5LB1A

Crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with thionitrobenzoate (tnb) adduct at the active site cysteine-354
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
HLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Binding and processing of beta-lactam antibiotics by the transpeptidase LdtMt2 from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5lb1A02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lb1A01
4GSQA 4K73A 4JMXA 4ZFQA 4HUCA 4A1IA 4LZHA 1ZATA 5DZPA 3VYNA 4QTFA 2MTZA 3U1PA 5K69A 5E1GA 3VAEA 4GSUA 4A52A 4QR7A 4A1KA 4GSRA 5DZJA 3VYOA 4QRBA 3TX4A 2HKLA 5LB1A 4Z7AA 4QRAA 5DUJA 3VYPA 5E5LA 5DCCA 3U1QA 4JMNA 5E51A 4XVOA 5DU7A 1Y7MA 4A1JA 4HU2A 5E1IA 3ZG4A 3ZGPA 3TURA 5D7HA 4LPQA 5DVPA 5LBGA 3ZQDA 5DC2A
chains in the Genus database with same CATH superfamily
2YRPA 1TCRA 2DWYA 1KDIA 3QZOA 4XCCH 4F2MB 3MV8B 1YEIH 3VMNA 4HUCA 1FCCA 3PQYA 1DJWA 2W9DL 4BV1A 3SY0A 4JFQA 1A14H 1DDHB 3BSZH 4QCIA 2UY6B 3Q9QA 5C0BD 4TQHA 3L9RB 1ZTMA 3OAYH 4FYTA 1CPUA 4NXSA 2KQMA 3ZUCA 4WNQA 3KS0H 2A6IB 4F5CE 3NDYE 2XBDA 1BJ1J 1SGKA 3U46B 4CA4A 1TQUA 3AQZA 3CFMA 2XV6B 4OQTL 2VL5B 5T1KD 1M7DB 3LN5A 5E8EA 3HFML 3QG6B 4Y2NA 1KBVA 2B15A 1YPZF 2J5LC 1OWRM 5F72S 5SX4I 3S5LG 1KY6A 4L0ZA 5DMKA 1OLLA 3JXAA 1S9VA 2VKWA 3QO1B 1DQIA 1EBAA 4X7FC 3JWDC 1JDCA 3NK3A 2GVYA 2RTTA 3VRLE 1XH2A 4ZUVA 3VRIA 1BZOA 2IANE 5C07B 4MZRA 1BYNA 4OI9A 3T71A 3MXVH 4B5ZA 5A43C 1YEDA 2W9EL 4YNYA 3TEZA 3PGCA 2BS71 3N0AA 2L7UA 1P7HL 3EJJX 1WDAA 3R1GH 1PG7W 3IMRA 5CMAB 3KHOA 3LZQA 4Z7VE 4A6YH 4XBPB 4LE8A 1SF5A 4X6DF 3FTUA 3Q6GH 2OR8A 1G7HA 4ELKB 4XP1L 5D1QD 2X1XR 1IRAY 1TZIB 3GMRA 1NZRA 2F1BA 2IDCA 1UXMA 1DVTA 3OZLA 2ROXA 1XSJA 1QBMH 4YHIB 5TF1L 2CKBH 5EU3B 4LFHG 3X2QB 2X4SB 2APBA 1BGXL 2X6MA 4M61B 1S5IH 4JZJC 5SV3A 4N25A 