5E56A

Crystal structure of mouse ctla-4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
b'IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxic T-lymphocyte protein 4
publication title Crystal structure of mouse CTLA-4
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e56A00
3Q1SH 1CI5A 3GGWB 5HGDA 3KPNA 3QT2A 5ISZA 5E2TH 1I9JL 5KSAC 2B20A 4KQ3L 4ZTOL 4PS4H 4JY6A 1BFOB 4RFNC 4KY1H 3M07A 4HIEB 2LU7A 3N1PC 2WIMA 1D5ZB 5FO7A 3RY6C 5T5NF 2NW3B 2BVOA 3BVNA 3BEVB 3P4NB 3V5DA 2C26A 1XGTA 4PRID 2DYPA 1SJHA 1FV1B 3O6FC 3L3KA 5B21A 5E2VL 2CDEB 4MQTB 3FB6B 3EYVA 1WT5A 4OTXH 2UYLB 2V5MA 1KLUA 2HFFA 5A2FA 3BP5B 1RIVH 3PWPE 2CLRB 3PP3K 4Z7VF 4MMXC 4PB9H 5FDWB 3KPRE 3P73B 1JF1A 4H20L 4GUPA 5DI8B 1R0AH 3K1DA 4G8GB 1FHGA 4XNZC 1F11A 4Y16A 4UIKL 2J5LC 4YAQA 5E9DE 2HG5A 3MACL 4PJXF 2D7MA 1G9MH 3LEXA 4FS0A 2ARJA 4K7FA 1E4WL 1U8HB 1AXTL 1P4BH 1YMMA 2P5EA 5AG8A 5A3ID 4MCZA 5FECA 3C6LB 1T83C 1VPOL 4ORGA 5DEFB 4OSUL 1X5KA 1SEBB 1RZGA 4ELKA 1BM3L 1L7IL 3P0YH 1D3CA 1JWMB 2BNRE 3U83A 4JFQA 4HC1L 1BBDH 3MLWL 3RBSA 1MNUL 2W07A 3IRPX 2JF1A 4QRTB 4ONFH 4K55A 3RPKA 3MNZA 3CGTA 4BH7A 1BVKB 2P8MB 3GB7A 4M5YH 4W6WB 5EULV 4G7YH 4XPBL 2PO6B 4YHKH 1EFXD 3EJYD 4JZOA 4KJPD 2QKIA 4FZEL 1REIA 4EI5B 3NCEB 5IFHH 1W8OA 1GGBL 1HHJA 1S7XB 4DQOL 4K7PL 3B3IA 1YQVH 3T1FA 3QI9C 2Z31C 4S0SD 3UZQA 3FQTA 5EA0L 3VD7A 5DJ2B 5EO0A 1CLOL 4FXGA 3OGOE 1FYTB 2IQAB 1ZA3B 3G5VB 5CP3H 3UXFA 2WWMC 3TJEH 3JWOL 2K3TA 4QXGL 4FFVC 4ZFGH 5F70A 3MOAL 1ZANL 5D2NB 3FQUB 1D5IH 1N2RA 1U3HD 3O2DA 4NKOA 5T3XH 1MQ8A 3TCXA 1QRND 2AXGB 5D93B 4MAUL 2N7BA 4HIXH 4JRYB 1TQBC 5BRZD 2RGSA 1U92B 3TBYB 4I77L 1ZLSH 2ITCA 5IT2L 4NGHH 3QG6B 4HKXA 3R8QA 5ILTL 4HMDA 2NY0C 1TETH 5DURD 5GS1C 2XWJB 4I1NB 4UDUA 3MFFB 1BOGA 4UBDC 1L7TH 5GS3A 3ZDYE 5B8CC 3RA7L 1CLYL 5E8PB 4OB5H 3BKJL 1CXHA 4OCYH 2VLMD 3T0ED 3H3PL 2V2WA 1H5BB 5IB2B 4MNHB 2WQRA 1YEJL 2GIYA 1QFUH 3CC5B 4WTXA 4D9LH 3QNZA 1D7FA 5TQ2H 1MVUA 3WO3B 3E3QC 1JF5A 3B8YA 5FYJL 3MODL 5MENB 4GAGL 2R0LL 3MYZA 2CD0A 5EFIB 3BUTA 3GO1L 4N1CA 2X6MA 3IJYA 2NY6D 4NC1C 5IEKA 5JPNB 2W9DH 1JNLL 3CDFA 4DKDC 5CUSL 5EU6B 1QLEL 3W5NA 1FE8L 5IV2A 5DJDB 3LD8B 4ONHB 4BKLB 1CFTA 5JHDE 3VGEA 5EU5B 2J2ZA 1J0JA 1XF3A 2CIKA 3BP4B 3VXQB 1T7VA 2VL4A 5I6XC 3VGAB 1FGVH 1IGJB 3MRQB 4EJ1C 3PL6A 1MUJB 1HSBB 2UVEA 4GMTL 2J3SA 4KMTH 4B0MM 1MPAL 4KROD 5C0NC 3REWA 5KVEL 1S3KL 1N8ZB 4R0LA 1KEGH 1T04B 3V79C 4KV5F 5AAMA 1T2XA 1ZA6B 2BVYA 3TM6A 4LCIH 5JNYA 2GAZB 2GY5A 1SVCP 2ZSVA 4P2OA 4TNWK 4NJ9L 3UBXA 5C0BE 1XMWA 2NW2B 3N1QC 4XP4L 3FN0L 2FGWL 3PGCA 2Q76B 3TCLA 1DTUA 2OI9B 4G5ZL 5GIRB 5KZCD 1A7PL 3B5HA 3WIHL 2P1YA 3C60A 4XBEH 5DQJB 3ZYJA 5I18L 3BN3B 5B3NA 4FQQA 4FFYL 5CWSB 4X7TB 2NY3D 1OPGH 3F62A 4X4ZA 5BMFL 4WUUD 4X99B 2X4RB 4UI2A 3WHXA 3NCYS 2VDPL 3WUWA 1CLCA 3UJTH 2Z8SA 4MHHI 5C6TL 2F58H 1EZVX 3NGBB 5DO2D 3LAFA 4JO1H 4PJCA 3RBGA 3UTZA 1DQJB 3MV8D 3VD3A 3F7YB 5BVJB 2EDEA 2Y1VA 4OF6A 2VLJD 4YHYC 3GMMA 4X8JB 4CADA 2DM2A 1LO3L 4ZTPH 1NGQL 5GRYA 5HXMA 5J3HC 5D1QC 4X6BB 2EC9U 2C1OB 5SX5H 1JUFA 5D7SL 4OF3A 2DM7A 5CD3A 5I8EA 1AJ7L 2ZG1A 3BH8A 4YXHH 5DMGD 3RAJH 4JO4L 3I6KB 2BOBB 5D5MB 1J0ZA 2FJFA 3OR7B 5L6YL 3RJDA 1S5IL 2YK1L 3FO0H 1Y6MR 2OJZH 2YBRA 3K8LA 5INDA 4K3JH 2DQTL 3UMTA 3KPMA 4FQXA 4OCSL 3IB4A 3S34L 2X4SA 5EO1A 1AXIB 1OGAA 1YEGH 4IRSC 4Y0GA 3A6CH 4TSCL 3FFDB 3IKCA 4H5SA 3HNSL 3E3QE 4O4YH 1Z5LB 4H1LH 3MSPA 4AMKL 1U2CA 2E27H 4NQCD 4MA7L 4UIMA 4O2CB 4I3RL 3UTQA 1OVZA 4KMLB 4IOIB 3HUJF 4YC2C 1K8IB 4NC1E 2NX5D 1EERB 5HHOE 3ARBC 4C83B 2NTSP 1AFVL 2Q8BH 5ALBH 5E7FA 5F1KC 1W0YT 3MV9D 5F3BB 2P24A 4J3SA 4LPXA 2JCCB 4NQDD 4JREC 1NLDH 1JGVL 4JFFD 3LB6D 3QUXD 5L2KB 1UYWH 3AMKA 3QDGE 4PRDB 2P45B 5T33L 4OV5B 3GSVA 4PP2B 1IAOB 2W60A 4OD1L 1PX4A 3JWDH 1Y18B 1CL7I 2ATPA 1AGFA 3LKQA 4Y19E 2OL3H 5INCB 1OB1A 1NGWB 4ONGL 4P5MA 4ZO8A 2OR9H 5ADOL 2GK0B 3UDWC 1N5YL 1F4XH 2H2SC 4Z7WE 2B1AH 1LILA 5FA3B 3V4PH 4PJ9B 2C7UB 1A0QH 5TFSL 3LQAC 3U4EB 4TVPD 4XMLH 3CAFA 4JO3L 4KZDL 1NMAH 3VFSA 4RFOH 4GRLB 2HH0L 1OGTA 1IM9B 2GTWA 4O9HL 2YD6A 5H94B 4P3DA 1LNUB 5D7JA 1RMFL 4Y1AB 2H6PB 3QFJA 5H37H 3DTXA 2HJFA 3F7RA 2PTTA 1J0HA 1E4JA 2DI8A 3LRSA 3BGFC 3MLSL 4L8CB 2DKMA 3OAYH 2OTWA 4N8CH 4TULL 4ZFOB 2HKFL 3ARUA 3IU4L 4BZ1L 4HBCL 2X4OA 4YFLF 1YECL 5F1IB 4NWTL 4BUGA 1NBVH 4ZUWB 4HBQA 1WZKA 2Y5TB 4TRPL 5C8JA 2DMKA 1TCMA 4JQIH 5LVEA 3NZHL 4PRBA 3QPXH 4PJ5A 4OLUH 1UC6A 4JAMA 5E95B 5IROA 2FR4A 2F53B 3ZDYF 3ZE1E 3ARVA 4JRXA 5FEBA 1DBJL 3UJIH 3P40A 1GC1C 2D3VA 1JHTA 4UQ2A 1DSFH 2ZNXA 1LP9B 1C08B 3QHFH 2O5ZH 2HVJB 1JI1A 3P4OB 4O58L 2RFXA 2VDLH 2D31B 1S78D 4HGWB 2QSVA 4K9EH 1YC7A 1KN4H 4Y5YC 2B0SH 1NCAL 4PJ8C 3MZTA 3QNYB 5DD3L 1IEBA 5FIEA 2D2OA 2VITA 3MLRH 3DARA 2O61A 3MJ7A 5IW1B 4L5FH 4G6AC 4XPFH 4ZAKC 4P2RB 4LCYB 5D6CB 4XCYB 3D5OF 5IQ7L 4L4VA 1RVFL 2X4UA 4J3OC 2YSSB 1CK0H 3GMQB 3SOBL 4OAWA 4LGPB 3I3BA 4G6MH 1G7MB 1GGTA 1XF4B 5AEAA 3TF7C 7FABH 2A9MH 1M6OB 2HJLA 2WZPD 4Z5RB 5ICZA 2ICWA 1RV6X 4YDVB 5J6GB 5CD5C 4LEXH 4OCLC 5DFTA 4FTVA 1WBZA 2APBA 4HW6A 2NXYB 1TQCB 4FXKB 3K4AA 4IRJC 3UZVB 3UBXI 3M1BA 1CD1A 2OTUA 