5LB1A

Crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with thionitrobenzoate (tnb) adduct at the active site cysteine-354
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
HLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
publication title Binding and processing of beta-lactam antibiotics by the transpeptidase LdtMt2 from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5lb1A02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lb1A01
3U1QA 5DCCA 4A52A 5DZJA 5DC2A 3VAEA 3VYOA 4GSUA 2MTZA 4A1IA 5DZPA 4QR7A 5LB1A 4XVOA 2HKLA 3ZG4A 3ZGPA 5K69A 4HU2A 4K73A 5DVPA 4HUCA 5DU7A 3ZQDA 4QRAA 3TX4A 4GSRA 4Z7AA 3VYPA 4QRBA 4A1JA 4LPQA 5E1GA 5D7HA 4ZFQA 5LBGA 5E51A 5DUJA 3TURA 4QTFA 3U1PA 4GSQA 3VYNA 4A1KA 5E5LA 4JMNA 1ZATA 4LZHA 1Y7MA 5E1IA 4JMXA
chains in the Genus database with same CATH superfamily
3MRPA 2N7AA 1MI5D 3LEVL 5EB9A 2ZPKH 4AXWA 3BP5B 2H0FA 1F6AB 4DESA 1QA9A 2WXJA 4EBQH 3RVWC 3D2TA 4Z3GA 1XZWA 3A5VA 2IH3B 2H6UA 4HCRA 1ZLSL 1ZLDA 2IFGA 3QUYD 3BVXA 1PG7X 2MKWA 4NKOA 2VDPL 4L3FA 3MJ7B 4NQSA 4OB5L 1DQLL 1FI8C 2P8PB 3JUYA 1S9XA 4ODVL 3RAJH 3SIKA 1MCPH 4GRLD 1BBDH 3WMPA 1WBZA 3KD4A 2WPGA 2XFGB 4W6XB 3DX4A 2AEOA 2YRBA 3GRWL 3HS8A 3PQYD 4FTVD 4M93C 4FNLH 3GHEH 3HZVA 5L9DL 5DJ8B 3OKDA 2WGNB 3GMQA 1KFAH 2Z91A 1QFUL 3BSZH 3QFJA 3QQ3A 4P5MA 3CFEA 5C97A 2EDKA 3LOWA 2WZPA 3D4ZA 3U25A 3F01A 1Q1JH 4L4TD 1NIEA 1YPZF 2C3HA 4HKXA 4FMFA 2AI0H 1YEGL 4LLDA 1XH1A 5BS0A 3LKNB 3BFQG 2C9SA 2KQNA 1BVNP 5BW7A 1DJYA 2LR4A 1G84A 4QR7A 4ODXA 5JR1L 1G7IB 1QPPA 3NFPA 3IRZA 1TSHA 3RRQA 3NPSC 3HI5H 3QDJD 5DHMC 2WVTA 3SD2A 1PKQE 4HIEB 3CN2A 4PW9A 2KH2B 4HKZB 1KGJA 1NMBL 2NTSP 3MO1B 3QWNA 3N43B 5CJOL 3S3PA 2JTYA 5FC9A 3O8XA 4GP8B 4L2LA 1KCWA 1T7ZA 1KCBA 4HUUA 3KLHC 2G30A 1K9TA 1B4JL 1IC4H 5I76A 1FYTA 1R34A 1CD1B 3IBOA 3KPQB 5CN3A 1NAKH 2NY2C 2VXTL 4WI0A 3B5GA 2WXNA 1I4FB 2OMBA 5SWSD 3VXSA 3ZZ1A 1FJ1B 5EORL 1OWRM 3NIDE 5TE4L 2PCFB 3OKLB 1VENA 3L9RA 1RZKH 1FNGB 3KVQA 1N7MH 2DTML 2AW2A 2Y5TA 2W0FA 2Z65C 4GI9A 4B6ZA 3CGTA 3O6MH 4RBPH 4ODHL 1NSNH 5GGVY 3HKZA 5EULV 1CTNA 4F9PC 3BH4A 3L81A 4PPTA 2CPUA 5D7SH 4ENED 1A3RL 4C4BA 1L6PA 1EZVY 2CIIA 1D9KA 1KB5A 1BX2A 1FZKA 1H3WM 4P2OB 3RIAF 2C1OB 5EH1A 2VSKB 2XWBB 4ELMB 2OV0A 3SBPA 1QNIA 3DSNB 3GEFA 1MJJB 4KVCL 3NH7L 1Q9KB 1U3HB 1CDIA 1IGJB 4WGWB 2H6PA 4ZW3A 1H3UA 1JHKH 4AIOA 4G6JL 4HC1L 4TNVF 3VFTB 3M1BB 4HGKC 2O5YL 3RWGA 1JFHA 2VE6A 5BZDB 4QCIB 2X4PB 4WHTB 2G60H 4AT6B 3MV8D 5CHNB 4IS6B 1E6JH 1AO7B 4BM7A 1KZQA 2AZUA 1AD9A 4I89A 3DSFL 1G9NL 2Y0SA 3BPLC 4N2IA 3RY5A 5CSBA 4XCYB 1BXUA 2EE3A 3ZT5A 1AJ7H 1A4KA 1UZ8A 1KCVH 1SHMA 4PBXA 1HWGB 4J4PD 2NY1C 1VADA 5ABDE 1P6WA 2VSDA 4HHWA 5GPRA 4EN2A 4LSSH 2A83A 3T0WA 1EH9A 5H35B 5DHVA 4RA3A 5HHOA 5IUCA 2I60H 3APFA 4XMZA 4NKMB 1YNKH 4KMTL 2WXOA 4N0UE 2P52A 3N41B 3RIAK 3NK4A 1U8MB 1ZE3H 1E4KA 2NDGA 4FL4C 3FU7B 4MJIA 1PD1A 5ANME 2X4TA 1F4XH 1KGWA 4L3CA 5IFAL 1Z9SB 1FN4B 4UAOB 2EUVA 3LRKA 2NXYB 1NFDF 4PJHA 3D34A 1TYJA 5KZCB 2C3VA 4TNVK 4EDWH 2DQHL 4G6KL 4KTEL 1A4BA 3V9EA 5IKCB 2FLMA 3HLAA 3HHSA 2QQKL 3BZEB 2B16A 4BZ2L 3WN5C 1NBZB 5FUOH 3VI4E 1ZHLB 3OKOB 4GO9A 1KN4L 4L3ED 3QUXB 2EADA 4IOIB 4WUKL 4LCIH 3WGUB 5MERA 4YAQB 1I31A 4XNDA 1DQQA 2ITDA 3K6OA 3WXWL 1FDLL 3PWUB 4Z8FL 4HG4J 3IE9A 4HT1L 1D6VL 4AVIA 3WIHA 2VQTA 4PMEA 5KYYA 4GI8A 1ADWA 2P49B 4J3SA 1UADC 4KZDH 2G9HB 1PZBA 4QF1B 5J7CC 1B0IA 4XPTL 4FLSA 2DBLL 3ROOB 4PRPE 2EQDA 4H13C 2AAVA 4H88L 2ERJC 3IF1A 4ZZKA 1U4EA 1YY8B 1A7NH 4BSVA 5ECJE 5CD3B 3CLEL 3AREA 3NJLA 1WCBA 4BSWA 4K7FA 1TYRA 5DRWB 1WAAA 2GJJA 1KEGL 2Y7LA 3RX5A 1BBJB 1HAUA 1CGXA 3FB5A 4LSRL 3NIFE 4FFYA 3L4CA 3L8QA 4X9GA 2FUQA 3CBJB 1Z66A 2X09A 3CSYB 1DTUA 4CMHC 2PYFB 3WFCL 4U3SB 3HG0A 4R4ND 1MHHA 5D93C 2Q87A 5DEFA 4N85A 1RZPA 4JFUA 5TDPB 4FQCL 1O9VA 1RSYA 1DVYA 2D31A 3HI6H 1IGTA 2HT3D 4QO1B 5D5MA 2QFRA 4QXUH 5I5MA 3V0EA 1NGZB 2ADIB 3OWRA 2R23B 4PJGE 5DVOA 3LKSB 4OY9A 4N2BA 4DP4X 1TSRA 2JE8A 3RZWA 3IJ8A 2P46B 5C7ZA 5SX5K 1NDGA 4MA3A 5LWYL 4DIXA 3QUZD 4K3EL 3ES6B 1RZQA 1QEWB 4P2QE 1KTKE 3TO4D 2DYRB 3ATAA 5H94A 4G9FB 2ZX9A 5E00A 1MHCA 3LS5L 4CDGC 1LEKA 4BFGA 2KLTA 4FNQA 3HI1B 4XZUA 5IOKA 2BVOB 4TVPL 1AZVA 3VH8B 4G7YL 4Z3TA 2X6CA 1CGSH 4NNXA 4U1MA 1OAYH 3LNEA 3MOBH 4LMQE 3RUGF 1RH8A 3KYKL 5I6OA 2R9HC 3V4PH 3AG2B 4MAUH 5K1JA 4OFIA 3TV3L 4C4KO 4E42B 1HCVA 2YQ3A 4U0QB 3RP1A 3TBTB 3VXUE 1OAUH 5ALCH 1JPSH 3TFBA 5E8PA 4YGVB 5JW4M 4KFMA 5I1IH 4AVKA 2ZG2A 1E90A 5D4JA 4EOWH 1NM4A 2V3FA 3A6BL 1T22A 5LUMA 1CT8A 3LRSB 5JHMA 1EFXA 3FCGA 2E86A 4GMSH 3BDXA 3W9EB 3B9KB 4PI0A 1W72A 4GXVL 4LDLB 4X5WB 2GJZA 4R7NA 1Z32X 1YC7A 2ADGB 1HI6A 3CDCA 5IM7B 2JJWA 5LKNA 2Y3NA 2PR4H 5IMLB 3OZ9L 3ZGPA 1IT9L 1QFOA 3SYCA 3E3QC 4XP5L 1QPKA 1Q9LB 1JTTA 1KC5L 1TPXB 2ROXA 4MD5B 4F24A 3VFRB 3LS4H 3H42H 4XRCB 2YAQA 4KZEH 3RI5F 4LRIA 3BVDB 5JIKA 2J88H 1MVUB 4ZG1A 4IDJL 3JVGC 3VFMA 2JB5L 1GPOH 4UQ2B 5EWIH 3LKRA 1G7HA 3HBGA 1QBAA 4DH2A 3HC3L 4HZLA 1TJGH 2WXLA 4NUGL 4A37A 3ILPA 4RZCB 2HLEB 5KVDH 2QVIA 1JTPA 4FHBD 3SQRA 3WUWB 1CFSA 5KS9E 4ZPTB 4TVPE 2ILLA 1EAQA 4XMKL 3I3EA 3TBSA 3ASWA 3V7AE 