA 4IMKC 4AH2A 4LOUC 5I2IA 4OZFA 5I16B 5TE6H 3MA7A 4PJEE 5D7IA 3U7AA 2O5XL 3Q5YA 4L8SB 3D3VD 4NZTH 4ELMA 1ETZA 3GI8L 2J88H 4MNGB 3QEUB 5DJAB 4BKLB 4P57B 5E00A 1Z9SA 3OAUH 5IGXL 4WIQA 4F7PB 1HYSD 1IGCH 4MJ2A 3CFCL 1DQML 1A7RH 3GSWB 3LKRA 5DMIH 2FLBT 5IKCB 2IJ0C 4EDXB 2AP2A 3S8WA 4IOFD 4OV5A 1NCWL 5ANMB 5GGRY 4G6KH 3ECBB 4KK9C 2APWA 4S11A 3CLEL 1MCWW 1WCBA 2HKHL 4OAWB 1RK1B 2E27L 2CDFB 1OB1B 4XTRC 1IEBA 1S7XB 3KLAB 4XAWH 3TO4A 1KCUL 2R9HD 1U2CA 1UEYA 4MYWB 4QNPF 4OSUH 3OWEA 3WXWH 3AAZA 2UY6A 2OP4H 4JN1H 3BVNA 2IBZX 3WYRA 1N8ZA 3GBMH 3IU4L 1CG9A 3UYPA 2R1XB 32C2B 1RI8A 5I6XB 4OT1L 3HUJA 2BVTA 3RI5K 2V2XB 4HPOL 1H0DA 4P2OB 1A7PL 1RJZB 1XGYL 4NQDE 2FD6L 1ONQA 4MHHG 5FECA 3ZE0F 3CVHH 3O2DH 5J3HC 3VXSA 2W9EH 1K3ZA 2HFGH 1T66C 1KJ2B 4ENEC 1J10A 2IPTL 2DMKA 3O9WD 1E6JL 2XQBH 5MENB 4U0QB 2ZNWA 5HPOA 3CXHK 3M17A 4JY5H 3EYOB 5D7JA 4YHLH 2V9QA 1WWBX 3OHXB 3QDGA 4FQHA 1PEZA 1CFSB 5L7XH 2PW2B 1PY9A 2I9TB 3MV8D 1FG9C 4U1KB 3GJEB 1AGEA 5EBGA 5HGHB 2XA8L 2DQDH 5I1JL 3VXUA 1UB6B 4YDKL 4DVBA 5BZWB 1F2QA 3KXFE 4IRSD 1Y18A 5J12C 4MB5A 3KPNA 4DWHA 3PHQB 3MV7D 5FGCB 4PTUA 2NY1D 3UTQA 3FOMB 4UNVA 1W0WA 1R24B 4BFGA 4XZUB 3L6FA 4U0RC 3SPVA 3HZYB 2IADB 3LN5A 1U95B 3TBWB 5I76A 4NQEB 1IGFL 2NXZC 1HCFX 3HE6D 1SJEA 1ZGLA 2G5BB 4PRBA 4ZAKA 3FFCA 3U9UB 3ZKMD 5CD5D 5HVFB 3JWOH 1IM9A 4OCXH 3BKYH 4LVOB 4YBQC 4ZTOH 4UDUB 5FV1L 2UVEA 4IRJB 1EJ6A 4Q58C 4KZEH 3H9HA 4BFEA 3E1F1 1K8IA 2AVGA 1RUPH 2K1MA 3I75A 3MQIA 2IFFL 5C2BL 5I15L 4LSPH 3VXNB 3OJMB 4CJ0A 3FAWA 2BK8A 4OQ1A 3VXRD 4S1DC 1HSAA 4IHOB 2FO4B 5IB3A 2VC2H 4PJEF 4M93C 1G9NC 4JFFB 1R5IA 4XCCL 1FYTA 3BP6A 2XA3A 3QCVL 4WTWA 5TF1H 5DZLA 5F71A 3WIFA 1G7HB 2ESVE 2VLLA 1T04A 3D69B 5LXGH 1MF2L 1DQTA 3D85A 4Y2DC 2NY4B 3TJEH 1JIBA 3CNKA 1QSFD 2BHZA 4KQ3H 1LO4L 1KCSH 1MPAL 5AG8A 5EDXA 3FJTA 4K9EH 2FCBA 2CDEB 1A2YB 3MREA 1HSBA 5DJ6B 5GS0H 5ESAA 5H37H 1A3LH 3LN4B 4KHXH 2HVKA 2DLGA 1A4KA 1PGRB 1EX0A 3ULUD 4U3HA 4HS3B 3CDCA 1T5XA 1FORL 3LEVH 1J8HA 5EN2B 5GSRB 5DYOA 3C5ZB 2H1PH 3TBSA 4OCWH 3L5WA 3SO3B 1DP0A 2XTJD 1DDHB 3HS0A 2MQ3A 1U8QA 1QRNE 4D9LH 5EZIL 3OG4B 1DN0B 2R0ZL 3NPSC 2H3NA 3MLPA 5D7LA 2GJZA 2A6DB 1FLRH 4JPKH 5DHVA 4LEXL 4W4NA 2XV6B 4FTVB 1CIDA 2HRLA 2DLFL 1T6WA 3TYGH 1T3FA 2A6KA 2IPUG 3AXLA 3RWCB 4WI3A 2YPLE 4FNLL 4LGRB 5FAAA 1L7IH 2B4CL 4RFOL 5H35A 3GIZL 2VIRB 4I5BB 4MHHI 4EBQH 2Y7QB 3O9WA 3PP4H 2VYRE 2DQUL 1JFQH 2W60B 1RZGA 1VKXB 3UCRA 3VGAB 5IG7B 5FUCC 2DDQL 4ZQKB 2F5AL 4WEMB 1N7MH 2DQEL 3UTTD 2IAMD 4PY7B 1RUAH 3L3JB 2JB5L 4APQC 4C56B 3MJ9H 4P46C 5B8CB 2F54B 5IHLB 2CDGA 1NMBH 2E9BA 3FT2B 4NO2A 4IRSA 1BPVA 2YWYA 3EJZD 3QPQD 3WD5L 4DKFL 3VRJA 3MV7A 5GZND 4P2QD 3GSOA 1T2JA 1MHPH 3MRIA 4LSQL 2ZSVA 4L1DA 4RFNB 4EKXA 4AEFA 5SX4H 1KPUB 1S9WA 3TYFA 3UJIL 3KJ4B 1NC4D 3IJHB 2Y4SA 3UO1L 3K8KA 2XN9D 2ICWB 2O5YH 3EFDH 4K9EC 3BWUC 3D18A 3OJ2C 2C4FU 1SBBA 3TBVA 3TCLB 5GS0C 3KYMA 5T3XH 2IBZY 4I0KA 4P49A 4X7TA 1QVOA 5ACMA 5C0RL 4G6ML 5JIKA 3O3EA 5F3HA 1UQSA 4J1UA 1BD2B 4Z7NE 3V52H 1YY9C 4LCYB 2P1YA 3T8XA 1T89A 1ZAGA 3OXRB 3I84A 1T2QL 3RNQA 3WIHH 4XNQA 5I1IH 2IGFL 1MJ7H 1AQKH 4U6XB 4HMEA 4MSWA 5D7KD 1A14H 1U3HC 1EHLL 2KQNA 4NWTH 1SBSL 1QPXA 2X4OA 3GKWH 2Z0BA 5SWQB 4H20H 4HIEB 2DQJL 3H42H 1IZKA 2EDDA 4PB9L 4CVZB 3O2WL 4L3EE 5BV7L 2Y23A 1KIRA 5F9AC 2HLFD 2FEEI 1K85A 4LPVA 5HJ3A 4IRZL 3LEYL 5EC1A 1CICC 3MACH 2NY0C 2EDLA 3O3DB 1NBVL 1QBAA 4JZJB 3ELAT 5GPRA 4P23D 1QSFA 3GFUA 3CJJA 3UAJC 1INQA 1IAIH 1ZHNA 4JR9H 5F1NB 1I9JL 2AJXH 2YD5A 3D0VA 4PRHB 2VDOL 4FXGA 3V6FB 2B1HL 4HHAA 5GGVH 3K2MC 4U2ZA 4XPTL 3UPRA 3TFKD 2OS7A 4YHYB 2DM4A 4OLWH 3IDUA 2VLJA 3DRQA 3RZCA 2X4NB 4QHNB 4HUVB 2APBA 4NRZB 4P5TC 3WIIH 1X5ZA 1LEIB 1FZJA 4LCWB 2IMMA 3ARXA 1RUQL 4PB0H 3G04B 3ZTNL 5LVEA 4DAGL 2R2BB 3A6BL 4U1LB 5F7KC 1JBJA 3VA2C 1NAMA 1TVHA 3WNMA 1D5XA 1D5ZA 2R29H 4DQOH 4U7KA 3QAZB 5C8JB 2FDBP 1M4KA 3TO2B 5IMLA 5JPNB 3Q3GA 3GMMA 2J6EA 1NMCB 4QTHA 5FCUH 3O6MH 2P8PA 4EVNA 4LPUA 4U2YA 2BSTA 5DEZA 1OCWH 5IFJB 4ONGH 2RAMA 1YECH 1EBAA 1F4XH 4N1EA 4TULL 5I73B 1RU9H 1FNFA 4QRRB 4PY8I 4UBDC 2AXGA 4BSWA 3EBAA 2WBJB 2D7TL 1QBBA 2BFVH 4PJIE 1CFTB 3DTXA 4OFDA 3ULUL 4GRLA 5T1LD 3T08A 3QUZD 5EOQH 1R5WB 1OAUH 3IDXH 5HHOB 2WBKA 4TQEL 3X3GH 2JCCB 2IG2H 3MRLA 4HH9A 5FK9B 3VFGL 4OLZH 2DQHL 