4RZCB 5F8RC 4KJQC 5C0RL 1S7WB 1QSFA 2R1XB 5BO1L 4X98B 3OKDA 4OGAD 4DKEL 4P5TB 5EH1A 4RQQB 4NQVA 4QRPE 4IIQC 5KJRL 3IFNL 4Y4KD 5F9DC 3RDTB 3RVTD 4D3CH 4LPCA 1L0QA 2SEBB 4QXTB 2EZ0C 5DJAA 1IGYB 2F5BL 1N4XL 1FG9C 2BSSB 2V9QA 5E8OA 3JV0A 3CSYB 4A2LA 3FT3A 4Y5VB 5C2BH 5C09D 4HWEL 3LKRA 4X80L 5HI5D 1I1YB 4DVRH 3QIBB 1U8OB 2H3NA 3HAEA 4NZRH 3IFPB 1B6DA 4Q2ZA 4S0TD 1AY1H 3E2HB 1KIPA 4OLEA 3BGMA 4PBVC 2EDXA 2D03H 2UWEA 2A6JA 4KHTH 5D7LE 3QDJA 2MNUA 4LIQE 3STZA 2JJTA 1INEH 1S8DA 1F6LL 1NAML 2DB8A 4Y4HD 2AKRA 3VJ6A 4OLWL 1I9IL 3QRGH 4M61A 5F1OB 4EDXA 3OKEA 2X1WL 4IEFB 1KENL 1SY6A 1FL3A 5ICXB 5DTFB 2ZUSA 4RWYH 4WENB 1EDQA 4NO0B 3AAZB 1A6AB 3S5LB 1X5HA 1BZ7A 5EBWA 4C54A 4ZUTA 3VXRB 1RIUH 4YZFE 1U91A 1U95B 2A9NH 1KB5B 1YN6A 3L3HA 3VXSB 2ZNWA 1BX2B 2A1WL 4Z18A 3B43A 1MOEA 4NOBA 5DRNA 4JDZB 4DZBA 3KPQB 5B3JE 1I1AA 4PG9B 4E42B 4L8SA 4ODHH 4QHUA 3MRHA 2NPLX 1FVDB 3KWWA 3FT4A 3DSNA 4EQ2A 3QEGL 3TBTA 3TPKA 3NFSL 1QLRA 4DUWA 1D9KC 1JPFA 4Z8FH 3AY4C 3S35X 1KBGL 3X13A 4WO4B 2BDNH 4U6XB 3TH2T 1WAAA 4LOUD 3SE3A 4ZUSB 1B6UA 3MV7A 5IGXL 2ILLA 1DBBH 2AV7B 1X5LA 2X10A 4R4BB 5IVZB 2GSGB 2X40A 5AUMA 4TOYH 3S35H 4H88L 5KN5B 3KHOA 4FQ2H 4F9LA 5D8JL 4C4KO 5GJSL 3SBWC 5MHSE 3MUGA 5DUBA 5GPRA 4M7ZB 4DN4L 3QQ9D 1ZLUH 4XCNA 4J3VA 3DGGB 4ENEC 5BW7A 3WFDH 5EN2A 4PTTA 3IFLL 1N6UA 5TE6L 3TZVC 3EO1A 2MTPA 4QNPE 1EVTC 3LHPH 4Z7WF 1KG0A 1LEKB 5IHZA 4JM2D 4P46A 4F37K 1YNKH 2E7LC 2A73B 2VLKB 2FWOB 1BZ9A 1N64L 4D8PB 2VZTA 1MF2H 3QA3B 5IHUL 4MQ7A 3U7WH 3SGKA 5IKCB 5C0EA 5SV4A 2J6EA 1MJJA 3FO1B 5T1LD 1GYAA 3EYUL 4YR6A 3MJ6A 2JB5L 5F9WC 3V6ZA 2XWTA 2H45A 3B9KB 4HWNA 1G7PA 5EIIB 3RZCB 4HHAA 4LSUL 1MRDL 5F44A 3QHZH 5FK9A 5KVDH 1KEML 4Q74A 5DLMH 2ID5A 3OBAA 5I2IB 2PYFA 3T4AB 3IDYC 1ZT1B 3DETC 2IANA 3RTQC 2CKBB 3GUTA 4GBXC 1DP0A 1L9NA 2R1WA 4ZSOA 4Z78B 2Y07L 3ZE1F 3Q1SL 3DIFB 1JWUA 1DQLH 4WW2C 3N85L 4YHLH 3GHBH 4MAYC 2RCSH 5E2TL 1P4IH 1ND0A 4N8VB 4QYOB 2BP3A 4PS4L 2FRGP 3JTTA 4Z7VA 1W72A 5C1MB 5KSUB 5C0AE 4POUB 4KY1L 1AO7D 9CGTA 1EFQA 5DUPH 3FQWB 2A6KB 5IVXB 3NH7L 4PJXA 5T5FH 4U1SB 4PJDE 3KYNB 1KB5H 4F7EA 2PYED 3ZMRA 3WLWD 2KPNA 4LHUG 3GBLA 2BXZA 3MRJA 5HJ3B 1UM6H 4G9FD 4OTXL 1IGCL 3ULUH 4WU5A 2XRAH 4RAVB 3AU1B 2XN9E 4PB9L 2VRAA 1TTGA 2ICWI 5I8CA 3H9SE 1FFQA 1DUYA 5HI4D 1R0AL 4I0PA 4LSQL 4UILH 1R24A 3PWVA 1U8JA 2YKLH 2NY1D 2GJZB 1ZSDA 4KDVA 4K8RL 3W9DB 5AG9A 1E27B 4Z7NE 4KHXH 4RAHA 2DQIH 4RGND 2UY7A 3O6MH 5TGBA 3X3GH 3ARDB 2C4XA 1AD9B 1U8MB 1IKFH 3IXTB 1SMOA 4WUKH 5F7EH 5F7NC 3D2UB 4I4WA 3MRMB 2X9YA 1OD7A 1LO5B 1BBDL 3LV3B 2EE2A 3EYOB 3B2VH 5DVNA 3FQRB 5B38B 5T3ZD 4ONFL 4EUPB 4HDIA 3HZKA 2BVQB 4R97B 4M5YL 3U36A 4G7YL 1NCBL 3PJSA 4YHKL 5KAQG 4CMMB 4X83A 2EYRA 4NT6B 2VISB 3INUH 1S7UB 5CBAB 5MEPA 4LU5H 3BZEA 1WK0A 1J86A 4WEBH 5C7XL 1EGJL 4X7DC 4OM0H 2BVUA 3RKPA 1CD8A 4JKPH 5EBGA 4PGCA 5HGAB 1YQVL 2EDWA 3GIZH 3RX7A 1CDGA 5DJ0B 2VKXA 1KB9K 4RISH 3TJEL 5C70A 4KKAD 3FO2A 3UROR 4ZFGL 1KTLB 1T3FA 3P9MA 4GJTB 1LE5B 1M05A 3C6LC 3PV7A 1D5IL 1WBYA 1J05B 5CEYA 5T3XL 3X14A 4FMFA 2EDFA 4QF1B 2CKBH 3CXHK 2WLZA 4MZ3A 5GRUH 4UT7H 4YZFF 1DDHB 3VGBA 4W68A 4OFDA 5F7KC 3RQ3A 5HDQL 1ZLSL 3RWCB 4RCAA 4NGHL 5SWSA 3MCLH 2GFBA 1HXMA 3QWOA 5BZWB 4QRRB 4PUBH 2AV1B 1L7TL 4GG6A 1HNFA 2OMNA 4EI5C 2OXHA 5F7LB 4OB5L 4WHYG 1FNAA 5JDSA 1BF8A 4OCYL 2DLFL 5KAQF 3SPVB 5HGDB 1GHFH 5ISZB 3HPLA 1QFUL 5HVHC 3H2WA 1G7LA 4OT1L 5C07A 3AREA 1U42A 3K3QA 3MRKB 4JY6B 1T66D 1C5CH 3ALPA 4IBLT 2EDOA 3MLUL 1RULH 4OCWH 3DV4B 2LU4A 5D2NC 3BW9A 1FO0H 3SGJA 1DEDA 5BV7H 3BVNB 4KI5D 2W9DL 4O2EA 1FN4A 1TNMA 1FVEA 3V5DB 3BFOA 5LAXA 4R7NA 5JXED 3FTGA 2PXYC 1SJHB 5FGBC 4PRAA 1QRNB 3L3KB 4BK4A 4XBGA 3D3VD 4XPAH 1HILA 3HC0B 3EYVB 3VG9C 1NDMA 3CFKA 3VXUD 3E6HB 1KLUB 2HFFB 3O11A 4QNPF 1FGVL 4P4KB 2UZYB 2WUBH 4MJ4A 3SDCD 2Z9TA 1MFCL 5DUML 3S36X 4RRPG 4UV4H 4KMTL 3BQUA 3U48A 5C0FA 3G6AA 2YWZA 1JF1B 3VMOA 3L5XH 1SYSA 4JPWH 2PETA 3OGCA 5A1AA 1WLHA 4GUPB 1RUQH 2YOCA 4LRIA 1F11B 4Y16B 2WK2A 4LCIL 5HHPA 1ZT7A 3S36H 3NAAH 1X5IA 4J8RB 3LEXB 2ARJB 3H7BA 4K7FB 2P5EB 1ZK9A 5GGUB 2X4PA 35C8H 1Q0XL 4RIRA 4TNWF 5FECB 1KT2A 1T0PB 3ZYZA 1NFIA 1A2YA 5D2LB 3S3JA 4ORGB 5T1KD 4XBEL 3RI5K 3SKUD 4ELKB 2B4CC 1FL5A 5J12B 2LTQB 2ADJA 2D0HA 5J1TC 1QKZH 2R0KH 3UJTL 3WUZA 2HKHL 2OSLA 5IF0A 1K5NA 1QBBA 3U82B 3ARFC 4EBQH 1G9EA 3GJEB 3GB7B 4LAQH 3BRGC 3CZJA 4JO1L 4PJAF 5IBUB 3TVMB 4JZOB 2AXFA 1YY9C 2DQDH 1T5WA 3VFNA 5HTSA 4NHUA 4LCWD 4KC3B 3PWPA 3VDCA 1JE6A 4K07A 3T1FB 1S9YB 3KPRA 4JJ5A 3FQTB 1GGCL 1KIRB 1Q9KA 5GGRA 2RQ8A 3WJJC 4MD5A 4NZDA 2DIBA 3ARZA 4FXGB 2HT2C 4XB7A 4CAGA 3HUJA 5E9DA 5HHVL 3ULVH 4PLJC 3DX8A 4B50A 4EDWH 2OJZL 1ZOXA 2V17H 1N2RB 2P8PA 5LWYL 1BGXL 1PGRB 4K3JL 5TF0A 3JV5A 4OLXH 1OT1A 3CFCH 4W4NA 5L8LB 2NY4C 1H3VA 1LWRA 3QXTA 4HWBH 4L29A 2ITDB 5E1AB 4IDJL 1DR9A 2FD6H 4O4YL 5IG7A 2VDQH 4HKXB 2BNRA 1E6OH 2E27L 4UDUB 1K2DB 3BN9C 1BOGB 2VXSH 1I3GH 5EZJA 3RWHB 2DS4A 3K2MC 5D2NE 3WDIA 3ZT6A 5EG6C 4UTAH 1KTDA 1S7QB 2BVTA 1JCKA 2P7TA 5FO9A 2AGJH 4JFDE 1NFKA 2P43B 4JRYE 5CZKA 5KVGH 2V2WB 2Q8BL 4Z7OE 1IGIH 3UO1H 3O0RL 5ALBL 1S9VA 2DLHA 3QNZB 4Z7NF 