5E56A

Crystal structure of mouse ctla-4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxic T-lymphocyte protein 4
publication title Crystal structure of mouse CTLA-4
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e56A00
4LSSL 3TVMA 1NFDE 1UA6L 1AKJD 1SQ2N 2DF3A 5IHLB 1S5IL 4YHKL 3D39A 4LRIA 5JHLL 2WNGA 4Z7UF 4Y4HB 3ARGA 2DM2A 1CICD 3UDWC 4RISL 4HXBH 4NM8L 2P8LB 3QXDA 2P42B 4PB0H 4QHMA 1IGML 4MXWH 3ZZ1A 1G9MH 1T7VA 5BZDA 5ADPL 2YD5A 1CCZA 3L3DA 4ONGL 1I85C 1IGJA 4MA1C 4OCXH 3SDAD 1T04A 1CE6B 4MNGB 3O41A 2ILLA 3QQ4A 4D9RD 4OCMC 3T0WA 4G8FA 4TOYL 2MNUA 3CVHA 5JQ6H 1MAMH 4OF3A 2E7LC 5CEZL 4EI5A 1FFQA 2O5ZL 1KN4L 1KFAL 3QXDB 3SDXE 3TN0B 3BEVB 4WI7A 4QHMB 1N26A 1MCWM 1J8HB 1YEIH 3SGEH 5JW5B 5BZDB 3REVA 5EORH 3L3DB 3SKOA 4WFHE 5BV7L 4C83B 4PP1C 1EZVY 4J6RL 3QQ4B 4BQ6A 4NCC1 4L29A 3ECBA 4JRXE 4GMSH 4K23L 1WWAX 1JZ3A 1C12A 1WAAF 3SO3B 3B83A 1A1MA 2XPGA 3CVHB 3F6IA 5GGRY 1KENH 3BRFA 2BJMH 5T33L 5HHMB 1I1FA 4EI5B 3RX5A 4F7CA 1U58A 2VDML 3OGCA 1QSEE 4PRHA 2VXTH 3DTXB 1IEBB 2ZCHH 5C0AE 1MREH 5DMKA 5A3IC 3V9FA 4BH8B 1MAKA 4L4TE 4HHAB 1KSRA 3KLAB 1EDQA 2PR4H 1I8KA 4L29B 3WIIH 5FO7A 4JE4B 1BFVH 5C08A 4NZRH 5SWSA 2XPGB 1RU9L 3O4LE 4P3CL 1HILA 2AAVA 2A6JA 4WI3A 3IETA 3D85A 4XBGA 4P3WA 4ZOEA 2AKRA 2NXYD 1INEH 1U58B 1LGVA 1K8IB 3TZVD 1R3LA 3RVWD 3N1GC 5DMKB 5FM8A 2EYTB 4X7TA 4OT1H 5ACMA 1QZ1A 4OKDA 4ZAKA 3IFNH 1KEGH 1LD9A 4NZUL 1H3GA 1MJ7H 2CMRL 3JBG7 3MGOB 4JM2D 3DV4A 5C08B 1HI6A 4N9GA 2BHZA 3FQNA 4PRIE 5SWSB 2EC8A 1FSKB 3RBSA 1HILB 1U3HA 4LSQH 2X4QA 4PJCA 1DBMH 1F6LL 3ETBF 3D85B 3IETB 4F7EA 2YK1H 3FL7A 3D48R 2EDXA 1JI2A 2NW2A 3C8DA 4G6AD 1AE6H 4F8QA 3BISA 3TIDA 1DQDL 3MJ9A 3H9YA 4PYGA 1FVCA 2MMXA 4O2CA 4Z7OE 4JZNA 5KS9F 5SV3A 4XMKL 1IGFL 2GY5A 4PJBA 4X7TB 3VXQB 5CEXA 1QFUL 2XQBL 4OLEA 5SX5H 2AVGA 1JP5A 1LD9B 1PG7W 4ODSH 3HI6L 3DV4B 4N9GB 5D1ZB 3QXTA 4OV6F 3S88H 2Y5TA 3C08L 4PG2A 1NAKL 3L7EA 3ZKND 4LSVL 4OUOA 4IM8A 4JR9H 2AJSH 3TIDB 3A6OA 3IJYA 4RGNC 1FVCB 3B2UD 4KJQD 4HKJB 1X5ZA 4JZNB 1W0YT 5AYUL 1XR8A 3MV9B 4P2OA 4PJBB 3OV6A 2BOCA 4MXVF 2X44D 5CEXB 4UINL 1DQMH 2AI0L 2VR4A 3G6JF 3V52H 4PJIA 4MNQD 2X9WA 5C0FA 3EGSA 3C5JA 2XIDA 5LGHH 2ZNWA 4JFDE 1OT1A 1A8JH 1AGEA 4N0YH 5GGVH 4Y16C 3LKSB 4JY4A 4X80H 4XVSH 2AK4A 3GJEA 2Y5TB 4R97C 4BQBA 5T3ZD 3L7EB 4KRNA 3UTTD 3PWLB 1NDMA 1K2DA 2P5WA 4HPYL 2K3TA 5E6ID 1E4XH 4R26H 3VGGA 4EI6A 1S9WA 3TO4C 4DKDC 3MROA 4XPTL 5IEKA 2PYEB 4XBEH 1XR8B 1KIQB 4P2OB 2ZUVA 4Y5VB 4OI7A 1ZLUK 3S36X 5HHXL 2B1HL 2VRAA 1WIOA 2Z31A 4MQXC 5C0IA 4PJIB 4J4PC 25C8L 2GEEA 1CDBA 4P9ML 2YR3A 2A38A 3CLEL 4R96B 5MEQA 3CFBB 1AGEB 3DXAA 2Z0BA 2Z92B 3DVNA 1WTLA 3G5XA 3RY5A 3IJSB 5I6XB 3N85H 1K2DB 2P5WB 4WEMB 1S9WB 4ZO8A 3KG5A 3MROB 3VWKC 5IEKB 4GT7A 4P59L 3CMGA 1DFBL 3SKNA 1I8LA 1NAMH 1T83A 3CDGA 1KTDB 4QWWD 5IWLA 5C0IB 3VFOB 4ODHH 2D3VA 2H6PA 2ERJC 5F3HA 3TN0D 4GQ9L 1S9XA 1J8HD 4ZO6A 4FTVA 3DXAB 1T2QH 3DVNB 4ENED 4HUKB 2QSVA 3GSNB 2Q6WA 3VD9A 5IGXH 3W2DL 4ODBD 4ONHB 5CD3B 4RRPG 2ZOKA 1YNTA 3CH8A 3ZKMD 3QP3A 2YUVA 4KAQL 2EH7L 3O6FC 2J8UA 2LE9A 2MQCA 3K4AA 5ERWA 2B1AH 2CUMA 4LVNB 2BP3A 5MEPB 3SKNB 1P69B 4X8JB 3BP4A 1S7XA 1B88A 3CDGB 3WCYA 1FL5A 5GRJL 4P2RE 3BGFB 5GS1A 2FO1A 4H20H 4NQVB 4G8GA 3V5KA 3MBEB 3VGHA 2Q6WB 1Z5LA 1IM9B 3CZJA 4XMPL 1H5BB 1Q94A 3ULVF 2ZOKB 1YNTB 4Z7VE 4Z18A 4XPAL 3ARBD 2HVJB 1JK8A 3HFMH 5ERWB 2P24A 1BWMA 3C09C 3W9EA 1GGBH 2RQ8A 1SM3L 1L9MA 1S7XB 3L5WB 1X5HA 4ODXA 3PWUA 4Y5YC 5I1AA 1PX3A 1RZ7L 2FDBP 4G8GB 3V5KB 2XA8H 4EBQH 4M6MH 4OZIE 3OB8A 3KYMB 4FZEL 3M8OH 4NT6B 3FO0H 3P40A 5GRUH 4TUKL 3U9PL 1T6WA 5GZOC 1OAYH 4P46B 3TT1L 2P24B 4P4KD 4PJ5D 3W9EB 5AWNL 1G0DA 5B4MD 4WWID 5FYLE 3LB6D 2KQMA 3AAZA 5CCKL 5DK3A 2PTUA 3BWAA 4ZDHB 1CD9B 4ODXB 4X6BB 5I1AB 5E7BA 1LDPL 4JEGB 4HXAH 3BAEH 4OFPA 1GOFA 3P0YL 4G6FD 4UDUB 2Z4QA 3MXVH 5J12C 2GJZA 1LEKB 2G75B 3QH3A 2VLJA 4KK5C 3CFEA 2UVFA 4BSJA 3LS5L 1F02I 4JFZL 1T1XB 5GJSH 3E6HB 2Y6SD 5F1KC 2D7TL 2VLLB 3WHXB 1QBML 3QDMD 3VXTA 3AAZB 1FNEB 4U6HB 2E6PA 3DUUA 2ZG2A 4LSSH 3TBWB 2JELL 4LDLB 1HSBA 4I9WD 5AG8A 3E2HC 4NNYB 5CEZD 2PXYD 2CKBB 3MV9D 2GJ6B 4PLJC 4P5KA 4NM8H 4D8PA 3QH3B 5J13C 5EU5A 3CFEB 5DK2A 4S1SH 5ADPH 2DJ4A 3W39A 1YEGL 1EGJA 8FABA 1P84J 5D6DA 4JO1L 1N3NA 4FMFA 1D5BA 3SDCA 2J7LA 4M3KB 5DJCB 4KJYB 1K8DA 3C5SA 4QXGL 4TOYH 5F7FA 1HSBB 2VLKA 4KK6D 1YEDB 1Q9KA 4JFXA 5HI3C 4WWKA 1JGDA 3B2VH 4MJ5B 3UYRL 4P5KB 3IJHA 2IF7A 4D8PB 5EU5B 4F15B 3BESR 5DK2B 3TBSA 4PUBL 3B9KD 4QRRD 1SEBB 2MSPA 1F3RB 1A9BA 2IAMA 4P2CG 8FABB 5KOVC 4JKMA 1N3NB 1D5BB 3SDCB 3TT3L 4EVNB 4YPGB 2NX5A 1PZUB 2BSTA 3C5SB 4X6DA 4S1QL 1FL3A 1WC7A 3SGJA 1D9KB 3LRGA 3HZVB 3DX9A 1HINL 4I2XB 4WUKL 5T33H 3RL2B 4JFXB 1KOAA 1MJUH 4BQCA 4NQED 1JGDB 3VH8A 1I1AC 1BOYA 1NC4B 4NN6B 4Z0BH 1S7QA 1CFNB 1NBYA 4NKDB 3IJHB 2KPNA 3D0VA 3MSPA 5T1LB 3TBSB 4OIAA 2OLDA 1YJDC 3UO1H 1TDQA 2WBJD 4MNGE 3D3VA 4E42B 2IAMB 4QGYA 2ZUYA 5JPMB 1L0XA 4GUPA 3VCLB 2B7DT 2R8SH 3JV6A 2BSTB 3T2OA 4X6DB 1WC7B 4U49A 4P3CH 1L7IH 4OZFG 3IRPX 2CJUL 1G6RA 3O9WA 2NYYD 4JG1H 4P3DA 5HGDA 1J9CT 1BP3B 1WJ3A 4HD9A 2AP2A 2R15A 1KXQE 