2YQGA 1Y07A 1E2WA 4GW4B 5CCGE 1CXIA 1J10A 3MSPA 4OZHA 5EOQH 5CU9A 4I87A 5DHDA 5CGMA 5E99H 5HHQA 2VLJD 4E5XA 3VFSB 2CK0H 5EDXA 4GRWB 4ZRGA 3D2UB 3H3PH 1DBAL 3P11L 4UOW1 2VH5L 4A6YB 7PAZA 4MWFA 5GS0H 2YPVL 5GGRY 1IC1A 3BO8B 2B1OA 4DP5X 4P2OC 4FP8H 4GAGL 2EILB 3KWUA 4GG6E 1FWXA 4QI3A 2FBRA 4OLVH 3OGCA 4K8RC 4XN8A 2Z7ZA 1DL7H 3HG2A 2GCYA 4FTDA 5JNYA 4M4RB 3V6BR 3QAZB 2IAMB 2WYHA 3VU1A 3MGTA 4WUUD 4X6CA 4PY8I 5I2IB 5D7LE 2P5WD 4FQQA 4GAJH 3LQZB 5E7BA 2OK0L 1N2RA 3ARDB 4N5EC 3SO3B 1KNOA 4K94C 3RU8L 2DQFA 2DQEH 3RI5K 4LPCA 1JERA 2VT0A 4UWQB 1KPRA 3SKNA 5DD6B 2NUTB 3OR7A 4CILA 4PV9B 1CPUA 3L3OC 5AAMC 4LSVH 4K4KA 3M17B 4P2CG 4Q9QL 5DZPA 1IZKA 4J23A 4D2NA 43CAA 2AMUA 5CJ5A 3IDNA 1IZJA 1LILA 2YRZA 4NQCA 2VN5A 1S7VA 3SDXA 3DO7B 3A4DA 2V0AA 3VFPB 3KNBB 3BSHA 2ZSWA 1NCAL 2IDCA 3U9UB 3AXHA 4AYEC 4HH8A 1J88A 2LTQC 4GH7B 3MRCA 3U1PA 1GAFH 2C9XA 3CIAA 3LKOB 4KQ3H 4MCZA 5DD1H 3UC0H 5D96B 1ZIAA 1YMHB 2FEEI 4NWUL 1TZIB 4WFHD 1V7NL 7CGTA 3QAQA 1GIGL 2FUTA 4KU1A 2X9ZA 3KPSA 4LSQL 1Z9LA 1A7RH 4LNRA 1BQHB 1RJCA 1WAPA 3B9DA 5C0CB 4D3CL 2YHGA 4ZUUB 1LE5B 3R19A 1H15A 2YPKA 3SY6A 1O7VA 3VWJD 4JFSA 1ASPA 4TS6A 2A4CA 4YEFA 2MPVA 5C07E 5DR5H 4XMLH 5JOPD 4D0DB 4HIIB 4JL2A 1BZDA 5EZLA 2YZ8A 3KLLA 2BMKA 4O5LL 4NQVB 2VOTA 4JKPL 1N70A 4N4YB 4Z7QF 5CO1A 4YSOA 1OM3H 5BUAA 5AVZB 3EYQC 4U6HB 4XNMB 1EO5A 4HUVB 4XPGH 5MEQA 4P2RB 2E0PA 3O6LL 4N0YH 1ZA6B 2UWEE 1A6WL 3O2DA 1QZNA 4Y9EA 5AKRA 4OCWH 1J5DA 5HVHB 3CVIH 1U33A 5C0BA 5L4MA 3RFZB 1G9EA 5DT1L 2IALA 2AQSA 4JB9H 4P9ML 2DBJA 5CJQH 3DV6B 1OE3A 3VU2A 4XGZA 5I66B 4ALAH 4OI9A 3QFGA 4L9LB 2F54D 3PP3K 4J3OH 4RAUA 5EOTA 1ZA3B 3Q5TA 3GZOA 4HIQA 1FE8H 3S5YA 4ETYA 4JZOB 3JWOC 4OSUL 1U58B 2OL3A 1I1YA 3N55A 1IARB 1VA9A 4BUHA 2OULB 2X4SA 3NSFA 3J7HA 2Q8AL 2QHRH 1S9VB 3BE1H 4YR6B 2UXVA 4GFTB 4AX3A 3IM1A 4YHLL 2CBPA 3QZBA 3IDUA 3D50A 4ZNEE 1FCGA 2EVJA 4F9PA 4FC3E 1NCDL 4AEHH 1GKEA 3Q44A 1N6QH 1Q0YH 4QRSA 2Y1AA 1MCOH 3ARGD 5FKAB 2DLFL 5IBUB 4BQBA 5AG8A 3I2CH 5D2LB 1HSBA 2CHNA 4H8VA 4BSJA 2PXYB 2X53A 5BO1L 3VRJA 3KGSA 4F3FA 1A7PL 3E1F1 3PQYA 5L2JA 3TNNB 1CXEA 1QSEE 2WXRA 1F4AA 5KANI 4B9FA 3P40A 1FO0H 2W9EH 3OHMB 3UP1A 1AC0A 3DWTA 3ABLB 1ZLVH 1SQ2N 2NDFA 3B3IA 1R4XA 4DT2A 2PW1B 3DECA 4L4TA 3O4LA 4IRZL 4BFIB 2CKNA 3EFFA 1HHHB 3AU1A 4QHMA 3KPRD 5EUKB 1KYAA 1LM8V 3FSOA 1FNAA 3BKML 4UNUA 1LK3H 4L5FL 3D3VE 3MOQA 1P4BL 2HKLA 4XAKD 4FLOA 4APXA 3FSVA 4HU2A 4PBWD 3EHBB 5EA0L 3B2VH 3KJ6H 3MX0A 1CDJA 3ESPA 4AI7A 1NEPA 5G5DA 5T5FA 3FTGB 1RIUL 1D5IH 3TJEL 5JDJA 3GSQA 4HBQA 1P0SE 4ZX6A 4AG4L 3QRGH 2A1WL 5DS8B 3VXRD 4XBGB 4NZRH 1UWYA 1DN0A 3ESOA 5E8EA 3V5DB 5FO7A 4MD0B 5A6LA 4ZFGH 4G8GD 4XPHH 1NGYA 3C5XA 2ZCKH 4UU9A 1JRHH 2CKBH 4WNJA 5IF0B 4LPUA 5DFAA 2AJXH 1AVAA 1XF1A 1CF8L 2CUAA 5IHZA 3UPRA 3T08A 2BP5M 2XG5B 4ZSOA 3B9KC 3VRLE 4JKMA 1G6RH 3EFOB 4LF3B 4BRVA 3U0WH 2PCXA 3VG9C 2Q76B 3INOA 1IILE 4BE5A 1T03L 1IGMH 2J56A 2HFEB 1JPTH 4H44C 2J2ZA 3QR0A 2CUMA 3NPZB 3QNYA 3WN5A 1QVOB 4DW2H 3NEEA 4NM8H 1TPXC 2DI7A 1SJMA 3CFQA 5INCA 5LN8A 2W0KA 1V3KA 1WZMA 2VW7A 2H3NA 5GRJH 1JXGA 4GKSB 1DN2A 5IB3B 3TWYA 3V52L 1LO2L 1PDKA 1JMZA 4ZUSB 3D39A 3QUKA 4QOKE 2CCLA 1I7ZA 1JCVA 4UQDA 4FQIH 3RDTB 5DJXB 4HX1B 5B1BB 2WSKA 3GJEB 2DWTA 4NPYB 4NZUH 5IV2A 1JRHI 2G2RA 4L5FE 1L7IL 4HIJB 1JE6A 1SNRA 4AV0A 5JIQA 1LWJA 3ARBD 1G0XA 1RIVL 3BPOB 5I5RA 3N6YA 5KANG 1FNEB 1XGRA 3K6DA 4AYFB 3BP4B 3HN5A 3TESA 1KYOK 1MVFA 4J3OG 4YXLL 2A7BA 4RWYL 3NCFB 2CE6A 3MCLL 3MUHL 4M43L 4EVNB 2DQDL 2DY2A 1T6VN 4Y1AD 3CHRA 3HNVH 4PB0L 4Y19E 4BKTC 3GRGA 5K9KB 2FZ3A 2LABA 1KCSL 4MAZA 4NIKB 2V7NB 1NMCB 1A8ZA 3KLQA 4PV8B 1WH0A 4GSXA 2WLNA 2VL4A 4MBOA 1HL5A 2J8UF 3ZKND 4N9GB 3LD8B 1DVUA 2FB4L 4TLSA 4HJJL 3HZKA 4NJAH 4PJAB 1IEHA 2YSSB 3IRCA 1HKFA 5GJTH 4KRLB 1PTZA 4IJ3B 4OJFL 5IVXE 4HJ0C 1PZSA 3BP5A 2HRGA 1F6AA 1ZEAL 2JQAA 1G7QB 3BVVA 3ARDC 5E2UL 4NYLA 3SO3C 4X8XA 2LVEA 5GSVB 4KC3B 4F58H 2IH3A 3DIFB 2YGOA 3FUMA 2WBJB 4FERA 2KYIA 2WLKA 3U0TA 2X2JA 4YFEA 2W92A 3N44F 2JELL 3MJ7A 4HZAA 3ZTEA 4XVTH 1G5GA 5DJDB 4EUPA 2P8PA 4TUJB 4E41E 4YH6A 4EIBA 4PYGA 1R3JA 1T1WB 3AGWA 4TMPA 1HOCB 2DIEA 2VM9A 1MRDH 4N2LA 4HUKB 4UUJB 2GUOB 2C1PA 2AQQA 3DYOA 4NRYB 2OA9A 3GC3A 3RJQB 3NIGB 4NQEB 3C5ZD 1JI2A 1C12B 2AEQH 3VA6A 4O58H 4Y16C 1NCWL 1QW9A 3JQOB 1A7BA 4JM2B 4EXPX 1OW0C 2CGYA 1IQDB 1L0XA 3HG1D 3GBML 3UO1L 2AP2A 3DI2B 2FLRT 4Z7OF 5KBDA 1GMIA 4M48L 1BFVH 2FQDA 1ZATA 2QZQA 4M29A 5D7JB 4BH8B 4YSQA 2ARJA 4WF7A 4Y9CA 4K2UH 2CA4A 2MFNA 3Q2WA 4HCRL 3LRMA 4Z7VB 4M56A 3R0MA 4NN6B 4X8JB 3T0ED 3I74A 1TVBB 1C7SA 1G7IA 1KF9B 2ZG1A 2YBRB 2P5ED 4FNRA 1ROCA 2WP3T 4KROD 3U4BH 3NABL 1ULVA 3FN0L 1A9VA 5J4MA 1CXKA 3HMXA 1QZ1A 1BJ1H 2FO4B 4PLOB 4C57C 4R8WL 4OGQC 1I1AC 4LP4A 1SM3H 4HKZA 3BAJA 1H5BC 3JV0A 4L1HA 4F8TA 1MRCH 5HVHC 4F92B 1UA7A 3BIKB 4X5RA 3RFZC 1XF2A 1UH4A 4FG4A 5K9OB 3EBIA 2UZYB 1JSYA 3JVGA 4Q4IA 1CD1A 3B2UD 1EHLH 1EZLA 1A0QH 1PIFA 3WS6C 4YWGH 1IFRA 3EYOA 2VDLH 4NQUA 4UT9A 4AM0B 2IBZY 4JFEE 2WVSA 2WK2A 2PCFA 1JPEA 4Z3JA 4BD4A 3OKLA 1EJFA 5IJVB 4WDIB 1FNGA 4POZD 4ZNCD 2PW2B 3K6FA 1LDPL 2JLPA 2SEBA 2VZVA 4RMSA 3VWKB 4QNPF 3UDWC 