1MVUB 3HNVL 3SKJH 1JTTA 1NLDL 4EVNA 5DEZA 1YNTA 1UYWL 2IF7A 1LO2H 3P0VL 2WLYA 3O9WC 3AS0A 4PJGE 3VI4E 3O41A 3EFDH 2ZUXA 3JWDL 5HHNA 4NIKB 1TVBA 3L5WB 2OL3L 4OM1H 3WIFA 3AS3A 5IV2B 2I9TA 1DVFA 2OR9L 1WIOA 1F90H 3L3OB 1ZXQA 3LZFH 5E8NA 1CFTB 4MJ5B 1H8NA 2NY2C 3BPNB 1A0QL 1XF3B 2CIKB 2YD3A 4GRWH 4AH2A 4H8WC 4XMLL 1A4KB 3AS2A 3V52H 3PL6B 3VU2A 5KSAA 3N9GH 3RIFF 3IVKA 3REWB 3RY6A 3VWJD 1CXIA 2QTEA 5FUOH 2Z35B 1LE9B 5JNYB 2XI9A 4P2OB 3S37L 1KTKE 2EYTB 1HHHB 2XPGB 2GYSA 3O6FA 4Y4FB 5C6PB 3E6FA 4OF0A 4MS8D 3AROA 1CL7H 5D1ZC 4WW2F 4ORZC 3WS6C 4CUCA 3C60B 4IJ3B 1U58A 4FQQB 4JQIL 3QPXL 4GAJH 5IP4A 5HD8D 4BFBD 4O02H 3TIDA 2ATKA 4DJMA 5L2JA 3WHXB 1B90A 1P9MC 2ZPKL 4PJ9C 1SBSH 3TBVA 3C5ZD 4YDLB 3VWKD 4JLRB 3VXMD 3S7GA 5JHDA 4PJCB 4MJID 1DSFL 3UTZB 5TDOB 3QHFL 4WV1C 3ZTJH 1T7WA 1EX0A 2CUIA 3ULVD 1ORSB 4LSVH 4P2CG 2NZIA 1OCWH 3BYYA 3GMMB 2VDLL 4CADB 5BJTB 1T83A 1KN4L 3O2DH 1MI5D 1XCTA 2B0SL 4PLNC 5E03A 1JUFB 5CD3B 4MCYB 5I8EB 1X6NA 3NCBB 4LVNB 4MVBC 3MLRL 2BNQD 1S7RB 1FIGH 1HKLH 4XPFL 1E4XI 1FFNA 2FJFB 4AZ8A 1OAQH 5C0BA 1AGDA 4WI8A 3QZWA 3GI9L 3MR9B 5IK3A 4P9ML 5INDB 3U0TA 3BX7C 4DK6A 3FT2A 1CK0L 3SQBA 2X9XA 2X4SB 4G6ML 4UU9B 1OGAB 4F33B 5GGQH 5TDNA 1UWXH 3I3DA 1X7QB 2DL9A 4OKVA 4BQ6A 2A9ML 1K4CA 4PY8J 3IKCB 4G8FA 4L3EB 5I1EL 4F7MB 4MQXC 3O4LD 1NC4D 3QI9A 2Z31A 1AR1D 4LEXL 1CT8B 3IJHA 5DSCA 1FNGB 3DYOA 3IDIB 2DYPD 4KU1A 4F3FA 2Z8WC 4PJHB 4N0CC 1GGIH 1MJ7H 5JQHC 1C16A 4BZYA 4QCIA 4TPRH 4GO6B 4KK6C 4KKBD 1MFAL 2X2YA 3EDFA 4DN3H 4JGJA 4OI9A 2HMID 2A74A 3FQNA 2P24B 1IM3A 1FZKB 3PABA 4EN3B 3QXVA 4DFIA 1A14H 3B2UC 3EIFA 2AEPH 3FHQA 3GSVB 4S1QH 4YBLB 4IMLA 1M1SA 5C2BL 5GS1A 3O8XC 2C9AA 4FFZH 3CZFA 3MJ8B 3LKQB 4OUUB 5ELIA 2YD5A 4DVRL 5B8CA 1YMMD 2CKNA 4PJBB 5JOPD 4NZRL 1G0XA 4GS7B 4XH2B 1BP3B 5JR1H 4BQ9A 5E4IA 2JCCE 4U1NA 4G80A 2R1YA 2XZZA 3MMEA 2D03L 2EYSA 2DWDA 3VFSB 3EO0B 3KPPB 1WITA 1OGTB 1U8PB 1EEUA 1TQCC 2GTWB 1INEL 3UPAA 4LVEA 3KVQA 3OWEA 1OWWA 4LLYA 1JZ5A 3QFJB 5F7FA 1TXKA 3DTXB 1XH3A 1XAUA 2YN3A 3LKOA 4RWYL 1YJDC 3BZDA 1F3RB 1OAZL 5HHOA 5GQBA 1QVOA 4G3YH 3RDTC 3GHEH 1T2QL 3H8NA 1YEEH 2H26B 4CMHC 2AERT 2A9NL 4FQ1H 2R2HA 4WCYH 1NBYA 3C08L 4JVWA 4Y5VC 1T0MA 1OQOA 3QDGA 4RBPH 5C6WH 3QISA 3HR5A 3DUSA 4PRBB 4I0KA 3T0VA 4XVJH 2MQCA 4KRPD 4JAMB 2DJ4A 4ZS7H 2ZOKA 3DUHA 5I8KH 3HMWH 2FR4B 1MCKA 3VGHA 4Y19A 3E2HC 2JIXA 4JRXB 3DX9A 5I15H 1IGMH 4P2QD 3WXVL 1QBLH 1I9RH 4Z7WA 5C0JA 4Z8FL 1JHTB 4UQ2B 5CSGA 5DD5H 2BDNL 5HHMB 3MRPA 4HUMB 4Z7OF 3W2DH 4WJ5A 2E8YA 2RFXB 5K9QG 3MRFB 5SWZE 2NZ9D 1EO8H 1DQTA 3DWTA 1DBBL 4JM4H 4TOYL 3S35L 4FQ2L 3WN5C 3F58H 1RJYA 2CLZB 4PJGF 3VI4F 4V2BA 2A83A 4HEME 4K94C 3CFEA 3WDJA 3MJGX 3WFDL 2YD2A 3UTSD 2YPLE 3O4OB 1BQSA 4YFLI 3SJVE 3LEVH 3KLHC 2AJUH 1FPTH 2ESVD 3LHPL 3KPSD 2Q3ZA 4XPHH 1CGTA 4JFEB 3L3IA 5DJYA 4QRSA 5D1XD 4F80A 2HJLB 3BD3A 4U1HA 5ICZB 4HUNB 4BSWA 2ICWB 4POZD 1MF2L 1S7VA 4F37F 4S1RH 5D1QA 3QAZC 5ESQA 4LFHG 1KTRL 3U7WL 4WO4C 2FATL 3Q2CA 1V3KA 4AL8H 1I8LC 1XCQA 4OF7A 3MREA 3GSQA 4NKMA 2BMKA 3M1BB 1PKQE 1CD1B 2OTUB 4MNQD 2MSPA 1QSFB 4PRHD 3TPUA 4PY7A 4XAWH 1VFBA 3F7VA 3L5HA 2QQNH 1AQKH 4NQVB 1FZOB 3QHZL 4HX1A 4X7SL 4QOKD 5LGJA 3JZ7A 5KVDL 2D7NA 4M7ZC 4IRSA 3U0WH 3QEHA 4M93B 4X6EA 5DJAB 3GI8H 3HG1B 3FT3B 4U1LA 1TENA 3VFGL 4HXBH 3UJJH 2QADB 3QEQD 3MCKA 5KOVC 4P48A 1PG7X 3LKRB 4BA8A 43CAA 3PIQB 1DQLL 2YUZA 2H3NB 1DQQA 2DQJL 4YHLL 3GHBL 3DV6A 2RCSL 3WHE0 1P4IL 2BOCA 4Q2ZB 3EFFA 2R8SH 2F5AH 2X9WA 3ARBA 2CQVA 1KIPB 3BGMB 4ZFFB 1PG7H 3D48R 1JFQL 2UWEB 2EDLA 2IADA 1F2QA 1SJEA 5DUPL 1HINH 3STZB 3IJSB 4GLRI 5DMKA 1U93A 1S8DB 2AKRB 5E5MA 5DHXB 3VJ6B 4M61B 5DFVD 2CO6B 3OKEB 5T5FL 4EDXB 3B9KC 1KB5L 3ZO0A 1BEYH 3WNOA 4HLZH 3RZCC 1FL3B 3BAEL 3KPLA 3MYJA 1BZ7B 3CLFL 3RGVC 2JTDA 1ZHKA 5EBWB 4ZUTB 1UM6L 5DK2B 1U91B 4XNXL 3UDWA 4QRPA 2XRAL 2FLBT 1MCDA 1YN6B 3L3HB 2MPAH 3NZ8A 3MLXH 3P30H 5ID0A 2XKUA 4HEPG 3PP4H 5J06A 4CVZA 1J0YA 4L8SB 4QHUB 3MRHB 1R5WA 4UMGA 3UX9B 3FT4B 4LHUA 4UILL 1NCWH 3GSOA 3TBTB 4HIJA 4JHAH 5F6IC 5ERWA 4DK3A 2YKLL 4D9RD 1QLRB 3S3PA 1Z0NA 4ZO6A 1IKNC 4FQXD 3RU8H 4KHXL 2DQIL 4R3SA 4XTRD 3O6ML 3VXSE 3WD5L 3NFPA 3X3GL 1LK3H 1H3PL 3DYPA 4YGVA 1IKFL 1ZTXH 1XIWD 4S1DC 5F7EL 5D7LA 4Q0XL 3SDYL 1IILE 5AUMB 3SDAD 4D0DA 1MCSA 1CR9H 1DCLA 4URTB 5CGTA 5BS0B 3B2VL 4IS6A 2VO5A 1CXFA 3MUGB 5DUBB 1XR8B 3DROA 4X6DE 3DYMA 3U7YH 4XCNB 4OQ1A 5EN2B 4PTTB 4IOSD 4LVOB 3JBG7 4GMSH 2BSTA 5ESAA 3INUL 1IAMA 3EO1B 1KG0B 4LU5L 2DBJA 1IT9L 2NMSA 2A6IB 5IHZB 3MLYH 2JCCF 4P46B 4OM0L 4JKPL 3EHBD 2WM0A 3JV4A 3GIZL 5DD1H 4LPYA 1M4KA 4FQPA 1BZ9B 3LKNB 1RZJC 4XRCA 3ALWA 5IIEA 2NR6C 3MLZH 5C9JB 4RISL 4MQ7B 4U3HA 4Y5YA 1Q9WA 4HAGA 1I3VA 2CRZA 4OLVH 5DD0L 3BT2H 5C0EB 3EOTH 5D7KE 2AS5M 2YZ1A 2Y36H 4UZGA 3T1WA 4YR6B 4AM0A 3RX5A 3UPRA 3T77A 2D9QB 1CGYA 3V6ZB 4OIAA 4ZAKA 2CKBL 1R5VB 1I4FA 3QH3A 5GRUL 4UT7L 2ZG3A 4BJLA 4AIXA 5CEZH 5FK9B 5TQ0H 1OP3H 5D7JD 3OXSA 3HAEH 3LH2H 2DDQH 3P9LA 2IANB 1UEMA 4NN5C 2R4SH 3TV3H 4V2CB 2R1WB 4ZSOB 1GOHA 2AEQL 1JWUB 3G6DH 3F6LA 2GKIA 1JZ3A 4NCC2 1GHFL 3V0VA 4ZUVA 4IRJA 5EORH 4B53A 1I3RA 3ZHKA 5JQ6H 