3VH8B 2NY0D 4ODUA 1S7QB 1NBYB 3ZL4H 4JDZA 4Y19D 3VXOA 1J8HE 1TFHA 1JF1A 2NY3B 3D0LB 3ULSA 1NGWA 3Q48A 2ID5A 1RK0A 2Q7YB 2OXGA 3QIWC 4OM0H 1V5JA 1ZT1A 4HUMB 4NZUH 1CD1B 1BPVA 1RI8A 5DVMA 3TGXA 1QEWA 5GIRB 3WL9B 3G9AB 4G3YH 2JJVA 5FO9A 3JV6B 3CD4A 5CZXD 2OJEA 2VAAA 1W8OA 4BFIA 1WBXB 2OR7A 3BUTA 3L5IA 1AQDB 5HHME 1G6RB 3NPZB 4P3DB 4WW2A 3QHZH 5KBNC 3L5XL 4KKAC 5TE4H 4WHTA 2ZSVA 4X9IA 1T22B 4JGUA 4W68A 1FNAA 2KKQA 3OF6A 4JDZB 3VXOB 3QDHA 3NTCL 5KSBF 2VZ1A 1JF1B 4WHCA 3QG6B 4J2XA 2XQBH 5I74C 1DBAL 1RUQL 3CPLB 4ODTH 1CLOL 2VLME 4ZO7A 2R1WB 3HI6H 4Z78A 4WTWA 4PGBA 3HE7C 4I5BA 1OGAB 4WI4A 4I3SL 3R1GH 4P46D 3ILQC 3QR2A 1EO5A 2AS5M 4WW2B 1OTTC 1T1WA 4LSVH 4RIRB 3WHE1 1ZHBA 1NGYA 3LPFA 4WHTB 2ZSVB 5LBSL 5CP3A 3HC4H 2F5BL 4KJPC 4HKBA 2H9GA 2ADGB 5AYUH 2MFNA 3BRDA 3QBTB 3PGFL 4OGAC 4RBPH 2AI0H 1S7UA 2GK0A 3GUTB 2FGWL 1NQBA 1TPXC 4AG4L 2D0GA 3EOAB 3V0WH 4GRMB 2OZ4L 3L1OL 4GBXA 4Z78B 3VE0A 5C08E 3RP1A 3ZHLA 4RAUA 5SWSE 1K4DB 2YD1A 3WBDA 2ZG1A 1QPXA 5EN2B 5EU6D 4YIQA 2KL6A 1ZHBB 1I7TA 1NGYB 2F8VA 1FNSL 5B3JE 3O6LH 12E8L 4LRNL 3GMPA 4G6JH 3ZE0E 4Y4FB 2H9GB 1KCUH 1V05A 4U3CA 5F89A 1L6XA 2EXWD 5F7WC 2B1HH 3K3QA 4KK9D 1S7UB 2QJDA 5CSZA 1GCFA 5EC2A 3QI9B 3WN5C 4PRPA 2GJ6D 4GRLD 2VTFA 2UVEA 4P9MH 3CLEH 3TYGH 1ZHKA 3MRIA 3OKMB 2P7TA 5C0GA 3AY4C 2AABL 3WD5L 3MACH 4YIQB 4JFFA 2YD7A 3FMGL 5BRZA 4HUUB 2YPLD 4G5ZL 1I7TB 4X4YB 4WGVB 4LK4A 4I9WE 5DC9B 3B4NA 3GMPB 4P59H 5JOPD 2IBBA 35C8L 4JVPA 4UIMA 4Y1AA 1NCAL 3HCVA 1YNLL 4NYLA 5I76A 3MV9E 4I77L 1TZGL 4ZFOB 4PJBE 1U8QA 2LTQB 5EC2B 5GGRB 4PRPB 4U1KB 1MLCA 4Y4HC 3NN8A 4OIIH 4HJ0D 3QUYA 3O45A 3MRIB 1YZZA 3ZKQD 2P7TB 5I1HH 3GBLA 2MCG1 3W2DH 4JO4H 5I0DA 4JFFB 3PWVB 3T0EB 1HH6B 3KJ6L 3MJ8B 4TNWK 2IQ9L 4P5MB 1PAMA 3C9NA 2NLJB 2PYEE 4K3EL 2DM3A 3HCVB 3DX8A 2E6QA 3TVMC 5HD8C 3AXLA 3BUYA 1U8QB 4OGYH 4HWEH 4FZ8H 3OR7B 5GRJH 5HHPA 4PJIE 3VD3A 5J9PA 1MLCB 4NBZB 3ARGC 1ZGLB 2IWGA 2UWEA 3QUYB 5HHOA 2WMPA 1SHMA 3EIFA 1X5XA 3BH8A 1MFBL 1JNHA 5EIIB 1M7IA 5ID0A 5IHUL 3NGBB 1OAZL 1CFQB 3EFDH 3ZKXB 1CU4L 4RGOH 4G6ML 2P5WE 5DHVH 1D5MA 4H25A 1K9TA 1RUAH 5CEYA 5FDWA 7FABL 2XWTB 1X4XA 4M1CC 3MLVH 3SO3C 1AP2A 4P48A 3EO1A 5CSGA 1NLDH 5HHPB 2OYPA 5IVXA 2P5EB 4EI5C 1Q0XH 3MLRL 4ZS7L 2VMFA 5HHOB 4JHAL 4ALAL 3DXAE 4GRWF 3BH8B 1FVEA 3PWPA 3OKKA 2F74A 4XH2A 5EUOB 1M7IB 5FYJE 5ID0B 1JWUA 4MJIA 4DQOH 1KB5H 1N4XH 4NWUH 4AEHL 4CVZA 2AXFA 4TUKH 3U9PH 1D5MB 1FO0B 4H25B 1X5IA 5HJ3A 3Q3GB 5IF0A 3CX2A 5CEYB 4CGTA 1MCSA 4F7TA 1E0OB 5FDWB 3NIGE 5AWNH 4LIQH 1YYMH 1KT2A 5T1KD 4U1IA 2IANB 2BNRB 3HZYA 1AP2B 4PTTA 1Z3GL 1VACA 1ZLVK 4ZOAA 5IOPA 4L9DA 1KUMA 1LDPH 5IVXB 2HLFC 5C9JA 2GTZB 2HTLD 2DQUL 3RVVD 3TJHD 3E0GA 1T5XB 2GKIA 3JV4A 5A2IH 5EZJB 3KPTA 2RIKA 2A83A 3RKDC 1FVEB 3PWPB 4ZTPL 2GUOB 3OKKB 4XH2B 3IDYB 5CWSB 3TBYA 3S9DB 1JWUB 1AD0A 1FIGL 4MJIB 1L7TH 3BHBA 2Y07L 2BVPB 2W60A 4ERSL 2AXFB 1YPZA 2MKWA 4Y8AA 1V7NL 1T5WA 1GZPA 1LO5A 3FN0L 3KPSB 3WFHA 3L95A 1JHLH 4KMQA 2XTLA 1S7WA 1OGAD 5GHWH 1CGXA 2D7TH 2NY6B 1CE1H 5F6IC 4KUZH 1KT2B 2GHWB 4J3XA 1QBMH 3WIFA 4YHYB 1ED3B 5FGRA 4PTTB 3SE9L 3ARSA 1VACB 2VDRL 3OKLB 5IOPB 3DECA 5DVKA 4JFED 4LEOA 3UJJL 4NFBA 4YFDB 4G8GE 5DD3L 3GB7A 3JV4B 3KLDA 5GGTL 5C6WH 3FZUC 4MSWA 4U1HA 5KW9H 3BHBB 5CJXC 4U7MA 3RI5F 3TF7C 2CR3A 1T5WB 5F71A 1CFSA 1S7WB 4MAYB 2HWZL 2R9HD 4OCSH 5D5MF 5D1ZC 4IOFD 1A6WL 3ZYJA 5FIEA 4JO1H 3WIFB 2HG5A 3BQUD 3QCVL 2ITDA 4DTGH 3DX7A 1U3HC 4FQPA 1BJ1J 3FCTA 4LEOB 1CGYA 2BRQA 1P53A 3W0WD 4Y4FD 4YXKL 1HE7A 4KDTA 4HAGA 1PY4A 3A6CH 1GIGH 3UYRH 2IEPA 1F6FB 3QI9D 2DM4A 2Q8BL 4MD5A 2VH5H 1KTLB 1CFSB 4IRSD 2W91A 1MPAL 3EO9H 1FL6A 3HZMB 4U1LB 3LEXA 3QZWG 2HG5B 4HAFA 3DPBA 4I0CC 4PG2C 3TPKA 5IEHA 4NC1C 4S1QH 4U6XA 3VDCA 2BXYA 3C8HA 2H1PL 3GSWB 1J1PH 3HZKA 3VRJB 1HINH 1KLFA 2I5YL 1HWHB 1W72H 2Q86A 3TEUA 1TIUA 4KKNA 4LPWA 2GJ6E 2NR6C 4P2OC 3LPWA 4Y5VC 4ESKA 5DJ0A 5DRZA 3O3AA 4GAJH 3HTLX 2PF6A 3VA6A 4ZXBB 5FK9B 1J7VR 3NPSB 1KCKA 2A1WL 4P5TD 2C5DC 3K1DA 1FL6B 2R0LH 5SX5K 3S98A 3SQOL 5CILH 1K3ZA 2W0PA 4APQD 3LEXB 1JMZA 2DQCH 3T0ED 5DDHA 3V6OA 3BOVA 5I6XC 4JGMA 3UEZA 4W70A 1R5VB 5IB4A 1FFNB 3S36L 3VD7A 2YPVH 3T3ME 2Q86B 3MV01 3R0MA 4CUCA 5BXFA 2ENSA 1E4KA 2OXHA 1IGIH 1XF3A 3L9RA 1B0RA 5DJ0B 1Y18A 3H0TA 5AZEL 5MEND 1RURH 4ZNEA 2Z31C 3RWIA 1UADC 1FZKA 1EFQA 1YQVH 5GGSY 3R8QA 4PD4K 5IQ7L 3N1PC 1VGEL 1FZMA 4FNLH 5D7IB 2FBOJ 4YUEL 4XVTL 2BMKB 1NMAH 2HKFH 1LP9A 4MVBC 4D0DA 2P8MA 3HA0A 5T3XE 1O0VA 4Q0XH 3VGDA 2D03L 3VW3L 1WUNT 4I2XE 2C3WA 2XKNA 1PVHA 3MCLH 4LVNC 1EVUA 4CDGC 4Z8FL 5DI8A 5EIVA 1FORH 1LO0L 3CU1A 4LSPL 1I8LC 1T7WA 1A7PL 4M1GL 1T83C 3L9RB 2AEIT 4PBXA 1WISA 2DYPB 4NQDD 1DANU 1ZHNA 4YHML 1YN7A 5IWLC 3QIBD 1FZKB 5TDOA 3BGFC 1RUQH 1HHKB 3SO5A 1UM5L 2B0SL 3MBEC 1N7MH 3VXRB 5I18H 2VDOL 1HHGA 1F4YL 3D25B 3MRBA 1LP9B 4X6DE 1IE5A 4WI2A 4DWHA 2EO9A 2XWBA 1QSFD 3UTTA 1F58L 4HMEA 1AGFA 2ZJSH 4MJ4A 1PKQA 3F58L 1Z9OA 3PQYA 4L8DA 4S1DC 3RHWK 2F5BH 4RFOH 4L5FL 4YWGL 5CKAA 1NAMA 5JZ7D 1ZHNB 4PGJA 4NPYA 4R2GD 2WUCL 3WMSA 5C86A 1IGYA 2DQIL 4JN2A 5GS1C 5TDOB 1YEEL 1MHPL 4AG4H 1WWCA 4LVEA 4WRLA 