3TN0D 4G43B 1JF1B 3I2CH 3G5VA 3UYRL 4HC1L 1RV6X 4H0GA 5SWSB 4QRQB 5E9DE 4CN6A 4MD0A 5DSCB 1L9NA 3RDTD 4ZFOB 2WMPA 4HGKC 1MHHA 4FFZL 3H0TA 3WEXB 4IM8A 4KXZI 4ZPVB 2YSSA 2CUMA 3C60A 4KVCH 1NBZA 5KVGL 3CH8A 2F53D 3M07A 4PJDB 1PLGL 5EB9A 4Z78A 1XEDA 2X1WL 4BH8B 2Q8BL 4KRLB 2A74B 1NFKA 3PGFH 4KC3B 5CJXA 3KDMB 2MKWA 2Z31C 2ZCLH 3WFHB 3FQWA 4P9ML 3IU3A 5HI4C 3VFRB 4HUWB 5B4MC 3PJSB 4PTTA 4JPWL 1YC8A 2HP4A 3HE7A 4U1NB 3QI9C 5KZCB 5IBUG 1FP5A 1XIWA 4IBLT 5D6CA 3BRGC 3STZB 1JNHB 4D8PB 1OVZA 4E41B 3WKNA 5JOPD 2XZQH 3QZWB 4P3CH 4PGDA 2IAND 5I1DB 1PZ5B 2QQKH 4X7FC 4YDJA 5DEFA 4BQ8A 3KPSE 1QOKA 5H37G 1U8IB 1MVFA 4KMTL 4MNHB 2AKRA 1VGEL 1MCQA 2O5ZH 3QDAA 3NIFF 2RHEA 1DFBL 1U6AH 4NPYB 3S34L 1T1XB 3GMNB 5SWZE 4WY7H 4YDVA 3N1FC 3BQUD 3EDFA 3RPKA 3AY4A 5FYLE 3G9AB 4Z95H 1K6QL 5I75B 4Q0XL 1S5HA 1YN7A 3Q6GL 3W2DH 1YYLH 2DLEA 4QRSB 4QXTA 5C0CE 2IQAA 3P2TA 3PIQA 43C9A 2QADD 3BXNA 1UWGH 2ICWJ 1Y6MR 1INDL 3BGAA 3FOLB 2NY7L 3I50H 4P2CG 4UV7H 4P4KB 3RA7L 2FBJH 4M00A 2OR8A 4Z8FL 5CZXC 3L3HB 3QCTH 2FHCA 1F4YH 4L8SC 4HX1B 3BPNB 3LH2H 5CHNA 1JV5A 5IEHB 4KUZH 2WIIB 1UZ6F 3VXOA 4QF1A 1XFPA 5FM8A 5J6HB 1EEUA 3X11A 2VXVH 1VFAA 4Y16C 4D0DA 2P5ED 3T2PA 2IC2A 2A83B 3SDDB 4HT1H 5GSVA 4LLYB 2FZ3A 2C5DC 4PJ8B 3MLTB 3HMWH 3AU1A 1X5JA 2ATKA 3MXWH 3D39E 3KNBB 5E2UH 1YN6B 1AO7B 4RGND 5HYJA 5FKAB 5JHLH 1LE9B 1UH2A 2WV3A 2VH5L 1A6VL 1CGSH 1S8DB 1IL1B 3RGHA 3ARPA 1EO7A 2JTDA 1S9YB 5D2NA 5KVEL 2MCPL 3E3QC 5FO9A 3FT4B 4M43L 1I1AA 3DHMA 5DJDA 4L9LA 3QDJD 1TJHH 1FH5L 3AB0B 4ZYKB 4X9BA 3BI9X 3U1SH 5C9JA 1P4LB 4N1HB 3ZTJH 1SJHB 5FHAL 4LLUB 5DK0A 3C8KA 5GJTL 1JN6B 3WN5C 4FMKA 1YMHA 2ZWLT 1H5BB 5TDNB 2ITCB 4DUVA 4FP8H 3REVA 3W0WD 1MAJA 5BRZA 5TQ2L 2GY7B 2G60L 3I85A 3AREC 1VADB 3MOBH 4KY1L 4TUOA 2G5RA 3ARUA 1F3DH 3A67H 5AWNH 2BVPB 2D3VA 5ITBL 5GZOC 5IBLD 3F58H 4RDQG 3NIDE 3WL9A 3C2AL 4M7KH 5DJCA 2P43B 3LKPA 5DMGC 1MJUH 3CUPA 4XNYL 1CIUA 1I7RB 4X0KA 1R0AL 4UTBL 3MLSH 4FQIL 5MP6H 7CGTA 2DYPD 4JKWA 4B41A 1YJDH 1BGXH 5D72H 4C4KO 1R3KB 4XNZB 4LVHB 2V9TA 3O6FB 3CZJA 4M5ZL 1I8MB 5K9JH 4HJGB 5SV3A 2AXHA 5D1ZA 5C09A 4DTGH 5FB8B 5MEOA 4R0LA 4HWNA 4NDMA 4NNYA 3G6DL 3QFJD 5C0JA 5GRZA 3O41A 5JOFB 2DBLL 2R1YA 1QQDA 4K3HA 4MAUH 4JQXC 5FM4A 3GIVB 4ODVH 4RNRA 4UNUA 5EU6A 1UJ3A 3MV01 3TNNB 1G7MB 2W07A 3CX2A 4LU5H 5GGVY 5B3JF 2FR4A 2EO1A 3PF2A 1PSKL 2LU3A 4LQFL 3U4BH 3GMOA 4U1IA 2UZXB 2VZOA 3MR9B 5EORL 2XZCH 2MTPA 1R3JB 1HKFA 3O8XA 4X8JA 2UUDH 3QNXA 4F33A 4Z77A 4LVOC 4ZFFA 4RX4A 2FH6A 5DEGA 2NY5H 4LLMA 3S35X 1AR1C 5ELIA 1DEEB 4XVTL 4Y4KD 1AHWA 2GJJA 3JV0A 3QIWB 4MD4A 5IB5A 1ZE3C 4HWZA 3DX7B 5HHPB 3T3MF 3SDCC 5D1QD 3MRCA 1OP5K 4G8GB 2B2XH 4Y0GA 2F9BT 5ID1A 3O6LL 3LHPL 1UM6H 2EH7L 3JUZA 2CK2A 5JZ7D 3MUGA 3B9KC 1FIEA 3BDYH 2GSGA 2ORBH 3WUWA 3MLYL 4QOKD 2FHBA 1HINL 4P59L 2VN4A 1GOGA 5ENWA 5IVXE 2VQ1B 3O3BB 3QXAA 4WWKC 3MRRB 4I4WB 4H25B 3H9SB 2L0DA 1ZEAH 5DXWA 4JFEB 4YHZH 3ZKXB 1I8LC 1XCQB 1TPXB 3LIZL 4XP4L 5DRNB 4CU7A 3QDMB 4NQXB 5E8EA 5BXFA 5HYQA 1DR9A 5F8QC 4FQXB 4ZUTA 1BREA 2XKNB 3OKLB 5F7LB 4DOHB 4PJGB 3MV9E 3RKDC 1MCOH 5MI0B 3D87B 4ZXBA 1ORQB 5DURB 1XGPB 1P9MA 1KELL 4UDTA 3GSQB 5CSGA 4Z7OE 4E9LA 3PWPE 1FNLA 4HKXA 1MY7A 5D8JH 3GRWL 1HKLH 4Z7UB 5C0AB 2BX5A 2VN7A 1MOEA 1YJDC 2H6PA 4NM8H 1FO0B 1MEXL 3DVNB 3RWDA 5IT2H 2R0WH 3W5MA 5TGBA 2DD8H 1KB5H 3KPMA 2YRZA 2AJYL 1T21B 4FQJL 5BVPL 3SO3C 2X89D 5B3NA 1WEJL 3EYFB 4HV8A 4UILL 5DUPH 4HJ0D 1ITCA 2AV1B 3RBSA 3EYVB 1EO8L 1FNHA 3VFOA 4G3YL 5FYKE 5INCB 1U3JA 2GT9A 3ZKND 4RISL 5D5MB 1DLFH 4Z76B 3NACL 1JPSL 2RJMA 3EZJB 1CCZA 1JVKA 2AJSL 3FB5A 4JLRB 5IV2A 3NZ8A 5JO5A 5LKNA 1HH9A 2J8UB 2FBOJ 5DVMA 3L5XL 3DURA 1MQ8A 4G9FA 3E6HA 1XR9A 2NY5C 3ILPB 4JY6A 1FL6A 1UADC 4KI5C 4OQTA 4WFHD 3PQYD 5DJXB 1IFHL 4JQIL 3VGAC 4ZDHB 2AV7A 2HLAB 4PRIB 2H2SC 2R39A 4FA8A 3BPCB 4Y5VA 4M7LH 4ZG1A 4NN6B 5E24E 5CEXA 3KPTA 3L7FA 3MGOB 1A1OA 1DUZB 4XH2B 3BP4B 4O02H 3X3FH 1WC7A 4J4PD 3FT3A 4QHKJ 1WGOA 5IHZA 4OCLC 4NFBA 1IAKB 4RFNC 3ZDXF 1IAII 2CSPA 1OGAA 1BFVL 2BDNL 2MHAA 5E8NA 2WLYA 1ADQL 3RVVC 1I1FB 3AROA 3GSXB 3RX7A 2FL5B 1EK3A 3DNKA 3CFBA 4PLOB 4X7SH 3RWEB 1DUYB 1MFBL 4JFYB 1MHCB 4CKVX 5D6DC 1BJ1H 1NDGB 5JR1H 1YEDB 4V1DE 1QFUL 5TQ0H 3P0YL 3LKQA 5I71C 3ESUF 2PTTA 3C5SA 3H3PL 4NC1C 4XBEL 4C59B 4R26H 4L3CA 