4H1LH 1AS6A 1GRWA 1GY2A 1IRAY 4WNQB 3IFLH 5KSAB 1RUPL 5DQDL 2ICWA 4UQ3B 1NIBA 4OV5B 2V17H 3H85A 4P2OA 3D09A 3DOSB 1VRSA 3NZSA 2OYPA 3WE6B 2D7QA 1AE6L 4GEJA 2J71A 3F00A 4ELMA 2XWBA 3U36B 3VG0H 3VSQA 2XN9B 3LEXB 3PHAA 4OZIE 4LHUG 3FW6A 1MJJA 3GXPA 3TWCL 1GY1A 2ZE0A 2R2EB 1QBMH 1MHEB 3EDDA 4NP4L 5DUPH 5E2VH 4F27A 1IGJA 5ISZA 1DUZB 4JPVH 3CUPA 1MJUH 4OF7A 2F74A 1MLCA 3NJIA 3GTVA 5DI8B 5IGXL 3ILQD 2FECI 2WXQA 4Q0XH 3IJYB 1BEXA 5KVGH 4QHKI 2X4PA 3L95A 3MLYH 4AT6A 2YRPA 3TIDA 3O3DA 2IDFA 5ITBH 5DRXB 3L3OA 2YMTA 5AAMA 5TDNA 1G5AA 2IDUA 5BRZD 4KTDH 3T65B 3QFJE 2E75C 2YAMA 2AV7B 4MVBC 4EN3D 1KB5L 4JUSA 4LVNB 1UGKA 1E5UI 3GXIA 1RUMH 5FGRA 1CFVH 4H2AA 4U1IB 3ILEA 5BS0E 1A1MB 2YD3A 4GLRH 4YE4H 5H35A 1LK2B 2OCCB 3MTRA 4MAYB 1T1YA 5AVRB 1WBYB 1FGVL 2IDSA 4PLKD 3EJZC 5KOMC 3V5HB 3W0WA 4APQB 4MA8H 3U7WL 4G8IB 2BHFA 1O5PA 1CWVA 1VB9A 3OF6A 4JQXA 4PJ8D 4EKJA 3FU7A 3L5HA 3MNWB 5IW3A 3RKDC 5C8JB 1OZTG 4F2MB 3OLGA 3TBCA 3ZTNH 2J55A 1A47A 1KIQB 2Z9TA 4Z7NE 4XC3H 1DDHB 3KBFA 4Z76B 1AG0A 1ZGLA 3S37X 5D4HA 3DBSA 1DLFH 3GMNA 5BMFL 1FYTE 2FJFB 5JA9A 3A6CH 5L2KB 3QJFA 1R1CA 2XVLA 1EXGA 5IKCA 1KIPB 1I7UA 3MHZA 3U83A 5AKVA 3BZEA 3O2VH 4YO0B 2XTJB 2FGZA 1NBZA 5D71L 4LCCB 3VXSE 3OSVA 3U48A 3OKOA 5KTEH 3PWPB 2AABL 4GQ9H 4IOIA 4MBRA 3ZX1A 2X9YA 3O4OB 4KI5E 3M07A 3QDMD 2GJPA 4Z7UB 3ZE2F 2P44B 2RA1A 3PWUA 3VD1A 1JI1A 1GGBL 1XIWD 5AUMA 4NFDA 2APBA 4HALA 4WTWA 5T3XL 1JGLH 4JPIB 4KK5D 5I73C 4J8RB 4YHPB 3RQ3A 2R69L 4QF1A 4XAWH 3QS2A 5HGGS 3WLBB 5EF1A 2Q1EA 3GSOA 4HFUL 3V2AR 3FB8B 4ZXBC 3MYJB 3BPOC 3DIVA 3ILQC 1YY8A 1QUNB 3QHTC 3WLWD 1BVOA 3UMNA 3JWNC 3WKPA 4AQAB 3AG4B 2WO3B 3FH8A 5DRWA 5IR1B 1FBIH 3VMOA 1BBJA 3TONA 1WRFA 1AANA 3G5WA 1VZGA 5FW7A 1YCSA 3PHQB 2QDWA 3AWEA 4YBHA 1T1ZB 1Z0NA 2XG4B 4E9LA 1MWAH 5DK2B 4F8OA 3P54A 3QE5A 5DMIH 2XX0A 3CSYA 1LQSR 4YC2B 2OR9L 3Q1EA 4H1LG 2CALA 2E56A 3ENEA 4M5ZH 2Z64C 1F90L 3ZSTA 3C08H 4QO1A 2GHWB 3B6SB 3QORD 4TNGA 2ADIA 2IADA 1J1PL 3WIHL 3WFZA 4FQ2L 1GH7A 2A6JB 4JFDD 1UXWA 2R1XB 5T1KB 3NCXA 1KLUA 3ES6A 1QEWA 2IGLA 5AZ2L 4NGHH 3NQKA 1E0OB 2OTUB 3QIUB 5FHAL 2WBJC 4AH2B 1Q94A 1N26A 2AANA 4DOHB 1UQSB 4ZFOL 1Z9MA 2Y1ZA 3KGTA 5IBTL 4FFYL 4NM4L 4OCNC 3MRNB 3TN0D 3HI1A 1BEYL 3AUVA 5HHOE 4NAJA 2A77H 1AGCA 1YYMH 3NVQA 3VH8A 1R5IB 4PRIB 3RWFB 1KZYA 4LU5H 1YNTF 3FFCA 3MFGB 4ZOCA 5JLZB 1K4CA 3HN8A 5AW5B 3V0JA 5T3XE 2IV8A 4XT1C 5CP3A 1H0DB 2CBOA 2D7OA 4MJIE 1DCEA 2GSGB 2VDQB 4X5XB 4JM2C 5D2NB 4G3YH 3KH3A 3LH9A 4L4VB 1RZGB 1G6RB 1RIHH 3TBTA 3IPFA 2HTLD 4PJHE 3Q5YA 1VKXA 1PZCA 1QEXA 3E2HB 1SUJA 4KO5A 4YGVA 1MUJB 4OGXL 1H8OA 2D3NA 2MPAH 3JVFC 3P9MB 3ZN6A 4W6YB 3VUAA 3HG3A 4P05A 5TE6H 4CN6A 4KK5C 3DJZA 3THMH 2XTLA 1YO4A 4AGPA 1JWMB 4MNQD 1EV2E 3PHSA 3LRSA 3QUHA 4NN6C 1FIGL 4PJ5B 2VN6A 4ISVB 3R18A 4UINL 4C59B 3CDGB 3F58H 3B9KA 4DQAA 4ANKA 3CCHB 5BVJB 1AY1L 1JNNL 4X5WA 1XCQB 4YHIB 2RD0A 4KVNL 1L9OA 3ASNB 1DVFD 2ADGA 5IK3B 5KVFL 3SHSA 3UP6A 5IM7A 1FHGA 1H3XA 4UV4H 4PJXB 5IMLA 1N59B 3QULB 1KGCD 2MEJB 3PWJB 4KKAC 1HH6B 1X6LA 4ONOA 2CRIA 2MQGA 1KENL 1A02N 3HUJF 3BT2H 4TQEH 3KMDA 1XFPA 2YUXA 2Z31D 4PG2C 4WFGD 1B9KA 3VFRA 2NSXA 4OGYL 1QFWL 4XRCA 5FYLL 3SDAC 2D0FA 4J6RH 4XCCH 3OAUL 3NCJH 3SDDB 1MVUA 3OPZH 5F7FA 3DGGB 3FB7A 1BZEA 4O2CB 2EKSB 1VFMA 3G5ZA 4RMBA 3ZMRA 2IANB 1WAAE 4KNTA 1CZ8H 4LK4A 1E7VA 4WGVB 5L4IA 4P5TB 4WY7H 1G9MC 1J8HD 1JNLH 2HUEA 3WUWA 1KTJA 2FYYB 2F7PA 3ML9A 4B9ZA 5IHWA 4ZPTA 1UATA 1JD7A 3WNPA 4X99A 3H3KA 4WHDA 3UZVA 3UTSB 4EI6B 3KG5A 4A38A 4M7LT 4Z7IA 3GZKA 1B0GB 1W72L 3RZCB 3I85A 3K5SA 1YN7B 4LASL 2BOCB 5D5ME 5JW5A 3CSGA 2AJVL 2RFXA 5KSAC 1FV1A 1J5CA 4JFOB 1CYGA 1T1XB 3L7FA 1ETA1 4U3HA 3RVTD 4A6YA 1UFGA 4TSCH 1MZYA 3BO8A 3FCTA 3MBXH 3E0GA 1TMCB 4IM8A 5JZ7C 4W1TA 4R26H 1A1NA 3F7YA 3QPQD 1T0MB 4UQAA 3T4AC 2K70A 4G6FB 3S35X 4M4RA 1RSFA 1ZANH 3D18B 3ZQDA 4AGLA 2BY3A 2I07B 3CAFA 2PTVA 2Q7YA 5I2IA 3N0PB 4B9YA 3UL4A 1LNUA 4QTIH 3DROB 2ZOWA 3OQ3B 1KN2H 4GAYB 1LD9B 2R4RL 2BDNH 4K7PY 4NN7B 5KVFE 2W8CA 2Q2EB 4JDEB 3MV9D 2YUZA 4ZTOH 1WLHA 1A7QL 3NMEA 1ZLUH 4LVOB 4LHQB 5A2BA 1W2KT 3MODH 3VI3A 4PV9A 3HMWH 4JKWA 1IKOP 1GVIA 3M17A 2J1XA 3V0AC 1DVZA 4XNBA 1KPUB 5FYLE 3Q7JA 1HZHH 1A4CA 4LSTH 3CU1A 1SQMA 4UILH 5CEZL 3DO7A 1NAMA 4JFPA 1NC2D 3VFPA 4LVNC 3T2OA 4AQ8C 3FS9A 3QZOA 5FS5A 3CZNA 5J57B 2PO6C 2Q5BA 4I18B 2E7LC 4LB8A 5LBGA 3J8F7 4KXZI 1CGYA 1XSOA 3LKOA 4QHLA 2CLVA 5LNEA 4Y16A 4X7CC 4MAYC 2BZ7A 2NXZB 2YQ2A 1TZIA 1OW0A 4PJBA 4LVHC 3LHPL 1OIOA 4QHNA 1XR8A 2AK4D 4M5YL 4V33A 2B59B 1S7SB 2G4EA 5C0CA 2EVHA 2Y1YA 4AGNA 3HG4A 1IM3B 1LE5A 4H20H 3ULUC 3LKQA 1XAUA 1CE6A 1UXLA 5AZEH 3VQ2C 1CBVH 4IBWA 1T89C 2XLLA 1HJCA 2NNFA 2H1XA 2WLIA 2IQ9H 5F7NC 5SWZA 3BH9B 4EE2A 4L9DA 4NQVA 4Y4KB 5EU5B 3V0FA 5LG6A 5I18H 1B4LA 4HUVA 3HB3B 3S96A 4OCSL 1ZPUA 1V54B 2WZ5A 4P2RA 4UZSA 1I1AA 5AL0A 4TULL 3F7VB 3O9WB 2XTJC 1H5BA 3ZHNA 4LCCC 4QRUB 4IRJB 1ZK9A 5EF0A 2HG0A 2WNGA 3RFZA 3RWIB 2ZYIA 3FHEA 3AW5A 3O4OC 4G71B 5F0MB 1LO5B 1QLEB 4DN3H 3VQ1C 2JB6B 4WWKD 2XV3A 4PW4A 4F37F 5I66A 4OZHE 4HF5L 4BCZA 3WS6A 2CDEB 1MFBL 4FFZA 4IIQC 1ZA3A 3MQIA 4JZOA 3G5YB 2PETA 2XBZA 3LN4A 