2OZ4H 3DYOA 1WZMA 4KZDL 3HLAB 1A9EB 3GMQA 4PJFA 5SV4A 2V7HA 3G5YA 4YXLH 1NGPH 4ELMF 2WWKO 5J11C 1AGFB 2X1WL 5E2JA 5ISZD 3PQYB 4XP4H 4L8DB 12E8H 4LRNH 4NC0B 5JHDD 1SJHB 3NCBB 1NAMB 1X5GA 2R2BA 5IG7B 4OQTL 1VESA 1IGYB 3FT2A 5D9SA 4RZCB 1SBSH 3ZE2E 3MRCB 4HWZA 3U0WL 5E2VH 5FF6A 4OLZL 1PFCA 4NQUA 3CLFL 1LK3H 1UWEH 5I19L 2PTVA 4KV5F 3S35H 1OGAE 2N56A 3OGOE 1PKOA 1XCQB 2FHBA 4PJFB 3EUUA 1ORSB 2V7HB 4GG8A 3SQBA 3WD5H 1BBDH 3T4AB 1GPOL 4UQ3B 1NFIA 5GRVL 2YOCA 3ZMRA 1QFHA 1JGVL 2R2BB 4I77H 2WINB 2ZSWA 3L6FA 3NH7L 5D9SB 5KSAA 3CK0L 1EMTL 4PJ7F 4HWZB 1AIFA 1CL7I 3TWCL 4HJGB 1CL7L 1P7KB 2D7NA 2VABB 4MD0B 4KTEH 5I1CL 2J1KA 5BS0B 1SY6L 5EOTA 3EKCA 3OWEA 2FBJH 2ED8A 1HKFA 1JMXA 1D7FA 3ZSSA 1KNOA 4S10A 1Q72H 5IBUG 4L3EA 4XTRC 4Y2OA 2XXMB 3PGCA 2XY1A 4LKXB 3BZ4A 2ZSWB 3L6FB 4RFNB 2J5LB 2X4PA 2B4CH 2EYSA 4TVPE 3OAYH 4D0BB 4YHZL 1KPUB 1RHFA 5MHSD 5I8EB 4NRYB 4NIKB 1NDGA 1CGSL 3ALWA 5EOTB 2O5XL 3WKNA 2V7NB 1OAZH 5IBLD 4AY0A 5MEOA 3CFDA 3CFKA 1OWWA 1UWXH 4NO2B 3MRHB 3IAQA 3P4MA 1MJJA 2AGJL 3D6GA 4L3EB 4PJ5A 4M8QA 4DN4H 2BHUA 3PGCB 3RBGA 1MFCH 1RVFH 3SDCC 7FABH 3VFNA 4TTGA 1V7ML 3GIZL 4MD4A 3LEVL 1N5YL 3BZ4B 4FQ1L 2DTMH 1YY9D 4PIRF 4P99A 3QUZB 1MF2H 1NSNH 5DQDL 1D9KC 4HX1B 2X4PB 2J6EH 1F11B 4PRPE 1NBVL 3MLRH 4ZS7H 4WWKC 1HQRA 3AC0A 4YR6A 4ALAH 5FB8B 3MBXH 4NN6C 1N0LA 1NDGB 4V2BA 1QA9A 5E9DA 2BVTA 3EDDA 4JFFE 3T0EE 5MEOB 2R4SL 2IAMC 4JHZA 4MJ2A 5C0RL 3P4MB 2PW2B 4HZLB 3TJEH 3VFNB 4LCYA 3QDMA 5IR1A 2VC2L 3CJJA 4NWTL 1Z3GH 5B38B 4JFHE 1C1EL 4BK4A 2D9QB 4XHJC 2OJZH 5TPWL 3V0AC 4KJWD 4YR6B 5DJ6B 3LQMA 2AJUH 4GFTB 3ARRA 1QA9B 1F3DJ 4WW1A 1FIGH 1M05A 2QHRL 5GJTH 2Y07H 3C2AL 5I16A 4Q9QL 3MUZ1 1F6AA 3VWJB 3WO3B 1ZSDA 2CXKA 4K94L 3JTTA 1HN1A 1TNMA 5CJ8A 2P4AB 1YEKH 4PREB 1PQZA 5IR1B 5JPNA 4QHUA 3PWNB 4GS7B 4R0LB 4I0PA 2ITCA 5F7YC 4WI6A 5JIHA 3MC0A 3HR6A 2P5EE 2H41A 1URLA 1A02N 5HHOE 3QFJD 5F7HA 5F7EL 4LLUA 1HEZA 4KHXH 1SMOA 1S9VB 2ZOLA 3BP6A 5EUOE 3V6BR 2ED7A 1M05B 1RIHH 3U48A 5I16B 1EEZA 2B2XL 4FQCL 4M7LT 2F54D 4KUCF 2Y06L 5E7FA 1EFXD 4Q74A 1CBVH 4K2UL 1WZLA 3FQTA 4XX1E 4RNRA 3WKMH 1A6WH 2IANE 5B38G 2BNRE 4QRPD 5JPNB 1VGKA 4QHUB 4ZPVA 1JE6A 2WK2A 4I0PB 5IVXE 2DQDL 4WW2C 1I7UA 1P4BH 1Y6KR 3ALXA 4ZSOA 1IGCL 3GSVA 1ZS8B 1HEZB 3GJFH 5IQ9A 2HH0H 3PWPE 4LLYA 5F3BA 2ZOLB 3ARYA 2DI7A 4MJIE 1B6DA 3QQ9C 1W8NA 2Q8BH 1EEZB 1H8NA 2M8XA 3AM8A 1A4JA 2A0LD 4EQ3A 3KPSE 4M7LL 3FFCD 4QTHB 5K59E 4NHCL 3RTQD 3T2QA 4RNRB 4IS6B 4JY5H 1VGKB 4ZPVB 1F00I 2P8PA 3H7BA 1A6ZA 2ICCA 3MZGB 3DO7A 4HT1H 5D8JL 1A6UH 3V0VA 4UOW1 1RULL 3MCKA 1JFQH 1I7UB 2H1PH 4HWBH 3QO1A 4UTAH 5EZLA 1YEHL 4WEBL 5HYSA 4HUNB 3ZT6A 4QT5A 4LLYB 5F3BB 5DR5L 3C87A 5CSBA 3OPZL 4O4YL 5I2IA 1JNLL 5C0BA 1FYTA 3I6GB 3GMMA 2IQAB 4G43B 4M7KH 4U0RC 4WVRA 3ULVD 1EV2E 1MWAL 4GBXC 4H26A 1DANT 5BS0D 2GJJA 3VU2A 5D72L 5EO0B 5ITFB 1FDLL 2H45A 1HXYB 4HUVB 1BVKA 3BDYL 2P8PB 3H7BB 5TDNA 4O02H 4Z7WF 4XAWL 1U0QA 4OFKA 4DAGH 2BSED 1VFOA 5ACLA 3DO7B 1NCCL 2Z93B 3MCKB 3AREB 5DTFA 1G7PA 4BZYA 5EZLB 2LU3A 2RB8A 3S36H 4JN1H 4PJEB 5LGKA 4LVHC 2HP4A 2F5AL 2GAZB 4NUJB 2K7PA 3OXSA 1KCVL 3QWOA 2FD6L 5C0BB 3WFBH 3ZYIA 1YMMA 1FYTB 1UYWL 1I9IH 5AZEH 2LTQC 5DRNB 4DN3L 2YA2A 4ZPTA 4K9EH 1Q38A 3WLWC 2VXVL 1WWBX 4FQLL 3G6AB 3AS1A 3U0TB 2X4TB 1SJVA 3P77A 2C4XA 3QDAA 1BVKB 1IC4L 1Y6MR 5FO8B 2X9YA 4QHKI 3LEYH 4F33B 1NMCB 3MZTA 4LHQB 1G7PB 5DTFB 3RDTB 1JYNA 3IAPA 2ICWA 5CGYD 5BOZG 2XT1B 4PJ8A 5L9DH 2J88H 4HFUL 1G7JB 1Q1JL 4Z8FH 1JRHL 2W0FB 4F8TA 4LSPH 3QUZD 3OXSB 3X3GL 3QWOB 5DMYA 3P3YA 5JOFA 4X4MA 1YMMB 4EDWL 3HI5L 5C0DB 2ADFL 4WGWB 1HZHL 4AENB 4O2EA 3VFUA 3QUYC 3P77B 3GKZA 1NFDF 2R0WH 5CGMA 4UT7L 4ZUTB 5DYOA 5LWYL 2DB8A 3NGBC 3TNNA 3ZKXC 1QO3B 2ICWB 2BSSB 5CFHA 3ILPB 1PLGL 3T2NL 2QL1A 2VUOA 3MLWL 1F58H 1FFOA 5D1XA 1AQKL 3O11A 2A77L 1O7SA 5EUKA 4XP9H 1I7ZA 3AGVA 1MFAH 2W9EH 1NCDL 2VSCA 1J05A 1RUML 5FECA 3RJDA 2VE6A 1TVBA 1YEEH 3FQUA 4PGDA 4GRLA 4H8WL 5D1QD 4F9LA 4WI9A 3QDJB 5D7IE 4KZDH 1EUUA 4XC3H 5L88H 2KUTA 4Y2DA 5D4QA 3IFPB 3TNNB 1IQDA 2XKSA 3RPIA 2VZUA 2DLTA 3VFSA 1AC6A 5L7XL 3SDXF 1TNNA 3QXAB 5D1XB 1XIWA 3O11B 1VEOA 1I7ZB 2R2CA 2BK8A 4MXQC 1H3XA 4R3SA 5BQ7B 4ZNEE 4EN3A 3LKQA 3CSBA 1J05B 5FECB 2FJGB 4PV8A 1TVBB 1IAMA 5EBGA 3FQUB 3U0WH 2BZDA 4QTIH 4X9GA 3VXRE 5DQJA 3MUHL 4M7JL 5I19H 3IDYC 3M1BA 4Y2DB 1LP9E 4R6UA 1LNUB 1G9MC 4PD4J 1KN2L 1IQDB 3C5ZA 5E5MB 2R1YA 4K8RL 3VG0L 5A2LH 4HCRL 3VD4A 3VFSB 5KOMC 2NXZB 4NP4L 2UUDH 1RIUL 5DA4A 3RL1B 2NY6C 5HHQA 1I9EA 3OB0H 4HK3N 1OARH 4OAWA 5LAXA 3KNBA 3RWDA 3MV7A 3WDIA 5CJQH 4XP5H 4R3SB 3T08A 5FUOL 5CLWA 4OSUL 3LKQB 4KHTL 3ARPA 5KAQF 5EB9A 1JNJA 4PV8B 4KROB 5D7KD 2DI9A 1J0IA 3B43A 5GZNC 1QLFA 2QR0A 4GMTH 4K3DH 5DQJB 5IW6B 5E2WL 3STZA 4CKVX 4D9QE 1LE9A 4WUUB 3C5ZB 4M48L 2R1YB 4XNXH 2R23A 4JAMB 1SYSB 5IB2A 5H94A 5DHVB 4LBEB 4EUPA 5IJVB 3F7RA 3BFOA 4JKKA 3EYOA 2W9DL 1FC2D 1PYWB 3QEHA 4JKWA 3PQYE 4XCFH 4OAWB 5DJYB 3RWDB 3MV7B 2FCBA 1S8DA 5KANG 3H42L 5F1NA 5DJ2A 1WIUA 5JO5A 3EYQC 4O00A 3G5ZA 4XZUB 2DQFB 3LKRB 2VIRA 1FNGA 2R0ZL 3RX8A 5M7QA 1QFWM 3U36B 1QLFB 3JTSA 1S3KL 2QR0B 5FYKU 