3ARBA 3ZKQD 4Y4KA 6FABH 4HZLA 2GCYB 1QSEB 3FN3A 3AGVA 5D1QA 5DD5L 2BVOB 2GAZA 2ADJA 2R0KH 3EO9L 2WINB 4JREC 2GITB 1NSNL 5EUOE 1FGVL 2G9HB 4NHUA 2P7TB 1WBZA 1H3UA 2Z91A 1AP2A 4QHLA 5FYKU 5IVZA 2OJEB 2GJ6D 3QG6A 5KVFL 3C5JA 3HMXL 3KPLB 1TETH 1N2RA 3BT2L 5MEPA 2Q7NA 3C6LB 3HFML 5HXMA 5C6TL 5E2VH 3DIFB 4KV5E 2ENSA 4QRPD 3SOBL 5DJYA 3L3DB 1N4XH 3SGEH 4HXBH 4JN2A 5E8DH 4JRXA 1OLZA 1PBYA 1I9EA 2JJSA 1A6TA 1JK8A 5HGGS 1A7NL 4KK5D 4N0CD 4U1MB 2AW2A 1UVQB 1S7TB 4RGMB 4U3CA 5E8PB 1RJLB 3MJ6A 2DRUA 2D4DA 4EUPA 3I9GL 1JHTB 1OP9A 1WLHA 3WSQH 2XICA 5I19H 2UZIL 5FA4B 3K7UA 3ZL4H 2W0FA 1ZHBA 2YC1A 3NAAL 4X99B 3GMQB 2DQFA 3M8OH 5A16A 4LCCA 2V2TB 2NW2B 4I77H 1N6VA 3MRPA 1J5OH 1D6VL 4LOUD 1N0XL 2A73A 3LY6A 1RZFL 2HWZH 2ARWA 4Y19A 2X89A 3GGWA 4I3GA 1NGYB 1KXQE 4WI7A 4MNQB 1CT8B 1SEBB 1CD1B 1KUMA 5TFSH 1MUJB 2HKFL 5F1SA 1G6RA 1MAMH 3KWWA 2Y36L 4LVEA 4NKOA 1OAYL 3MLRL 3SJVA 3X12B 1IVLA 4XC3L 1D5BA 4U1JB 5EH1A 5DS8B 1RURH 1ZVSB 4OM0L 1KPRA 4WCYL 3WNLA 1H3VA 4MB4A 3ULVE 2A1WH 3BO8A 4ZUSA 5DVNA 2VDNH 4KK9D 3BISA 3RL1B 3P9MA 2BNQA 3D9AH 1TCRA 4Z0BL 5JW3L 2V17H 2WBJC 3LS4H 3MCKA 1G7QA 5C70A 3TGXA 1F6AB 4XTRD 4LLWA 2FO1A 2XZAH 3VWJC 5CIPB 5KJRH 4ZS6C 4WUUE 3DECA 4NQDB 3WKML 3O11B 1FV1B 4J7RA 3QQNA 4DN3H 2DKMA 4HIHB 1JF6A 3S7GA 3NCYS 1A47A 1I9RL 1P7QD 3WNOA 4H5SA 3QNYB 4GBXA 1X5AA 2Z93B 4PGZA 4PJ5B 3N50A 3VCLA 3ZKSD 1JNNH 1V7MH 4C58B 1NPUA 1I1YA 1U92B 2XWJA 4P2RE 4Y1AB 1EEQA 5F9JB 2FIRT 5J3HD 4CL7A 4GRWE 2A9MH 3BEWB 1T66D 1U41A 1FLTX 3PXHA 4OGYL 4ENED 3SE4A 4MXWH 3NN8B 1UM4H 1U8PB 4DVRL 1J1OH 1BZ7B 1E4WL 1U93B 4TSCH 4HULB 1C5BL 3X13A 1WUNT 1I4FB 4RIRA 3SE8L 4F7TB 2NTFA 1I8IB 4H8WC 2EICA 4L8BB 1JGLL 4HGMA 4JKPL 2WWMC 2KPNA 4GXUN 1NBYA 4OFYA 3MA9L 4CMMB 2AEWA 4NN7B 3SGJA 4MDIA 5HHVL 2FX7L 4JG0L 4MJIE 1H8OA 5IMMA 4LKXA 1QTYT 5AAWA 4PR5A 4ODUA 3STLB 3VXQA 2E7LA 5AZEH 5EUOF 3VFMB 4KQ4H 1DLHB 3RPIA 3QQ3A 3FO1B 5IVNA 3S4SB 3TESA 3VXTB 4JM2A 4YNYB 2BNUA 1K2DB 4Q6IA 1FZKA 5C2UB 1A3RH 2PW1A 3BMWA 4OZIE 1DQDL 3EKCA 3NCEB 4NHCL 1Q1JH 1UACH 1QFOA 3HHRB 2NXZD 4PJXE 3MJ7A 3KPRD 5DR5H 5I75C 3G5ZB 1KEGL 1I7UB 4PJAB 3OKEB 1U8KA 4GKNA 5EUKA 1P7HL 1PJ9A 1VPOH 4WW2C 4YBQD 3TVMC 3GJFB 1QO3A 1K4DA 1A9BA 1I7ZA 1KTLB 2ATPB 3MLVL 2H45A 3QHZL 4KJYB 2ILLA 4RMQA 3RWIB 5JXAL 4P4KC 1JYVA 5MHSD 3UPCA 1CDJA 1NJ9A 4S1DD 1L7TL 5A2JH 5FYJE 1AXTL 2R56L 4AENB 1ACZA 1SY6A 2AJZA 2ZCHL 4IMKA 3LOWA 4YQXL 4BFIA 5K9QG 4JFQA 4MQXD 2ADIB 3VGBA 4TTDC 4R3SA 2X4TA 4UUJA 3OR7B 1CN4A 1A1NA 3R8QA 4K71B 1TXKA 4WHDA 3INUL 5ESVB 2ZUWA 3MRNA 5ALCL 4KKAC 3O2VL 2DS4A 5CEZE 2APTA 4ELME 1CVRA 3SDDC 1MWAB 4Y2DD 3F7RA 3U0PA 2ZUQB 3ZHLA 2VXTL 4Q6YA 5KS9A 2UYLA 4IEFB 3RTQC 1ACYL 1BEYH 5I1KL 3CDGB 1NCCH 3T1WA 1HHJB 1KBGH 1UM5L 3SDYL 5ILTH 2CK0H 5A3IC 3IFLH 4MQTB 2FYYA 4F15B 1QRNB 4OUUB 5MERB 2DQTL 1G7PB 5BJTA 1GAFH 2DI8A 3WHE1 3QWOA 1NAKL 5I30L 3S6CA 3TNMA 1KT2B 1F5WA 4BZ2H 1MCIA 3D3VB 2YPKA 5E1AA 2NZIA 5I1CL 1VGKB 1EEYB 5EBLA 1S9XB 1H5BC 2EKSB 3DUUA 1ZLSH 2VLRA 4N8VA 4OF5A 5I8OH 5IJVA 1QZ1A 2FNBA 3ARFA 2OR7A 4KKCC 4X6DF 1UFUA 2VKWA 3NOIA 3IJYB 5HHNB 5I1HL 3HUJE 2P42B 3DXAA 2JJWA 2RR3A 3G6JF 4HWEH 1QEWB 3BH9B 4R97B 3HAEH 2BVYA 2IALB 4NZRH 3VXSE 3P11H 4KJWC 4R4NC 5IESH 4ODXB 4Z7QF 1NEZG 4G9DB 2CJUH 2EYTB 5F3BB 3MBXH 2OX5A 2ZOKB 1TZIB 1H8NA 4NCDA 4JDZB 4Y8DC 4RRPG 4LVHC 3O6FC 1Q9WB 4GH7B 3UTZB 3V5DA 4ONHB 2Q8AH 4YXLL 2HVJB 4NQCA 2XQYK 5FYJU 3MRHB 3DO7A 4LSDA 4APQD 4P46D 3MO1B 4GS7B 2ED7A 1MCPH 4J3OC 3MXVH 3QG7H 5ALBH 3VXUE 2OTWB 3V4VH 3CMGA 1V7NH 1WBYA 1YNKL 4S2SB 2EEBA 1AD0B 1UYWH 4URTB 5LJYH 4KU1A 2CKBH 1WWCA 2CLVA 2ADFL 5IHBA 1QA9A 1Z3GH 3IKCA 3LKNA 2X70A 1A6AB 1IGYA 5FM5O 3NA9H 5GS0D 1FL3A 3BYYA 3QIUA 3O6KL 5F6IB 3FFCE 3CK0H 1ZA3A 1RUKL 1IKNA 1A6ZB 3B2VL 1YY9D 3DX6B 1KLGB 2J3SA 2EDYA 3MV8B 1KOAA 1II4E 4R7NA 4GW4B 4MJ4A 4PP2A 4G7VH 3SE9L 3KVQA 1QKZL 4NZTL 1U3HD 4IIQB 2J88L 2D0FA 4IOIA 3RQ3A 4ETQB 1RIUH 3ZKXC 3OAUL 4EI5A 1IGCL 5JXEA 3QXTA 2Y5TB 4MQ7B 4QCIB 4NZUH 1HI6A 4HS6A 5DMIL 3MOQA 5D7IF 2XYCA 4CVXA 4H1LH 4Y4HD 3C8DA 2BSRB 1FYTE 3CLFH 4Y5YB 4ELMF 5IR1A 4IMLB 5MI0C 4S1SH 3JV4B 3JZ7A 3TT1H 1CICD 3HE6B 2NY0D 2PYEA 4G6KL 3L3KB 3GDBA 3S97C 4N8VG 3UAJD 1KXVC 3NBNA 4XBGA 2VABB 4LHQB 3MUJA 2V5YA 2M26A 1MLCA 4TUJB 4X80H 5C0DA 4OGAC 