1T03L 1SY6H 3JTTB 3TO2A 1W72B 1C5CL 3HE6D 1CDUA 4U6HA 4FMKA 4JN2A 2VSDA 1JZ4A 1INQA 1EEQA 4J3WA 1RULL 4J1UA 4OCWL 4IIQA 1E4KC 1M71A 1FO0L 4U0RC 5BV7L 1U8QA 3WNKA 3VE0B 5A3IC 1ES0A 5TF1H 3MO1B 2HTLD 1LEGA 3PGFH 5FYLE 3MRJB 4LBEA 3B9DA 5IMMA 1JK8A 4JQXC 4XP1L 1F45A 1BFVH 2WUBL 4OI7A 4UV4L 3KPTA 3UC0H 5DRZB 3ULSA 3PWLA 3L5XL 1CG9B 4JPWL 3I50H 5I8CB 4KJPC 1L0YA 1DUYB 4OIBA 4RFEB 3FRPA 2FBJL 1R24B 3PQYB 4MD4A 3PWVB 4PJAA 1U8JB 3NAAL 4L4VD 3C8HA 4A2MA 5C86A 4FQJH 4CRPA 5JPMA 1DLHA 1A6VH 1ZSDB 2Y25A 35C8L 1IRAY 3HRPA 5E5UB 1QFWI 3U9UA 5TGBB 5C0AA 1CGWA 1OSPH 4X6FA 4HG4K 1AGBA 4I4WB 5E6YA 5SX5K 1U3HC 5IB4A 1QKZL 1TDQA 3C5SA 3OR6A 4ODVL 4GAYA 2R0KL 3ARRA 3RI5F 4S1SH 2YPVH 2XIDA 2ZJSL 4HDIB 3HZKB 4EBQL 4P4KC 1Z0MA 1UM4H 3U36B 5I19H 1J1PH 1JNHA 1F8TL 1T4KB 4WWKD 1GGYA 3LKPA 2EYRB 5DHYB 2DQDL 5E24E 1D9KA 4TN9A 1EHLL 1WWBX 3ULUL 3I2CH 2EDDA 3BZEB 3FCTA 5C92A 4P99A 1ZLVH 4X4YA 2XN9A 4R4ND 1U2HA 4PB0H 4PGCB 3WEXA 2NXZD 1OTUD 4KK9D 3H9SA 5C08D 1U36A 1JMZA 2VYRE 4JFPA 4PRIE 4P2YA 4ACPA 1L0XA 5IESH 5CEZD 1BPVA 3IYLW 5E2JA 2VR5A 3ULVL 1OAYH 1CFQB 3F6IA 3SBWA 3MRBA 3P9MB 5J7CC 1QHPA 5F3HB 2V17L 2YEZA 4WGWB 1WBYB 4GSDL 2Z8VC 5CEYB 3X14B 5GS0D 2H2PD 4MXWH 1IZKA 4OLXL 3CFCL 1TZHA 5LKNA 5BVPH 1P1ZA 4HQQH 2NY6C 4HWBL 3DX6A 3TZVA 5I75C 3QDJD 3NA9L 2D7PA 5FYJU 1N5AB 5SWSB 1MJUL 2GFBB 1HXMB 1HIMH 2CXKA 2FD6L 3QWOB 5HYQA 2VDQL 1AGCA 4MSWA 2E7LA 1G9NH 4PBXA 3W11D 3TVMC 2VXSL 3SO3B 2X70A 1W72H 3EYSL 4ODXA 3PNWB 1P84K 4DAGH 4NKIH 2XZAH 1G9MC 3NACL 5KS9E 1UWEH 3O3EA 4HUVA 5GZND 2CUHA 4Q9BA 4BQ8A 5KVGL 3UO1L 4XNQB 1ODAA 5DJCA 3HPLB 4KROC 4NC0B 2CK0H 4HGKC 4GKSA 3SKJL 3AREB 4AY0A 3CK0H 1I1AD 4F15B 4QRRE 2ZCKL 3QNXB 3VFVB 1BD2D 1J87A 3RUGE 4YEFA 3BW9B 2W0KA 3P9WB 1NMCB 3EFDL 4O2EB 3WYRA 1SJXA 3LMJH 1FVEB 1GPOH 1VFAB 3RTQA 4PR5A 5LAXB 3VFRB 1AKJD 1BIHA 4GBXA 4X6DF 3ZDXF 3L3GB 1G1YA 1F90L 3T3PE 4PRAB 5I30H 2BNUA 4XBGB 3UTPD 3LZFL 1HILB 4WW2A 5FOJA 3S8WA 4KKCD 3CFKB 4MAYA 3KHQA 5IB1A 3O11B 3MV7D 4LP4A 3V52L 3QO0A 4KTDH 3CCHA 1T7YA 3BQUB 5C0FB 2G5BA 2VXUH 5DO2C 3K0WA 4NHCH 5MI0B 3IDJA 1NSNH 1UXWB 3L5JA 4OIIH 1OP5H 4GXVH 3CU1A 2IFFH 5FO8A 1AXSA 4JY5H 5FCUH 5FUOL 1RZ7H 4DGVH 4KXZI 5HHPB 3UTOA 1QRNE 1VFOA 5L8JB 5BRZE 3S4SG 3H7BB 4X7EC 4N8VG 2VDNH 5GGVY 2X4PB 2ENSA 4XHJD 1CL7L 1X4XA 1JGLH 3VFWA 3G5ZA 3TGXA 3R0NA 1FL5B 4DCQA 4NUGH 2ADJB 2Y7QB 3Q48A 4P23B 5JW4R 2CUMA 2P44B 4O02L 4BQCA 1HHIA 3BPNC 3KJ6H 3GGWA 3V0AC 2VLME 2OSLB 1K5NB 4XX1E 3KYKH 3RL1B 4U1KB 5E7BA 1BFOA 2AXFB 1NAKH 3RWEA 2FHFA 2D7TL 5D2LE 3LQMA 4HIEA 3VFNB 1OCWL 5GS2H 4NHUB 1GIGH 5EBLA 3PWPB 2HFEB 4GOSA 3O2DL 3BEVA 1U0QA 3P4NA 4GKNB 4JJ5B 4P2OC 4WI6A 1PVHA 4MD5B 3ARGD 1UKQA 1FBIH 2DQEH 5GRZA 4Y4FC 2KKQA 1FIGL 4Q58C 4S11A 5E9DB 4JN1H 3DX8B 1FORL 1OAQL 5DRWB 2UYLA 2P8PB 3LB6C 3QUXC 1AC6A 3IDGB 2XY2A 4IJ3C 2ZCHH 2YWYA 4WI3A 1J9CT 3LIZH 2FJHA 1CQYA 5GGQL 4L29B 3P73A 3TH3T 3V9FA 2YD9A 4P3CL 3IU3B 1ZKAA 4U1IB 3RKDD 4D94A 3OB0H 5IG7B 2BNRB 4DUXA 4Y2OA 3OTTA 1PZ5B 4UV7H 4EUPG 4YNYB 3Q6FA 1KTDB 1MJ7L 5E00A 4RA3A 3TLRA 5FO9B 4X4XA 4TPRL 3C6LA 4HV8B 4PREB 5DEFA 1K6QH 1S9VB 4DN3L 4UOW0 1EEYA 4QHKI 1RUPH 2BY0A 3MQIA 5DK3A 2XZCH 1YNTB 4CU8A 3GM0A 4WUUE 1MREL 1A14L 4JPKL 4LPVA 4WU7A 4BZ2L 4I0PD 4QRTA 2AEPL 4S1QL 1KJ2B 2P8MA 3O41B 4TTDD 4FFZL 5HHNB 2VLRD 4JB9H 4EI5A 3P4MA 3MV8E 3CPLA 2I9TB 1DVFB 4NQSA 1SMAA 1UA6H 3CXDH 1LK2B 2VLJE 5DHVA 2V7HB 5E8NB 1DBMH 4LLVA 5DZNA 1UADC 5B39G 1MCNA 5F93C 5DJ2A 4KDWA 5CSBA 1OT2A 4I2XE 1DLFL 2IQAA 4AT6A 4RFNB 4Z7UB 3NA4A 2B2XH 3ORJA 5LXGH 2IALB 4WHDA 5D2NA 3FQUA 4QHKJ 2CDGB 4PRPD 2GSIA 4JJHA 4JFDA 4JRYA 2EO9A 1S78C 2PXYA 3TBYA 3B9EA 4EN3C 1AIFA 1YEEL 5FGBA 2R2BB 3O6FB 5HYFA 4WVRA 4FQ1L 1IQWH 1VESA 4LSRH 4WCYL 3CJJA 4YBLC 1IAKA 3MA9L 3P4LA 1KC5H 4NQCE 1U58B 5JW5A 1B9ZA 3QDMD 2WIIA 4PJGA 4XVJL 5E8PA 4L8BA 5GS2D 2X89A 3DVGA 4HS8L 2LFGA 4ZS7L 3PUCA 5I8KL 4A6YB 3HMWL 2OK0H 5L2JB 2M1KA 2NX5E 2R2EA 1A6TA 3P0GB 4QGTA 4AIZA 1QSED 1H3UA 3K74B 3TA3D 4D9QD 1IGML 1EUTA 4WFHD 4XNZB 3MXVH 2J5LB 1I9RL 1UZ6E 5KS9F 1CICD 4ZTOH 5JHDB 1XF1A 4LDLB 5EB9A 5DD5L 5MENA 1U8KA 4BYHA 4NQDE 1YMHA 4YFEA 4JKLA 1Q9OB 3GJFK 4JHWH 5EFIA 1EO8L 3ZLQC 4HUUA 2YS4A 2MQ3A 1NQBA 4OQTA 1BQHB 1KCLA 1TJIL 3ZSTA 1KLGA 5DXWA 3F58L 3RUGF 3OF6A 3R1GH 3KG5A 4X9GA 2ZOLB 4OGAC 4XI5D 1CD0A 5ENWA 1FFNB 3DPBA 5C0BB 1AGDB 5J56B 4Y4KC 4XX1G 3BP4A 3EZ8A 3LEVL 3ARFA 5C07D 2AJUL 4TVPE 1FPTL 3T3PF 1HSBA 3FT2B 3VXNB 1LGVA 2PKDA 2XYCA 1XGRA 1Y6KR 5TDNB 4OKVB 1FAKT 1S9WA 1K4CB 5HI5C 1EJOH 3VXPB 1O5DT 4X5WA 3NBNA 1JHKL 3QI9B 4S1RL 3IJHB 2YR3A 3WJJA 3O3AB 4F3FB 4HH8A 4AL8L 3BJ91 4ZO7A 1E4WH 3LN9A 2XG5A 2EXYD 5CJXC 2Q76A 1EUUA 1C16B 4BQBA 4OZFG 3ZKNC 4XAWL 1OAXH 2QQNL 3FQNB 1AQKL 5KOMC 5CWSA 5K33A 2HT3C 1TQBB 4P4RA 3PABB 1WF5A 2IWGA 2X4RA 3U0WL 1F02I 1A7RL 5DZOA 4MA1C 1R3IH 4PJHE 1GZPA 4XP6H 4IMLB 3G5YA 4K7PX 4HXBL 4G9DB 5GS1B 3UJJL 4HIHB 1HCVA 2JLLA 3AS1A 4I48A 5B8CB 2N4IA 4UUJA 4QRUB 1BF2A 4HKJB 4UNVA 2ESVB 4OFYA 4X8JA 5F89B 2R8SL 2F5AL 3RVXD 4K7PH 4U1NB 2FB4H 3AVEA 5CJ8A 5D2LF 2ARJQ 4X6BA 2R1YB 5DQ9B 5D71H 1KUMA 2EYSB 1CVRA 