1IL1A 1LE9B 3VA2C 2ADIA 4FA8A 1OTSD 3RVTD 3JZ7A 4WTZG 4UT6L 3V4UH 5HDLA 5J6GB 1OW0C 5I75B 4PJFE 1KB5B 1UKSA 1OB1A 3K4DA 2E27L 2O5XH 4LNRA 1YC7A 1U36A 1F97A 3RWJA 1OOAA 3RJQB 4Z7OF 3EYOB 3G6DH 1YYLL 1MCFA 3NABH 1KJMA 1S8DB 1AY1L 1G9NC 3BKJL 3GK8L 3ARED 4DUVA 5IJKC 3OR6A 5T1KA 2Y72A 5F1NB 4FQ1H 3FQWA 4IOIA 3VFRA 2C3VA 3RIAF 2XZQL 2VIRB 2CDGA 3JTSB 1AXTL 4KDTC 2MHAA 3V4VH 1F90L 2ADIB 2Y25A 5D93B 2V2TB 3U4EA 4MAUL 4WY7L 5BS0E 3L3GA 1DP0A 5LGJB 3RI5K 4LNRB 1ZA3A 4ZXBC 1DQJA 3NPSC 1G9EA 4HPOH 1EAPA 2X5PA 2R4SH 2COQA 5DC4B 4Z77A 5C0RH 3DVIA 2R2EB 4N0CD 1XGRA 3CZFA 4KQ3H 1OAXL 2D9CA 3OR6B 1B9ZA 5E8NB 3MV8A 3NFNA 1LO4L 4NWTH 1FAIH 2C3VB 3F5WA 5EG6C 2CDGB 1K5NA 2HT4C 4HDIA 5E5RB 5F7LB 2GI7A 5HYIA 2MHAB 5E8EA 4NGHL 5D7JD 5BMFH 4RQQA 3U4EB 3L3GB 1ES0A 3V7AE 2ARWA 2AEWA 2QHRH 1DQJB 4KMTH 4Q9QH 1EAPB 1FJ1A 3IU4H 3TV3L 4Z77B 3FRUA 4AEEA 1FG9C 2BY2A 4RAVB 5JMOC 4L3EE 1MCOH 1XGRB 1U91A 3CZFB 4IRZL 4M93C 2PO6D 4AL8L 4KRPB 1CIUA 3V6OC 3QULA 3MV8B 3NFNB 3VJ6B 4UI2A 4OTXL 1K5NB 4HDIB 4TULH 2GSIB 3IKKA 4NO3A 2LU7A 2XY2A 5E8OB 4NZTH 2ZCLL 1KC5L 1KEML 4IMLA 1A64A 1WZKA 3DRTA 5DVOA 2R56L 2V2WB 2AXHA 4HGWA 5C0CD 4WU7B 5JR1L 5LXGH 5C0ND 2DKUA 3X13A 3CMOL 1QHOA 3ZTJH 5CBEA 5HVGB 1ZLWH 2E7CA 4W6WB 1BOGB 1UCBL 3QIUA 4DUXA 3QXWA 1ADQL 2Y06H 5I1EL 2VZ3A 4IRSA 1U91B 4UBDC 4W4OA 3QULB 3NVQA 5ILTL 3SN6N 4JO2H 1UACL 2HRPH 5E4IA 2YD4A 1KLUB 3Q1SL 3U0PB 5ABDE 4HGWB 1W72B 1MUJA 3Q5OA 5GISL 3X13B 4XPFL 3U46A 4MA8H 5CBEB 3SGDI 2XKUA 4BZ1L 4X0KA 5H8DA 1MCNA 3L5JA 4JPVL 3QIUB 3IXTA 1RZKL 4A6YH 3TBTB 4LSUH 4M7LH 5EOCH 4DGVL 3MRNA 5AD0B 1PY9A 4K71C 2H3NB 1U8MB 1CQYA 3SHSA 1F8TL 4FXKB 4L4VB 3SKUD 4N9OB 2ZZUT 5D8JH 1NCWH 3VXPA 3T0VA 4WNQA 4G9FD 2XRAH 5FOBA 1YEHH 4WEBH 4PV9A 3MLSL 4RMWA 2GCYA 3LH2H 2C1OA 1MUJB 4Z7VF 4U0QB 4JRYA 5DR5H 4CU7A 1ONQA 2DS4A 3K8MA 3U46B 1ZK9A 5BZWB 3N0PB 5DQ9A 5F9OH 5I1LB 3W11D 5MENA 5IB3A 3ZYZA 2MQ0A 2JIXA 2V17L 1NC2B 1Q9LA 3LCYA 3QEGL 1MCCA 1JPFB 3IDXH 4XPBL 4WO4D 2KQNA 3VFGL 5D72H 1JZ4A 1FDLH 3LKOB 3P11H 3UAJD 3MGTA 4BELD 2WUBL 2JJTA 4PP2A 3VGAB 3VXPB 4OZIF 2MPAL 3LZFH 3U7YL 1NFKA 4WNQB 1C08A 5FOBB 4U6YB 4PV9B 4KDWA 2GCYB 3UTPE 3UTQA 3E6FA 3HNSL 2KDGA 1KCVH 2FD6H 2ZUTA 1UM4L 4NQDA 3F7VB 4JHBA 5IB5A 2JIXB 3QIBA 2CH8A 2VXVH 4FQLH 3R8BB 4F7MA 1Q9LB 4TYUA 3VGEA 2R2HB 5E2UL 2HT2D 5ITBL 3ZDXE 2OZ4A 4PG9A 3MGTB 3MRPA 1BLNA 1IC4H 1AR1D 4PP2B 2EDWA 3DVGA 3ABZA 5KVDH 3GKWH 3OBAA 3GMNB 3DHMA 4ZSOE 5DRXB 3ARTA 5FGSA 1HNFA 4XVUC 5C07A 2QQLL 2SEBB 3FAXA 3MJ7A 4ZUUB 2Q8AH 4B41A 3E6FB 4NQCB 5BO1H 1JRHH 1ZLSH 2HT3C 4JCLA 4ODWA 2QQNL 5IHZA 2OTWB 2X1XR 3EZJB 3MOBH 4M9OA 4EDWH 3FAWA 3ALPA 2Q3AA 3WV0A 1LO2L 1Q9WA 5IB5B 1ND0B 5KSAC 2VR5A 1BM3L 4MYWB 4F7MB 2XXCB 2WZPD 1CD8A 3KPRD 2FEDD 3L3JA 4PG9B 1D5ZA 4P2QD 4UT7H 4X98B 5HGBA 1BLNB 1WCBA 1T0MA 3NCJL 1U8NA 3DVGB 1GH7A 5IKCA 3HRZA 3ZE1E 1NGZB 1JWSA 1PLGH 1BFSA 5C07B 1I9RH 3MJ7B 4PJEE 1G6VK 1D5IL 15C8H 3C60D 4ODWB 4OLWH 4JPWH 5DC0A 5ISZA 2ICEA 2DQTH 2OM5A 3JWOH 3CCHA 5C0BE 3QZWA 1FYTE 1H0DA 3LQAL 2Y9RT 3VFTB 3I6LD 2WV3A 3C6LD 5AZ2H 1RUMH 4NJAL 1H3PH 3ARDA 4XGZA 1ZAGA 3L3JB 1N0XL 5K9OA 1D5ZB 1Y6NR 4H8WH 2W07A 1T0MB 5FV1L 2VB5A 2FLBT 4QEGA 4BUGA 1U8NB 5EZIL 3W5MA 4CNIA 2HLAB 3HRZB 3MLZL 4K8RD 5F7MC 5BCAA 1CFVL 1WK0A 2H8PA 5EU7E 5HY9B 1RZJH 1QRKA 4X6EA 3JVGA 1R6VA 1GC1L 1B3JA 5C7XL 4KRPD 5L7XH 1WAAA 3RVUD 3SE8L 2ICEB 4H1LH 3LB6C 1YMME 4U31A 4Y7MA 4OV5A 1HYSC 2F9BT 4CMMB 5IFJA 3TH2T 1YDPB 3Q5YA 4YHLH 1QVOA 2ESVB 3ARDB 4M43L 3OAYK 4XGZB 1N2RA 2ZUQC 5K9OB 3QNYB 4M7JH 4LCWD 4CNIB 5AUMA 3D87B 3S5LA 1KN2H 2DJUA 2H8PB 3HB3D 3KYKH 3I2CH 1F4WH 1BGXH 2YC1A 4X6EB 1IAIL 1UZ6F 2I24N 4KKBD 5ELIA 1WFTA 4UDTA 2D7OA 1NGXB 4QGTA 5DD6B 2WM0A 4X4ME 1LE5A 3KPQB 4H5SB 1BQSA 4GS7C 4R0LC 4O9HL 3MRKB 5IFJB 4KDVA 1LO3H 1QVOB 2J6EA 3QEQB 1AXSA 3ROLA 3VXSB 5LQBH 1N2RB 2KZ1B 3QDJE 1MIEL 3SDDB 4NRXA 3QA3A 1XGYL 5AUMB 4POZD 4M48H 4RDQG 3MUY1 1BD2D 1UQSA 3EDEA 1T1ZB 2EXYD 4W81A 1ULVA 4UDTB 4MDIB 3U30C 4J7RA 3OKNA 4NQSB 1LE5B 2ZKHL 1L0YA 1QBBA 4X5WA 4DZ8B 4I0PC 3K74B 4AJ0A 1AXSB 1A22B 3PGDB 3ROLB 1J88A 2F19H 5I66A 4P4RA 1S3KH 2VZVA 4QLRA 4NRXB 3QA3B 2WSKA 5D2NA 5MP6L 1BZ9B 5FHBL 4LU5H 4KY1L 4OM1L 5I17A 1BFOB 1J0HA 1DLFH 4KKLD 4PTUA 1BZQK 1FFRA 1UQSB 3O8XD 1FBIL 2G2RB 2E27H 1G7IA 1M7DB 2YD9A 3L3IA 3MRRA 3LN4A 4R4NC 1X5AA 5FM4A 4EOWH 1IT9L 3TLRA 2EDKA 2VAJA 1LEIA 1T66C 1E6JL 3FONA 3KPPA 1AY1H 3OKDA 3BKJH 3GK8H 3WIHL 4X5WB 3QUKA 3O0RH 3HUJA 4KPHH 1ZWIB 2A9ML 2N7AA 5KTEL 4Q6IA 2C4FU 3NAAL 2XZQH 5EIQA 3MRDB 3QNXA 2VXUH 4TSAH 1AXTH 3KYOB 3B9EA 4P4RB 5DVLA 5B39G 2E8YA 3A6BL 1F90H 2P45B 4DKFH 1LILA 1H15A 3JUZA 4MGXA 5D2NB 4L8CA 5GGTA 5I17B 1RPQA 4WUUE 3BO8A 5DEFA 3AM8C 3DETC 2JCCB 3QUML 1R3IL 5EFIA 3LN4B 2RBLA 1UC6A 5I1GL 3PXJA 3U4AA 3UTSD 5DJXA 4PRDA 3MV7E 1OAXH 3OKDB 4HIHA 3ULUH 3QUKB 3QWRA 5DD5L 3HUJB 1MCHA 5F1OB 4Q6IB 1LO4H 5DXWA 2FNBA 4LHUG 4QHKJ 4JKPL 4CJ1A 2X41A 3QNXB 4ZD3L 1B2WH 5ENWB 4D0CB 4BKLA 1A6TA 1DQQA 3GJFA 4ZFZA 1H15B 3KXFD 4L8CB 3UBXI 5TFSH 1CS6A 5E70A 5KVFL 1FGVL 1W0WA 1HIMH 5DF0A 5B3JF 2F58L 3ZE0F 2F54A 1CLZL 