4XCNB 4XAWL 1OGTA 1JYNA 4PD4J 4OSUL 4MAYC 1XGTA 2OP4L 4JN1L 3QO0A 5HYSB 3VXRB 2FIKB 3GBML 1F3JA 2WLZA 5B39A 4HUMB 3LAFA 4P5TD 3B83A 3SDAB 1JWUA 5L0QB 3GB7B 1A4JB 1J8HE 3FN0H 4I18B 1OPGH 4GKOA 1FFOA 1T83C 2R2HA 4X98B 4OLEA 3QUKA 3CVHL 3O2DL 3QWRA 4NP4H 2W9EL 3LQZA 1CXEA 1EFXD 1HILA 4M9PA 2HFGL 1FVDB 4JVPA 3VRIB 3VI4E 1AGDB 2XQBL 5D7LE 3NCJH 1MAKA 5T3XD 5HVWA 1LWRA 4X4YA 5HPMA 4DGYH 4JY5L 4P2YA 4YHLL 1OWRM 5GGSA 4R8WH 1CFQB 3ARDB 4PJFB 1IEAB 3DSFH 5I8CA 4K94H 4IDLA 3RWFA 3VFUA 2ZJSH 5L2KE 1JGDB 2D9CA 3H7BA 4PJAF 5KSUB 2GSIA 2V5RA 2XG5A 2O5XH 2CGRH 3SGEI 2XTJB 4LRNL 1LP9B 1NEUA 2F15A 2X1QA 2IEPA 3MRJB 2XNAB 4UQ3B 2Z9TA 4OLVH 1Z9LA 3T0XA 2NYYC 3KJ6H 5C0NC 4QY8A 3JWDL 4YDLB 2X9YA 3I6LE 5IROA 5JQ6H 1EDQA 4TVSa 5DJZB 5CP7B 4QO1A 2NLJA 4M7JH 1KENH 3WS3A 2EE2A 1JGVL 5KAQG 3S88H 1ZVHA 3JWOL 1NFDB 5DGQA 1M7DA 5DA0B 2P24B 2DLIA 4OCXL 4YO0B 3BKYL 5EO9B 1L0YA 3BIBX 4XVUC 2F74A 5CP3A 3CLEH 4ZTOL 2Z31D 3KPSB 2DBJA 3VFTB 5HI4D 4KZEL 5B4MD 4FFVC 1FG2B 1FJ1B 3VFVA 1RUPL 3ARGC 3QFDA 1KCUH 4F7MA 2QKIA 3DHJA 1JRHH 5SWZB 1FSKB 5FIEA 3UTTB 2QHRH 2IAMB 2ZUTA 1HXYA 5LWYL 2VC2L 4NSKB 5DTFA 3IU4H 1IILE 1GGBH 3V5HA 5EFIB 5BVJA 3HC3H 5JIIA 5TF1L 3RGVB 2UZYB 4OGXH 3RP1A 3V6BR 3MROB 4PJCA 5IIEB 5IMOB 4OT1H 3U7WH 1B9ZA 2C3VB 5B39G 1LK3H 5LXGL 1A7PH 4NUGH 4M8VA 4JJHA 2NR6C 4L4VA 3TJEL 1NC4B 1ZXQA 3PWJB 2AEPH 3QIBA 4FG6C 2YKLH 4KQ3L 2VLKA 1ORSB 2XN9B 2DJUA 2ZG3A 3WE6A 4K9EL 2CMRH 4JO1H 4LRIC 3MMEA 4MA3B 1E6JH 4E42B 5BW7C 1ZHLA 3R1GH 1FFNB 1JPFA 5GS0L 5MEQB 1A3LL 4KHXL 5B38G 4HD9A 1T7ZA 2Z4QA 5HGAB 3HTLX 2BCKA 1WV7T 4HWBA 4K94C 4Z6AT 1MCRA 2ICEB 4IJ3C 1T4KB 5LAXA 1SYVA 4OCWL 1BVKB 5CZXD 1MI5A 3TH2T 1S7WA 4ZSOB 1NAML 1J86A 2VQUA 3T65A 1FAIH 1U8HB 3P77A 2VLJE 4P5TA 3NFNB 3U46A 1W72A 3IKKA 2JJTC 4D9LL 3OGOE 5DI8A 2P5WD 2J6EL 2DWDA 2CD0A 1FLRL 4JPKL 1QD0A 4GAJH 1QLEH 4Y16D 4I0CC 1U91B 3TYGL 1I8KA 3WO4B 1IGFH 5EG6C 5FO8B 1MREH 1EO5A 4AMKH 1L7IL 4MS8C 3VI4F 4P23B 4H26B 4EBQL 3MFFA 4LNRA 5CBAA 1IGIH 3PP4L 5GJSL 2OK0L 1JFQL 3NTCH 4HK0A 2CRYA 1S7RA 3Q5OA 4K7PH 2CRZA 2ITDA 1ZLUH 2OL3H 4IS6A 5BS0A 1E6OH 1N7ML 3AMKA 3T4AA 3OKKB 5KOMC 4LSUH 2YEZA 3T1FA 5FCSH 1RUAL 3BKJH 2OTUB 4ZUUB 4XXCA 1N5AA 3MJ9L 1WZ1H 1DVFA 4PYHA 4GG8B 2BERA 3LN9A 3IJSA 2ERJB 4X6FA 2BMKA 1NMBL 2RFXA 5IW6A 2MWCA 2XOTA 1HOCB 1V3MA 3VH8A 4FRWA 1QLFA 1P53A 1MRCH 4X6CE 1U9KA 1MHPL 5E6IC 1D7FA 4G7YH 1TTFA 4K2UH 3BW9B 3F12A 3ARED 5IOPA 2O5YL 3EFDL 5JW4Q 1CXKA 1HQRA 1OP5H 5CJOH 5GZOD 2JB6A 3F5WB 5DZNA 4ZUVB 4PRPD 5JW5B 3IGAA 1WBXB 1FGNL 4HUXA 4LVNB 1UWXH 5DMGD 4N90D 5F9OL 1M6OA 2MSPA 3V52L 4WO4C 3FQUA 1HK6A 4PJ9A 3NPZB 1XH3B 5F9WC 4QRTB 1LE5B 3WIHL 4WV1B 1UXSB 1JJUA 1MJ7L 5T1LB 3QUZB 3DLQR 4YH6A 1AQKL 4F2MA 3QI9A 1TQBC 1FORH 1G7IA 3DMMA 2AJ3A 1A14L 4BH7B 3ARZA 2BSSB 1I3UA 3CAFA 1IBGH 4HLZG 1KEMH 3FQRA 4LIQE 3P73A 4NWTL 4A2LA 1GGYA 1Y0LA 3V0WH 3QA3A 1O5DT 4H20L 2D7OA 3H42L 3L9RB 4HIJA 3RDTB 1IGJA 3DRTA 2HN7B 1BP3B 3LPFA 3LQAH 1TTGA 3UTSA 4G42A 4OBRA 3QUXA 1CDBA 2R0ZH 4QEGA 4O51A 1J8KA 2P44B 3F62A 5KVMC 3CZFA 1VB9A 3EIFA 1XCTA 2JK5B 3F7VB 4L4TD 5F7EH 3V6ZB 4AM0B 1FVEB 2F53B 1FYHB 5ISZA 3U0TA 1IAIL 3OBAA 4JR9L 4YPGB 1I3RA 1CXHA 1M7XA 2AJXL 3ARYA 4NKDA 4RFOH 1ZT1B 4PGBA 3CGTA 4A6YH 1AGFA 3CSYA 3FO9B 2DQUH 4UIMA 5INDB 1AR1D 3BWAB 4UNTA 5GGVL 2B8OT 2ZCKH 5JOEA 4OLWL 5FGBC 3SDCD 3SKUD 4X4MA 3B9KD 3MV9B 4WFGD 3WIIL 2AK4D 2IANB 1A8JH 2HA1A 4NKIH 1Q0YL 4PB0L 4RCAA 2BNRD 2VDMH 4TVPL 4WWKD 2QQNH 2C4XA 4PJFF 3DPBA 4MNGA 3QEUA 3Q1SH 3PWPB 2R29L 4BKLA 4P57A 4DQOL 3MBEC 3WD5H 2F19H 5KSBB 3P9WB 5HHME 4O00A 5ADOH 4F7PA 1VDGA 3VJ6A 1E4JA 5FCUL 3RKDD 4MZ3A 1E27B 1M05B 5IKCA 5HDLA 1OCWL 4TVPE 3BQUB 4ONGL 2VL4A 1BVLB 1T0MA 4Y8AA 1F4XL 1ZLWK 3EO1B 1UKQA 1Y6NR 4GOSA 3RY5A 5ANMA 3ECBA 3X14B 2BFVL 4F15C 1RK1A 4JDVB 1OL0A 2EIDA 2IPKA 2CDFA 3DVIA 4RGOH 1OB1A 4QHMB 5ETUB 5EOQL 1S7XA 3KLAA 4LGPB 4PD4K 3FTGB 4GMTH 1OAUL 3IDXL 3WFCH 5HYJE 2GK2A 1F2XK 2IG2L 1VFMA 2IGFH 1ZWIB 1I7TA 1XF3A 4OLZL 3KAAA 4HXAH 3I2CL 4Z9KB 3SDXB 4HK3J 4JG1H 5D2NE 1D9KA 1EHAA 3GJFK 1GRWA 1EHLH 3UBXG 4FZEH 4U05A 3HI6H 5JUEH 1YEHH 3LQAC 2PO6B 32C2A 3VE0A 4XMKL 4JGMA 5KG9B 5BV7H 1ED3B 2V2XA 4P2OA 4UOW0 3RWGB 1ODAA 1RJZA 2P5EB 4JY4B 1AFVH 4WENB 5DQJB 4QWWC 2AABH 2W0KA 2B4CC 1WT5A 2NZ9C 