4K9EC 4EIZC 3WL9B 4CJ1A 4PG2C 1HINL 3WNPA 1YY8A 4X5XA 4HT1H 4LLYB 4R6UA 5E8EA 4NC2B 1XH3B 3O9WA 3SCMD 3T09A 3LKOB 4PJBE 1UH2A 1A8JH 4YJZL 3BP6A 5HHOB 5EC1A 1QVOB 4PJIE 4MNQB 4NDMA 3TN0D 4W4OC 4M93C 3FFDA 1YC8A 3OZ9H 2R2HB 2VIRA 3KPRD 1Z5LA 4B5EA 2MPAL 3DI2B 4M4PA 2QADC 2EXWC 3QQ9C 3V95A 1YQ2A 3QDGB 3P30L 2OP4H 3DUSB 3PP4L 1NL0H 3BGAA 2ZWLT 5I74C 2H32A 2ZOKB 3BKJH 1QBML 1NCWL 1XF5B 4HXAH 4Y19B 2G60H 4PIRF 4JM2C 3DX9B 1RQ5A 2IAMD 1WIUA 2NYYD 3DVFA 4GLRH 4YFDB 1F3JA 1V05A 2VN4A 4Z7WB 5C0JB 4P9HC 1OTTD 1JYWA 2JCCA 3NABL 3A67H 2YRPA 1FNLA 3UAJD 1P7HL 3OX8B 4GQ9H 1ZTXL 5F9JA 5HYJD 2E6JA 4U3XA 5D1ZA 1ITBB 4LEOB 1IAOA 5FM8A 4JCMA 1NANI 3WS6A 3SHSA 4L4TD 1CR9L 3WIIH 1Y18A 2DBLL 5C09E 5CUSH 1K8DA 1QLEH 1RJYB 4JKKA 3F12B 2A83B 3U7YL 4KTEL 1VENA 5K9KB 4Y2DD 3CFEB 1OSZB 2FLRT 1P9MA 3DI3B 4PJ9A 1H9VA 3PGDB 3IGAA 1IZJA 4GMTH 1ERNA 2HJKA 3DXAD 1CN4A 4WV1A 3EKCA 1P6FA 5DJYB 1MPAH 4HWUA 2Y6SC 5ICYB 4YHYB 1LDSA 5I1DB 4U1HB 4HPYH 3TYGL 4XP9H 4BSWB 1S7VB 5D1QB 5ESQB 5BQ7B 4ZFOA 1CQKA 4NWUH 5IWLC 3BT2L 3EOTL 1HKFA 3PDOA 2Y36L 4XP4H 1PY4A 3FN0H 2QJDA 3LDBC 2E6QA 1JTPA 3GSQB 4NKMB 3L95A 3D85D 2BMKB 1A7PH 3QQ4A 4G5ZH 2Y5TA 1NKOA 5CLWA 4JFEE 1ZHLA 3QSKB 5KSAD 3TPUB 4PY7B 3F7VB 1H8SA 4FFYH 5SWZA 4HX1B 4GQPH 5TQ0L 5LGJB 3WLWC 3LH2L 4IRSB 4WY7H 2PR4H 2DDQL 5DT1L 3QEHB 4C4KT 1I7TA 4ZNEE 1RZKL 3M17A 2VDPH 4LVOC 1NCDL 4AEIH 3HZYA 3T0WA 5E6ID 4J23A 4KPHL 1J88A 1WZMA 1RZ8A 4LCCC 5L8KB 3MCKB 4NZTL 2YPLA 3Q0HA 3NCYP 3BSZL 3SJVA 3G6DL 4GFTB 3JUYA 3DV6B 3P4OA 5EORL 2BOCB 1CD9B 1SY6L 2N1KA 5HI4C 3ARBB 4HGWA 2R0WH 1ZVHA 4AEHH 4Y89A 1UXSA 4PD4J 5E99H 4KTYA 3ZE0E 3QNYA 1AJ7H 1SJEB 5JUEH 1A9EB 4JREB 5DMKB 1U93B 2NY1C 1KOAA 5E5MB 2UZIH 5L6YH 5D6CA 5FA4B 4RGNC 3CVHB 4YPGA 5TF1L 1CXKA 3QG7L 2DQTH 1HI6B 3PGFL 2YSSA 3KPLB 3O8XA 1PKQA 1QOKA 4TSAH 5C0IA 1ZHKB 1NCCL 3CD4A 3NTCH 4PYHA 4TUKH 5FOBA 4C56D 3VD5A 2DF3A 1BFVL 2DIAA 4QRPB 4XB8A 1HEZB 1VGEH 2ZUWA 4BSJA 5IOPA 3UC0L 5FYJD 4I3RH 3G9AB 3JVGC 3I50L 1ZWIA 4CVZB 3QJHB 2V9TA 1R5WB 4FXKA 4XWGH 4LHUB 2X4QA 1A6PA 4H1LG 2HN7A 1S7WA 4FQJL 2R1XA 4KFZC 4BK5A 4JPVH 1KCVH 3BGFB 4LPUA 1A6VL 2VZSA 8CGTA 4RQQA 2F15A 4R3SB 3H9YA 2VWEC 1JGVH 3NFPB 2DM4A 5AZEL 1OSPL 1HN1A 3MRNA 4YGVB 2SEBA 4AENB 5HSFA 4QXTA 1IGYA 2BSSA 3CSYA 1VCAA 2Z31D 4Y5VA 1YYLL 2ZUTA 2AK4D 4D0DB 3WNNA 3DOSA 4LDEB 5ITFA 4IS6B 4S1SL 2DJSA 3OXRA 4PJHF 2YPVL 1U8OA 3QCVH 3AGVA 3W0WD 1UM4L 1TCRA 3MFGB 1J1PL 2IBBA 1MCRA 1WC7B 3KXFD 5TFSH 4M62H 5IB5B 3BH9A 5ESAB 1AO7E 3UEZA 3I2CL 5EU3B 5JMRA 2PW2A 2J6EL 5JZ7D 5JW4N 1RMFH 1N0XL 3JV4B 5CSZB 4PGDA 1RPQA 2NY0D 1QFWH 5IIEB 1OL0A 4UBDD 1XF2A 1T89C 4Y5YB 3WN5A 5HDOA 1Q9WB 3S5LA 4QHMA 1OAYL 3HRZA 1IAII 5F9OH 2VQTA 4HBCH 4PJBF 5HDBE 4G9FE 4Z77A 1U95A 3T77B 4APQD 4ZAKB 4MXWL 4MQSB 3VXSA 3QUMA 2F54D 5BVPL 1BX2A 1I4FB 3PXJA 3QH3B 4HQQL 5JOEA 1GZQA 1UWGH 1IAIM 4JDZA 3KPQA 3OPZH 4LMQE 2ZCLH 4JFXA 4MB5A 1NFDE 1HIML 3OXSB 1MCLA 3QUZB 1JTOA 1G9NL 3DUUA 4S2SA 2OJEA 1T80A 4X6DA 1W72L 4DAGL 4NKIL 2XZAL 1UWEL 4WO4A 4RGNE 3MRLB 1I8LA 2ICEA 3T0BA 4ZUVB 4O58H 4N0YL 4IRJB 2AI0H 1I3RB 2WBKA 2IPUK 2GJJA 3HTLX 2AV7A 5IVZA 4R4BA 3TO2B 3QJFA 1HSAB 4U6HB 4NJAH 1NCAH 2JJVA 1INQB 5D9SB 5DD3H 4J1UB 4IIQB 3CH1B 1M71B 4ZDHA 5T3ZE 4F7TA 1CZ8H 2VAJA 3DMMD 3DGGA 4E9LA 4ELME 1GPOL 1EBAA 1XZ0B 1ES0B 3WE6A 4K71B 1I7ZA 1RVFH 4YK4B 3LQAH 4HJJL 1LEGB 3LRHA 5I30L 2CMRH 4CN6A 2VSCA 4LBEB 5IMMB 1UJ3B 1JK8B 3QHTC 5F7WC 3OJMB 2A73A 2IPKB 3VGDA 2EIZA 3I84A 2FWOA 2DI9A 3SO3C 1HYRC 2VWEE 3QO1A 4HF5H 2IPTH 3PHOB 4KTDL 1RZIA 4ZPTA 4KQ4L 3MRDA 5J4MA 5IKCA 3PWLB 4DTGH 4D0BA 1NSNL 4OIIL 1MY5A 1JZ2A 4R2GD 4GXVL 1QHOA 1RSFA 3G5XB 4JY5L 5HY9A 1RZ7L 4MD4B 3K80A 3AC0A 4CW1A 3B9KA 3AREC 4LIQH 5C0RH 3CMGA 5DDHA 5JPMB 4X7CC 3CIQA 5BO1H 1A9BA 5FYKL 4F15C 3RZCA 3RWIB 1JL8A 4NQEB 2G75B 4KUZH 2NNAA 2QV2A 5KJRH 2OXGA 5CZXC 5F71A 2VR9A 3RGVA 1JGLL 1NMCC 3UTTD 1IC5H 4G6FB 5C0AB 5I2IA 5DWUL 4X6FB 4ZXBD 3T4AA 5EOTB 1AGBB 4NUGL 2H1PL 1FNSH 3TWCH 5IB4B 4LKXA 1LQSR 3OR6B 4HWEH 4GAYB 1GC1H 4PJDB 2M26A 3KJ6L 3RWGB 3S4SA 1KCRL 2ZSWA 3B6SA 2DKSA 4H26A 4N8VA 4DGYL 4WI4A 1CDJA 3KYKL 4XXCC 1OM3H 1JNHB 1GXEA 1NAKL 3ARXA 3KGRA 1D9KB 3HE7B 1IKNA 2B5IB 1GIGL 3FCTB 4KXZH 3IKKA 3WLBB 5MI0C 4X4YB 3FQWA 3L1OL 2APFA 2XN9B 5HYSG 5I16A 2YXFA 1B0RA 1RJLA 3ZE0F 3H9SB 2MCG1 1ADQA 4GKZA 4JFPB 1UM5H 4FP8H 1FBIL 3U4BH 3PDDA 4JN1L 2P5WD 5T1DH 3V7AE 2R9HD 4M48H 5HJ3A 3D0LA 1AE6L 2HLAA 1TVHA 3VXUE 2ZCHL 5F6HI 4RAVA 1TZHB 4P23C 1P1ZB 3AU1A 2HTKD 4JM2F 2G5RA 3LIZL 3DX6B 2HVKA 1MJ8H 3CH8A 1MRCL 4KKNA 1EK3A 3TO4B 4HUKB 2W92A 5D4QA 4FNLH 5ESVB 4MSWB 3UYRL 2XTLA 2O5YH 4UV7L 3NFSH 3CMOL 2BRRH 1UCTA 4RAUA 3T04D 3ZYIA 3BWUC 2HRPH 4ODXB 3W9DA 3BJLA 1KBGH 3OHXA 5DZLA 1MCWW 4HUVB 1VADA 4FG6C 2YA1A 1K6QL 1U8MA 3IXTA 4AYFA 6CGTA 5DJCB 3NOIA 2IEPA 1RUPL 4GKSB 4QKXB 4KAQH 4CDGC 1R5IB 1LO5A 3LV3A 4HS3A 5GJSH 2F9BT 4EUPA 4PRIA 4KVCH 5F6HJ 4JVUA 5EOCJ 1JWSA 4JDTH 3GSXA 3V0WL 4MS8C 3RTQB 4PR5B 4CMMA 4JB9L 2HA1A 4HMEA 4GBXB 1YNLH 3HLAA 3MROA 1UA6L 3CXDL 1R3JB 3MNVA 2BNUB 4ZOAA 4LCWE 1DBML 2RJMA 4WW2B 4JCLA 5D7LD 5HD8C 