1AGDA 4PJ9A 5DJXB 4PRDB 5D7SL 4LLDB 2O5YL 4HF5H 4LIQE 5KN5A 2D7MA 5DLMH 1NBZA 1NMCC 1P1ZA 4L1HA 4NO5B 1YUHA 4YDJB 5EU7C 2Z8RA 3RGHA 3X14A 1BZ7A 2OTUB 1JHKH 3OKYA 3U7AA 2DBLH 4BKLB 1A6TB 2X4UB 1KC5H 3FO2A 1KEMH 4ZFZB 1BREA 3VFWA 5BW7A 2FWOB 4GAGH 2XN9B 4YHIA 2B39A 5EA0H 4GO6B 3TFKC 3LSOA 4ZQKB 3HS0A 4WENB 5TF1L 2APBA 2EO1A 1ADQH 1AGDB 5I1EH 4PJBF 4PJ9B 2YRZA 3FFCA 5LJYH 4N8CL 5KN5B 1W2KT 3RTQA 5DVNA 1HDMB 4ONOA 4PPTA 5IB1A 5JORB 1XH3A 4PJ8C 1BZ7B 3BPOB 5H37G 5F6HI 3X14B 1G0XA 4FQQB 1MSPA 3QXVA 3KWWB 2XTJC 4FQXA 3VFWB 1K6QL 3EHBD 1MHEB 4XPFH 4YHIB 5E03A 2ESVD 1LVEA 3LSOB 3I3DA 5ACZA 3DYMA 5GS0L 3CGTA 1MHCA 3TIEA 4JPVH 4JG0H 2W1NA 4XI5D 1RZKH 4DGVH 2QTEA 3D9AH 1ZT4B 8CGTA 1YEJH 3T04D 1IFHH 4PJIF 3RY4A 4E41A 3MV8E 1JYWA 2N4IA 1OAQH 2D31A 3IDIA 1XH3B 2F53B 2PW1A 1NMBL 4WU5B 1BAFL 3CDYA 3PXHA 5D1XC 3PHSA 1DVFA 2BVEA 2HJFA 3HG1D 4U6VH 3VXMD 3D2UD 1X3DA 3EJYD 4PJGA 3F7YB 4Z6AT 2EXWC 4UILL 1RJZA 3TIEB 4XAKD 3S96B 1EERB 2VDLH 1CTOA 4M5ZL 3BDBA 1EBPA 3SDDD 3S34L 4RMTA 5ESAA 3WXVH 5JUEL 3ZHKA 2FJFA 1MOEA 4F9LC 4XPBH 2P47B 2FJHA 4ZUWA 1JTPA 1QBLH 4Y2DC 1MJ8L 4JREB 5C09A 3VFGH 4E41B 5JOEA 1VA9A 2EDNA 2WUBH 2D31B 2ZCKH 3NZHL 1GZQB 1Y0LB 4LASL 3GDBA 3U7YH 2NXZC 3MODH 4L1DA 3WFEL 1J1XH 1XIWC 1DVFB 2A74A 5GGUB 3T1FB 2HJFB 4HIIA 2E3VA 4M02A 4PJGB 4EN3C 5L0QB 1QRND 5LKNA 1QACA 2YXFA 3NIGF 1RJZB 4LHUD 2DQJH 4RSVA 4KROC 2G5BA 4LAQL 3DURB 4P9HH 3WFCL 2DD8L 5E2UH 2FJHB 4ZUWB 1XFPA 3F8UB 1GAFH 4YDLB 2QADD 3KPMB 3C5ZC 1CG9A 3TNMA 4L4VE 2E5EA 1LMKA 3EFFB 2OK0L 2M1KA 1SJEB 3L3KA 4OCYL 4R97B 2A74B 1KG0A 2I26N 4TPRL 1EHNA 5DUML 2I07A 3CDCA 1MNUL 2VL5B 2X7LB 4HV8A 1RUKL 4OQTA 5ALCL 3SDYH 4JDVA 4Y89A 5JLZA 5HGHA 2FIKB 4N8PA 3RWEA 5IM7A 1FRGH 2AV1A 4EDXA 3ROOA 3RWCB 4U1GB 2BSRA 1II4E 1ZE3C 3MX0A 1IEHA 2E7MA 3TNMB 4HZAA 3MXWL 2ZUXA 1A3LL 4IRJD 2YPKB 4HC1H 1UB6A 4FQJL 2AJVH 4JANA 1AD9A 5IMKA 1KELH 4KWUA 2VKWA 4XC1L 3P9LA 2A9NL 4LGRB 1N5AA 4NUGH 4HUXA 4AEIL 5CMAA 5A43C 1VHPA 1FGNH 2I07B 5JW4R 1S7VA 1EJOL 1I4FB 2HN7A 1ZTXL 1GYAA 4EZMA 5HGHB 1YNKL 2AV1B 3CAFA 1N0XH 4KUCD 5D93C 4AH2B 1S5HA 3SOBL 1A3RH 5EZIH 2JK5A 4MA7L 1SY6A 3MLZH 3SKJH 4YXHL 1ZA6A 1UB6B 4PGEA 4JANB 4PP1D 1GC1H 5IMKB 1UXWA 4OLVL 5E6YA 3P9LB 1CZ8L 1HHJA 1DSFH 4NQCE 2DMBA 5I15H 3SE8H 4HUXB 3INUL 1F13A 4GKZB 4IDJL 3F7QA 2HN7B 5JA8B 4L3CA 2CO6B 5T5NG 5JMRA 2XZAH 1E4WL 1NEZA 4XWGL 2HTLC 3HC3L 2RCSH 2VLRD 3WFDL 2NZ9C 4YE4L 3SCMA 4M9PA 2LQRA 1B4JL 1GGIH 1MHHA 3RVXC 2JK5B 5A3ID 5SX4H 2DICA 2Y7QB 4PGEB 4PGCB 1C5DA 1QQDA 1PZ5A 3GM0A 5C07E 1IAIH 1UXWB 2AJYH 4OLXL 6FABH 1HHJB 3T8XB 1R5IA 4LCUA 1QNZL 4MA3A 4PLOB 4BYHA 4K7PX 3C09B 3HMXL 2AJXH 3GMLB 3RIAK 5D2LA 5J56B 1DZBA 2FX9H 2DOCA 1NEZB 2EDJA 3BT2L 4V1DD 1TVHA 1UH2A 3PJSA 3P4NA 5GGQL 1KACB 4WFED 1GGTA 5C8JA 2C4FT 4OZ4A 3SCMB 4M03A 4PY7A 3G5VB 4KFZC 3BKYH 4I18B 2W92A 3T3MF 2NY5L 3IRZA 4UQ2B 1QQDB 1T20B 4JDTL 1HQ4A 1PZ5B 1YJDL 4XBPA 5FKPB 5FYKH 1EXUA 3WUWA 4CVXB 5C2BH 3MLUL 1M71A 3GSUA 5KAQG 1PEWA 1QP1A 4LCUB 4MA3B 1QFWH 3MRFB 3OX8A 4HS8H 1DL7L 1UJTA 4OUUB 3HRPA 4LCIL 4P23A 5LCVL 2VO5A 5D2LB 1CDUA 1A6VL 4ZFGL 4YDKL 4EXPX 2ESVE 1TVHB 3P4NB 1NGQH 5KSBA 2JF1A 4ELKA 3GRWH 4G7VH 3MLXH 4U2YA 4KY1H 4OM1H 1VKXA 3DGGA 2LFGA 3CH1B 1FCGA 3QIUC 2D0HA 5DMIL 3UJIL 3WSQL 4M62H 1EXUB 1U93B 3WUWB 3UPRA 2UZIL 1M71B 4FFYL 4W4OC 3JSSA 1C7SA 1IT9H 3VXUA 4QXTA 1GGCL 1UWGH 4XMLL 3MGAA 4DGIL 4YQXL 3WIHH 4P23B 2A6IA 1YY8A 4TSCH 3BGMA 3FO9B 1NCBL 5HI4C 3QEQE 3VXSE 3E8UH 1IGTA 4ELKB 4X6DF 4M4RA 4RGND 4WV1A 1RJLA 1A47A 3IDUA 1AO7D 4NSKB 2WIIB 5FYLL 2H26A 5DD1H 3QQNA 1VKXB 3DGGB 4LCCB 3IFLL 2XYCA 1ZLWK 3N1QC 1R3IH 3UPRB 3MUGA 2YS4A 3VXUB 3QPXL 4Y16D 2CR6A 2A6IB 5DD5H 3TCLB 1YY8B 3VGAC 4F9PA 3FQXA 2BC4A 4MZ3A 3S4SA 2VDQL 4MS8C 4JKPH 5DT1L 4JVUA 1IGTB 1YEFH 1CDHA 3TO4D 4WV1B 4B7LA 4MMZC 4MB3A 1OD7A 1HSAB 5J3HC 4NM4L 3D18B 2BNUB 2YKLH 1U8KA 1D6EA 3I3EA 2D4DA 3STLB 4MQXD 4J4PD 3MUGB 4A6YA 2WIMA 5JXEC 4JB9L 4PJAB 1OPGH 1E28A 3X3FH 4FS0A 5IIEA 4IHOB 4BFEA 2IALA 3ZE2F 3IXAA 3D69A 1WBYA 4J8RA 2BC4B 2DIAA 4Z95H 1RZFL 4GKSA 4OLUL 1JIBA 2GT9A 1A5FL 5EU3B 5FUCE 1TZIA 2CLRB 2BNQA 5KSVB 5DHYA 1J1OH 1PSKL 3VWKD 4WIQA 4JRXD 1BIHA 3QPQC 2EIZB 5D2NE 4Q2ZB 4WW2F 1TJIL 1U8KB 2MCPL 1U92A 1D6EB 1EZVX 3CFCL 1I1AB 3STBA 2QHLA 2JCCE 2R4RL 3THML 3IF1B 4YDIH 3HR5B 4A6YB 1AXIB 4NDMB 4LAJH 1W0VA 4E0RB 2VQ1B 5IIEB 1MWAA 4Y0GA 1QSED 4OJFL 4WJ5A 1T7YA 3OSKA 1TITA 1J87A 2G60L 2IALB 3P9MA 4GJTB 3VFMA 2R29H 5T5FL 1N6QL 3HUJE 3IXAB 4XB7A 5C0AD 4UV4L 2N1KA 3W82A 1HH9A 3O6FD 2BNQB 4HGMA 4L4TD 5B8CA 2BY3A 4G9FA 5AG9A 5HPMB 5DFVC 4ONFL 4J23A 3ZTJG 4PJXB 4IOSD 4HS6B 4U33A 5F9DC 3O4LD 4W6XB 2APVA 1XGTA 1YQ2A 3H9SA 4R2GC 3TA3A 4JQIH 5TQ0H 5GS0H 1RJYB 1U8LA 5SWZB 1W0VB 3QRGL 4N5EC 2FO4A 3MRMA 1JGLL 5IFAL 5CUSH 2GTWA 1QSVA 4KRLB 4I3GA 3VFMB 1N64H 2YEZB 5JIPA 2NY1B 2CK0H 5JW3L 3DV6A 5CBAA 1FAKT 2RAMA 1NMBH 3JV5A 1BAFH 43CAA 5FKAA 3RA7L 2VYRE 3FT4A 4PRID 3A67H 2XN9E 4K3HA 1XGTB 3DWTA 5EBMB 3WXWL 1OLZA 3OKEA 3P2TA 1CXKA 4UILH 3TA3B 5HYJB 3HI1A 4UTBH 3HNTL 2CKNA 3MPCA 3ARDC 2PTTA 3S34H 2GTWB 5I74B 