5DTFA 3VXRB 5IOPB 1PU0A 2FWOA 3TCXA 1HKLL 4P2YA 1KEGL 5AD0A 1NC2D 1FSKB 3OG6B 2QVTA 3QDMA 4H13C 5SX4H 4HLEA 1IGYB 3UOAB 3VXOA 3HZVB 4I3RL 5CZXC 1BQLL 4PEEA 4PRHD 4I88A 5GJTL 3CXHJ 4XPHH 3ARGA 3MJ8B 3L1OL 1L9RA 2Z31D 4PJ9D 1U3HA 1XF3A 2K70A 4JVPA 2WP3O 3H42H 1MFMA 3ARFC 1M1XA 5IEHB 5CEZL 1QI4A 5JPNC 3FT3A 4UNVA 3ZYJA 2J71A 3GZQA 2DRUA 3QXAA 4G59C 2MHAB 3O6ML 4OJYA 2IBGA 1X5FA 3VFSB 1S7VB 1CDGA 1MCWM 2CJUH 3I84A 4AV4A 1F41A 2A6DA 5B1CA 4NNXA 4OT1L 5BVJA 3QJHB 3MPCA 2CO7A 2CDFB 3RVVD 3SYPA 3CH1A 2NY6D 3GZPA 4OF7A 2WBWB 5IW1B 5LHDA 4KFZC 1ZIAA 2CR0A 1KTBA 3GTTA 2V9QA 4O2CA 4EN3C 4WO4D 5DVNA 5CJ5A 1SUJA 2FLRT 2HP4A 2K9UA 3BPNB 3EJZC 1EQWA 1FQ9C 3L1FA 5C0GB 3AT0A 4XAWH 3QUZA 3C5ZC 4M5ZH 4OZFA 5DUJA 35C8L 4LNRB 7TAAA 3L3GA 2CU9A 1GA2A 3X1BA 2JJWA 4JG1L 1P1VA 1RK7A 2MCPH 4UT9A 4LLUB 1I8AA 1BVLB 2GIYA 3CBKB 5HI4D 4NHUB 2D3JA 1E42A 4CRPA 5KYYB 2WXOA 3VFVB 3X13A 3KR3H 4MQXC 3TBWB 4IJ3B 1BV8A 3Q2LA 3WFHB 1MCOH 4MB1A 1G5GA 5CLXA 3VDBA 2ICEC 1OTUC 3LHPL 3QUYB 1Q9WA 5D8JL 1AANA 5B1JC 3RZCC 1JE6A 4OH2A 1SJEA 4WCYL 5ICZB 3SJVA 1BXAA 1NWOA 1MAML 5CHNB 4PJBF 3NRPA 3VYPA 4KROD 5ISZE 4HFUL 4EI6B 4UT7H 3X3FH 2ALAA 1ORQB 3UBXA 3BDXA 5C3IA 4P2RB 4KXZI 3NUKA 1UOLA 4ZQTA 4IBUA 4RAHA 5DJCB 2PO6C 5BUAA 2WXQA 2CPUA 2YPLE 4GRLA 4XOBA 4DJMA 5IW6A 5JHAA 2ICWB 2YUVA 4L5FL 1B9KA 4DGIL 1DBBH 1JGEA 5JUEH 4PREA 2A83A 2NZ9D 1R5IA 3ARXA 3L3JA 5IB4A 5PCYA 4FABL 2R4SH 1UM4H 3HC0B 3AS1A 4AUJA 5GGUB 3CBRA 4WI2A 8FABB 4MX7B 4PJHA 5K39A 3ES6A 2J2ZB 3LXBA 2Y9RT 1J86A 3FOLB 1L0XA 1GTFA 3CNKA 4NN7B 1CK0L 3WBDA 4JVWA 5HHPB 4YHOH 5J12B 4XXDB 1KTRL 4BZ1H 2DMHA 1XH3B 3OMIB 5I19H 3GKWH 3N44B 5C0EA 2IALB 4JPVL 1JGIA 3ARDD 3E2HB 1NFDB 1P1ZB 3BWAB 4QOKB 1J05B 3QWNA 4PWEA 1INDL 4QRRB 3AS2A 4K9JA 1J8HA 3K2IA 4NOFA 4A2HA 2AVGA 2R29L 5E1HB 2BJMH 