1KJ2A 3MNZB 5BRZE 1KGCD 1XF4B 1T7XA 2ZCLL 4GXVH 5MENA 1F97A 4KI5D 1I9JH 5EBWB 4RGNB 4BK4A 1TFHA 1PG7W 3EYOA 2H2SD 4R4BB 3OHXA 1GOFA 3QEQD 4FQQB 3G5XB 1TTUA 4ZOEA 2I9TA 3R8BB 2BHYA 4YHNB 4JO4H 4P3CL 4U1KA 2SEBB 3GJEA 5HGHA 3QDJB 2QQKL 5DJ0B 4FMFA 5CKGA 2PF6A 5GRYA 4NC0B 1UB6A 4FQ1H 5BZWA 1YQVL 4GS7C 2O5ZL 3LKOB 3A6BH 5C09E 3PHQA 4V1DB 3FOMA 4JO2H 1U6AL 3HR6A 3IYLW 1XGUA 3W0WB 3T0EA 1R24A 4XZUA 3DI3B 3RIFF 4CNIB 3RVVD 4WY7L 3HZYA 4M03A 2IADA 4KMLB 1U95A 2LVCA 3V0VB 3V5KB 5EU6E 4JQVC 4OF3A 4Z95L 3TBWA 4NQEA 3UC0H 3ESVF 1UKTA 2G5BA 3U9UA 4J3UA 1NC2D 2WQ8A 1XR8B 3QO1B 2FECI 1BD2D 2VAAB 3SKMB 4UQ2B 4IRJA 1U3ZA 2DYPB 3I50L 1F3RB 1ZT4A 4UV7L 1IT9H 3F7QA 3FZUC 4G6JL 3VXNA 1F4YL 3LH2L 3VFGH 4IHOA 4P5KB 2YD3A 3QFJB 4KUZL 1T1YB 2IH3B 2NX5D 1Q72H 4JFFA 1N6QH 4EQ2A 3ALXA 4HK3N 1F42A 5K93A 2VXVL 5BV7C 1A21A 1BF2A 4HAFA 4PRNB 3GMLB 3T2NH 2PNDA 4OZGF 1I8LA 4K7PY 5I8KH 4Y5YC 1FZMB 3CCHA 1G7HA 1ZLVK 4KWUA 4YDIH 3MODH 4HT1L 5C71A 3D69A 5TH2B 5IUSA 2A77H 1EXUA 1PLGH 3SKOB 3MXWL 1C5CH 5T1DL 2CDEA 1A2YA 3D1MC 5JA9A 5DJ6A 2ARJQ 4LDOB 1CGSL 1JNLH 4XB8A 4WI4A 2WWKO 1ZK9A 4LMQI 2XFXB 4HS3A 1UENA 2R23B 2A6IB 3FB6B 3K2UH 1TJHL 1X5KA 3IDJB 3QULB 5EN2A 5GSRA 3PHOB 3C5ZA 3NH7H 5CJBA 3SDAC 4N9GB 5DJ2B 2YD4A 4I18C 5FYLH 3O0RL 1DDHA 2YZ8A 3MRMB 1IC7H 4FP8L 4J8RA 3TPUB 3QH3B 3WJLA 1DFBH 3CH1A 3MOBL 5HHXH 2IMNA 5J11B 1SHMA 3RU8H 3UBXI 5D4QA 3PV7A 5AWNL 3ISWA 2UVFA 4YE4H 2Q7YB 5JHDD 2VJXA 4FTVA 5FKPA 1I9IH 3K80A 4M6NH 5EOCH 3GSRB 4R90H 1K6QH 1TZHB 3RWCA 4WJ5B 1A02N 2VIRA 4I5BA 2Y7QA 2WBJD 2X09A 3MLSL 5MP6L 3ARDC 2W60A 4G9FE 5BOZG 2EDFA 4NO0A 1YJDL 1BGXL 5D72L 3UDWC 1VKXA 1CE6B 4F3FB 5IG7A 3VWJD 4HUUB 4Y4FC 2Y9RT 4OZHF 4G6AC 5EZOH 5IFHH 5JIPA 5LG1A 4ZS6D 1CGTA 4ZQKA 5GGRB 4DTGL 4P2RB 1MY5A 2GUOB 3OR6B 4K7FB 2Y06H 4PY7A 5SWSD 2X40A 3L3JA 5GGQH 4C56A 3S36H 2CRIA 5B8CA 2F54A 3OV6A 4ODVL 4ZS7H 1H15B 3U9PH 3PP3K 1YMME 1E4KC 4EIGB 4QGYA 1IGMH 4LU5L 3S37X 1DL7H 3U4BL 5DUMH 4UAOC 1X5IA 2XZCL 3IJHA 2BOBA 1OGAE 2ICWA 3LSOB 4JAMB 2AJUH 3U36B 5DD1H 5KSBF 2NY5L 4F7CA 1V3JA 4YK4B 2ED8A 4U6VH 3PQYB 4X9FA 4OM1H 4YFDB 2J2ZA 3VWKB 1C7SA 2ZPKL 5KZCD 2WWMD 2B2XL 4NQUA 4LCYA 4ELKB 2MCPH 1FSKC 3BDYL 1KIUA 2ORBL 3OXRA 3VGGA 2X42A 3O45B 5HVHB 1AD9B 4F9PA 4U6XA 3EDDA 2PCPB 1ZEAL 3RGVC 4PJXB 1XGQB 4YHZL 3IXTA 3BZFB 5CZKA 3OJDB 5SWQA 1RPQA 4HIEA 4POZD 4MXVE 2CKNA 4CVZA 3FFDB 1B0GA 5IWLC 4N0YH 3I6GB 2CLRA 4S0SD 1MCOL 2G60H 2D0GA 3SDXF 1KIPA 3V7AG 4O2CB 5KSAC 4L29A 5I9QB 4JKMA 3RVTC 4P3DB 3TA3C 4QHUB 2CIKB 5I8EB 3FB8B 3O3DA 4JZJA 1DANT 1AR2A 2Q1EA 1HKLL 5F1NA 2R8SH 4PRHA 3TVMD 4JRXE 4DEPB 2NY3B 4AH2B 4NM8L 4DK3A 2R0WL 3PGCB 2DD8L 1KB5L 1P1ZB 4P4KD 3R06B 4CUCA 3EFFB 2XWTB 4M5ZH 2W9DH 1ETZB 2X4UB 3T0AA 1SYSB 5E00B 2VLME 1HXMB 2X4NA 4QHNA 4HUVA 4XP6H 3IAQA 4NRZA 3BGFB 3VGHA 1P7KB 4XPAH 4LCWA 3ZYZA 4TTDD 1YEIH 3G04A 2GJ6B 2R2BA 4GXUM 5L8LB 2EIBA 1DLFL 4KROC 1KG0A 3OPZH 4KKAD 4Y19E 1CVSC 5BMFH 3O4LD 3P4NB 5C8JA 4QRPB 3TO2A 3WO4C 5JPNA 3SDDD 1BZ9B 1NCDL 1WIUA 5J06A 4U33A 4PBVC 3V4PH 5EORH 1EAPB 4GLRH 3SJVE 4RFEA 3RTQD 5IFJA 5J57B 1WFOA 3QUMH 1AO7D 5DVKA 2E7BA 1IRAY 4YHMH 4YBHA 4QRRA 2R2CA 5A3ID 3PABB 1A7BA 2Z8RA 3FAXA 1U8LB 3BVNB 3DVGA 4M7LL 3U30B 3TFKC 1CFTA 2OTPA 2BNQE 4OFPA 1CBVH 1S7QB 3HNVH 3O6LH 3QDHA 1R5WA 2R69H 4JEGB 5HHOA 5CKAA 4O02L 2JCCA 3X3FL 1NH6A 5FK9A 3HUJB 4S1QH 4G43A 1JF1A 1DBJH 2W92A 5SWSA 2Q76B 3B4NA 1NGZB 4QRQA 1W8OA 5EZLB 3HA0A 5DSCA 4ZFOA 4ODWB 1P4BH 3J7HA 3AS0A 1LDPL 4LEOA 3RIFK 4Z7VB 3VMPA 5HD8C 4YXHH 2OM5A 1U8JA 4KKCD 3WEXA 4CJ1A 4ZPVA 1CDIA 3QPXH 4ORGB 4OZ4B 5JR1L 5HSFA 5D7JB 1I75A 4PJDA 4LVNC 4FQHB 5TQ0L 4XCYB 4BH8A 3L95B 5HYFA 2A74A 2P8MB 1AGCA 3KDMA 3WFHA 5FYKH 4KJPC 4R26L 3VFRA 2XPGA 3PJSA 2D7PA 3P9LB 2HTKD 4U1NA 4WV1C 8FABB 6FABL 3O6FD 2G75B 4RBPH 3IDMA 3STZA 1AXSB 3HZKB 2PETA 2VE6B 4FQJH 2VISB 1JNHA 4D8PA 1WEJH 4DFIA 4JPIB 2Q20A 3ET9F 4E41A 3QZWA 4IDJH 1CQYA 1PZ5A 1X6NA 4JFDD 5GRUH 1PG7X 1P7QB 1U8IA 1TETL 1LNUB 2DTSA 4MNHA 4L8DA 35C8H 2YD1A 5I76B 5E2VL 3V9FA 2HFFB 4M61A 1CXFA 3I3DA 4NPYA 3HG1A 2VDKH 3GMNA 1N4XL 4N68A 1G84A 1FBIL 3TZVC 4HXBL 5E8DL 4KDTA 4UT6H 4FFWC 4NGHL 2CR3A 2QV2A 3DJ9A 4ODHH 3PUCA 4PIRF 5CJ5A 2OBGA 1CFVH 4F37K 2VSDA 1LVEA 4QRSA 4OJFH 2FGWH 3WSQL 3C09C 3ZL4L 