2VO8A 4N90E 1MFAH 4UZUA 5CEZE 5LAXB 1Q1PA 3IK2A 4F7TB 4YR6A 2WYIA 3VNZA 5A2JH 5CLZA 5AWNH 4AUYA 3IN0A 1SGKA 4P9HC 3UDWA 4Y89A 3AAZA 4X6FB 4EXKA 4YS4A 2QMJA 1L7TL 4MD4B 1L3WA 5A7EA 1HL4A 3QPKA 3LYRA 3L13A 4Y0GA 4X6CE 3TYFB 3O2DL 2ZSVB 1UTDA 3TEXA 5F7KC 5FKAA 5AB0A 4YC2C 4WVRA 4JDVB 1ONQB 4N5UA 5D2LA 3IFOB 2X44D 4H8PA 1E8WA 5TQ2L 2F5BH 3CFMA 5HP5A 1LP9F 3LB6D 3TNNA 1B88A 4LPVA 2X28A 5T1MB 4XNQA 2N0MA 4JK0D 1KBKA 2X87A 3ZHKA 2E9GA 2Z0BA 3HR5B 3MA9L 5D7EA 1UD4A 3VGHA 4XWGL 4DVBA 1RZJH 1U8CB 2OL3L 1YEFL 3FQTA 4NQCE 3SDXE 4AUUA 3X12B 4PAZA 4Z3FA 3QIUC 3LEVH 1ZK5A 3KJ4C 5TDOB 4F37K 1GTFA 4XBEL 2FH8A 3ZKMC 5B38B 4URKA 1HC1A 5EUKA 4X50A 5F1IB 2WLMA 2GITB 4HXBL 2R0WL 1AR1B 4BFFA 4Y4FD 5AOIA 2HB0A 3C5JB 3QDGB 1ZLSH 1FPTH 3RPIB 3ZL4L 1S7QB 2NT0A 4HUNB 2OPCA 3KPSE 3L1OL 3V8OA 3GIVA 1ZT7B 2VDPH 3DTXB 4H8WH 4YUEH 4G5ZH 4QYOB 1KXQA 1LLAA 3S3DB 3QYMA 4OB5H 4IDLA 4G6AC 4ODVH 2OXGB 4R7DB 5DD3L 5LCVH 4UM9B 3REVB 5D2NC 3FF7A 1LL1A 5DS8A 1Z5LB 2M8XA 4XBGA 3MMEB 1WFUA 2XBDA 3NSYA 4N28A 3GRWH 1YG9A 4GW5B 1OSYA 4PJ9B 3S9DB 3DMMD 4A55A 2ZCZA 5ID0B 1INQA 1K3IA 3F5WB 4JO8A 5CIPH 1QFUH 2YLHA 4WNSA 2ZXQA 1A1OA 1OE1A 3VM7A 4V2BA 1GZQB 3MV7B 6FABL 3H7LA 5T5NG 3QWRD 1ZTXL 1XF3B 1FQ9C 4R96B 5C0BE 2XG5A 4KNUA 1DQDH 2NLJB 2PWHA 1YEGH 3K7UA 5DSCB 3FFDB 1SY6A 3EFOA 4ZAKB 4LF3A 4DP0X 4HW6A 4QPEA 2ZNWA 1G0DA 3DVGB 5F0PB 2HFEA 1QR4A 4PWFA 3V4VA 3TZVB 1X5XA 3IPBA 4FQJH 2R51A 1MCNA 5JR1H 3IMSA 5T5FL 5LXGL 1QVOA 1MY5A 5F9AC 5IHHA 5ITFA 1IUZA 4N3TA 4LKCB 4FKHA 1FL5B 4JO1L 4PJDA 3BKJL 1ZLVK 1XGPB 4ZO6A 5IB3A 3SDDC 3KVPA 1J05B 4R7VA 4WV1C 5GGQL 3Q8BA 3RY4A 1ND0B 1J9SA 5EFIA 5HYEA 3FYIB 4LP5A 5CJOH 3W3BA 3OG6B 2NY5C 5GGTH 2LLNA 3QB7C 4HX1A 2ADJA 5IW6B 5DGQA 5EIVA 4GKNB 1B4JH 4ZXBA 4KKNA 1MXGA 3WDJA 2VXTH 3QDAA 4PJ7B 1SJEA 1DJIA 4JG0L 3ELAT 5E8OB 3RZCC 1F6LL 3GMOB 5EORH 5I9QC 5T1JA 3F83A 2JXMB 2B8OT 4YSCA 1IV8A 3X1FA 5K9KA 2DTMH 4XMUA 2WQVA 3KPMB 4GBXD 1PMYA 5GIRB 1NC4D 4ODHH 1T2JA 4QRPE 2HSIA 1ET7A 1CL7H 2F0CA 4OAWA 4LEEA 1ZMYA 7FABL 1D5XA 3O4LE 3GKZA 1GS7A 2WZ0A 3KZ8A 2EXYC 5F8QC 4I3RL 1F13A 5HYSB 4OGAC 2CU9A 2HPTA 1M3IA 1VFUA 1ZTXE 4LQFL 1G7QA 2YFOA 4AV4A 2APTA 4KVCH 3NH7H 5GSVA 4JM4L 3TJHC 4NKDB 2WBJA 2IPKA 4M5SA 1PVHA 2IG2H 4KK6C 2N7BA 1F58H 1RP9A 4PM1A 3ZKXC 3D1MC 2R83A 4G6JH 4HC1H 3ZSSA 4KJWC 1BZ7B 4HD9A 3P30L 2O5YH 2CO2A 4KDTC 1DANU 2CJ3A 5LXVA 2K8MA 5LNGA 2ESVB 1HOCA 2EEBA 4F57L 3D5OF 4OF6A 3DSFH 5JTWA 1G9NH 1FC2D 4L8BB 4N8VG 4N9OB 3K0YA 2W88A 4NQEA 3OAWA 1C12A 4HIHB 5B3JE 1DQIA 1L3NA 5CUSH 4ZW7A 4JM2A 4K9EC 2VLKD 5FF6B 3KWTA 2GT9B 2NXZC 4QXWA 1IQDA 5BO0D 5I30H 3IMVA 1UASA 1J48A 5E4AA 3BAWA 5F7EL 4D0BB 5JW4Q 3G5XB 4JFXB 4ZSOE 1IGFL 2WZAA 4KTYA 4NHUA 4OFDA 1CMOA 1WZLA 4EIGB 2OTPA 3NCWA 4QLRA 4BH8A 4O02A 4Z18A 1FZMB 3ZDYE 5ADPL 1UM5L 1BD2B 3N1MC 4U31A 5C0GA 1FLRL 3HC4H 2E8YA 4ILDA 2DDQH 4KMTH 1U95B 3UBXB 3D9AL 1NCHA 2BS8A 2A3TA 5JXED 1JWSB 1C9SA 4D8PB 2VLMD 1MFVA 4OF5A 2VW4A 4Y4KC 3WO4B 4JFWA 5K59E 3A23A 5IG7B 3GMMB 5L6YH 4LOFA 3HB3C 3D39E 1WA1X 5IFAH 3SGDI 4N87A 1M1XB 2R0ZH 2BIOA 3A47A 4IRJC 4WO4D 3BIKA 4PG2A 3RGVB 1KJMA 3CDYA 1GW6A 4KTEH 1JYWA 2WCGA 3BAEL 2B1AL 3SDAA 3KPLB 1KJ3L 3BAIA 1EEYB 2LLLA 1OSPH 2QQKH 1X9LA 5HDBB 2UZYA 3WEBA 5J5EA 5K9OA 2KERA 5HHPB 3HE6D 1IBHA 2OSYA 2E27L 2JKWA 1FAKT 1Q38A 3FB6B 4WI5A 1NFAA 1HWHB 3QJTB 2HVJB 3EOAB 1A6PA 3K4DA 1A65A 2HN7B 1KN4H 3PV7A 4WUKH 3OWEA 4JN2A 4RFNB 2NR6C 2WZ6A 2HWZL 4KJQD 4JFDA 3WXWH 4Z8FH 3QXTA 3WSQL 4HT1H 1D6VH 3S5LG 5J11C 5J12B 2P3YA 4N25A 1QRNB 3BVWA 4A67A 3UROR 3CFJA 1TO4A 2D9CA 3NCBB 3VSUA 4XPTH 4GKOA 3HMXL 1XBRA 4JKNA 3W39B 1QHQA 1TZGH 4H88H 2ZAIA 4Z0XB 4HS6A 4POYA 3CLEH 1R3KB 3UTZA 3NSDA 4OV5A 4OUUA 1E43A 1QLRA 4C58B 1U3YA 4NQDB 3ZGIA 3U36A 1FFPB 4A66A 2XN9A 2FR4B 1E65A 3QR1A 5GZNC 1M71A 3T4AA 2NY4B 1TZ8A 4ABWA 4WEMB 1DQJA 4JPKL 2FYVA 1MHEA 4UT9L 3F6LA 3WFCH 1DUZA 3B43A 4JY5L 2X0WA 1F3JB 1TQCB 3I75B 5DI8A 5E4OA 3HC0A 3AQXA 3IJYA 2A4ZA 3QI9B 2DJUA 4LMQI 5BOPA 3RL1B 4GPVA 4WHYH 2J7LA 5LWYH 4MA1C 5DRXA 5F7HA 4K3EH 3BI9X 2BWDA 5HVWA 1AR1C 3JV5A 3T65A 3ZT7A 1YEIH 2VN3A 1JZFA 4LZHA 5IIEA 3VD3A 4GIPD 1T2QL 3FPYA 1FAIL 4AQ8A 3LS5H 1W6WA 1OQOA 4HJ1A 5JW4R 1YAZA 2PO6A 5AYTA 2E7LA 1K85A 1J7VR 4K8RL 4DGVL 2WB1A 4TVPH 4UTCA 1DHKA 3CZJA 4B41A 3US9A 4MAYA 3D7PA 3B2MA 1WBYA 4ZX3A 3VD5A 5E1AB 3DK2A 1R3LB 1ZVHA 2BSEA 1EDHA 4K3JL 4PJ9C 2GK0B 4LL4A 5F7YC 4K94L 2WQWA 3T2NH 4PGDA 4WJKB 3TV3H 3UJTL 2P9RA 5ESAB 3ZO0A 2HFGL 5JIMA 3MNWA 2E6QA 4L1BA 3V6FA 4YDJB 4FRWA 3SGJC 1JVKA 3E3QE 3FXIC 2YXMA 4G42B 5TF0A 2XKSA 1KIQA 4HAGA 4WSGA 1T89A 1A2YA 4Z76A 1MRFL 3J2PA 4FQLL 4OZFB 1XR9B 2BW5A 4ZAKC 1AS7A 2NXYD 2AGJL 5KZCD 3EXLA 3A6BH 4WWOA 4PD4J 1KIPA 3TZVC 2XIBA 4LSPL 3ISRA 1MREL 4X6EB 3UXFA 3BUTA 3FU5A 4LCCA 4GXVH 1J9RA 4GYBA 1WZ1H 2IC2A 3CVBA 4AEEA 4NDMA 2XPGB 5B4MC 2BIHA 2WHVA 3MRBB 2NCMA 2G5UA 2ICWJ 2WUBL 1BIIA 3QUXD 4DGIL 4NRXB 4XP5H 2PKDA 4JPIA 4NBZB 3ZK0A 1I3GL 2JIXB 3H9HB 4IIQA 4J8RA 5I74B 4YHPA 3E38A 1CTMA 1M05B 1SLUA 4GFXA 3WLBA 4IDJH 2JB5H 4Y4HC 3FB8A 2DTSA 3MYJA 3S4SB 1M7DA 1UA3A 2A2QT 5B39A 1ZT1B 3HC3H 4NUGH 5IW1B 1QUNA 