1ZOXA 4KXZH 5ESAA 3E9UA 1M1SA 5DI8A 3RVXD 4YHNA 3LPFA 3UJIH 2J3SA 3MV9E 4DGWC 1TZHA 4MAUH 4ANVA 3S97C 1EGJA 2DQCH 2X9YA 3CDFA 3HZYB 4PJCE 3KCPA 1D2PA 5B3JE 4H8PA 3SBWA 2Y7QB 2Q6WA 1LO4L 3IF1B 1WHPA 4ELMA 4B9JA 1HNGA 3BUPA 2P9RA 3NAAH 3LMJL 3NN8A 1GGBL 2R69H 1Y6KR 2ZOWA 3LIZH 1KFGA 3O9WD 1CFNA 2H6PB 4GNKB 2J5LB 2J43A 4GKNA 1J7VR 3W2DL 4LSRH 3OJVC 3ZE2B 2MNUA 1NJ9B 2WVTA 1QNZL 3DJZA 3OX8A 1MZYA 2DLFH 5DMIH 3UG3A 3CN4A 4H20L 3M17B 3RA7H 1PX8A 5SWSB 3SDAA 2Y7LA 5F9OH 3KWVA 2DWSA 2OSLB 4YO0B 1KXTA 2YKLH 4WDIB 3PGFH 2Y6SD 1UM6H 4IGBB 5B1BB 4KKRA 1TQBC 3IFLH 3FT2B 4U2ZA 2PXYB 5EOCH 1GY1A 4P5KA 1HYSD 2ZXCA 3GSWA 4MA1B 2PNDA 4F1ZA 4QHLA 4QDGA 3OB8A 4TTDC 2BHYA 3GIVB 1OY3B 3FYIB 4H4NA 3MRMA 5DZ9A 1JL8A 3VXTA 3GXMA 3V0GA 5B4MD 5ESQB 5B38G 5IQLA 4Z8FH 3X1NA 3DXAE 5F21B 4HGKC 3FK3A 3NEOA 1MPAL 4O2FB 2D7TL 3PGDA 3V4VB 4IRJA 1OB1A 2C4FU 3G5YB 2PWDA 3MRHB 1IBBA 1H3WM 3WNKA 2EADA 4UOW1 2X4OA 5DMJB 3G9VA 2JB6A 3PLYA 4HZLA 2I60H 3T0ED 3WIHA 1CO1A 1RIHL 2KI6A 1CFQB 5I6XB 5KSUA 4GBXD 3ARFB 4HMEA 2ATKA 4BQ6A 3IETB 2VLRE 5JPNB 1JAEA 2PCFA 4JFOA 4EKJA 4K71C 1I1CA 2AABH 1WZ1L 2VT0A 4P5MB 4K3EL 4UINL 2H2PC 2IVFC 3KPRB 2JLLA 3G04A 3L45A 4Q6YA 4XRCB 1JUFA 1E27A 3O2WL 3Q6FA 5JXAH 5KYWB 3QR1A 4G7VH 5IEKA 5DRNA 1TQSA 4PRIB 1GW0A 1XL4A 2B5IC 3PAZA 2EDLA 2DYSB 2W1NA 3OF6D 2AEWA 1VPOH 3RX8A 4JDEB 5FM5O 4EN3B 5KJRL 2G9KA 3ALWA 2XXFA 4NXKA 3TH3T 3VD0A 3HAEB 4MD5A 1AO7E 1PZ3A 4JHVA 1V7MH 5K69A 1DUYA 2X70B 3C5ZB 4KAQH 3PQYE 5T5FL 1T20B 1G6RA 2X89D 3VCLA 3VX0A 3WLWC 1TG8A 5D1QA 1EEZB 3OD3A 1JRHL 4LRIA 4YSEA 1X4ZA 1DEEA 3O3EA 5DGRA 2G0LA 2JKJA 5FKAA 5BUGA 1AQKL 1JIBA 1G4MA 3CD4A 3GJFB 5DJAB 5DZAA 3MX0A 2P5WB 4B9PA 1S7WB 2FH8A 1GZHA 1XWVA 5DF0A 2ICEB 4X6BB 2WD0A 2Q8AL 2PYED 1NC2A 1IKFH 3RZCB 4KX7A 4K23H 4PJDF 1MFEL 3RL2A 1EDYA 4R7DB 