4GKZB 1CXLA 4M48H 5IB3B 3M8OL 3FOLA 1J5OL 4GMSL 4YXKH 1MELA 1EVUA 1U8MB 3EO0B 1G7LB 2EDEA 4X7DC 3BP6B 3L3HA 3N85H 4GSDH 1B0RA 5J12B 3D48R 3QISA 5IEHA 1RHHB 1MCCA 2WIIA 5TFSL 1HHGB 3NIGE 2EYSA 1WF5A 1BFTA 3GBNH 1MAML 3T04D 5J6HA 3K1KC 4FQLH 5K59F 4U0RB 1QYGL 1QNZH 1RURL 1J9CT 2DL9A 4PJ7B 5KANG 1DN2A 2GHWB 2A83A 2NXZB 2A1WL 4OIIH 4LLYA 2VDNL 2XXCB 1X7QA 3KPRB 4PJ8A 5C6PB 3D9AL 3MLTA 2DMCA 4HW6A 5CMAB 3QSKB 4EOWH 2V17L 3LS4L 1T5XB 1YN6A 4GRMA 5E5UB 5FKAA 5KS9E 1NGXB 1LE9A 4OGAD 2XZAL 3QRFM 5H2BB 3EOYG 5KJRL 1Q94B 3GSVB 1S8DA 1S9YA 4MAYD 1HH6B 5EC2B 2V5TA 3FT4A 3LV3B 4I3SH 4DN3L 1FNEB 2X5PA 4ZYKA 3MGTA 1OT1A 5D7LB 1BIIB 1BQLH 3SBWC 1P4LA 1GZPA 1MLBB 2PO6C 3HC0B 3BP7B 3HMXH 4JRYA 1SJHA 2PN5A 3GMPA 5BCAA 4CVUA 4LLUA 2B20A 1JN6A 1JNNL 1V7ML 4XCFH 5EBMB 1JPTH 3BESR 3VA6A 1T3FB 2VR9A 5TDNA 1MRFH 3CVHB 5E99H 1F8TH 4NIKB 4LK4A 3P30H 2A9ML 1LO3L 1VADA 4Y2DB 4B50A 3VD9A 2BVPA 3REWB 4MXWL 2VLRE 1AJ7L 1QFPA 4OI7A 1UM4L 3LZFL 2F5BH 1J1OL 3NCCB 3WNKA 4TSCL 5L2KB 4GAFB 3QUYB 3DXAE 2VXSL 2QSVA 4PRID 4RA3A 1I7RA 1N3NB 2ADGB 3QXUA 4LHUG 4CRPA 2X4RB 3JVGA 4KKNA 3NAAH 4YFLF 1R3KA 2VZVA 2FSEB 3O6FA 3ZT7A 5I74C 4HJGA 5FB8A 5F1IB 5AZEL 2XY1A 4KQ4L 1MCFA 4D3CH 4OCNC 2JIXD 5JOFA 3HPJB 3ULVH 4NQCE 1C1EH 2HT2C 3OTTA 5K33A 3TYFB 1A3RL 1NFIB 2NYYD 3GIVA 2JF1A 3D18B 3NPSB 4KRPC 4UI2A 1QACA 3MLRH 5CWSB 1G7MA 1Q1JL 4N0FA 1UACL 3TBVB 1CD9B 2VDRH 5E1HB 4Q9BA 5HYIA 3WO3B 1QVOB 5DR5L 4I13B 4XAKD 3MR9A 4D9QD 5F3HB 3B8YA 1R3JA 3C08H 4XVUD 4X83A 2KQMA 4W4OA 1VPOL 3TIDB 4D0CB 2RBLA 5KOVC 1MIEH 2E5EA 3RNQB 4XNQB 4JKKA 4I0PC 4FFVD 4XPGH 1JTOA 3BZEB 1DEEA 1FL5B 5HHQA 3QIWA 3ARGD 3DX7A 4U6HA 3F7YB 5F89B 4G8GA 2X4OB 5EOTB 2X1XR 4GQPH 4NCC1 4YR6A 1OTTC 3W11C 4APQB 3U2SA 4GRWH 4P46B 2VQ1A 3O3BA 4GQ9H 3MRRA 1PX3A 4I4WA 4G8EB 4H25A 3H9SA 1X4YA 5FDYA 4JFEA 1EFQA 1XCQA 3NIGF 5EC1B 5DRNA 1GOHA 1FNGA 2XZZA 3QDMA 4NQXA 4QGTA 1TCMA 5IBUB 4FQXA 2NR6D 4WEBH 3ARTA 2XKNA 3OKLA 1DQLH 4PJGA 4FG6D 1D5IL 2CXKA 1BEYL 5C07A 4K55A 1XGPA 1NCCL 1KBGL 4QT5B 5ILTL 3GSQA 2CK0L 4NWUH 4MZ2A 5KANI 3IFLL 1QBLH 2PYEE 5EIIB 2B5IC 1HWHB 4Z7UA 5C0AA 1T03L 5E2WH 5EU4B 1GAFL 5M94B 3AS1A 3MA9H 1FO0A 3DVNA 4YPJA 4JG0H 2EIZB 2BSED 1T21A 3UZQA 1Q9OB 4BZ2L 3GK8H 1NAMB 1JL8A 3ULVC 3EYFA 1D5XB 1D5ZB 4ONFH 1U3HB 3EHBC 2AV1A 3EYVA 5INCA 2AAVA 2VB5A 3I6KB 3LRSB 1ZLSL 2WSKA 1ZA6B 5D5MA 5I8OL 1RFDH 3BJLA 4Y4HB 1P6FA 1T83A 4DK6A 4GKSB 1TZGH 4JLRA 4PV9B 3TBYB 5D70H 4HWEL 3C9NB 2NY0B 4N0UB 2J8UA 4OD1H 4Y88A 4MS8D 1CU4H 1T5WB 3DTXB 3P11L 1KEGH 1SVCP 5IESL 3B2UC 2VZ3A 5FYJH 2CJUL 3MBXL 3SKNA 5DJXA 2WIMA 3BH8B 5DGRA 4ZDHA 4X6CB 1A6WH 2HLAA 3BAEL 4PRIA 4R9HA 1OM3H 4XHQA 4OZFH 3MRGB 2Q8AL 3BPOB 5DHXB 3BPCA 4UU9B 3I02A 2OZ4A 4NQDD 3L7EB 2HJLB 4P5MB 2ARJB 4N1CA 2DLTA 5CEZH 1NCAH 2IF7A 2R4RH 3MGOA 1DUZA 4XH2A 2R56H 3UJTH 5TF0A 3BP4A 1FRGH 3BRFA 1MCPL 3MXVL 2HT3D 4OLUH 3QG7L 3V4VL 1RY7B 4NZJA 1GC1H 4KAQH 2OI9C 2R2EB 4JGUA 5E6ID 3C60B 1IAKA 1NBZB 3QRGH 2EDHA 1UYWL 1ZGLM 5JQHC 1D5MA 4FFYH 2CKBL 1RZJH 2X1PA 1EFXB 1I1FA 4KRMB 3GSXA 1Z3GL 4NCC2 4OI8A 2FL5A 1J12A 2WP3O 3RWEA 1DUYA 4JFYA 2X10A 1F11B 3NA9L 3UPAA 1MHCA 5IB4B 1ACYH 2X7LB 3ARRA 5L8JB 4R2GC 1KPVB 1NDGA 4YK4C 5I1KH 3KXFD 1YEDA 1F6FB 3FRPG 3CSPA 5D6CB 3CK0L 1A0QH 3VWKC 4NZDA 4PJ7F 4NFCA 3ULSA 1KSRA 2OXGA 1OTSC 4WO4D 5F21B 3H3BC 4DZBB 4QNPE 4CAGA 2FATH 1EUUA 3OAZK 4M4PA 5DEFB 5D7SH 4FZ8H 5HVHC 2GCYA 1QSEA 4YHOH 5IW1A 4G7VL 3VG9B 3GMRB 2BVOA 4GUPB 2WINA 2GITA 2G9HA 1RIUL 1SEQL 2MNUA 4X6DA 1ZLWH 4CU6A 2P7TA 4RAVA 5SX5H 3JBG7 4OFIA 3NFPB 3WDIA 43CAB 4GLRI 3G6JA 3PDGA 3KPLA 4NZUL 2FH8A 3OF6A 1LMKA 1BQSA 3HKFA 4OUOA 3C6LA 1ZVYA 4PUBH 3MJ8B 3TT1L 3QT2A 4X9HA 3VGFA 1JPGB 5CINH 2YD8A 1G9EA 3L3DA 1HHKB 1F00I 1S5IL 2UWEB 4NRYA 4L4VE 5IFAH 4M6OH 3ABZA 1CK0H 2VLKE 4U1MA 5GRXG 2NY3C 1T6VN 2CO7B 1UVQA 1S7TA 5E8PA 5FF6B 1RJLA 2DQGH 1P2CB 4W81A 1JHTA 1HIMH 4OI9A 5CHNB 5HHMB 5FA4A 2QSCL 1G1YA 3C6SA 2ESVD 3N0PB 4YXLH 3GMQA 2V2TA 2NW2A 4TN9A 1CYGA 2FECL 1CD8A 1GVIA 4J3XA 1HN1A 2VKXA 5I17B 4HKBA 3FN0L 1F90L 1OPGL 1NGYA 4B5EA 2WNGA 1FIGH 4MNQA 1CT8A 1MI5E 3MBED 4KTDH 1CD1A 4UB0H 1RZJC 1DBKH 1MUJA 2FZ3B 4NP4L 1YNKH 3X12A 4U1JA 3ROOB 1ZVSA 2L7JA 5FXCH 3NCJL 5HYJB 3JTSB 3DETC 4ZD3L 2PKDA 5DC4B 4DGYL 3TO4C 4C57C 1KXTB 