3X1BA 2AVFA 4C54A 3F12B 2HRHA 4DNLA 4JFHD 4AQAA 4ELME 3PLYA 4IBSA 1XXDC 4G6MH 3UIZA 4XMKH 1E4XL 5DZOA 1T1ZA 5ISZE 2XG4A 2F58L 2V9TA 1UA6L 5ESVA 3CXDH 3IMRA 1U91A 1AGDA 3ECQA 1BW8A 2I9LB 3P11H 1DBAH 2VH5H 2VXVL 3B6SA 2YPVH 2ITCB 1AO7E 1XMWA 2NY0D 4HDIB 4DUXA 3BRFA 3BZ4A 1EX0A 3SE8L 2AZAA 2BSSA 4GAGH 3GM8A 2A6JA 4ZQKB 3JWOL 4PS4L 2R1XA 4HFWB 1SVCP 1ZSDB 5T1KA 1KLGA 2BLFA 1ICTA 1RZ8B 1WFNA 4MYPA 3Q8CA 1JP5A 1J0HA 5LJYH 4URTB 3QIUA 5D1XD 1R24B 4Q7DA 2FT8A 3OHXB 1OPGH 3QP3A 3ZXAC 5KJRL 2OK0H 3NUKA 2OZNA 3UJJL 3V0GA 4G9FD 3MRNA 3VB8A 5C09D 4L8DA 2QJDA 4ZMXA 1XGUA 4OKVB 4PJEB 4QXTB 3H0TB 4TSAL 5EUOF 5ACLA 1IEBA 4U1GB 5LNDA 1R5IA 2VO5A 4PRIA 3RA7L 5JLZA 1MCLA 2YRLA 3RJOA 5EIIG 4WHYG 3W0WE 2Z1KA 4Q9QH 1DQKA 1H0DA 2FT6A 2WLYA 3PG2A 1AQDB 2DLEA 1PZAA 4R90L 5A16B 4TM9A 2BVTA 2GSGA 3HOGA 1HSAA 3HZYB 4X5XA 3WFHB 5D2NA 5MEPB 5A3ID 2ENQA 1RZGA 3FSAA 1UOLA 4HCIA 1NCAH 4JZJC 4XN7A 3D85D 4NCDA 3FU0A 4M7LL 4OCYL 3T3MF 2BFGA 2BSTB 3UCQA 5JORB 2HKHL 3MBWB 3RB5A 5J6GA 5DS1A 4HLZH 3QNFA 3CPLB 3HPJB 3LN5B 4HMCA 3V7AG 1TCRB 1JWMA 1GIGH 2ZNXA 4LSQH 2IMMA 4PJ5A 3C12A 2VLRB 2ORBH 2WWKT 3CDGA 1YEKH 2DLGA 3RTQB 3EO0B 2MH4A 2ODHA 5T3ZL 5BVJA 3WO4C 1XCQA 2P80D 4RMWA 2R56L 3CC5B 1WTLA 4GB9A 1F4WH 3I6LD 5IK3A 4Q9RL 4HOZA 4MMYB 5GGRA 1N59A 2ZF8A 3QULA 4E9QA 3BGFB 3PWJA 2OYMA 1HH6A 1B0WA 4CSPA 3MKGA 2XYBA 5CILL 4DP2X 4BKSC 1NGXA 2GQHA 4JKPH 3PPEA 3RGVC 2ENSA 5FYJD 3RVXD 1AZBA 3A24A 3V79C 3SDDA 3QHZL 5I0YA 3T9WA 3DGGA 4WV1A 4O2CA 4PU2A 3SE9H 4P2YA 1AG6A 2KPWA 3BESR 2JMRA 1ML0A 5DJCB 3VXMA 2WXPA 1HZKA 4IGBB 4P9MH 2UXFA 1G4RA 2W80C 5K69A 4FNTA 1FNSL 4TLUA 4XHJD 3S3CB 3HNTL 3P4NA 4KZ0A 5J13B 1JNHB 2JKLA 1CGTA 3P4MB 1Z3RA 2VITB 4K5MA 4EI6A 4GSDL 1B0GA 4OSUH 1MCIA 3RZCA 3I9AA 1YN7A 2BOCA 3C6EA 4RNRB 3NGBB 2A0LD 2DIBA 1PEZA 1T1XA 3FK3A 2VMJA 3GMLB 4YQXH 1KPVA 6PAZA 3SE4C 1G9HA 1J0YA 1NFDA 1UWGL 4YSTA 4YHLH 4DUVA 4AW4A 3D2UD 4NC0B 2ZQKA 2ZUTA 1FCCA 1OXYA 4RRPA 2GY7B 3SDYL 3WNOA 3VI4B 1NCDH 4NO0D 5CWSB 3QO1B 2PPFA 2V3EA 1X9RA 4LCWB 1AGBB 1OP3H 5H4ZA 2Y5QA 2CRZA 5I8EA 3D18A 3KDMB 5FGCB 4ZMLA 2X2UA 4FQXB 2I07A 1KOAA 1NBQA 1DR9A 2IAMD 3UAAA 1CE1H 1PYWA 5BO1H 1Q0EA 2EIKB 1A7PH 4OFYD 1CVRA 2W60B 3ZE2B 5T3ZE 1ZHKB 4GAYA 1LD9A 4OQTA 5DZVA 4YPJA 3FFCE 4L18A 2D7NA 2EVIA 1A4JB 3QI9C 4S1SL 5H2BA 3U6RA 1JS4A 2XWRA 3MRDB 1EA9C 3BZFB 1UWXK 5EEXA 5DJ6B 3ARSA 2GUYA 1KCKA 1TU2B 4Z23A 1KPUA 4LIQL 4KDTA 1YC8A 4A6YL 4IRZH 1H9DA 1XH2A 3U46B 3DXAB 4BQ6A 2WIIA 5GS1C 1IBDA 1PZ2A 3VFWB 3F62A 3I6KB 1KB3A 3CDFA 1KJ2B 4M1CD 2A9AA 4DKAA 2ZYHA 4L5FH 3LZOA 4RGND 2BVQA 4IKNA 4CC0A 1P4BH 5DZNA 4FJZA 3UTTB 5EDSA 5EA0H 3SODB 3MRIB 4WQOA 4YSAA 4B7LA 1RK1B 2GC7C 4PJGB 2XZCL 3JUZA 2EIZB 5AVTB 1D7CA 1RIUH 4R4BA 1CYXA 2R0KL 3TJEH 3EYFB 2B59A 1S7SA 5HI4D 1YYCA 1UOKA 4AG4H 2A1WH 3IXAB 1GGCL 3ULSA 1USZA 2C4XA 4W9HC 4EKXA 4YL9A 3GSNB 1W0YT 4P2QB 2K9UA 3IKCB 3GXMA 3DDFA 3Q8EA 1A8JH 2YK1H 2WCSA 3ARRA 4HV8B 5DD0L 2WUCL 4ZMQA 4BK5C 3BH9A 2VR4A 1DQML 4Y4KA 4ONFL 5EU5A 5T5NF 4IU3A 2BNUB 3WELA 1V05A 4HLZG 4FKEA 1W0WA 5CAYB 1X9QA 4MJ6A 1P1ZB 1CF8H 1U92B 3F7VA 3ARYA 2DYPA 3ARUA 2EH7L 3TBVB 3LZFL 3VXTB 1EO8L 4QRUA 4IRJA 4I48B 3MOAH 4UZGA 1OO2A 2NYYD 1NCBL 3DBXA 1T03H 3DHPA 3RWIA 4OIAA 1ZT4B 3UTOA 3TF7C 1D5MB 4WK0B 1LO5A 3RUGA 3GJFH 1EHXA 2JB6A 4CN1A 3C9NA 2P7TB 3F6JA 4JZNB 4PREB 1PSKL 4QAMB 3MLWL 5I74C 1NIFA 5EZPA 2NR6A 4LIQE 4N2AA 4GRWE 4HJIA 3V52H 5ICXB 1LO2H 3US1A 2YPLD 5LAXA 4B9PA 3KPTA 3DX6B 3C2SA 1WEJL 5DU7A 3NSJA 3VA2C 1LGVA 3U1SH 4X6FA 3VQLA 3ARTA 2V7HB 2BNRB 4MD4A 1L7IH 3CG8A 4NBYB 1JXFA 3RWHA 1JHTA 5IB4B 2P8LA 1RIVH 1UB6B 3J27A 3Q6FA 3RVVD 3TYFA 5ERWB 4YXLH 4RWYH 1XZ0B 1I9IL 3MCLH 2COQA 1ONQA 4MZ3A 3BUQA 3GGWB 4EZLA 4XODA 3IFOA 4M43H 1NCOA 1CD9B 1NL0L 5F0JB 2DQDH 3QFDA 4AQZA 3LPPA 5GZNA 4PB0H 3CZKA 4AZ8B 5FB8A 1CIUA 1TITA 1U6AL 1VACA 4GW1B 1KCSH 1MNUL 5KSUA 3VI3E 1CUOA 4PRHB 2X4UA 3HR5A 5C0RL 1TFHA 3FOMB 3DGDA 1U8CA 2YD4A 2V5YA 2VR8A 3EGXB 4YVUA 2VKWA 3HNSL 4WKXA 5I75B 4HJJH 3V7MA 3X12A 1OB0A 5A2KH 4U6YB 2EDOA 1BP3B 3DTDA 4OJFH 4JMXA 1OGTB 1Y7VA 3OHXC 1ZEAH 3L3JA 3LMJL 4LSUL 5F1IA 3ARZA 1J12A 4HEPA 5I15H 2GITA 2D2CC 5AOZA 1DFXA 3IDXL 3SEPA 5FO9B 5FM4A 3K46A 4PJBE 3C5JA 4U1GC 4P04A 2AEIT 3P4OA 1NBYA 2EXSA 1KXTA 1JXKA 1P7BA 2JELH 1AR2A 4QYOA 4RCAA 5C0CE 4BHUI 3SOBL 1XF4A 3UZEC 3EHBD 2GSIB 1XVSA 4ZTPH 4R7DA 4YLQT 4UM9A 2H5UA 1Z5LA 2F18A 4XVSL 3HEIB 2WM0A 4N20A 3VXNA 2J73A 4ZODA 3V0WL 1KJVB 5SWZE 4PJ9A 3FRPG 5D55A 2ZOKB 1MN4A 3KBPA 2YQBA 4WWID 1M2VB 4P57A 5IJBC 5ID0A 5C0NC 3F5WA 3D33A 4I3GA 4P2RE 4C4UA 4DJMA 3F65A 3KXFD 2OQJA 3FQUA 4YBLB 3SGJA 1GZQA 3UO1H 1ACXA 1ITBB 3L9EA 4XWOD 3D0VB 3SQBB 1KTCA 1E50A 1IAIL 4R96A 5EG6C 2EYRB 3RTQC 3TF4A 3DJRA 1K5NB 5DSCA 3FFDA 3FUKA 4HCRH 2MCG1 3BDYH 3DVGA 4QKTA 1HCFX 3GO1L 3TZVA 4HSAC 3BGFC 1CFNB 3OLDA 2YKKA 4DWHA 4ZFFB 3US0A 3GEWB 3STBA 3RWJB 3WJMB 3ECWA 5LGYA 2VDNB 4MQSB 3NABH 5HI3D 3FN0H 2V33A 4LKCA 3FQ1A 4IRSD 4S10A 1FL5A 4GT7A 4R8WH 4X4XB 4L37B 1XGPA 1A7OH 5CR1A 4N1HB 3NT0A 1J05A 3QEHB 5E6ID 4NT6A 1RHHB 4HUWB 1IVLA 3OSKA 1BA9A 5IW6A 2WO4A 1QI3A 3MLRL 4GKNA 4X8CA 