4MAYB 5GSRA 1TNNA 1QPXA 5IB1B 5DJ0A 4HJ0C 3QO0B 3C5ZC 5IHUH 3IF1A 4XP5L 3CCHB 2G5BB 1EA9C 1UEYA 5LXGL 5KANI 3NVQA 2R56L 3IDJB 3VRIA 1E4KA 3LSOB 3EYUH 4Q6IC 5GRVK 4OZIE 1AXSB 4JEGB 1J05A 1Z9LA 4HZAA 3U7AA 5KS9A 1MCEA 3K1KC 4QF1A 3ZKXB 4OJFH 1G1CA 3D39B 2YPKA 5HDBF 4NOFA 1KCKA 1IQWL 5FKPB 4HFWB 4LSRL 5BZWA 3G5ZB 1JGEA 3WFHB 1D6VL 4QRRA 2I07B 1KC5L 5F97E 4JQXA 3RUGA 1Q0YL 2G2RA 4DCQB 1BVZA 1NFDF 5CILH 1DVFC 2F8XC 4PJ8D 5K9JL 3VXTA 2OK0L 2Y07H 3MBED 1HHIB 1EFXA 2DLTA 3SPVA 1X6LA 3N85H 3IXAA 2QR0A 3MXVL 2VLLB 5TH2A 3MRKA 2ENYA 3QXAB 3G04A 3RWEB 4FFWD 1HZHL 1AR1C 2F19H 4JHWL 1V7NL 3DV4A 5EBLB 4L9DA 4L3AA 3H7LA 3NH7H 1CU4H 4R9HA 3R1GL 3K8MA 1KYOJ 1U3HA 2BRQA 1EPFA 1XGUB 1QRNA 4ELMF 32C2A 3HC0A 4ZQKB 5BRZA 2EH8H 3E6HA 1IGCH 5D72H 4P4KA 1J8HD 5LQBL 4LNRA 4AG4H 3O3BB 5IFAH 2FJHB 4OV6F 3R4DA 3LY6A 1X5ZA 4F7PB 1EJOL 4HZLA 5DJ6A 1FZJA 1T1WB 4LSQH 3KLAA 3FN9A 2EZ0D 2NY7L 2B8OT 1BFSA 4NYLB 5HGGS 3BIKA 4J8RA 3LKSA 3LPWA 4NNXB 4YDIH 5FHAL 1OTSD 1CDHA 3QULB 3Q6FB 4K8RH 5GGUA 3U9PH 5E00B 2QQLH 4CDHA 1A6ZA 1I8KA 1CICB 4X4XB 3V7AG 4OCMC 1EEZA 1YYMH 3BMVA 5D2LA 5CBEB 1N6VA 4WFGE 3RGHA 1EEYB 1OAXL 4PJFE 1RJCA 3T8XA 1MWAA 1C12B 5EOQH 4WU7B 4EXKA 1BWMA 4R8WH 1R3IL 1IL1A 4XP6L 4U33A 3GJEA 4X9HA 1NCBH 1EH9A 3TVMA 3VXME 3O6LH 1HH9A 3A6BH 3HCVA 3P4MB 3CPLB 3HZVB 4OZFA 4NQSB 3GMNB 1LEIB 1T21A 1PJ9A 5DHVB 3BEWB 1EGJH 5E2UH 5HDLA 5C7XH 4LLVB 5DJ8A 2FB4L 4KRPC 3WFEL 1S9YA 1Y0LB 1KIRA 2FEDD 1G7HA 1MI5E 3QUYB 5D71L 2GJ6D 5HVHB 1SQ2N 2ERJB 3RVWC 2VE6B 5BOZG 4AT6B 3FB5A 2VJXA 1OP9A 1UVQB 2BNQE 4JFOA 4HT1L 5GGSY 4HS6A 3TBWA 4TVSa 1JHLL 1YN7A 5TE7H 5L88H 4NPYB 1PEZA 1M7DB 2GSIB 4TNVK 4JFDB 1CIUA 2NZ9C 2PXYB 2APXA 4XNMA 1AIFB 2ITDA 3ABZA 3FB8B 5E1AA 1W0VB 5HDQH 3OZ9L 1FC1A 4X6CE 4ODWA 2J88L 2AP2A 1IAKB 4HSQA 4Z7UE 1KPRA 3VG9B 3O4LE 3QIWD 4WUUA 1K2DA 2X7LA 1NC2D 4MXVE 4M6AA 2OP4L 5JW5B 2LAGB 3RWHA 1JP5A 2WIIB 1NL0L 4PJGB 4JZJB 1MFDH 4L8BB 3DVGB 1S7QA 4XBPA 4HXAL 2DLFH 2R2EB 1A6TB 2G60L 3MV8A 4OF5A 4F58L 4GW1A 4AIZB 4HFUL 4ENED 2RBLA 5D1XC 1R6VA 1IJ9A 2VLJA 1Z2KA 4OT1H 1AC0A 3RNQA 4POZC 3TZVD 3A67L 1U8KB 3B5GA 1YMHB 4CBPA 4GQ9L 3MLUH 1NEZG 25C8H 4I2XA 1PX3A 2XT1B 4HUUB 2IBGA 2QQKH 1BJ1H 1KLGB 3WIIL 3L5WA 4LP5A 3KYMA 4KK8C 1C8PA 4YO0A 5C0CB 2WBJB 3L3OA 5ENWB 3UYPA 2AAVA 4MJ5A 3NCCB 1PSKH 1ZGLP 3ARFB 1MHEA 1A4KA 4DOHE 1AHWC 1F6AA 1MFCH 3SDDB 5DUMH 2YA0A 4L4JA 4K8RD 2XQBH 4G6JL 1XGRB 4NQCA 5JIKA 1OY3B 1S9WB 2VDKH 1OP3K 4OD3H 4HPYL 4XP9L 2YHGA 4XWOD 2R15A 4X5WB 1CFNA 3DETD 1EMTH 1P7QD 2Z35A 1LE9A 1RZFH 1DN0A 2FGZA 2NX5A 4NWUL 2EYTA 2P49B 4G6KH 1HHHA 2XPGA 4YHPB 4OZIF 4Y4FA 2P8LB 1NANH 1Q0XH 3RX8A 1LHZA 1ORQA 2OS7A 3QUXA 3VRLF 5DFVC 2NY4B 2BJMH 2KZ1B 4P4RB 3WDHA 1PLGH 3QPQC 4WY7L 4YLQT 2PR4L 3MPCA 3D9AH 2WQ8A 1OHQA 2JB6A 4AEIL 4XVSH 3PG2A 2HKHH 1MCJA 1GZPB 2V7NA 3G5YB 4PJEB 3T2NH 4F57H 4P2QE 4JLRA 4OZGE 5TDOA 2V2TB 3BZFA 4I48B 1ORSA 4UUJB 2KBGA 4NFDA 4MDIA 2W0PA 4XPTL 1AGEA 5C0DA 4Z0BL 3FFCB 4FABH 4OCXH 5BJTA 3PHQB 5T3XD 3SKMA 2R0WL 4AEHL 1GGCH 2FX9L 4WGVB 5E99L 4ODBD 2VQUA 5D70H 4MCYA 4FQLL 3LPFA 4PGEB 3HN3A 5JUEL 3WS3B 1S7RA 1YY8B 4I8DA 5HHVH 4X5XB 2UZIL 5E8EB 4XTRC 4KK5D 3UTSE 5ACZA 4PGJA 3MR9A 3O9WB 5LWYH 1BGXH 3MRRB 4GH7B 2FNBA 1XIWC 1TZIA 2ESVE 3BP6B 3HFMH 3KPSE 4TSAL 5EC1B 4UU9A 3FMGH 4TUKL 4F33A 3NTCL 4NDMB 3SDAC 1QD0A 1JF6A 1X7QA 4YHIA 4IDJH 4Y8AA 1FLTX 1WCBA 4L3EA 1MH5B 2VIRB 4F7MA 1VGEL 2NY2B 4YX2L 1CT8A 4I9WD 1PY9A 1FNGA 2AABL 3RNKB 4LL9A 3IDIA 1UQSA 4DKAA 4MHHG 3NMEA 3DRTA 4PJHA 2XOTA 4V1DB 4XAKE 2H32B 4GW4A 1KLFA 4GXUN 4XWGL 1YDPA 3D69A 4BM7A 4M4RA 4MNQE 1MIMH 3O0RH 4JPVL 4OQTH 1KCVL 2BHYA 1F3JB 4PRHE 3EHBC 3EYQD 2B4CH 3HNVH 1ZHBA 3KDMB 5LJYH 2GW5A 1FZKA 2N7AA 4HJGA 4QOKE 4EN3A 5F9JB 4R90H 4PJFF 3P0VH 4G8GD 2LVCA 5D1ZB 2YRLA 4NZUH 3CFIC 1I3UA 3KPOB 3MJ8A 3QEQE 4OUUA 3DO3A 1K8DB 4H1LA 2ARWA 1J18A 3QCVL 4PJBA 4XH2A 3C6LD 3DHMA 5JMOC 1XEDA 2AJYH 5J1AA 4M62L 1U8IA 3IGAB 3EO0A 3KPPA 3LQZA 1U8PA 2HJKB 1BLNB 4WV1B 1FSKC 3S37X 2VMFA 1A7QH 5IW3A 2R0ZH 4TSBL 5IFJA 2IPUG 5CP7A 1MCQA 1QFWL 5DVMA 5I1HL 3VD9A 1P7KA 4KUCD 2PO6D 2R4RH 1XGQA 4EI5D 3S37H 4FN0A 4R4FH 2DTML 5F9OL 3PDOB 2H26A 3HE6C 1G7JA 3ZKQD 3L95B 2OTPA 3QQ4B 2KUTA 3FRUA 4RX4D 5CZVH 4O2FA 4OZHE 4Y8DC 4Y4KA 1ZHLB 2W65B 1UWGL 2EKSA 1FYTD 3OPZL 1VERA 4X6CF 2ZCLL 5SWZB 1L4IA 3KYOA 4Z7UF 1BQHG 2HTLC 3CFBB 4MXVF 1I7TB 4K2UH 2ZPKH 5C09A 3M17B 3QXDB 4BSVB 3HZYB 2Z4QA 4M03A 3C8KB 4D9RE 4ZD3H 4GW5B 1RZ8B 4JRYD 4HD9A 2YZ8A 5KVFH 2YPLB 4NN7B 5FM5O 3SJVB 4ZYKB 3LCYA 1EAJA 5M7QA 5CJXA 2AI0L 3MRFA 3CVHL 3QQ3B 3IDMB 3WSQH 1IAIH 4XMPH 4M6OH 4X4ME 4M5ZH 2OZ4A 1UXSB 4NJAL 3PHSA 3WKMH 2C4FU 3GMOA 4MD0A 3ZTJG 1X4YA 2X89D 4TUJA 4U1MB 2CLZA 4LHQB 1WTGT 3OKNB 5E6ZA 3NIFE 1CZ8L 4OCNC 4XXDB 5BCAA 1C7TA 2BY2A 4Q6YA 3N1GC 3OKLB 4YPGB 1ETZA 3GI9H 1GGUA 4P9MH 3LQAL 4H8WH 4J3UA 3C8DA 3O8XB 4M1DH 5MEND 2CMRL 1PKQB 5C0IB 4LRNH 2YC1A 1YEDA 1GVIA 4JFEA 1JYNA 5FOBB 1EZVY 2F8OA 2P48B 4J4PD 3QUZC 4ETQB 5I1EH 1SJVA 5K93A 3MJ9A 4HF5L 2IPTL 3H6JA 5IOPB 4KDTC 3G6JB 5EU6D 3OF6D 4ZNEA 4ZG1A 3K4ZA 4DTGL 1OAUL 1KJ3H 1ZWIB 1QR1B 