4LSRH 5E5MB 3IVKB 5C08E 3RL1A 3BPLB 2P46B 3BJ91 3T3PF 2I9LB 1QRND 5DJDB 2AQ3A 1F6AA 2D7MA 1LEKB 3IDGA 1J18A 2OQJA 4HFUL 5CIPA 2ZJSL 4F58H 4NQDA 3N9GH 2MQCA 2CGRL 4K8RH 3O11A 2KKQA 4PFEA 3SE9H 1QKZH 5BS0E 3MTRA 2YPLD 3KYOB 3HNTH 4HIHA 4OLVL 2P5WB 3QNYA 3KJ6L 1GZQA 2X1OA 1EZVX 3QWQB 2Z93A 5JQ6L 4PJ5A 4FOMA 5AZ2H 4UV4H 3L5HA 5EU3B 1U92A 4Y16B 2GEEA 4M7JL 1KENL 4Y1AA 5F9JA 1IQDB 3S88L 4YAQB 4QWWD 5GHWH 5D7JC 5C1MB 2NZ9D 3BEWA 4X0KB 4LMQE 3SY0B 3NN8A 3NCFB 4I8DA 5T5FH 4YGVB 1BZ7A 1U93A 5FHBH 5D2LB 2C1OB 5FUZH 5BO1H 1I4FA 1G7JA 4F7TA 1T7VA 1I8IA 5MEOB 5ERWB 4L8BA 3PWLB 4NNYB 1YQ2A 1YEGH 2CR6A 3OX8B 1JRHL 1IAOA 1OW0A 4NO3B 4CMMA 2QHRL 4JCLA 3CFDB 1QQDB 3EYSH 4ESKA 1A6UH 1G0YR 1VACB 1GGBL 3Q2CA 1V3LA 5DMYA 1G1CA 2PTVA 3STLA 3HC3L 2F8OA 3VFMA 2E8YA 4OGXL 1MFDH 1DLHA 1KJVA 5DDHB 3FO1A 4Z7WB 4GW1B 3S4SA 1MH5A 3U7WL 4JRWA 4JHZA 5DHVH 3VXTA 3WN5B 1LK3L 4YIQA 4YNYA 4ZAKC 4NUGL 1K2DA 3NCYP 3KLDA 3QB7C 3QNXB 3AREB 3GI9L 2AEPL 2YKLL 1RZKH 3IFOB 1N64L 1HDMA 4Q9QH 3UTSE 4PJCF 1EA9C 2CMRL 4PREB 4JO1L 2QSTA 4PRPB 2Q87A 1DQQB 3IETB 7FABH 3R1GL 4MD4B 3G5ZA 2DLHA 3G6AB 3U0WH 4ONOA 1BOYA 1E28B 5E94A 4PPTA 1I7UA 4PJAA 5KVDH 3OKEA 5CGYC 1OQOA 1KB9J 5ISZE 3GJFA 1KTLA 4KJYA 4L3ED 3JV6A 3FZUD 4HKJB 3RWIA 2VUYA 1G0DA 1MCKA 3WJJA 1KTKE 2B39A 1T1ZB 2M1KA 1AKJD 1FAIL 4AENA 4KVNH 2YXFA 4CMHC 5HYQB 4LRNH 1HWGB 2ADIA 4X4ME 4XCEB 3ZE1F 3OR7A 4OZFG 4PP1C 4OD3L 2C1PB 4ZXBB 4RWHA 1F58H 4GAJL 2YK1H 5ESVA 3JWDH 1QLEL 1T20B 2YBRB 4MNGE 5IJKA 1MREL 1MWAA 4AMKL 4L4TB 5HDQH 4PJHB 1DBAH 1JGVH 2I60H 2BVQB 3OAYH 1IGIL 3NTCL 1B6UA 5FOBB 3RWDB 2H2PC 3CDGA 1HHJA 4K7PL 2N56A 5I1EH 1VEOA 1A9EA 3HNSH 5L8KB 1QFWM 2OL3L 4M62L 5ANME 5HGBB 1E6OL 5ICXB 2FX9H 3SDCB 4LSUL 4OUUA 2XKSA 5MERA 4PYGA 1G7PA 5BZDB 5F7YC 1PVHA 3BKJL 1GPOH 2GT9B 3VMOA 1WZ1L 3B9KB 3PL6B 3LMJH 5J4MA 5J1AB 2AK4B 2AEQL 5LWYH 1DSFH 3SDAD 2BNRB 4MQXC 2Z8WC 4WWKB 3UTOA 3D3VA 1MRCL 1GGCL 5IV2B 1VGKA 1EEYA 1S9XA 3AMLA 3EZ8A 4JANB 1M71B 4G7YL 1MCEA 4K2UL 1PQZB 2EECA 1K4CB 2A6JB 1KJ2L 4J3VA 3D2UD 4YGAB 5CJOL 4MB3A 1FL6B 3IJYA 3S4SG 5HHNA 5KN5B 2W59A 1I3VA 3QUYC 1P6AB 1QEWA 5J9PA 3BH9A 3OKDB 2IALA 1YDPB 5E9DD 4YEFA 4ODXA 4OGZA 5IEKB 3ARDD 2EYTA 4BSVB 5F3BA 3VI3F 1QRKA 2FHFA 1YMMB 2ZOKA 1TZIA 1LK2B 1CDYA 5MENE 4Y4FD 3WDJA 4JDZA 4G6AD 3VDCA 3WS6C 2DF3A 2UWEF 3UTZA 1Q9WA 1WC7B 4ONHA 3BUYB 2DKUA 1AE6H 2HVJA 3RFZC 1IBGL 1KEML 2V2WB 1UJTA 2FEDC 3G5YB 1L6ZA 3V0WL 3NABL 1NAMH 25C8H 2YUVA 4PGCA 2GTZB 2X9WA 2DKSA 2WZPD 3MO1A 2Y72A 3LQAL 2RB8A 3JWDC 2J6EH 2OTWA 1MFNA 4LAQH 2F58H 1AD0A 5GISH 4TPRH 3DV4B 5F7EL 5C3LD 3LKSA 2IQ9L 3JWOC 3WFDL 5IF0B 3AM8A 3T0EE 1TNMA 3KPQB 5J13C 4PG9A 1EEZB 2X44D 1A6AA 1T89C 4A6YL 5GJSH 4OLYH 1CLCA 3KPSD 2OK0H 1JHLL 4NQEE 3DBXB 2AI0H 3PG2A 1K5NA 1UC6A 2ZCKL 4P4RB 4J3SA 4CVWA 1QFWH 3RY6A 3QEHB 1A6ZA 3QEQB 3DX6A 1KLGA 1ND0B 5J1SC 5SWZD 4TUKH 3MV8A 3QG6B 1Z9OA 3OKOB 1FFPB 2XRAH 2Y1VA 4NKIL 4PRDB 2EDOA 1FAKT 2VDML 4GW4A 1MCWM 5FYLD 2QQNL 3W9EB 4IIQA 3RGVD 3FB7B 3Q1SL 4ETQA 2PXYD 4GO6B 2F19L 5ADOL 1CXIA 3IF1B 3CFJB 5C0CD 2Q3AA 4MQ7A 4LAJH 4QCIA 4JFFE 2OJZH 5JDSB 1JK8B 2BSRA 3Q6FB 4QRUB 4Y5YA 5KSAD 5HGDB 4IMLA 3HR5A 3RVTD 4TTGA 3TA3D 5CCKH 3HE6A 2DIBA 5ICZB 3L3KA 2A9NH 3P0VH 1FGNH 1NC2B 5I71B 3JWNC 2VABA 5F7FA 5F9OH 1J7VR 4LIQH 2DQFB 3RZCC 2VR4A 4RGOL 1O7SA 4TUJA 3ZDYE 1KB5B 4MXQC 4GMTL 3WFCL 1DTUA 2DQCH 4Y19B 1AC0A 1KCRH 3HRZB 4HXAL 5HYSA 3VXRA 4JREB 4JG1L 2FIKA 3HZMB 3CIQA 4LKCB 5D2LF 4FZEL 4OF7A 4Q2ZB 3HI6L 5JUEL 1W0VA 2KZ1B 1YEHL 3NIFE 2NX5B 3SDAA 3GB7A 3D39D 1A4JA 2DL2A 4LPCA 4I18A 1KPRB 4KROD 5JPMB 4MA7L 4Y4HC 4X5XB 3V7AE 4X98A 1KJMB 4OIBA 1AFVL 1FCGA 5J6GA 1HHHB 4RMTA 3ARWA 2ZG2A 2AABL 3VRIA 1YPZB 5FV2A 2FJGB 2V5MA 4Z7WF 1D3CA 1AGDA 4WU5B 2NXYC 3UP1A 4CDGC 4GXVL 5E7BA 4HLJA 4LLWB 4GRLC 4X6BA 2LE9A 4FTVE 4WFFE 1CFQA 1KTDB 3BPOC 4UT7H 4PJFA 2XACC 4JO4L 1IEAA 4DGVH 3KS0H 2XWBB 1R6VA 1JGDA 5KSUA 4FQ1L 4WU7B 1UZ6E 2L4OA 1Q0YH 3FO2B 4YHPB 4HC1A 4TVPH 5J89A 3DSNA 1LP9A 4JO2L 5A2KH 5TDOB 3MRJA 3C60C 1LEGB 2XNAA 4UQ3A 4OCRL 4LSSH 1H3PH 5HI5D 4C56E 2F54E 1JGEB 4JZOB 4GAYB 5HD8D 1NCTA 4CGTA 5CP7A 4D2NA 3UC0L 1QLRB 5JHDB 5F9DC 3MRBB 3HE7C 1BBJB 5TE7H 4ODBD 1NFDA 3HLAB 4OB5H 4WWID 3RVUC 2P24A 1XIWC 1L0QA 4YO0A 3VGEA 5EO9A 1F3DJ 