4YZFE 3QIWD 3GZQA 2UV3A 3RDTD 1L5GB 2V8MA 4Y4HA 3LZRA 5J13C 2FH6A 2N3JA 3ZGHA 4AVJA 4S1DD 4NUJB 2AC0A 3MNDA 3C6LB 3QSKB 2A9CA 1KSRA 5D2LE 4JGNA 2H32B 5GGUB 5C07B 2K6ZA 1SY6L 2BP3A 1BXAA 2NNXA 5E8OA 3GMOA 3QT2A 4CU7A 1G7PB 1TUPA 2JXMA 5CEXA 2ZP8A 3MRKB 1TR7A 2PP7A 3NGBC 4J3WA 1GZPB 1MZZA 5KOVC 1KEMH 3O11B 4G80B 2E7MA 1I53A 7PCYA 4KPHL 2EIBA 2N59A 4O00A 4HIXL 4K71C 1ZE3C 4M8RA 1OKEA 1RUPH 1CURA 4JDZA 1BSIA 4CVWA 1EZVX 3SKJL 2Z92B 3S7GA 1QG3A 2MKLC 2E9WA 2VDKL 3IJSB 3P2BA 2G3MA 4FQXC 3ZDZF 5B7FA 4HK3J 2CD0A 2X2HA 3M8OL 2L3BA 2DQIL 1JV5B 5TGBB 3NG5A 1M4KA 3BD3A 5DJAB 4Q52A 3TX4A 3QIBD 3GINA 4F2FA 4NKDA 4NP4H 1PIGA 3ARFD 4J8QA 3O2WL 5GGSY 2EDWA 2KS0A 3QUMA 1KXQE 4MNGA 4YXHL 5C1MB 4GSQA 5HI5C 4YOKA 1W8EA 3FSWA 3P0YL 1J5IA 5JHDB 5IGXH 5L0QB 4AGQA 2C7UB 2R7EB 4BEIA 3VFVB 2Q2LA 5IEHB 3JYBA 3D8MA 1EBAA 1CDBA 1O75A 3F3HA 2F2HA 4JFZH 1ORSA 2ESVA 5D1ZD 1N67A 2NYKA 3DX1A 3DURB 2YKLL 4WFFD 3VX1A 4OFKA 5E9DB 2BK8A 3GMPA 3WNMA 3P3SA 3HZ3A 3MRFB 5AD0B 5C08D 4AYDC 2QQQA 3ULVD 5GRYA 2B5IB 3O3AA 4FJYA 3PDOB 1CJYA 5FF6A 4XPBL 2GT9A 1GC1H 1RK0B 2XV6B 3NYKA 3QPXL 1TTUA 2Q8BL 5ELIA 4JZJA 4D0BA 3BN9D 1HQ4A 3G5XA 4NOBA 2O61A 4L1DA 4KAQL 5DS2A 1G7MB 3L5WB 5HGHB 4UNVA 2DWEB 3E7JA 1FZMA 1BD2A 1S7XB 1TQSA 3IB4A 3ZUCA 3BYTA 2KLRA 4MTMA 3UBXA 1BFOB 2AK1L 2I5YL 4OLEA 1PPIA 2VZ3A 1JWSA 4PJDE 2X3CA 4ZDHA 1M3JA 2OJEB 1EDYA 3R8QA 5HYFA 5ABZA 2NMSA 2OJZL 2UY7A 4TPRL 5A2LH 3V0VB 1A6ZA 4GO8A 1U8OB 3W1ZA 4ZO9A 3VW3L 1NINA 3WDHA 2IDTA 3LRLA 3DETD 5IB5B 1IIKA 1OB1B 5BMFH 5DRZB 3RGVA 3KPLA 5D1QB 5D8JL 3MFFB 1EEYA 1U8QB 2O6EA 1JL8A 2V9UA 1WS8A 2WAQA 2R15A 2MQ0A 5HHPA 3JWNE 3G3LA 1OTTC 3MA7B 5D71H 3FB6A 1UB5B 5I1CL 4QRRB 3GI8L 4O02L 1SBSL 4FHKA 5DHVH 2AABH 2X6UA 3BFOA 3TO2B 5EOCL 3I02B 4GXUN 2AJSL 4ICXA 2HYMA 1GGBH 2WLZA 2YGVA 3KW8A 2K7PA 1OT4A 1QRNA 3UAFA 1NANH 4A7VA 1HE8A 1PAZA 2DL9A 3DRQB 3Q43A 2IWKA 2R69H 5KN5B 5T33L 3FTUA 5IVZB 4B7IA 3MRMA 3W39A 1ZV5A 3BGMA 4H0GA 3VWKD 4NLAA 1KBBA 3LXCA 4PJAE 2G3NA 4GP5B 2MNUA 3SE4A 4RESB 1R3KA 2QVTA 2YC1B 4G2AA 5F6HJ 5D1ZC 1YYLH 1IAOB 3OJMB 1JUFA 3PWVB 4GUQA 3UCRA 1FFPA 4ONHB 5IB2A 2YD5A 1TLMA 2EEXA 3DX7B 4XTRD 2MMXA 5FFOA 1NPJA 5I1DB 1ZS2A 2NZ9D 3H55A 3PHOA 2NUPB 4KKCD 2DI8A 1GMEA 1L9QA 5EBGA 4YSRA 2OR9H 1G9ML 2GBTA 3BN3B 4YFDB 4LAJH 1ASQA 4L48A 1F3JA 2VWEC 1F90H 2X4RA 4KY2A 4BKLA 2ODIA 1UD3A 2DLTA 1K8DA 2G5BA 3TVMB 5I75C 3QI9A 4PLNC 4RAHA 2FEEL 1NGQL 4FQ2H 5T1LD 3RL1A 2A9ML 4IK6A 3TA3B 4YPGA 1OARL 3BIAX 4L2YA 3S97C 2WW8A 4NQEE 1SXCA 1C5DB 3OMAB 5L7XL 5AZ2H 1FRGH 2I32A 5EOCJ 5FHAH 1BOGB 2OMWB 4OD1L 1TEFA 1YY9C 4IIZA 4LLMB 4R0LC 1OT1A 4AMKH 5EC1A 1M6UA 3BJLA 5GS1A 1CFMA 2R39A 1EHNA 5IBTH 4FFYH 4NM4H 5CGTA 4ES9A 4ZW5A 5L4FA 2JKNA 1P84K 1BEYH 1H3VA 1MCBA 1MSPA 1J0ZA 4OCMC 3T77B 1I8IB 1HZLA 5E1AA 1UH3A 3QZMA 5GXBB 3FDWA 4BWTA 1BZ9B 4TOYL 4MJ4A 1OL0A 2VISB 2GK0A 4Z77A 5IVXB 3Q3GA 3QRBA 5ESAA 2EUWA 3MZGB 4LESA 2D8KA 3MCG1 4YDJA 4K5LA 2P43B 15C8L 2ALAA 5E6YA 2NX5D 4FQ1L 5GS0C 5F9OL 5I6XB 3CZLA 4F7MB 1GHFH 4OGXH 3K1KC 4PGCB 3WEXA 3CFTA 3MLXL 4GXFA 4BK5A 2IPTL 4WI7A 4OVVA 2ADFL 1H3TA 3ARPA 1BLIA 4Z7AA 5C0AD 5DJ0B 2G2PA 4HUXA 4UINH 1FIGH 4J3OD 4KK8D 4P4RA 4MNHB 2OSLB 4X6EA 2BSDA 2VDMB 2J8OA 1JZEA 3DX2A 4C56D 2DW5A 4I13B 1AY1H 4U3CA 1P4LB 1HE7A 5I1EL 5KVFH 4O51B 2XPGA 4GG6F 4K23L 1FFRA 2NY7L 3SDCB 5E23A 2DOCA 4Q8BA 4A2HA 2MTAA 2SODB 2W95A 3FU8A 3PWPD 4NRXA 1KENH 5AVQB 4IMLA 3CFBB 4XTRC 1LEGB 3MNVB 5KAQG 3KBHE 3RNQB 2JIXA 2FBOJ 3PIQB 3LNIA 3H9HA 5CINL 2WLLA 1ORQB 4OGYH 1QFWH 5FYLH 3ULUL 3WS3A 3OAUH 5IMOB 4NKIL 1T5KA 2CQVA 3S4SA 35C8L 1B3JA 1U8KA 5FIEA 5IW1A 3C6LC 1A5FL 3F12A 3HRZA 1AZRA 1XF5B 2DKMA 2XN9E 1WYJA 2QELA 1MQKH 5HHVH 3Q2LA 3WENA 3MCKB 4KDWA 1MJ7L 2QQLL 2Q7AA 3ZHFA 4U33A 3LDBC 4F7EB 4OJEH 3C87A 1HL9A 2EE6A 3EH5B 1W72H 4JFQB 3HIZA 5FUCC 4LASH 1KY6A 4KMQA 5KJ7E 1Q9WB 2I9LA 2OSWA 4PP1D 2IOIA 2MCPL 5GQBA 3FTWA 1VGEL 2ITCA 1RXLA 2DJSA 1ADQH 1JZJA 4HDIA 4BUGA 2O26U 1ITCA 4AE0A 2RR3A 1UT9A 4ZQKA 5B7MA 4HFWA 3GWJA 3JV4B 4PN6A 3R06A 2DICA 3GBNL 3AWFA 3T1WA 1RZ8A 3ABZA 3I9PA 2Y07L 4G1MB 2JTDA 2DPKA 3UZQB 1P7KA 2FWUA 5EO0B 1G1KA 3MJ8A 4I8DA 2HXAA 4P9HL 4RSVA 3OHXA 3M7OA 4ELDA 1QI4A 2R4RH 4Q6KA 3NCYS 1DYZA 4OKVA 4PJEA 4XVUD 1UKTA 2X2YA 3BVUA 2DF3A 5J9PA 2Y1VA 2IBBA 4EIZC 3HCVB 3MRPB 2WN2A 2KC0A 3TJPA 2UWEF 4AXWB 1UURA 3QZWG 1AQDA 2CJTA 4LOUD 3UZEA 3ULUE 4JFFB 2A4EA 5J1AA 5CEZH 3F7RA 3T8XA 1DO5A 5MEPA 1VLXA 2B15A 2M1KA 4NKOB 1DUYB 1IBGL 3ZMEA 4PWJA 2BSTA 4N2MA 5GS3A 4NQSB 5JORA 2ZX5A 4PS8A 3MBWA 5A7BA 5L2KE 4P5RA 3VFOB 5LLIC 3PUCA 1S9XB 3CPLA 3SY0B 3LN5A 3HC2A 1R5VB 4Y2DD 1S7TA 2XTJE 3LHPH 4IKKA 5ECGA 2DLHA 2VLRA 3KYNA 2XNAB 4M5YH 5E6SB 4A52A 3RTQA 2PYEB 3EO0A 5FR3A 3KPOA 4HGMA 3VTMA 1SEQL 4S0HA 3GMQB 3QFJB 3QXAA 3QQ3B 4HAKA 3A67L 3D4CA 3QQ9C 2Z6FA 4OIIH 2PTTB 4XO5A 5EU6B 4DN4L 1GGTA 4JHBA 1JOIA 1K72A 3W2DH 5I6NA 3QISA 3D25B 3K81A 2CZNA 2VDQL 4HKXB 2C9RA 2KZKA 1I8LC 5D1QC 5BS0B 4JRXB 4YLBA 3IBEA 3PAUA 1B4RA 5FWQA 4TULH 4HCFA 2KPNA 3C8HA 4MXQC 4PP1C 3VD2A 1B2WL 2HCZX 1C5BL 4XNXL 1F1GA 2DQ6A 3EYSL 5DJCA 5FDYA 4LHUD 2MJWA 4WJ5B 5DFWH 4Z6AT 