4PG2A 4WWKC 1MFEH 4YDJA 3EOAA 2X4QB 4JFZH 4LIQL 1TJHL 2HN7B 4KJYA 1MFAH 5DK0A 4PV8A 4R4NC 5TDPA 3BO8B 4KUZL 1OTUC 1FZOA 4KK9C 1F42A 4DVBB 1G7QB 2VZOA 4QXUL 1IC5L 3TC9A 3MRNB 3VFTB 4W4OA 1CFVL 4WFFD 4CMHB 2YMXH 3DNKA 3RL2A 3HG1A 4K71C 4YK4C 3TWCL 1FNSL 3DRQA 1J0KA 5GS0C 2LAAA 1GC1L 2NTFB 5ITFB 3ZL4H 3PIQA 1P69B 2FYYB 1UJ3C 3OXRB 2VXQH 4PLJD 4QO1A 1TCRB 1OM3L 4OZGF 2BY3A 4JM2A 3AM8C 4J7RA 4ZFFA 1CDYA 1IARB 3BH9B 4HWZB 3F5WA 3VMNA 1JN6B 3IJSA 2PW2B 1K4DB 5HBBA 3QCTH 1CE6A 1QQDA 3QB7C 4B41A 3BKMH 2C3HA 3OB0K 5GZNC 4PGDB 1UM5L 4FP8L 5T1LA 3V4VL 3BN9D 3U4BL 1XF2B 1VB9A 3WN5B 12E8L 3I9GL 4LLWA 3QWRD 1OAZH 3UBXG 3QIUB 4QHMB 3HRZB 1S9XA 5AYUH 4YBHA 5T1DL 1T2QH 3ARSA 4M48L 5DK2A 2X5PA 3FB7A 3ZKMD 4Z77B 4PP1D 3C08H 3CX2A 3QUMB 2CXGA 5HYSA 1GZQB 1B4RA 1MJ8L 2NQCA 1CLZH 4JFXB 2Y5EA 5EU7C 2A2QT 1JGUL 2XNAB 4FNLL 1MRFH 3WUWG 4S2SB 3DUUB 2O5YL 2IMMA 2OJEB 3RPIB 1K85A 2BRRL 4X6DB 3ZDZE 3HE7C 2HRPL 4KKCC 3WXVH 2B5IC 2WMPA 3QAZB 1Q94A 5IWLA 5EUOE 4HAFA 1BIIB 2ICEB 3RWDA 2Q8AH 1AO7A 3FO9B 3BKCL 4PLKC 2NY5C 1C5DA 3T65A 1CFSA 1H3XA 3QJFB 4F2MB 4CN4A 4KAQL 1MFBH 3CX5J 4DUVA 1JYVA 4LF3A 5BS0A 4G43B 5IM7A 3O6KH 2I27N 2QSQA 1XR8A 1DQML 1F4AA 4KVCL 5EOCH 2OM5A 4ZDHB 4F7TB 3AFLA 1QA9A 4JDTL 3OKYA 1BVLB 2VXVH 5CMAA 4XHJC 3WE6B 1I7ZB 1YNLL 2J7LA 4G9FA 1GSMA 4LCCA 4B7IA 3TO4C 4FZ8H 5JHLH 2A6IA 5IMKB 1X5XA 5L2KD 2IBZX 2VKWA 2RHEA 5IW6A 2EIZB 3LKNA 4MWFA 5C08E 1NFDA 1OD9A 5EZIL 4D0CB 4LPTA 3QO1B 3VG0L 4MLIA 5C9JA 1RZIB 4ZPTB 4JR9H 4LARL 2K7QA 1YJDH 3MRDB 5CEZE 1DFBH 2FATH 4D0BB 3TP4A 1U8LB 1JI2A 4K3GA 5HY9B 4PJ9D 5B22A 4YHNA 5TPWH 3W5MA 4CW1B 4U6TA 3GSNA 1R5VA 4OJFL 5DDHB 1A9BB 3O2WH 4GRLD 1J0IA 1IM9D 2NNAB 4BELD 1WV7T 4X7SH 1NGXA 1T2JA 3ARGC 3EO9H 4OZHF 3RGVB 3RRQA 5JOFA 1A6WH 4Y1AD 5GRWA 4Q9CA 3GJFA 4I18C 1HK6A 3VFGH 2CO7B 1R3KB 3MLVH 5CILL 1TTFA 4LKXB 4ELMA 3VFOA 2EE3A 4K23L 3JVGA 2VABA 4MVBD 1FNFA 3S4SB 2ZSWB 2DQJH 4L8DA 4LSSH 4NQEE 3B6SB 5IVOA 4H26B 4MX7B 3QR2A 4UDTA 4FQHA 1KJMA 5F6IB 5L9DL 5HI3D 3RKDC 4E41B 1EO7A 1JFQH 2F19L 3CUPB 3ECBB 1F4WL 1BD2E 2F53D 2AJVL 5I0ZA 5I16B 5K9OB 1B0RB 1LMKA 1RJLB 3VE0A 4XCFH 1CU4L 3ZKXC 1F4YH 4OUOA 1BBJB 2FZ3B 4GKZB 1AI1H 5EU7E 1YEHL 3MO1A 4PTUA 1KELH 3NIFF 3OKMB 3BAEH 4DZ8B 1NGYB 3TT3H 3CLFH 4N0CD 3UTPE 1CIDA 3OKOB 3MZGB 2EH8L 3D0LB 1N6QL 4XNXH 2X1OA 2HLAB 1TVHB 5D72L 4KK6D 1Q9LA 3GSRA 3HS0B 1Z9SA 3CVIH 4AG4L 3MOQA 5CJOH 5IFAL 5DRZA 4DWHA 2HWZH 2HVKB 3V2AR 1CG9A 3OKKB 3ILPB 5AYQA 2J8UE 4RFEA 4P2RD 4K3EH 1UENA 4XHQA 4G7VH 1ITCA 3PQYA 1K9TA 1CDBA 1FQ9C 1ONQA 1FYHB 4RAUB 4YDIL 5JIIA 2IC2A 1R3LA 1T89A 3U9PL 2YD4A 4NUJA 3OHXB 4N90D 2QQLL 1HDMB 4NNYB 4WHCA 3WD5H 1YYML 1H3PH 1VADB 3KJ4C 4XCCH 3ILQD 3SDXE 3L9RB 4Q0XH 2JJSC 1BHGA 2QQQA 3SDYH 5GSVA 3OAUL 4MLSA 5I1KH 1MCHA 2NXYD 4HS3B 2VAAA 1MCOH 5EOQL 3V5KA 3TJHC 5DC9B 1OOAA 3BXNB 4R8WL 5C0GA 3MRIA 1J1OL 1FNEA 2E6PA 1G7IA 4PRIB 2CPCA 1JWSB 3GSXB 5HHXL 3SKOA 2NLJB 1T4KA 3O6LL 4P5TD 2ICWJ 4NN5B 3A6BL 4W6YB 2C3VA 3C6SA 5DHYA 1OWRM 3HLAB 4LPWA 1N26A 3MROB 3VXUA 3RDTD 1IT9H 3MNVB 4KWUA 5E2UL 1ACYH 5EZLA 1W8NA 1L6XA 5GSRB 1IMHC 2WAHA 1KN2H 4FXLA 2PW1A 5HVWA 3IF1B 3TA3C 2FJGB 3QIBD 1SVZA 5DD0H 1CFQA 1CICC 1HHKA 1MCFA 3VRIB 4WI7A 5F3HA 3SY0A 4U0RB 2OX5A 5TE7L 5L88L 4WI9A 3VRJA 4HCRA 5KS9B 3OQ3B 1KXVC 2OCFD 2VDRH 4Z7VE 1L6ZA 5GGSB 5B39B 1X9QA 1HXYB 2YPKB 1N5AA 3VDAA 4TNVF 3LPGA 4LQ1A 1II4E 1JGEB 1MHPH 5I9QC 4PJXE 4XI5C 5B3JF 5FYLH 2VR4A 3RUGB 3VW3L 4BFIB 2G2RB 4AEFA 4NO0D 2XKNA 1MFDL 1N3NA 3KS0J 3PNWA 4BH8A 5FUZH 3VXTB 1HH6A 1YEKH 3VXRD 2AEQH 3HAEG 1EFXB 2V9RA 4L1HA 1ZLWK 3D39E 4XNQA 3IXAB 2QR0B 5M95B 3QUYC 3VXSD 3SE8H 2ERJC 1T03H 3MOBH 2V5SA 3KAAA 5EUOF 5TH2B 1ADQH 5KW9L 3G04B 1RI8A 25C8L 3QNXA 3VFVA 5EC2B 4NZJA 4XNUL 2H41A 2EXYC 2QQKL 4TQEL 1H3WM 1VFAA 2APTA 1U41A 3VFRA 4E5XA 1Z6JT 2VLRE 3L3GA 4OZIA 2CJUL 5E8DL 1U3HB 4WO4D 3JWNC 32C2B 1PSKL 1XT5A 5ABDE 3D6GA 5BRZB 4JHBA 4BFGA 4XP1H 1NEZA 2EIBA 4XXCA 3RY5A 1KPVB 4JZJC 1JYXA 1RZJH 4LNRB 1B0WA 3JUZA 2H9GA 2XQBL 5I1CL 1DJSA 4LMQI 5DURB 1SYVA 2VDKL 1WZ1H 5DD6A 4OD3L 1UXWA 4HZLB 5DJ6B 1FZJB 3KLAB 2FBJH 1EMTL 2Z92B 1RZFL 1T1YA 4PRPE 3BIKB 3RVXC 3LKSB 3T0EB 4G6KL 3LRGA 4LQFH 2RB8A 5IBLD 2V5RA 5A40E 3BPOC 1DE4A 1A6ZB 1I8KB 3V5HA 4QLRA 5I76A 1EEZB 4EUPH 2VLKD 4N1EA 4LLDA 1PFCA 2MOVA 3VA2C 5DGQA 2Y7QA 4P23A 3QDME 3QUKA 1KGCD 2BJML 3SCMC 3T8XB 1PLGL 2WBJC 2NY6B 1CBVH 3D9AL 4JPIB 4ODVH 1MWAB 5I75B 1DQDH 4DGIL 4XVSL 1DBAL 2ZJSH 2W9LA 1IL1B 1PKOA 1QSEE 3ETBF 3RVVC 3TFKD 3TN0C 3T2NL 3B9KD 4QY8A 4D9QE 4WFHE 4F57L 3RL1A 3SDDC 1F8TH 2QHLA 3VH8G 5I66A 1DEEA 2FO4A 1RU9H 4U1KA 1HH9B 4RGMC 3RZCD 2FDBP 3HCVB 4OZFB 1EHLH 2P4AB 3KR3H 2P47B 4N0UE 1MCBA 2IH3A 4LSTL 1T21B 4P57A 3V6BR 4OCXL 4FABL 5IEHB 2APVA 2HFEA 5DJ8B 5ACLA 2HYMA 5JO5A 2XG4A 5CCKH 4GKNA 1G7HB 4GG6E 1VACB 4KROB 1FH5L 5CIPA 5D70L 2GUOA 3FB5B 4NQTA 2IAMC 4UB0H 3NN8B 3DBXA 1NJ9B 4JFOB 5EWIL 4PJDF 1IC1A 3I02B 2F8VA 1OTTC 5FKAA 4HS6B 3TBWB 3JTSA 5DRWA 3D87B 5CINH 1YN7B 4GSDH 3UAJC 3IDGA 5BXFA 5C07E 2HT4D 5LGHH 5LCVH 5KTEH 3HFML 3N1MC 3PWUB 5KZCB 3FMGL 2WSKA 4XNMB 1QFOA 