4G42A 5JUEH 4B0MM 3ES6A 1U8HA 2BDNL 4HKXA 3GMOA 3WS6C 4LQFH 2W65A 5GXBB 5GZOD 3NZHH 4YHPA 5CBAB 3JVGC 4MLSA 3LAFA 2OP4L 4LASH 4WHYH 3ARFA 2C7UA 1BECA 3WFEH 43CAB 5FKAB 4PY8I 4G7YL 2CDFA 2Y36L 5EO1A 4F3FA 3EYUL 3AB0C 2OR9L 3VI3E 5HYEA 4XP1L 3SJVA 3CVIH 2ZUSA 2ZUWA 4WCYH 4L3AA 2B4CC 5B22A 3JV0A 4LAQH 3UJTH 4AIXA 5ICZA 4Z0XA 4CADB 2DD8H 4X6FA 1U8HB 2BFVH 1C5CL 4P2QA 2AXGA 4ORGB 4JFPA 2IC2A 4KK5D 4YHPB 5DWUL 2F53E 4HLJA 2EE6A 4RWYL 3ARFB 3LKNA 2C7UB 4Y5XA 5GRYA 4JFDD 2ORBH 5F7DA 3EO0A 4OI8A 4OFYA 4DKEL 1P7QA 1CT8B 2CDFB 3C60A 4H1LA 4TPRH 3WDHA 5KSUA 4XCYA 3GSXB 3SJVB 3UP1A 3Q6GH 5DA0B 5JNYA 5I8CA 5HXMA 1FVDB 2CUHA 1TVDA 1OP5H 1GVIA 2DKMA 2XACC 4QXUH 2GY7B 4PLJD 4D9LH 4E41E 2AXGB 4BJLA 1MIML 1NEUA 4JFPB 5D5MA 1KIPA 3HPLA 4FQJH 3LKNB 4Y5XB 2VDKL 5E4EB 5EUOF 1YECL 5C70A 3O3BB 3EYSL 3O2DH 5F7DB 3EO0B 3VDBA 3PL6A 3SEPA 5I30L 1P7QB 3GHEH 2K1MA 4H1LB 4DK3A 4AEIH 5KSUB 4PJGE 4XCYB 5DZLA 3UX9B 2VKXA 1KIUA 3EOBA 1ACYH 1C16B 5I8CB 5JNYB 4GSDL 4LFHG 4QRUB 5FUCC 1PEZA 3OZ9L 1HKLL 2A73B 4UU9A 5HI3D 1PJ9A 3E1F1 1QKZL 5EO9A 3V4PL 4LLAA 4AQ1B 1NANI 1QHPA 4XWOC 5D2NC 5IVXF 4UOW0 5L8JB 3OAUL 3PWJA 3EYFB 3GSRA 5FGCB 1A6AA 1KTRL 4YXHH 3C8KA 4MJ6A 4HFWA 1UXSA 1JWMB 2GFBA 4Y4KA 3PL6B 1ORQA 3MRQB 3INUH 4Z5RA 3U9UA 3VRIA 3RGVA 1AI1H 4P2YA 3T0AA 5GS3A 5CJBA 5K59F 4OI9A 4Q6IC 1I8IA 3O2WH 3RU8L 4FFVC 3TVMB 2JB5L 4UU9B 1E4WH 2IBGA 4JFYA 1XCTA 4XWGH 5E56A 3SY0A 3D39B 1JNNL 3ARGB 1IJ9A 1WITA 4BM7A 3PWJB 4XPHL 2CIKA 4P2RD 4GKNA 1CXEA 3ARZA 4LEXL 4B53A 1WZ1L 4FABL 1BEYL 1IGJB 2GFBB 3WJLA 1T04B 1ORQB 5IESL 5JA9A 3O41B 3BRGC 5CJOL 5KZCD 2QQKL 3RGVB 4DEPB 4J3WA 3V5DA 3K0WA 3VMNA 3EJZD 3PUCA 4MCZA 1TJGH 2GSGA 4G8FB 4CN4A 4JFYB 1FHGA 1XCTB 2Z35A 3OJDA 3ME0A 2YMXH 1MY7A 5F6HJ 5GGQH 4TVSa 4DOHB 3CXHK 3DUHA 3OXRA 1GL4B 4L4JA 3RZCA 2CIKB 2NY5H 5K9JH 2DM7A 1DQLL 1G7HA 1MVFA 3MLYH 3O8XA 4FQIH 3REVB 3QIWD 3SKOB 4HIXL 2O26U 4UV7H 4PJ9C 3QUXA 4C56A 3NA9H 3OKOA 4YEFA 1DL7H 5A16A 4NO0A 3ECBB 4LCIH 5GS2D 1G9NH 2NQCA 4MCZB 3SBWA 5C92A 2GSGB 3KLHC 1C12B 3FO1A 3BPOC 1A1MB 2IPTH 2V9TA 3AS2A 3OJMB 1M6OA 4KKAD 5I8OL 1I1FB 3L5HA 4QRSA 5DSCA 5FYLD 4F7CB 1P5VA 1V3JA 2IH1A 2IG2H 3U4BL 4UIKH 3GI9L 1JN6A 1RFDL 3OGCB 3RZCB 2A6KA 1CXFA 1L0QA 4PRHB 2I60H 3R06A 1G7HB 1JPGA 3FN9A 4X7SL 5GPRA 3RIFK 3ZKSD 4HBCL 4QKXB 2E9BA 5FUZL 4XVJH 2GQHA 2G9HA 4C56B 4OGXH 3OKOB 4MWFA 3HE7D 1I8KB 3GSNL 5FO7B 5FYJL 5A16B 4UNTA 4NQTA 5F6IB 3HNVL 3ILQD 1A14H 3LRSA 3I50H 1VSCA 3MOQA 5I8KL 1OTTD 2OMBA 2A6JB 1AJ7L 5HPOA 1PG7X 4XBGB 4BZ2L 4FQXC 2AKRB 1VDGA 2YUXA 3WNLA 2IH1B 4KJPD 4LLMA 1WFNA 2AEQH 1JN6B 4JO3L 1R3LB 2FRGP 4OBSA 1ROWA 2A6KB 4BFGA 1WBZA 3R06B 1IAKA 4OGAD 4D3CL 4DZBA 4K9EC 4LPXA 2UZXB 4LFHD 3QEUA 1IQWH 1PD6A 1ADQA 4ZAKB 2V5TA 4JREC 4ELMA 3FHQA 1HI6B 3FQNB 1UH3A 5D2LE 2FX8H 3S37L 1P9MA 5E00A 2HFGL 5E8DH 3DSFL 2VDQH 5D7IF 3E3QC 1EEUA 1U3HB 2X4QB 4PJCB 1J10A 1DVFC 4F7EB 1N8ZA 4KI1A 4NJ9H 2NW2B 4R8WL 1DBKH 4J3SA 5L0QC 4NNPH 4O2CB 3AS0A 4Q9RH 4QY8A 4F7PA 4K07A 5CKGA 4DZBB 5T1MA 3KVQA 2UV3A 1EH9A 5J1SC 3OAZK 4PRAA 5JXAH 3U1SH 4DVRL 1KCSL 4YDLC 5CIPH 4EKXA 3HE6A 2VXSH 4MX7A 5L2KA 3DMMA 4N8VA 4L8SA 4YJZL 4WDIA 1N8ZB 1LP9F 2CK2A 3BZEA 1FNHA 2X9XA 3B6SA 3IJYB 1ZXQA 5FCUL 1JGEA 4PJ7A 4G6KH 4XP6L 1CF8L 1U8PA 4KTDL 4QY8B 4F7PB 4C59B 1T03H 5MERA 2I9TA 2BOCB 4Y4HD 3GBML 1FZOA 1FE8L 3MRJA 4PRAB 1SEQL 3VXUE 3JWNC 1QR4A 3VDAA 5ALBL 2BOBA 2IADA 4U1GC 1IAOA 1OP3K 1VFUA 2GYSA 4OJFH 5C0FB 3EGSB 3C5JB 3EOTL 2I25N 2JJWA 4UV4H 5L2KB 3DMMB 3UXFA 1EEQA 2A6DA 2EICA 4JY4B 2DAVA 2AK4B 3GJEB 3HKFA 4WDIB 5T3ZH 1NDMB 1S7SA 4ONFH 3B6SB 4EI6B 3J8F7 2BHYA 1JGEB 3TVMD 3VXMA 4FFWC 5MERB 2I9TB 3RHWF 3O6ML 3EZ8A 2VDNL 1M1SA 1Q9OA 2Z31B 4PJAE 5E5UB 2CKBL 4ZS6C 2IADB 1JGLH 1IAOB 2NY2B 4KVCH 3GBNL 5MEQB 5IT2H 1KJ2L 4UB0L 5KG9A 1KIRA 1UVQA 3G5XB 1XT5A 5DK0A 3X11A 4HH9A 5GQBA 3LS4L 3QG7L 2X10A 5DZNA 4EXKA 4PJFF 1S7SB 3V8CA 4TRPH 4M1CD 3LQZA 3ARUA 3CSYA 1QRNA 5HHMD 3TP4A 4EI5D 1Q9OB 1MEXL 2BVOA 4JRWA 2H6PB 3BSZH 1KULA 4PR5A 5F3HB 1IC5L 3GHBL 3PABA 1S9XB 4FTVB 4N1EA 1YC8A 5DO2C 1UVQB 1A2YA 5CZKA 2D4FA 2HRLA 2EDRA 3X11B 5EOCJ 4N0FA 2BNQE 4HC1A 4OCNC 1J5OL 2VLMD 4X5XA 1EGJL 3P0VL 2FX7L 2J8UB 4YX2H 3O2VL 4PJXE 3PV6A 1HCFX 4GXVL 5TQ2H 3CUPA 1H8OA 3BP4B 2DQEH 3CSYB 4XP1H 3T0XA 4ZFFA 5HHVH 2HLFD 2YSSA 3VXNA 1FL5B 5SWZE 2BVOB 5A2JH 3MREA 5GS1B 4LSRL 1RD6A 4PR5B 4KZEH 4F2MA 4I3RH 3PABB 3IU3A 3RKDD 2C26A 3SCMC 3UDWA 4I18C 1ZOXA 4C4KO 2HMID 1IC7H 1A2YB 1JI1A 1Z5LB 4K7PL 5DWUH 2KBGA 4N0FB 1PBYA 1Q94B 1K85A 1CK0L 4IRJA 4X5XB 1BQLH 3KHOA 4OCRH 2V9QA 4F58H 4J1UA 3L3OA 4P57A 1JK8B 5C08D 5J11B 2QSCH 4LOUC 3U82B 5E08H 5SWSD 4OLYH 1P2CA 3CUPB 5TE6L 5F88A 1JJUA 3D85D 5HYJE 4ZFFB 4NNXA 5IBTL 2YSSB 3PWUB 3MREB 1CXLA 4F2MB 2E7LA 3ZTNH 4I4WA 1TJHL 4CAGA 3FZUD 1IKFL 4U1MA 1J0ZA 1QOKA 5GGVY 3V95A 4YHNA 5F9JA 2XV6B 5DD0H 1UM6H 3V79C 2VDKH 4J1UB 4WFGE 3L3OB 3EYSH 5D1ZD 1MCQA 1NUGA 4P23C 5C6TH 1U3HD 1WQVT 3RQ3A 1CLCA 5T1DL 1INQA 2P44B 3MQIA 3BWAB 4NNXB 2HFTA 4PJDA 1O5DT 3QJFA 1G6RL 5IW3A 1T1YA 3IDJA 5KVGL 3IT8D 1UA6H 4CW1A 2FATL 1QKZH 1S5IH 