4XPFH 5C3TA 1YEEH 1KLUB 3KPSA 4E5XB 3L3OB 3VFTA 2HH0H 1W0YT 4KJPD 1QR1B 5C0IB 1FG2A 3BGMB 1IT9L 4W70A 1FJ1A 3VWJB 3RPIB 4MJ6B 4F9LA 3VG9C 4ZO8A 4JM2B 4UIKH 3UTTA 2IAMA 1N59B 2YMXL 3ILQC 4NSKA 1NMAH 1Q72L 3W39A 1N6QL 3WFEH 4MA1C 5EFIA 3MV11 1NEZB 3TC9A 3T2NL 4JVUA 3AY4C 2NMSA 3MROA 5IIEA 5IMOA 5I8KL 4XMKH 2N4IA 2C3VA 1M7IA 4P2QA 4YDIL 3MJ7B 1C5DB 3MODL 4KZDH 3KYNA 5HY9B 2W1NA 3TZVD 2GYSA 1REIA 3VXME 4KUCD 3MRKA 4FFWD 2A77L 3RX5A 1NC4A 3PWJA 1ORSA 2XN9A 3VD4A 1C5CL 4KPHH 1K4DB 5DUBB 4XRCB 3LD8C 4MA3A 4E42A 5JORB 5MEQA 5IW3A 5JMOC 1JNLL 2H8PB 1GYAA 4MVBC 2BRRH 1Q38A 1KB9K 4LSTH 2CO6B 4TYUA 5HGAA 2E9WA 4U1SB 1C08B 4JJ5B 3ZDYF 4LHJB 3K2UL 5A1AA 4PRHE 1Z5LB 1DE4B 4I3RL 3CDYA 4R3SB 3MV9D 5F1OB 4BK5A 1OARH 1ZMYA 2ICEA 3NH7L 1T4KA 2I25N 1BVKA 4GJTB 4O9HH 3DVFA 5FYLL 3BHBA 1YQVH 4ZSOA 2JJUA 3PWPD 1U8HA 3OB0H 1IC7L 4JFXB 5AUMB 3NFNA 5TE4H 5F7MC 1KFAH 5B3JE 5HHXL 3RU8L 4QXGH 3GUTB 1JZ3A 3F6IA 3M1BB 4LCWE 1JPST 4YE4L 2ZSWB 5HI3C 4DZ8B 3CPLB 4BQ6A 3OKNA 1I9IL 1U91A 4M6NL 5EOCL 3E6FB 4HF5H 2H32H 5EO0B 4R90L 4LLDA 5FO8A 2LAGB 1K3IA 1AGBB 1BLNA 4P23A 4J6RL 4POUB 4H26A 5D2NC 4MX7B 4KTEH 3BPLC 5FYKD 5C0EA 4K3DH 3MUY1 2MFNA 4WW2B 2A0LC 4LDLB 3TVMB 3T3ME 4L9LC 1BBDH 1T1WB 3TNMB 5ESQA 5EZOL 5IFHL 4H88H 4GG6B 2M8XA 4CDHA 3KR3H 4EDWL 3U4EB 2YWZA 3MNWB 4ZPTB 3ZT5A 2LU4A 5E1AB 4QRRE 3WHE0 1JTTA 4G6JH 4CW1B 3OKKA 2OSLB 2R0LH 2Y06L 3ZT6A 3IDIB 2Z92A 4OZGA 3ARQA 4ZUUA 2OTUA 5TDPB 5GGQL 3K8MA 2VMFA 3S36L 4OKDA 3DUUB 5FOJA 1AY1H 3EAKA 4GG8A 4YHIA 1CFNB 1X5HA 2IH1B 4ZS7L 3U9PL 3JTTB 1HOCA 3STBA 1WIPA 2PO6D 1TVDA 5HHOE 4M3KB 1IGML 4PJBB 1DL7L 3FONA 5DUML 3O4LB 4M9OA 2R1WB 4X8XA 3IS0X 5CJQL 2AJUL 5DD1L 1EUTA 1J0JA 4ZUVA 2O93L 3RTQB 5JW5A 1PKQB 1EHXA 4U6VL 1CGWA 5T1DH 2P45B 3JSSA 2XY2A 1EJOH 4BFBD 5A40E 3B5TA 4OM1L 2NY6C 4YZFE 3VMNA 3V7MA 5D1ZC 4R0LC 4Q9RH 2LABA 3A0OA 4PJDE 1CQKA 3ZMRA 1MHEB 3RVWC 1XH3A 3T2QA 4QRTA 1LE5A 1UXSA 4Y2OA 2OMNA 5T1LA 3QUZA 4DCQB 1OD9A 1UJ3C 5GS1A 1FVCB 4BH7A 2BSSA 1VFUA 1CDCA 3TN0A 1DBBH 3RUGB 4V1DD 3O0RH 5DRWB 2HT2D 3L9RA 5F6HI 3VDAA 4E41E 3RDTA 4G80B 4MMZC 3LEXB 3O8XC 2HN7A 4FABH 2MMXA 4EXKA 4N0YL 1YNTB 1U8OB 4KRPD 3CX5J 3T0WA 1BMGA 3VFWB 1FL3B 5CGMA 1ZS8A 2JK5A 4R7DA 3SE3A 3F7VA 3QIUB 4HPYH 4OQTH 4HS8L 3V6ZA 4AM0A 1FVEA 1DQJB 3EJYC 4OZHA 3HG1E 2F53A 4MWFB 3U6RA 3ALPA 4YPGA 4AT6B 2R8SL 4TRPH 1RSFA 1ZT1A 2EDTA 3QJHA 3MCLH 1I85A 3FO9A 1U58B 4I0PD 3S35H 2BOCB 4JO3H 3BWAA 5INDA 4LLQA 2APVA 1BJ1J 4KKLC 5EA0H 2W9DL 1MCSA 1J1PH 2EDRA 3UX9B 5L88H 1CFBA 2DOCA 2OXHA 3L1OL 3LB6D 3UTPE 4XP6L 1OTTD 3W11D 3TJHC 4XPAL 2IANA 4KRNA 5GIRA 1YEIL 1E0OB 4JFDB 4NQSA 3MJGX 4Z5RB 3ZDXE 3HRPA 3OPZL 4ZXBC 2YN3A 5BMFL 1CF8L 3ZHKA 5KSBA 3RKPA 4X7CC 5CSZB 1OP3H 3ME0A 3QP3A 1JZ4A 4YUEH 2OLDA 4OF0A 4WVRA 3V4PL 1E27A 1M05A 2G2RB 3BQUA 1BVLA 3QUML 1RAMA 4YHKL 4YHML 2H32A 3PV6B 4K3JH 4OCYH 5E56A 3X14A 3GRWA 1XGTB 2LFGA 3KYKH 3WUZA 3LCYA 2ZPKH 4JDVA 3FQXB 2YPVH 2FJFB 1CBVL 4QHMA 2NQCA 3HNVL 5ETUA 4C4KT 3DGGB 3MRFB 3FTGA 3T0VA 2R69L 3PL6C 1FFRA 5DQ9B 4NO5B 3TV3L 1ZWIA 3CD4A 4S1QL 4XBPB 1DBJL 3ULVD 3SDXA 1T80A 5BQ7B 3RAJH 3EHBD 3QUKB 5E6YA 1EGJA 3MRDB 3UJJH 5B38B 1P4BL 4RMUA 4XMLH 2YD6A 2JCCF 2HJKB 2Y6SC 4YXHL 4HGWB 4YX2H 1ED3A 3RWJB 5E0QA 3RWGA 1VFBB 4JRYE 4X4YB 1QFWI 2P5EA 4JY4A 4WUUD 3QPXL 5CD3B 3HAEB 5DQJA 1N26A 3QCUH 3MNZA 1BAFH 4EUPH 3B2UD 1KLFA 2E7HA 3ROLB 5FYKL 2QR0A 3DX8B 5EBWA 3L3GA 4YZFF 5DT1H 2HFTA 1MCHA 4W6XB 3DYMA 2HMIC 4PJDF 2GSIB 4P2RD 2Z35B 4FQQA 4MAYB 3G5XA 1HHIB 3QNZB 1LO2H 5SX4I 4YHNA 4IDJL 2Q3ZA 3MLWL 4N5EC 5GRUL 3QDJA 4W6YB 5F7WC 2FWOB 4O58H 1G6RH 35C8L 3PWVB 2VL5A 3LKOA 2NY2C 2NLJB 5F96H 1T0PB 2VDKL 2CKBB 5IM7B 1YC7A 3W0WA 2FJHB 1ADQA 3FN9A 1YA5A 5CEYB 5EZJB 4CNIA 1BFOA 4UT6L 1SMOA 1NCDH 5C0BE 4UTAH 4LCUB 3V0VA 3V5KA 1NUFA 1RJYB 4MJID 2VQTA 3OL2A 3SEPA 4LPWA 4ODHL 4PLJD 4R2GD 3ARBC 1CFVL 3SCMD 1Z0MA 4OJFL 2FGWL 3O3AB 2VOTA 5I18H 3VWKD 1XR8A 3QO1A 1F6LL 4K3EH 5GQBA 4MMXC 1OTSD 5HVGB 1DANU 4M48L 3QQ9D 2AS5M 1HXYB 2VAAA 4UQ2A 2DYPA 3CC5A 4YXKL 1QG3A 2X05A 2AXFA 1JE6A 4U7MA 1WAAA 1MQKH 3N85L 4GSDL 3RWHB 4P5KA 3QFJA 2JIXB 4G8GE 1T1YA 3GBNL 2IH3A 2DI7A 3O81A 5K9KB 1VESA 3WUWG 4FQLL 5E4IA 1GCFA 4JFZL 1RUMH 4H1LB 2VLKB 1QNZL 3V0AC 4PRNA 3GMLA 1LDPH 3K4AA 2JJSC 1CLOH