4P5TD 5AKSA 2F8VA 4OM1L 2Q7NA 5F3BB 4HF5H 1JIBA 1CQKA 1JGDA 1MFBH 2KQMA 4BCYA 4F15B 4RQQB 2MCAA 3UTSD 3O8XB 1AACA 4RNRA 2XA3A 3UC2A 4PGZA 3IYLW 1VJSA 4DF9A 5I76B 1FYTB 1OCZB 4GIAA 2J20A 2X9WA 3H3BC 5HYJB 3GSWA 4UOQA 3K8MA 1DE4B 1P1VA 3POCA 4B97A 6PCYA 5FLUA 4V1DB 4PBVC 3QO1A 4TKWA 3O2DH 2P24B 1M1SA 1NFKA 1GYWA 3G7TA 1NWPA 1AGBA 1MCDA 3IGAB 1SZNA 4LCWA 5HDWA 4DOHE 5F9WB 2DQCL 3KDMA 4K3GA 2NY5L 4JN1L 4FQXA 3SPVB 1GTNA 2Y5TB 5TQ2H 2W60A 1CGUA 1J87A 3B8SA 3DVIA 4PRIE 3ESMA 4KRPD 3TVMC 3CFCL 4PI2A 4MASA 2IMNA 3MA9H 3TA3C 2CIIB 3CZUB 4XNYL 1KB5B 2OL3H 1BX2B 1YEFH 1QPXA 2CO6A 1VAHA 2R0LL 5DJ6A 5CZXC 4I3SL 1TU2A 1S4IA 3SE3C 3DYPA 4CADB 1ZCRA 2HMIC 5FECA 2OMNA 5D2NE 4L4VE 5C7XL 3FUEA 3DXAA 4NZJA 4XBEH 2C3WA 2FJUB 3FO1A 3PXHA 2EC9U 2WV3A 5F97E 2H6PB 2XXFA 4N0CC 2EICA 5IT2L 4YBQC 4LLQB 1KJ2A 4HXBH 2R0WH 3ZE0F 3BPNC 4H26B 3R4DA 4S1RL 3VX0A 3W82A 3ZL4H 4FA7B 3RWGB 3FZUD 1BPLB 5C0JB 2VE6B 4UQIM 1F97A 3L1OH 3UTTA 5KG9B 4PJ5E 4IRSA 2NZ1A 4WRLA 3LZLA 4E5XG 2EIZA 5A40E 3O6FB 4ZTEA 2R2HB 4OQTL 5DD3H 4RZKA 4PG9A 2QMKA 2XN0A 3EZJB 3IXAA 4PJXE 3BAXA 4JDTL 1UZ8B 4F8QA 1JZ3A 3TFKC 3W56A 3GSNA 5E0FA 1LJMA 5HD8C 5I6XC 1VADB 3I3BA 3UBGA 4FS0A 4UOJA 4FNPA 2HLFC 5AOJA 1OP5K 4HV8A 4JLRB 4Q58C 2N4IA 4YSEA 1QYGL 4K0OA 2UXTA 6FABH 2ZKHH 3CVHH 4H8UA 2IANE 4X7FC 2R8SL 3VXME 1U92A 1ZTXH 4DGUA 2XRAH 4A04A 2GJ6D 3IGKA 2WINA 1OP3K 4TUKL 3KR3L 3PV6B 4K9EL 4NI6A 4I9WD 3GBDA 3PU7A 4MJIB 4OLYL 1D5MA 3FT0A 2X4TB 2VZUA 5T5FH 4L3CB 4JZNA 3CH1B 4PREA 4XH2B 4AY0A 4PJHB 1MFDL 1C1EL 3D0LB 4ADGA 5ILTL 2UZXA 2HA1A 1T66C 1CLOL 5ICXA 1F45A 2IWFA 5EC2A 1ACYL 1BF5A 4Z95L 1NFDE 5GGQH 3HLAB 5IJKA 2C4FU 2MOVA 4Z9KB 3DX6A 3LXAA 4HZ1A 3S2CA 2H0PA 2BNRA 4P2AA 5JW3L 4PHZA 4R9HA 5IB4A 3NFSL 1DBJH 4FG6D 1UB6A 1H8NA 5CGYD 5ERWA 4PS7A 3ZQWA 1EBPA 5FHBL 1N3NB 1XZ0A 4HUMB 4WZ9A 5D1ZA 5KYYB 2VDOB 3TH3T 2I26N 1CF1A 4YMPA 1B4TA 2CDFB 2OMVB 5KVMC 2RB8A 3E1ZA 5DVLA 3SJVB 1OK8A 3QJUB 1KBWA 1QLEL 2XXMB 4AZ8A 4WW2F 5K5YA 3OQRA 4GW1A 4D9LH 2J4WL 3HUJA 4PRHA 3L7EA 5IFJB 3H9SA 1O6VA 3GI9H 3AREB 3MACH 3FOMA 1WCBB 4CNIA 3TOPA 3FB5B 5C6TL 2H3KA 3MLUL 2D3JA 1U2CA 3L9BA 5ES4B 2ITFA 4AUJA 3AGVA 1DBML 5GJSL 5IHUL 3PREA 3KPPB 1OAXL 1AAJA 1F00I 1A3QA 1MHHB 3WKML 1NCGA 4KHXL 2H1PL 4JM4H 5FO9A 3UEQA 2D31B 3QRLA 1U30A 4R0LA 1XCXA 2J57A 3QDGD 2KT6A 4PP2A 1NDGB 3P30H 1NFIA 3S8FB 1D7FA 1IC5L 2JCCF 3L2NA 4PB9L 5D70L 5AVUB 3IFPA 3UAJD 1NGPL 2GSIA 2F7OA 1NCIA 3BRDA 5HTSA 1CLVA 2JKXA 2A5UA 5T1DL 1MCQA 3ZOAA 1KGYE 5I6MA 4LXFA 5F89A 5H94B 2WOBA 3BKCL 1TXKA 3HW7A 3UX9B 4GI6A 2ZOKA 1W8OA 1N10A 2OI9B 4IBYA 1FZJA 1LEIA 3FC8A 1NUGA 5F7EH 5DVKA 3K71B 1B9ZA 3SQBA 3D0VA 1IGFH 4E9WA 4JVPA 1OCWL 1X9UA 3KHQA 2OMYB 2BP8B 2W5PA 1QACA 4E9XA 1RJZA 5ADPH 1UM5H 4IMKC 1DO6A 3BEVB 5SV4A 1FLRH 1T0NA 4E9SA 3NTCL 1WWAX 3D9AH 5FPIA 4JREB 1CFNA 4K07A 4ZFFA 3MREB 4B95C 5C2BL 4RFOL 3WJMA 1JF1B 5E8PB 3UTPE 4IKIA 1HQRA 1I9EA 2F53D 4LZKA 4KK9C 2XIDA 2BP0B 5DO2D 2Y6SC 1CBJA 1XSJA 3ISWA 5EZIL 2F9BT 2NW3B 1PLBA 4RMRA 4X4XA 2FBJL 4OZIF 3VGBA 3QEHA 1CT8B 4S2SA 1RHHA 1EFXB 5GHWL 4UNIA 1KMGA 3LNFA 3BAEH 1MCEA 1KJ3H 1W72B 4ZUWA 1QATA 2VL5B 1UVQB 1HNGA 1L5GA 1O9WA 3U9PH 5GGSB 2KUTA 4DKFL 3NN8A 2Y24A 4NUJA 3K6NA 1IC7H 3MBEC 3C6LA 4QXGH 3L5XH 3MR9B 3Q1SH 4UQEA 2H32A 4AM0Q 4F15C 1UZ6F 2J6EH 1AXIB 1G7PA 2HWZH 1F1AA 4BJLA 5ADOL 1GZPA 3WSQH 3O11A 3T6WA 1CFTA 2XKUA 4JJ5B 3WTSA 4G80A 4OV6F 2OW6A 3LKRB 4CMMB 4HZLB 3HMXH 2CPCA 3ILPB 4YHKL 2R1YA 1Z3GL 2HT4D 1HU8A 5AQ0A 3TBSB 3R8BB 2Z92A 5F9WC 2UUDH 1YMMD 4U1HA 1SDDA 3IJSA 3SPHA 4DK3A 5M94B 4MQ7A 5TGBA 5ICYB 1RFDL 5DJAA 1MQ8A 4CL7A 1XSIA 1H3PL 4JPKH 4YDZA 2WLHA 4ZD3L 3AG1B 2Y2TA 2EEAA 4MWFB 5TF1L 3TS8A 2VRAA 5HJ3A 2ZX6A 4IOFD 4JY5H 1PNDA 4PRDA 1T3FB 4Z7NF 3TC9A 3ZE1F 2VUKA 5IEHA 4U0RB 2Q9OA 1F6FB 3AT8A 2GCYB 2XQ0A 4EDXB 1ZWIA 1CR9H 3DURA 3WFEH 3MGTB 4EZMA 4X6CB 5E9DA 1A64A 5AD0A 5C0AA 4FQQB 3PAVA 1N2RB 1NMAL 3PDOA 4AC2A 4JO4L 1M53A 1FF5A 3KBEA 4OFPA 2YD9A 3MUY1 2DQFB 2DWDA 5IROC 1FAIH 1UACL 5C9JB 5MEND 4ZYKA 4FXKC 4GS7B 4P46B 4OJAA 2XDHA 4K8RH 4DGVH 5I26A 3DJ9A 5CLTA 1G7MA 3L5WA 3O6FC 2VN4A 4HJSA 2DM4A 4MQXD 4UMGA 1IBFA 5HGHA 43CAB 4ZUTA 4NQCB 3SDXB 1S7XA 1TQVA 5BZWA 1KCRL 4K73A 4NENA 4AW7A 2VUOA 4K3JH 2CJSA 4K94H 5AVXB 3UJTH 2IWEA 3L1GA 4JG9A 3MRCB 2AMGA 2HFGH 2OJEA 4MCZB 1RLBA 4WCYH 5F70A 2ETWA 1MF2L 4MJJA 1UUSA 3N5AA 3EO1A 2B3RA 1U8OA 4TQHA 1MRFH 4JANA 3DUHA 3KPSB 3NP3A 5IB5A 2HJKA 4LNRB 1AHWB 4WEEA 1XGYL 5DRZA 2FATL 2AGJH 2ICWI 5LGHL 3PL6C 3W5NA 2HRPL 1XV8A 1I8LA 1SXZA 5D1QA 5AFAA 1H15B 2YPKB 4H0IA 1IKFH 4KKLC 3MVSA 1MREH 3MA7A 1UB5A 3Q01A 4R5VA 4QRRA 2QGEA 5EZLB 43C9B 4AWJC 1TKWA 2X6VA 1YEEL 3TO2A 2WUBH 4PJIF 3I50L 3G6JF 5KBMA 4DGIH 4N2HA 2WJ5A 1MCWM 2FL5B 5DWUL 2HKFL 2PTUA 4O2FA 4D9QD 3II1A 4DFHA 3VDAA 1UEMA 3HAEB 3B1UA 5C0BB 3K72A 3TTYA 2YD0A 3FO9B 4C55A 4OIFA 4JY4B 4N2OA 4O9HL 4XGZB 5CR8A 1JWUB 2YC1A 2K0RA 4HULB 1AKJD 2DQUL 2XXGA 1KG0B 5EOTB 5H37H 4ONHA 1E4XH 1KCLA 1MI5B 1I9RL 2X10A 32C2A 5KSBB 4Y2LA 3H6JA 4NQDD 5I1DA 1Q4NX 3D52A 2F58H 1UA6H 3QYNA 2CKBA 2NUPA 4IJTA 2HX8A 4L8CB 3ZO9A 2AHIA 2NY4D 1KIUB 