4YHKH 5JHLH 2H32A 1EHLL 4I4WB 1GGUA 2Z4QB 1MCPL 2CGRL 4U1MB 4LCCC 4RISH 4IIQA 2GJZB 4YHNB 5F9JB 1BX2A 1IGMH 2VLJB 4ONGH 4LKCA 1A7RL 4NKQB 3X17A 5E2TL 3VXTB 3SJVE 1ZEAL 1INQB 3DUUB 4BH7A 4PJDB 2JB5H 3IDJB 3RWGA 4CW1B 3WNKA 2RR3A 3LV3A 4WV1C 1JPTL 2PYED 3MR9A 2L7JA 2NR6D 5CEZH 3GRWA 4C55A 2BVYA 4P2OD 1MI5A 2O5ZH 4IIQB 2FEEI 5E95B 1KN4H 1P6FA 1KFAH 3MRGA 1SYVA 2HVKA 1Z2KA 4X5LA 1WZ1H 1J12A 4FABH 1C5BL 4G8IA 5BV7H 4FP8L 3W39B 4RCAA 1U3JA 3TH3T 1KGCE 1N59A 4J6RH 5CJOH 3V8OA 2AK4D 4QOKA 3WIHA 4F9PC 5CZVL 1BQHA 4IJ3B 4K23H 1H3VA 2P5WD 1K8DB 3CX5K 4TSBL 2X05A 4YO0A 2VLKB 2VUYA 3VG9C 1EO7A 2DLGA 2VZOA 1Q9KB 4M4PA 1MI5B 4WWKB 2NY4C 4XXCA 1UZ6E 2VDMH 2Z31D 3NFPA 2EEBA 4IDLA 2J8HA 5FGCE 3DSNA 4TVPL 2HVKB 3MMEA 3QUMA 4HIXH 43C9A 1TZHA 1A9BB 3DXAD 3F7PC 5DJ8A 4G80A 5FYJD 1UEYA 4BQ9A 4QOKB 1BQHB 4MVBD 2NX5B 1Z0NA 3ZDXF 2LABA 1FL3B 3B5GA 1MQKL 1RU9H 1MFDL 4XNQA 3BVNA 3DX9B 1T3FA 5C71A 3D39E 3MV11 5I8OH 3BKCL 3BW9A 3H3BC 4R4FL 2RJMA 1IVLA 1ZLUH 4ZFOL 3NCYP 5LVEA 1RFDH 1XGQA 2EDHA 3UBXA 2HTKC 3D0VB 4X7SH 4HBCH 4FFZL 4TTDD 2FB4L 3BPLC 3MBED 1JCKA 3D3VB 4G80B 1U95A 1IM9D 2CMRH 3U7WL 1JV5A 1RSFA 1AC0A 4GUPB 4TQEL 2NY1C 1VEMA 5B8CC 4XNQB 5I8KH 3BVNB 1T3FB 3QCUL 2OL3L 5KVEL 3O9WB 5HGDB 3BW9B 5IVOA 4DOHE 4S1DD 3RWHA 3ZE1F 3TO4A 4YFLF 4JFQA 5TH2A 4PY8J 4ODUB 4YBLB 1WICA 1DQDH 4PJEF 3TA3C 2X6MA 4F57L 4XMKH 1IGFH 1QBAA 1MFNA 4G8GD 3UZVB 3ULSB 1NGWB 1GGYA 1QFUH 1RK0B 1JF5A 1ZT1B 3NACL 1BIIA 1VPOL 1FG2A 1I1YA 3BE1L 3Q0HA 3BJLA 5EZOL 4H0HB 1QEWB 1CDIA 3SDXA 4PJHA 5FO9B 2OJEB 2VAAB 3DSFH 1MCLA 3F6LA 3C08H 1INDL 1T21A 1FH5L 4BFIB 1NAKH 1NUFA 5SWQA 3VH8G 5EOQL 1WEJL 4JFQB 5TH2B 4LLVA 2DRUA 4LPCA 1FLRL 4PRHE 3CXHJ 3IDMA 3KYNA 4UINH 1AGCA 4C56E 1BIIB 3LMJL 4EIGB 3O81A 2CPCA 1TQCB 4JM4L 3ULUE 1QSEA 4PGBB 4I5BB 2IGFL 2IH3A 4PJHB 2X4SA 1FO0L 3EOYG 2YUWA 5FA4A 3ARFC 1OGTA 2IPUG 1BJ1H 1T21B 5D7LA 1P4LA 4KKCC 3QCTL 4L4TA 1T1WB 4HPYH 5L2JA 4L8BA 2ZP0T 3JWOC 1AFVL 1CN4A 2X1PA 4XPTH 4HKBB 3O4LA 1NH6A 3P9WB 4XHQA 3IDMB 3KYNB 5HHXH 1AGCB 2GK0B 5A2FA 4U0RB 5ALBH 2FSEA 1BFTA 25C8H 4H8WC 4HXBL 4BK5A 4GBXB 3VE0B 2JE8A 4PB0L 1X6LA 1G9ML 2IH3B 3P4OA 2B5IB 4RAUB 5FA4B 1OGTB 1RZJC 3P30L 4Y5XC 4PJCE 5E4EC 5D7LB 1P4LB 4R7DA 4K3JL 1NKOA 3KR3L 4XTRD 1JHTA 3C60C 4CMHC 4JPIA 4YGAB 2EDBA 3WFZA 2VL4A 4LVHB 1DFBH 3VMOA 3F62A 4DFHA 5JQ6L 1XMWA 5DJAA 1MAML 3BWUC 5F89B 4HBQA 5GSVA 4Y5YA 2VDNH 3MJGX 4GW4A 5CSZB 2CKBH 4LNVA 1RZ8A 2FSEB 3SGEI 3N1MC 4KGJA 4GQ9H 1YEIL 2O93L 1KJ2H 3P4OB 1ZHKB 2V5SA 3BEWA 5EORL 4YHOL 5FA3A 5ESVA 5C0GB 3PP3K 5JQHC 3CXDL 4NC1E 4R7DB 3F12A 3LS4H 3UCRA 3NCMA 3PL6C 5BRZB 4KAQH 1JHTB 2EH7H 3G08A 3SDCD 3QDGA 4GMSL 3CFIC 3M17A 2ICES 4UIMB 4Y1AB 1D9KD 4NYLB 5T3XD 5I76B 2VLKD 5DJAB 1KENL 2EECA 3VFVA 4LL9A 1DEEA 5K33A 2PKDA 4WWKD 4LRIC 5K9KA 4JFOA 4OZFH 1NC4D 3NN8B 5F72S 5MI0B 3GHBH 3BYYA 3O45B 2VXTL 4RX4A 2DI8A 3BEWB 2C3HA 5T1LD 5L2KE 3H6JA 5ESVB 2AK4E 4XMPH 2YHGA 1J5OH 2IAMD 1HWGB 1JZ8A 2OI9C 4PB9L 4Y4KC 2PR4L 4XPAH 5TDPA 2FX7H 3X12A 1BFVL 3G08B 3O2DA 4JCMA 3QDGB 1KF9B 4JFDA 3RGVC 3C9NB 4DEPC 7CGTA 4XNYL 1SM3H 1ZHLA 4H88L 2AERT 3DX8B 3VFVB 3AXLB 3BUYB 4XHJD 3BIAX 1INEL 3WLBA 5EBWA 5J9PB 4JFOB 2EDDA 4S1RL 2UWEB 1RZ7H 5L6YL 2NW3A 1B4RA 4JLRA 5H2BA 3RKPA 2NY3D 4FZEH 1JNHB 4OT1L 4TUJA 2XWJA 3D3VD 3IFNL 4BSVA 1KEGL 3WJLC 4OD2A 4EUPH 1WCQA 3TT1H 1RMFL 5INCA 3T0BA 5EC1A 1CI5A 1ZHLB 2IBZY 3ARVA 4TUOA 1KB9K 4LSQL 3H8NA 1DBML 4YBQD 5CCKH 2YK1L 4LPUA 3EO1B 3WLBB 5EBWB 3WEXA 1AKJA 1V3LA 2NW3B 4NRZA 2UY6A 1I3UA 3P0YH 4FTVE 4JLRB 5H2BB 1CICA 3RZCC 2F74B 4CVZB 3QUXC 3GMRA 2YBRA 4DCQA 5BJTA 2J8UE 5HJ3B 3LS5H 4HH8A 5IF0B 1J11A 4JFZH 3SDAA 4F7TB 5INCB 3ULUC 1I3GL 1FZJA 4UT9L 5EC1B 5IV2A 4TUOB 3HMXA 4U1IB 3SBWC 1MCWW 3HZYB 3FT3A 5T1DH 4LPTA 4EQ2A 5KVGH 3WEXB 1XAUA 2JELH 1AKJB 2FATH 5C9JB 4OF5A 1BVLA 3OF6D 4CJ0A 4N0UA 2A83B 2CGRH 3QQ9D 1WGOA 3TBYB 1AD0B 1DQML 1JPST 3TBVA 2W60B 3V52L 1YPZB 3GMRB 1QD0A 2YBRB 3FJTA 4DCQB 5BJTB 4ZAKC 1GZPB 1LO5B 1LWRA 3WFHB 5HVHB 3SDAB 3L95B 4XX1G 1PG7L 1FZJB 1YEGH 4N0YL 5GGVL 3PHQA 5E2TH 2Q87A 2X89D 1VFMA 4XVSL 3FT3B 2WQRA 1ZEAH 1E4XI 1YMHA 4QXGH 5DRWA 1E4XL 4R26L 1BVLB 5F70A 3GB7B 4LHJB 4N0UB 1DQTA 1ZV5A 3DRQA 3HAEA 4MSWB 4U1HB 2H2PC 3V6ZA 3TBVB 4TVPD 4NN5B 2YN3A 5I1DA 1DTUA 1JPSL 4GBXD 2I27N 4PUBH 3QYCA 3LN5A 3REWA 3PHQB 1P9MC 5A1AA 1RZIA 3O4OC 3TT3H 3N85L 2ITDB 4RAHA 3DX7B 1H3UA 1YMHB 1HOCA 3FCTB 5J6HA 1CDYA 4FQHA 4WUKH 1A7NL 3WNOA 2OR8A 5F9AC 5LG1A 2WAHA 4OFDA 1NAML 2GITA 3GSOA 4NKIL 3PV7A 3TZVA 1V3MA 3WLWD 4PRPD 4ODHL 2VLJE 4MD5B 1RZKC 4WHDA 5DUPL 4N68A 3LN5B 4HWUA 1T2QL 3W9DA 3HE6C 4LMQE 3SE3A 1T7ZA 3KPNA 4JM2A 3DMMC 4JFFD 2E7HA 2VR9A 4PJDE 1IM3A 1EUTA 5F1IA 3FRPA 5IEHB 4U6XB 5HDBE 3UTZA 4CU6A 5J6HB 1MCIA 2EYRA 3HZKB 2B1AL 4OB5L 2CJUH 2GITB 5HSFA 4X7CC 4XXDA 3TZVB 4JFHD 4M6AA 5DRZB 3O3AB 3SE4A 1OQXA 5FYKE 4FFZH 3FB6A 3QUYD 4X99A 1CFTA 2NY2C 3ULVL 4JZOA 1M7XA 3GM8A 3AVEA 2VJXA 5CIPA 4JM2B 4M93B 1P84K 1RK1A 5DDHB 3SGKA 3UTZB 2VERN 5IB4B 2VLKE 1Z6JT 1GGBL 5DMGC 3QCUH 2OL3H 4XCCL 4KK8C 1FV1A 3MFFA 4GG6A 1MI5E 3L5XH 4OZGA 5BXFB 