5LN4A 3SE3A 4PRHA 4ATWA 1AKJB 4I85A 4KJYB 2IH1B 4AYEC 4YN3A 4ZFGH 4RRPM 2Z31A 4PJ9A 2XV0A 4L8CA 2ADGA 3SD5A 4MCNA 5F9AC 3BPOB 4QGTA 1U8NB 1UD4A 1SMAA 2X42A 2BIIA 2PO6B 4P46C 3WJLA 3CUPA 1BIHA 3FUDA 4OD3H 4PM1A 2AQ2A 3SSGA 1BP3B 1TENA 2WUBL 2DKSA 4UYPA 1ZVNA 4F7PB 5EIQA 4HMCA 3ESNA 1N7MH 1UA3A 5DA4A 2OQJA 4AENA 1XCWA 3BXNA 1N2RA 4W9KC 5EUOA 1MLBA 4N8VA 1J1PL 3V0HA 3A6BH 4FNUA 3LYRA 1C5DA 3QORD 4U6YA 4JFUA 4MMXC 4WO4A 4R8WL 4F15C 1CFVH 1EERB 2GJZB 3MAWA 5EIVA 3VWKC 1AXSA 1MWAA 3UAFA 1S7TA 4XBEH 3ZL1A 3T2PA 1AKPA 4LESA 1R3KA 5DRXA 3TFKD 2K9FB 5HYSB 3QQ4B 1RL1A 1EO7A 4BH7B 1QSZA 3I3DA 3NP3A 1XCTB 1YUHA 2G30A 2CHDA 1Y6NR 2DJMA 4JRXD 1S3RA 3QAQA 4HSCX 4N0UA 1JV5B 2RJMA 2DIAA 3CMOL 2AQPA 3EOTH 3LKRA 4BYHA 2BIMA 2XWEA 3WV0A 5I0DA 5I17A 2A6JA 5K33A 3O0RL 4P59L 3UTPD 3ARVA 1KV3A 1SHSA 3MI6A 4Y5VA 3PWLA 4Z78B 1TJHH 2VR4A 3TT1H 2E7DA 2CE6A 1Z5LA 4IBZA 4LZKA 4HEMA 3EUUA 4LHUD 1ZA6A 3EJUA 5AFAA 1JZ6A 3UGEA 3E3QE 3LNDA 5B1KA 4DKEH 3UBXI 1FNGB 4NZJA 3KM2A 1JFQH 3CVHL 4POZC 4QHNB 2EYSA 4F20A 2DWEB 1FLTX 3RWEA 4U7KA 4KZEL 3FO1A 3VE0A 3ISRA 4PP1C 2KYIA 2OR9H 3VFMA 4RISL 3QYCA 2EDMA 1XMWA 3N6YA 1FDLL 4IBWA 1E8XA 3AACA 1UWEH 3LRMA 1I8UA 1OCZB 1BLNA 1GC1H 4D2NA 5EF1A 1ODAA 5EDSA 2BNQD 4PSPA 4AXWB 5E0QA 5J1SC 2OZ4A 1ND0B 5E1QA 4L4TB 2D7QA 1OQOA 1JXDA 1F5WA 1VZHA 4S1DD 3MV7D 2CBMA 3GNMH 4K7FA 5I1JL 4N8PA 1VKXB 3C60B 2R1YB 5D7LB 3SJVE 1O7VA 3N44F 2HX9A 1HSAA 2CMRL 1J9QA 1DN0B 3C6LB 2X28A 4HCRH 1JYXA 1SUHA 3VMOA 5AOLA 4MDRA 4X4MA 3KW8A 4HBQA 3D87B 1JERA 4OJCA 1G9NC 1E2WA 1VGKA 3EBAA 1YSOA 4TN9A 2FSEA 4XO3A 2FO1A 1WUZA 1JGUL 4D9LL 3BWSA 2P7TA 3F6IA 3KNBB 4YGAB 3ME0A 3V52H 1M6OA 4UMSA 4WFHD 3BVVA 1RERA 1MCEA 1OGAB 2X6UA 4I13B 3WG7B 4PJHE 1E65A 3MHZA 5T3XH 5J6HA 1KCVH 4HUXB 4JFPB 4OFPA 4K71B 4ECNA 5JIHA 3O6KL 3C75A 