2VXUL 4DCQB 1N5AA 4EEEA 1EJ6A 4FYTA 3X2QB 2G9KA 3UAEA 1QSFD 2ESVE 3TVMA 2VXVH 3DX8A 4UYQA 1J18A 3T6QC 2X1OA 4FMVA 3KL0A 2I85A 4MQXC 3PCYA 3SE8H 1OSEA 5CSGA 4QRSB 3TA3A 5DYFA 3JWOH 4PS4H 3U2IA 4KI1A 2ZWKA 1HSBB 4G7VL 1C5DA 2G4GA 2JVUA 5DTFB 3SE3A 4OKDA 4FTVB 3VNYA 3PQYB 1BOGA 2OMWA 4PGEB 4N2EA 4OJYA 1CU4L 1VFBB 3DHUA 2UZIL 5KJRH 2CHWA 4JVWA 4K3DL 4Z0BL 4BFBD 3UJJH 4P23D 2VQUA 4S1QL 2EDJA 2MWCA 2ZX8A 4OU3A 4TSAH 1E4XI 3T77A 3IEAA 8PAZA 2Z4QB 1I8IA 2X3BA 1BD2E 3B3IB 2WOYA 3RA7H 4L4TB 2PNDA 2CDGA 2CH8A 4QLWA 3EFFB 5I17A 2COVD 3ZIMA 2EIJB 2BZDA 3AU1B 1HYSC 4L4JA 4X2UA 2VISA 4R90H 5FGSA 1SOQA 4HJUA 1NGWB 1WAAF 2UY6A 1JGEA 4HK3N 2CO4A 1E6OL 4H4NA 4P59L 2UVFA 3GHBH 5JIPA 2OI9C 1MH5B 2DRUA 3IU4L 1P6AB 2UYLA 3TT1L 4AENA 3TCLB 4APXB 4F91B 5IUSA 3QDJB 4M7LH 3RPBA 1KACB 4UCFA 3MX0B 3FRUB 1XB6A 4PGCA 4M61B 4ZO8A 3ZRCC 3RVUC 3S36H 1TETL 4IK7A 1LO4L 1KYOJ 1W6LA 2NSMA 1T2XA 2ZZUT 5IQMA 1DN0B 4JREC 1XX9C 2Y7QB 2NNCA 3C2AL 2WBWB 1DEEB 3T1FB 5DJ2A 5DF0A 1WT5C 2R56H 4GUCA 4UU9B 4Q9RH 1AYRA 4QWWC 5DFVC 3MZTA 4DAGL 1G7LB 5SWSB 2ATKB 1QRNE 5CP3H 2ZUSA 2ZXDA 3DO4A 1BPVA 3PJLA 5BVPL 5CILH 4WHCA 3CFBA 1LEGA 1U0QA 3RNQA 5IHZB 2AJ3B 2XN1A 3PIQA 3TU6A 3JXAA 1ORQA 2W81C 4ZSOB 3SSGA 2BRQA 5IMOA 3U4AA 2HVKB 5BXFA 1G4MA 2EDRA 1K6QL 3ZDYB 4FABL 4YXKL 2J2ZB 5FYJU 1OY3B 1F1DA 1QO3B 5I6PA 5JHBA 3RX9A 1L9TA 2HG5A 3N1FC 1BF8A 2XQYG 5FYKL 4B0MM 4YVNA 1FNSH 2X6MA 5INCB 1ROWA 4FNUA 2H3NB 5AVWB 4F7EA 4GSDH 2FE0A 2ZF9A 4HQQL 2X4OA 3IRPX 3D39B 4LEXL 1I7ZB 4JFQA 2WB7A 3DLQR 3QEQA 3PE9A 1WFJA 4N26A 4FD0A 2CG9X 4KKBD 5AENA 4XXDB 1WHPA 2Q6WA 5CZKA 1EUUA 3NZ8A 4P23C 4ETQA 4LL1A 1DCLA 5IOPB 4M6ML 1UWGH 2ERJB 1FG2B 5AW0B 2QPSA 4X6DF 2ICEC 3SDYH 5H37G 3D30A 1F56A 4HJGB 4IEFA 3IWUA 1P5UB 3RAJL 4G1MA 4JG5A 2TSAA 4J3BA 1I8AA 2YMXH 5EO0A 2FZ3B 3FT9A 4CMHB 2YGNA 4BGDA 3PFQA 5GISL 3WV0A 2ZXAA 4K7PX 1I3UA 1S78D 1BGXL 4S1SH 1KFAL 2EDNA 3IJ9A 4FYRA 3HCVA 1AZUA 4FZ8L 4BIKA 1XB3A 1ZDSA 4H40A 4LL9A 5JMOC 4DETA 3IAGC 4NERA 3K2IA 1DBKH 1II4E 3MTXA 4IBTA 4GRWH 4A6YH 5A2FA 4JFFA 2FEDD 2AI0L 4NYLB 1EHAA 2GC4C 1AQ8A 3B7RL 5FKPA 1JPFB 1PJ9A 5MHSE 4F1ZA 4E9TA 4GS7C 4P46C 3U0TB 1DUYA 4XPAL 3MNMA 4JR9L 5A6MA 5FYKE 1AQMA 2A9DA 2ATPB 4EUPB 3EH1A 5BCAA 5EEUA 4QTFA 4OI8A 3EH2A 1FFQA 3VFOA 1N12A 1P7QA 1R3JB 2P26A 5JDSA 3SY0A 1E9QB 4OZGB 1R5VA 4U2ZA 1EEUA 5DD5H 2XZCH 5AZUA 4Z1PA 2R0KH 1TTRA 2C1PB 2XNAA 1BQKA 3QQ4A 1EHKB 3ETSA 2PYEA 1GGCH 3APCA 3W81A 2W0PA 4IMKA 3PWNB 5HJGA 4AL8C 1JBJA 3VRIB 2E4FA 3UERA 1KTDA 3EOTL 1J8RA 2H3XC 1NAKL 3FO0L 4PHXA 3QQXA 2EZ0D 3OMNB 2PTTA 3C8KB 5EU6A 1IEAA 4XB8A 2WUCH 2XC8A 4WEBH 1AHWC 4FFVC 1DQMH 4ONFH 3D25A 2ARJB 3BISA 1TEYA 3P77A 4GT0A 2L8AA 1CICD 1X5KA 4JRXA 3WG7B 3QJHB 1R9FA 5HSFA 3Q0HA 2XWEA 4DP8X 3KEHA 3HJ0A 2DL2A 4A68A 2EH7H 3LZFH 1EO8H 1H19A 1SYVA 3MLTB 4HKJA 5DJYB 2EVGA 3O6ML 3RKPA 4WJ5A 1NCBH 3VH8G 1C8QA 4B9KC 4AQEA 4N22A 1KTLB 3UOAB 2A6DB 3APDA 3K2UH 1SF5A 4UIKH 2DEXX 3IS0X 5F3BA 4IGBD 2XT1B 1TNMA 3GRBA 3MBEA 4U6VL 1PSKH 2EIMB 2MHAA 4H8WC 4RQQA 2Z4TA 1ZV9A 1Y7MA 4G7SB 1XF2B 3GLAA 1UGNA 5ACMA 1JF6A 1E2VA 1JK9A 2BIQA 2V5SA 3IE4A 2BVUA 4JE4B 4Y2OA 5HYJA 3SGKC 3WMQA 1DE4A 4HWBH 4OTXH 3EDFA 4U1KB 1MAJA 1JHKL 3EYOB 4BFOA 2GPZA 2OW7A 2EDFA 4TUUA 3NA9L 4V1DA 1N8OE 1RULL 3BVNA 3VXPB 3UAJA 2P24A 3QUZB 1AXTL 1BM7A 3IGAA 3Q2CA 4NI3A 3STZB 1E6JL 3MYZA 3SPVA 1MPAL 2H2PD 1DVSA 3TO4B 5IBLD 1C8PA 2SEBB 4K7PL 5FCUL 5B22A 4BCXA 4PJEE 1T7VA 2UVEA 5DYOA 2BHZA 3QUYC 4PWIA 4ABQA 1U6AH 1MNUH 2Y25A 1URLA 4XCEA 2ICWB 5C0RH 2W65B 5HVGB 2EDMA 3K8LA 4GRLC 4JGUA 3HNSH 1LO0H 4L29B 2AJYL 4NO2B 4PRPD 4CADA 1XDTT 3L3HA 3VYPA 4M00A 4P3WA 1OOAA 1PG7L 2I60L 2XIIA 4B60A 1YNKL 3CQFA 4FA8A 3LMJH 4KX8A 3H6AA 4LSUH 5D4IA 4Y5VB 3WUWG 4BWWA 5ISZB 4JNXA 3OKKB 1W91A 2XWTB 4I85A 3CUPB 4LLQA 3IDXH 2F74B 1MLCB 3CFDB 5MI0C 4H26A 5F96L 4FF9A 5C0JA 1PLGL 5IROA 4ZFZA 1F4XL 5KG9A 3L95B 1E4JA 2VLRE 4FXKA 4GKZB 1IFHL 4JX0A 3TIDB 3BUBA 3O3DB 2OKMA 2ZXWB 2ZWZA 3L3OB 5TDNB 2E8ZA 4FI7A 4R2GD 4RX4D 4ATTA 3O6FA 2R2HA 5B3NA 2AQNA 2HFFB 2K4WA 5HGDB 3IAPA 2VERN 3V0WH 6CGTA 1MWAA 5D7KE 2WMPA 5FUOL 5FDWA 2OMZB 4P2QD 2PABA 2J21A 2LTQB 2JF1A 1U8PB 1UKSA 4JLRA 5LVEA 2V2WA 1T1YB 3F8UB 4DKTA 1WWBX 3ESNA 4D9RE 4F2EA 1IAIH 3F7QA 1KJ2L 3W0WB 4HK0B 1HYRC 1U8LB 1OGAA 4ANUA 3K4AA 3BUPA 3Q2NA 5EUOA 4KZDL 1BVZA 1EJ8A 3IDGA 3PV6A 4X7TB 4EQ3A 2QTEA 3IU3A 3PL6A 4NWTL 3FPXA 5EF3A 2QVMA 1DLHA 3QC5X 4TXVB 2VKXA 3GO1H 3RTLA 4OLXH 3LSOB 2XBTA 3DUUB 4WIQA 4N2KA 4DGWC 4K3HA 4N2FA 3CH1A 4XH2A 5B1JC 3BKYL 5C6PB 5K59F 1ZGLB 1OCRB 1HX0A 4UQBA 3D0LA 1YMMA 3CMGA 3GMNB 3VXUD 1AHMA 3R7QA 3GSNL 3MGOA 1H8LA 5HGBA 3QJFB 2DD8L 5KEZA 4LLWA 1I7UB 4TUOA 4UTBA 5BPPA 1J8KA 3VM5A 3IJEB 3MLRH 1KGIA 4ENEC 3EGDA 3KS0H 2AJUL 3ZT6A 1V5JA 3ECBA 2FCBA 4FA6A 3BWUF 3FUIA 3BAKA 4LCWE 4QXUL 3AJ7A 5E5LA 3L4YA 2VZ1A 1SYSB 1WJ3A 2FX7H 2ZX7A 5FGCE 2ZG3A 1QR1A 5HDRA 1BQHG 1CLZL 1IAII 5AUMB 5B7EA 4ZO7A 2MNWA 1N3NA 3FCSA 3UGUA 3BCFA 2EDHA 4MLIA 5E6UB 3ZE2E 3CX5J 1BYNA 3BQUD 2CDFA 2OMVA 4WUUB 3OVUB 4JHZA 2BSBA 3SJVA 2P5WB 3GSOB 1L0PA 4JRYA 3GB7B 3D05A 4F7CA 1DVQA 5DVMA 5IFJA 4LCVA