2VNCA 3NA9H 4N9OB 4PJFA 4ODWB 4OFPA 1MJUH 5E94B 2FHCA 2GI7A 3IU3A 4U1IA 2I25N 2NY3B 3DLQR 1KPRB 2JE8A 2CIIA 1WFUA 4WUUB 2X7LB 4MB4A 3GMLB 4Y2DC 1PZ5A 1AD0A 3VA6A 2J8UF 3C5ZA 3EYSH 3R8BB 3E8UH 1UB5A 4QEGA 4YNYA 5F1NA 3T08A 3NACH 3VXMA 4XBPB 1O7VA 1F13A 2XTJD 4HV8A 4PREA 4YXLL 3MV8B 4GW1B 1H0DA 4Q6IA 1K3IA 1MIML 4OQTL 2VLJB 2B4CL 1BAFH 1I85C 1HQRA 3RNQB 4JFHD 3S9DB 3ES6A 1KNOA 4KKLD 1WEJH 1P4LA 1MI5A 2ZCKH 3SDXF 1A21A 4R90L 4I2XB 1UZ8A 4NBYB 1KJ2A 3ELAT 1JIBA 4NZUL 1OARH 1FLRL 5I8OL 2BNQA 4PJ7B 4KGLA 4OF8A 3BMWA 1H3TA 2NR6D 1GOFA 3EDKA 3KYMB 3DO7B 3BESR 2QSTA 4YO0B 2X1QA 1LO0H 1LK2A 3ARDD 3WFCL 2A0LD 2V7HA 1V8HA 3IETA 5JW3H 4KJWD 2AJYL 3D2UD 3V6OC 1MHEB 1JZ8A 4X6CA 2ZZUT 3Q5YA 3U1SL 1TFHA 1F6AB 4Q9RH 5E6IC 3FONA 4Z7UA 4JQVC 3O4LA 1NC4A 1A7QL 4NQCB 2IALA 2R0ZL 5DC0A 3JWOC 4IHOA 2CDGA 1UH3A 1CFNB 5C0CE 1A1OA 3S3SA 1DN0B 1XR9A 1CGVA 2R4RL 2NX5B 1IEHA 2WP3O 1TITA 4R4FL 4X9BA 1A7NH 1WQVT 5M94B 2R2BA 1VEOA 4C55A 1MWAH 3ZTNH 3MV9B 2VTFA 1OAKH 1KJVA 1A02N 3KLDA 5CZVL 1ORQB 4NQDB 1NLBL 4O51A 4JFFB 4NBZB 1KCSH 3HKFA 1FFOA 3QUXB 4UQ3A 5CGMA 3QDAA 2FX7L 1LO4L 4WWID 3HUJE 1C1EH 2BCKA 3ULUD 4OZFH 2DLGA 2EDYA 4A6YA 4YWGH 5J1SC 2DLIA 2JB6B 4K2UL 1FL6A 3CFDB 4HUXA 3L6FA 1YA5A 4WTZG 4ZD3L 2V7NB 2Z91A 4I3SH 5KVFL 1PDKA 2IQ9H 3BZFB 2D7TH 1Q9OA 4MDIB 5C0DB 1AGEB 5DR5H 3QP3A 4Z0XB 5HYJE 3H0TA 4QRRD 4NRYA 3WSQL 1IAIL 4XMPL 3SKMB 4M6OL 1NUDA 2QLVB 4M5ZL 1BQHA 4N5ED 1WGOA 3WKML 4L4TE 4ZFZA 2FCBA 3CU7A 1F58H 2ZOLA 1D5MB 4PJEE 1P6AB 2FIKA 5LG1A 1AQDB 1FORH 1B0GA 1FZMA 5ISZD 5ACZB 5FGCE 1FFRA 3ZYOA 4H8WL 1IQDA 3FFCE 4M1DL 3VXNA 1TZIB 1JNNH 1T22A 4LRNL 3DXAE 3QBTB 5A2IH 4L9LB 2AEIT 2PTUA 4YHIB 5CJ5A 1UKTA 2L0DA 1TVDA 4P3CH 1EXUA 1WCBB 1NGPH 5JTWA 4NO2B 3VXPA 4LGRB 3SQOL 15C8H 8FABA 5I1AB 4RNRA 2J4WH 4NN7C 3O3AA 1KJ3L 1UQSB 4EI6B 3DRTB 5H35A 5IMLB 1PBYA 5GZOD 4GW4B 1MFEL 4P2QA 1YDPB 3D69B 4X0KA 5KSVA 2E3VA 4JFZL 4EIGB 2BK8A 1ZT4B 1G6VK 1UJTA 4OZGA 2C3WA 3IFOA 5F1SA 5JZ7C 3J8F7 4P4KD 2VC2H 1KULA 3WMSA 2XICA 4H25A 2ED7A 3EUUA 1ZHBB 4MYWB 4HJGB 4PPTA 4EZMA 1MREH 4JPKH 3V6OE 4BZ2H 2YMXL 4Y16D 5J6HA 1D5BA 1T5XA 5B4MC 4V1DE 2HAZA 5F96L 4G9DA 1HYSD 4HIHA 4APQC 3I3EA 5AD0A 3ZL4L 3Q5TA 3UTSA 1TJGH 4H1LB 5F7MC 2P5ED 2VXQL 4QRUA 1KF9B 2C3XA 4HKJA 1W0WA 1INDH 2D7OA 2ESVA 5F89A 4N8PA 3KPSA 1ZGLA 3VFMA 4FQIL 4PJIB 4WDIA 2DRUA 2I26N 4QHLA 5J1AB 5DQ9A 2M2DA 1U8IB 5D1XA 4ZFOL 3S96A 3WL9A 1IGTA 4G8IA 1DLFH 3LQZB 1QP1A 4U1JA 1MLBA 2XXCB 3QCTL 2I9LB 1A7OH 5IHBA 4ESKA 4GG6F 5KG9A 1MAMH 3BKML 5IFJB 1T0NB 5CP7B 1OQXA 3RY4A 1P7KB 3TVMD 3FOMA 2O5XH 1XGQB 5E4EB 5AYUL 3N06B 2EEDA 4MNQA 2DAVA 4R26H 3STLB 1G7JB 4PRHA 4C56E 2OL3B 1RURH 3FRUB 4O2FB 4HUWB 3H42L 3MA9H 2VUYA 2KQMA 4QOKA 4Y4KB 3BKYH 3CFJA 3DMMC 3GMRB 2EKSB 1AHWA 1MEXL 5FYJE 1CLZL 3KYOB 3SGDI 4HS8H 2OQJA 2HFTA 5FCSH 1VKXA 4TVPH 1HOCA 1MRFL 1XF5A 3ET9F 3QEQA 4J3TA 4M3KB 5C09B 2VDMH 4YXKL 3ZT5A 3U46A 4CGTA 2Z4QB 1XGPA 1G6RA 4YPJA 2FECL 3TEUA 1BWWA 1WIPA 4RMSA 3VCLB 5IMOB 1GCFA 1Q72H 3OX8A 5DA0B 4K3DH 2Q8AL 3WCYA 5JA8B 1ZVSA 5CEXA 4OLYH 4LEOA 4U3CA 3HB3D 4R2GC 2CRIA 2C3GA 3L7EA 1XGYH 1TJIH 4Y4HB 1FGNL 1MFBL 2AK4E 3QIUC 5T1MA 4MD0B 3GMOB 3KNBA 3PDGA 3MV11 4TUJB 2R29L 3F12A 3O6KL 3SN6N 1NBZB 5EOCL 3UPCA 5K9KA 4TYUA 2MCPH 1OSZA 3W0WE 2VXVL 4HPOH 4MA1B 3KXFE 1ETZB 3PGDA 4ZXBC 1G0YR 4FZ8L 5JHLL 4OZHA 5FYKU 2YC1B 1YEDB 1KIQA 1VSCA 5ICYA 2V5TA 5I1DA 4F9PC 4HK0A 3MRCB 1JHKH 5BQ7A 4JR9L 1FVCA 4UT9H 1YJDL 4KI1A 4RMTA 1DFBL 2EDQA 1NUFA 2Q20A 4MA3B 3EOAB 4YDJB 3QYCA 5TPWL 2ORBH 1NCNA 4KJYB 4YHML 5DK0B 2F54E 4PV8B 3PL6D 3O2WL 5TDPB 3BE1L 1XIWA 5IBTH 4UAOB 5GGTA 3EO9L 1A6WL 4X4MA 3SDAA 1Q38A 3G6JE 1A7RH 3RL2B 4WNQA 5CGYC 2R9HC 2WUCL 3R0MA 3MLVL 4P2OD 5DA4A 4CU6A 4IOFD 3MGTA 1KPUA 3RIAK 3DRQB 2VDOH 4Y4FD 3CSPA 2HTKC 3MBXL 5I74B 4LSSL 5EBMB 4CNIA 1I1FB 4JM2B 3C60D 4LLMB 5D6DA 2QSCH 3F5WB 1A9EA 1CE6B 1QQDB 1SEQL 1RK1A 4JO2H 4U1GC 4K94L 3I6LD 2V2XB 4XCFL 4ODUA 5FA4A 4JFYA 4Y5XC 3CVHA 1F4YL 3QUML 4BFEA 1AI1L 1E6JL 5T1LB 2QBWA 2EH7H 4PJEF 1KELL 1HI6A 4LLWB 2XWBA 3TT3L 2HLFC 1S9XB 2ZKHH 3RIFK 3OB8A 3ROOA 1TTUA 3FB7B 3U6RA 2XY1A 3O45B 4LLAA 3EDDA 4N0RA 5DQDH 1HEZA 2PTVA 4MZ2A 3CVIL 1MCIA 3VMPA 5CJOL 5HYSB 1JPSH 5JXAH 1I8MB 4NSKB 2HWZL 3TBSA 5F7YC 6FABH 4IMKC 1QACA 3QJHA 2CR3A 4N5UA 3IRZA 4LASH 5E1HB 4K3EL 2FO1A 3MUJA 1FNHA 1QBMH 4G7VL 1JRHI 3OJDB 4DEPC 3HMXA 1MELA 4UTBL 3U2SB 3GK8H 2OZ4H 4RGOH 1Q94B 1SM3H 1OGAD 5KSBE 3NABH 1DUZA 2K9UA 1HQ4B 2WWKO 4ZOEA 4N0FA 1KCUH 3RWDB 3UTTE 3HE6A 4AENA 1X5GA 1AO7B 4L3ED 4XCCL 4FHBD 3LDBB 4NRXB 4O5LH 1C5DB 1QSZA 3T65B 1CFSB 2DKUA 5F7UA 4MB3A 4OCRH 4M1CD 3RZWA 5AAWA 2E9WA 5I1KL 2DBLH 4LF3B 4PV9B 1MCOL 3GSWA 5IM7B 1X5JA 1MQKH 2PYEB 3EOBA 4KTEH 1QA9B 1NDGB 2Q86A 3QZWG 5CMAB 1WC7A 1S7SA 2DMBA 2ADFL 3MJ9H 4Z7QE 4RMWA 5IB5A 3GSUB 4G9FB 4CVWA 1UB6B 4LCCB 4YBQC 5HPOA 3HC4L 5EU3A 4EN3D 4WI2A 5L0QB 1QLFA 5ANME 1ACYL 4J2XA 4J12A 5DVOA 3C9NA 5IW6B 3TYGH 1KN2L 3MBEC 4MWFB 5CSZA 3U30C 1IBGL 1ZGLM 1NFDB 3HR6A 2BC4B 3RWJA 2UZXB 3GRWA 2UUDH 5SWQA 2P5WE 3FL7A 3GM8A 4FFWC 3X12A 4J6RL 2NY1B 4MMZC 4YHNB 5D96C