3N40F 3OGCA 4JPWH 1TIUA 3O9WA 5FM5M 4M5YH 2O26U 3MLTB 4I87A 1JTPA 5CKAA 1OAQL 4XBGA 2AJSH 1FE8H 2EABA 4ZMXA 2E86A 3DOSB 3KPQA 3EFFA 1P4LB 2DM2A 1JVKA 3KJ6L 4FFZA 3S35X 3ZE2F 3IU4L 4WO0A 3GJEB 3CV5A 2WZAA 4AYFA 4HC1L 1J8HE 3GXNA 2DQJL 4KVCL 5I5JA 1QHQA 4J7RA 4YHYC 1B0WA 1WV7T 1B4LA 3FT0A 5KSAC 25C8H 3Q5YA 3SD2A 4R0LA 5H37G 1Y0LA 3MLYL 5BPPA 4PD4J 5EO0B 4CN4A 2AEPL 5I6PA 1JPST 2GITB 3EG9A 2NXZD 3OL2A 3BJ91 4LEOB 2DJUA 3WENA 2V5MA 3FDWA 1JWMB 5FYLD 1BIIB 2QPUA 3TH2T 2HVBA 3T1FA 2WWKO 4ELME 1A9BA 2IFFH 3RWCA 1QLFA 3TCLA 1VEPA 4UQAA 4JFQB 4QCIB 4DEWA 4EOWL 3TJEH 4QTIL 3N85L 4U31A 1BWWA 4TVUA 1FIGH 4XMPL 3T4AC 1OCOB 5KVGL 4WNQB 4AT6A 3EYUL 2G3NA 3GHBH 1H3GA 2FBOJ 2AAAA 1QYGL 4M6NH 4HKBB 2QTEA 4OLYH 5IHWA 3T0EA 4M9PA 1OAUL 1T1XB 1WWAX 3LXCA 1JZFA 2O5YH 4PJIA 4AW4A 4JGNA 3K91A 1CU4H 2DAVA 5JHLA 4GBXA 1T5XA 1KDJA 3TNNA 2F54B 1P7QB 4NQCA 3UTOA 4NRXA 4P46B 4NUMA 4U1LA 4M8RA 4LOVA 3NBNA 3FTXA 3QDAA 4XXCA 3HMXA 1PEWA 3U2JA 4K5NA 3QAZB 4ZUVB 1OCWH 1GCYA 2ZCKL 1MRCL 1YEDB 2R4RH 3OZ9H 2BY1A 4JHZA 2IH3B 2AXWA 2EDDA 5SX5K 4AQEA 2BWIA 2VAAA 3RUGA 3U9WA 5MEOA 3OF6A 3F5WA 1BPLB 1O6VA 2IFGA 4ONFH 2WCGA 2QTVA 3JV6A 1SHXA 4W9IC 3GMRB 4GQPH 2AV1A 5EFIA 5GGRA 3MROA 3FYEB 4G6FD 1HWHB 3WHXB 1UT1A 2FQGA 5D6DC 2XJLA 4GAGH 5AAMC 2DQHL 2FWOB 3INOA 1AGEA 5AD0B 1UD6A 3QDMB 3WUZA 5IB2A 2Y4SA 2Q76B 1D5BB 4TULL 3UTZA 4Q9QL 1NDMB 2C26A 2VM3A 1NMAL 3ARGB 2CK0L 4NQTA 4X80L 1I9RH 2OPCA 4X8XA 2PYEA 3QJRB 4NBYB 3FH7A 1XF3B 2HCZX 4Z3EA 1M1XB 4KTEH 4HJTA 4AQ1A 3N0PB 1UYWL 4IBLT 1QOKA 1DLFH 5ENWB 4N22A 2WSKA 1OE1A 4PY8J 2Q3AA 1P4IH 5BS0A 3QJZA 3FB8A 3FUMA 1C5BH 4IRSD 4GIPD 4P05A 3INUH 3CZFB 5L8KB 1B4TA 5DA0B 3KXFB 3MBEC 1DHKA 3UG4A 5BVJB 1NEZA 3IFPA 4R9HA 3GMQA 3QUMH 3F7VA 1FORL 4MJ5A 4X4YA 5ITBL 4J1UB 4Y19B 4XN7A 2X4UA 2AI0L 3VXSA 3L5WA 