4XXDB 4RMRA 2C1PA 3MNWA 1XF3B 1B0RB 1U8OA 3GO1L 1F3DH 1Y18B 3I75A 3H0TB 3NTCH 4F57H 1RAMA 2P5ED 1ODAA 3ELAT 3I9GL 3RWIB 2EZ0C 4X99B 5HHOD 1CFTB 1UCTA 4NKOA 4P9HC 4EBQL 4M6ML 1DBAH 4GXUN 4JZOB 1FZMB 1CLOH 3M8OL 4MNQA 3BE1H 4QOKE 1DN2A 3FO0L 5GRUL 3BMVA 2BVUA 4CDHA 2NX5E 2BY0A 4I13B 1OAYL 4I3SH 4D0DB 2P8MB 2O61A 1FH5H 3MFFB 2XKNB 3TPUA 3KGRA 4GG6B 2IAND 2CRZA 2IMNA 5DI8B 2BNRD 4OZGB 5E6IA 4MXQD 2C1PB 3MNWB 5LBSH 6CGTA 2MWCA 3CX5J 1U8OB 3I75B 1GSMA 1NUNB 4HXAL 3BAEL 1YN7B 4JQVA 3IGAA 4Q9CA 3PGFH 1DBJL 1F4XL 4POYA 4KU1A 3D3VE 3PWPD 2FGWH 3MXVL 2EDLA 2DQHL 4MNQB 4MJID 3L1OH 4JM4H 1HHGB 2P8LA 3ARWA 1B0GA 2IGFH 4K71B 2RGSA 4OQ1A 5DGRA 3MRBB 3BN9C 4IBLT 1IKNA 3KPSD 1R24A 1CE6A 1EA9C 2O61B 4MNGA 3J7HA 4LGSB 2NY6D 2XWBB 3QCTH 3UTTB 4JJHA 3U79A 4ODVL 1BVZA 1PKQB 5E6IB 4E5XA 3ZDZE 1AFVH 1FNSH 1MY5A 3LQAC 1OTUC 4NPYB 1QR1A 4XRCA 3IGAB 2NTFA 4JN2B 5GZND 4NCDA 5D6CA 5L8LB 1EVTC 3BIKA 5I9QB 3TN0A 3BEVA 1B0GB 1J8HA 4S1SL 5JW5A 4Z7QE 4IRJC 1S7TA 1DCLA 3GMQB 1R24B 4C83A 3G5YB 3P30H 1GC1C 2AABH 4MAYD 3PNWA 1GOGA 4K3JH 1QTYT 2JJSA 3FMGH 3KR3H 4G5ZH 4E5XB 1U2HA 4RDQF 5HI5D 1ZLVH 35C8H 1NCAH 3EYQD 1YNLH 1QR1B 4XRCB 1TZGH 4X9HA 2NTFB 3FT2B 5D6CB 2YWYA 3B2VL 3P0GB 5FF6B 5FGBA 3BIKB 3WNPA 4PJHE 3DTXA 1IEBA 4UAOB 1S7TB 4YHOH 5CD5C 1X5JA 4GG8B 4BH8A 2HFEA 1U8IA 3CXDH 3PNWB 4BA8A 4HHAA 3KLAA 3KJ6H 2Z9TA 3ARBA 1NFIB 2IQ9H 1IRAY 5B21A 3CIQA 2YRLA 3ZT7A 2FH8A 1QFPA 2VITA 4M5YL 4K3EH 1QFOA 5IW1A 1MJUL 5KSAB 3S7GA 1K8IA 3PP4L 1AIFB 4XB8A 4Z0BL 1CGVA 3KS0H 4BSWA 4IIQC 1CWVA 2Q1EA 4XNZC 2P1YA 4ZXBD 1MFBH 5J57B 2EYTA 4KI5E 5IMMA 2HFEB 5IHUH 3UO1L 1BF2A 1U8IB 5D7LE 4PB9H 4OFVA 3MA9L 1CU4H 1N6UA 1HYRC 2DBJA 4G6MH 1N6VA 1KNOB 3MGOA 3ARBB 4ZO9A 4P4KA 2R8SL 5D6DC 4Q7DA 2VITB 3O3EA 4XNYH 4H88H 3OJVC 4IJ3C 2HJKA 1L7IL 5HDQL 2HT4D 2K9UA 4JG1L 5HGGS 5IW1B 4GQPH 2EYSB 3T09A 4FXLA 4S1RH 5EDXA 4BSWB 5L6YH 2FHCA 3ZL4L 1UH4A 3AUVA 4JHAH 2WBKA 1BJ8A 2HFFA 5CJXA 3BGAA 3VXQA 5IMMB 3A0OA 4OM0L 4AEHH 3C6SA 5BRZE 2DL2A 3CFKB 3CFDB 3KAAA 4U1NA 1MJJB 4P4KB 4PJ5B 4G3YL 5D1ZA 4M8QB 1RMFH 3O3EB 4YFLI 4N0RA 4M3JA 4Y1AE 2HJKB 3MLTA 4MD4B 1Z9MA 3SGJC 3TO2A 3QHZL 1KPVA 4YK4C 5TE4L 2IJ0C 2DQUH 3K2MC 1HQRB 3MOAL 4HKJA 2ZUQB 1SJXA 2DYPD 4G6FB 3V7AG 4XXCC 4AYFA 2PXYA 2HFFB 3MV9A 4ZTPH 5E9DB 2XI9A 3RZWA 4C4KT 2W59A 1PW3A 4ODTL 4ERSH 1TQBB 3C6SB 4NBXB 1UJ3A 4N90D 4UBDD 4U1NB 3VXRD 1V7NH 3FN0H 2JCCF 3QDGE 4EIZC 1YN6A 1JYXA 5AYQA 1I3GH 3R1GL 4UT9H 3RY6A 3T65A 4QNPE 1X4YA 2X42A 3LKSA 3MLTB 2AXJA 4LCYB 3QDMB 4PRBA 2FIRT 3SE9H 3TO2B 3PWLA 2VDRH 1KPVB 1SBBA 3FKUS 2X09A 3HUJF 4RRPA 5C1MB 3O9WC 4Y8DC 3UJJH 2UWEE 3UYOD 3HC4L 5DD3H 2PYEA 4YBLC 2PXYB 1KIQA 2CLVA 4G8EA 4Y5VA 5GGTH 3S3PA 5INDA 4WW1B 3QAZC 5F9WC 1F6AB 1UJ3B 3V0WL 1ZSDB 5BV7B 3R4DA 4D9QD 3B9KA 1X7QA 3JTTB 4QRRA 1YN6B 5EBLA 5FM5M 4R96A 3CFBA 2HWZH 1PG7H 2Z92A 3T65B 3U30B 2WP3T 1PQZB 2ICWI 4PRBB 3IJSA 3QCVH 4FOMA 3I3BA 2ITCB 2OS7A 3PQYD 3O6LL 4G6JL 4FXGA 1KCRL 4YXKH 1KCUL 4LLUB 1EPFA 3WJJA 2FECI 4LDOB 2CLVB 4G8EB 4NQEA 5INDB 3BP6B 2FECL 2FL5A 1KTDA 1CDJA 1TETL 1X9QA 2FZ3A 2VDPL 3VFOA 1JPSH 3B9KB 1X7QB 4QRRB 5EBLB 4X6CA 1MPAH 1OAUL 1TQCC 3TYGL 5M94B 2WBJA 3FQTB 3GSNA 3MACL 4ONHA 5CD3A 2E9WA 4ZSOB 1KB9J 4FXGB 1MRCL 3FOMA 3GSVB 5MEPA 1A7NH 2ZPKL 2I5YH 1X6NA 4X8JA 5IQ9B 5KANI 5IMLA 2L0DA 4NQEB 4NKIH 1J18A 3P73A 2FL5B 5GS0C 2FZ3B 4Y19A 1YPZE 1A4JB 4OIIL 5DUPH 2L4OA 4NQVA 3VI3F 2A1WH 4X6CB 3MBEA 2WBJB 3SQOH 4NOFA 1I3RA 5I1HL 1IM9A 4D9RE 2B5IC 3B5TA 1H5BA 4JO4L 4O51A 4KI5C 1A6ZB 2JKXA 4K3GA 2APXA 4M1DL 3V0VB 1R3JA 2HVJA 4XVUD 3QO1B 3QHTC 2E9IA 5HYSB 4OB5H 2YUZA 3FOMB 2HT3D 3RUGA 4N0UE 4QT5B 5IMLB 4OZHA 3L5WA 2NY0B 3S3JA 5TE7L 1HNGA 3P73B 4OGYL 5I2IB 5KSAD 4HWEL 3H3KA 4FZ8L 4Y19B 4B7IA 4DGYL 2D0FA 3GMMB 2XG4A 4L9LA 1T0PB 4RBPK 3QNZA 3KYMA 2FH6A 5IQ7H 4H26B 1A7BA 3ULVH 1VGEH 4U3XA 1I3RB 1ZGLP 4NT6A 5ANMA 4RGMC 4O51B 1WT5A 5TDNB 4YUEH 3EFDL 4RGOL 2QQQA 4XVTH 1R3JB 2ZNXA 4P46A 1RUAL 5EPMA 4L3ED 3VW3H 2D03H 3F65A 3NFSL 5DFWH 4XCCH 3RUGB 4CL7A 4OZHB 4Q58C 4BUHA 3MLVL 1LO0H 5DZOA 1A7PH 4M1GH 5J06A 4ZDHA 1NLDL 3GO1H 3NIDE 4X6BA 2VISA 4GLRI 4YHMH 4ZPTB 1Q0XL 3I9GH 3KPOA 4L9LB 2CQVA 4PJGF 3H9HA 4C58B 1I75A 1KXTB 1G1YA 3QNZB 5MI0C 4UDUA 1XGUA 1UM5H 2B0SH 1KV3A 5ANMB 4DQOL 1KB5L 1N4XL 2VDOH 3BX7C 4NWUL 1LEKA 1F4YH 4X9FA 2G75A 4PLKC 4ZUSA 5HYSG 3NIFE 5EPMB 4GKOA 1T1XA 3E6HA 4PJ8B 4FG6D 5EU6A 2VLLA 4LIQL 5GRXG 1YYML 3K80A 3WHXA 3DVFA 2XTJB 1FNEA 3F58H 1HYSD 4U6HA 3R0NA 5JOFB 3WUZA 4YWGH 4L5FH 4U2ZA 2VISB 3TBWA 3KPOB 2OTPA 4HEME 4NNYA 2WUCH 3H9HB 1DBJH 2DQIH 1F4XH 4O2EB 3VFUB 1XGUB 2CKBA 1MHPH 3S97C 2DQHH 2GJ6A 5E9DD 2A2QT 1KJVA 1L7TL 5ADOL 3CU7A 2X2YA 5DYOB 5T5NF 1KJ2A 1A4KA 3VWJD 3V6OE 2NZIA 1WTGT 4ZUSB 3MYJA 3PIQA 3BD5A 1JHLL 5FXCH 5GHWL 5TF0A 5EU6B 1CE1L 4KUZL 2YPLA 1FFOB 3NCFB 4ODVH 2GW5A 5EUKB 5DJCA 4KJYA 2CLZA 1CIDA 1YEDA 4OQTH 5IP4A 2OX5A 2VE6B 4OZFA 1U3YA 4PGDB 4MJ5A 1JGUL 1DN0A 4GRLB 1KJVB 4N90E 1TXKA 4OLZH 5KW9L 3CLFH 3DO3A 1KJ2B 5IK3A 3BKML 2XICA 1A4KB 4JGJA 1KPRA 3MYJB 3PIQB 1SEBA 1MCKA 3OMZA 2YD3A 3RPIB 4OCSL 4B50A