1H3VA 4KGJA 5TDOA 1PQZA 3A4EA 1CIDA 4WV1C 4HIEB 3GMOA 4FZEL 2AJ3A 5JOFA 1HX0A 3R06A 2V17H 1J0YA 1Z9PA 4XO8A 1OSPH 5LN8A 4NKOA 1E4JA 3U6XA 1THCA 2BY2A 3MNWA 3QORA 4N6RA 3BEWB 1FC2D 3TN0D 3L3GB 2VN6A 2NY1D 1F8TL 3AUVA 2VRKA 1J1OH 4HS8L 2MTAA 3TONA 3S88L 1XGYH 1YQ2A 1DZBA 2V5SA 2CBPA 1XD0A 3HS0C 4BUQA 1LILA 4PRHE 4UNIA 2EE9A 4JHWL 4TUOA 4H8QA 2B1HL 1A22B 2JKNA 3VNYA 3TYFB 3UADA 4F7KA 1A8JH 1KGWA 1Q9WB 2AKRB 4X5XA 2QSCH 1I9IH 1SJEB 1WT5A 3OLEA 4JRXA 5EWIL 1AQHA 3BVWA 5CO1A 3RX9A 3S2CA 3VACA 3C2AH 2H1XA 3L4CA 1MHHA 1X7TA 2AQQA 1WS8A 4FDWA 3V6BR 3QUKA 4PI0A 2R0WH 4UV4H 3J2PA 2CA3A 2WOYA 3I9PA 2MTZA 3MZTA 5CSGA 4U33A 2CAKA 2DQDH 4OCWH 3LAFA 3TO2A 3UFIA 5EOQL 3AXHA 2FQDA 5D9SA 3TX4A 1JWSA 4PY7A 4KTDL 4PREB 3MRPB 1R5IB 3IBOA 4DN3H 1G7LA 3JV0A 1R5VA 1IFHL 4OIIH 4A2GA 5K39B 3ES6B 4FXTA 3H85A 1CD0A 4JQXA 1EWHA 1F0LA 1JGLL 4H5SB 2MNJB 3CZEA 4R5VA 4W4OA 4XNQB 4ZOEA 5E2WL 3T0AA 2YAHA 3V5HB 2VQTA 3SQOL 4XVSL 4G11A 3EYSL 1BW8A 4D0CA 4OCXH 1UGKA 4YHYB 5D1ZD 1IBDA 1EIBA 5KSAB 1F1AA 1Z9LA 3K1DA 1AVAA 2BNQA 3OWRA 4RIRA 4WFGD 5FGCE 3WSQH 2RB8A 2AERT 2XHNA 1SQMA 3UBHA 5KTEH 3MV7A 1VZIA 3TTSA 4OGAD 3GSNA 5FM8A 1D5ZB 1HHIB 5DI8B 5I1IL 4YHNB 2XTJE 3RDJA 5BO1H 5AVVB 5DK2B 3PP3K 4U7SA 3SO3B 1LO2H 4JR9L 4QD2E 4KC3B 5CU5A 3AREC 4HWEL 5F3FA 4YFEA 3D6GA 4ODSH 3NJHA 1E6OH 2VR9A 4KROC 3QRBA 5D7SH 4XB3A 3CFJB 1YJDC 3OB0K 1Y18A 4N87A 4QRPD 4JHUA 5AVUB 3WN5C 1KF9B 1RULH 1C7TA 2NUTA 3ESMA 2UZYA 5C97A 3LNFA 4KJWD 4JN1L 4B9IA 2BS8A 4MLIA 2ZE0A 1DUZA 1YEWA 4NQVB 1MJ7H 3O2DA 1ACYH 3U1PA 1HVXA 3ILEA 2X41A 2WKOA 1CLZH 3QDGB 4FQ2L 3SPHA 4N4YB 4MZ3A 4XNAA 4XP4L 4KQ0A 2KHAA 3SDAB 3QZNA 5E5UB 5HXMA 2HT3C 1NCUA 1DJXA 3KLDA 3Q01A 4EDWH 5E5MB 4JJ5A 4YHKH 2WHVA 4RBPH 3QVAA 2FJFB 2OLDA 4Z5RA 4HKJB 2QEJA 4XTRC 4ZO9A 1Q72H 4M43H 4PV8A 5DUMH 5ECJE 4P5KB 2VXVL 1VJSA 4X4ME 3GSWB 4O9HL 3EYFA 3MRKA 1UB6B 5E2UL 4NJAH 4I18C 3ARDC 3NSYA 4AYSA 3EDKA 1TZGL 3MRMB 4OD1L 3VXTB 1DQQA 2R0ZL 1WFJA 2TRYA 4A1KA 3UABA 4JG5A 3E6FA 4MCZB 3ZR5A 1S6NA 4FLRA 2G5UA 5D71H 3V6ZB 2V3EA 1BEXA 1FC1A 2F0CA 3C5JA 4OCYL 3LNGA 3BZFA 1TTRA 4IRJB 5GS0D 3BZEB 4IKNA 5BZWA 3HI1A 1M71B 2WXHA 2X4OB 4PS3A 2PP7A 2D3VA 4QHKI 3FB7A 1DSFL 2VLKE 4HZLB 2WN3A 1JZIA 5C0BB 1UUNA 8CGTA 4ODHL 3ZGHA 4BRJA 3VGEA 1VESA 5A2IH 4UT6L 3V4PA 2XA3A 4JRYB 4PCTA 1E30A 4ONGH 3WNNA 3FFCD 1CBVH 2OBGA 4OJEH 3IDMA 5F1NA 5T1KB 1KELL 4OJDH 1CD1A 1ZVSA 3G04B 3D06A 1I1FB 4ZODA 1E27B 2X1QA 2YS4A 1YC8A 2VABA 3MBEB 4XN2A 2Y06L 1QZNA 2HKHL 3A6CH 2E7LA 3QQ3A 5IEKB 1CL7L 2F19L 1Z3GH 5DRNB 4C56E 3WUWA 1HSBA 2X53A 3T1WA 2ZX9A 1F45A 3HLAB 4P9HC 3MACL 3K6IA 1JGVL 4MA3B 4ZFQA 1QVOA 3IS0X 5L4MA 1S9WB 3J27A 4ZUTB 3RTQC 4FERA 4KKLC 1A8ZA 3P9LA 2CLRA 4NNPL 5ERWA 1T4KB 2IEPA 4X5LA 4WV1B 1TQCC 5H37H 2Z4QA 3ESUF 3V0WL 1NGPH 3RWHA 3POHA 1DUYB 3VCLB 4AGPA 3FOMB 3O4OB 1A4AA 43C9A 4AQZA 3KEHA 1ILUA 1MCBA 4L8DA 3T6WA 1AQ8A 5D1QB 2C9VA 5I8OL 2F5BL 4FNSA 2Y36H 3COOA 2WTPA 1BOYA 1BAGA 3O3EB 4KV5F 1OEZW 3CH8A 1NM4A 3MBWA 3HS0B 4Q2ZB 4MWFB 4HDIB 2W07B 3H56A 4OLXH 1PYWB 3DDGA 3FQRA 4RGND 4ZUUA 2MFNA 2ZSWB 3W0WA 5AWNH 4FE9A 1NC2B 5J13B 1XGPA 2WUCL 2IAMD 2QGCA 3HAEG 3RL2B 4NQCE 2NYYC 4ZMLA 4KRMB 1ZS2A 4L4JA 3IRPX 4KZCA 2GJPA 5EIIB 3IDGA 4XT1C 2O4EA 1KLGA 1FJ1A 3D30A 1FO0L 4XMTA 2Z31B 4PJ9B 4L29A 4O51A 1EAJA 4ZRGA 1DL7H 3VG0L 2ZWSA 1NLBH 5KN5A 4V11A 4L48A 5CLTA 4Z76A 3K71B 4NFDA 4QHMA 4J4PD 4QY8A 3T0XA 4RMSA 3PL6D 1RJYA 4IRSA 1HXMA 4M00A 1IAKB 3B7RL 3DIFB 5DZJA 3FFOA 3PE9A 1JHTA 2OQJB 4OQ1A 4YOKA 4AENB 3BXNB 5C0JB 2UZXA 1QEWA 2E0PA 4UTBL 5EUOB 2YEQA 2NY6B 4FQIL 1MLBB 4G6MH 2YC1B 1DANU 1BAFL 3S3CB 4ZTPL 3D3VD 2B14A 4I2XA 3QNXA 5CGTA 1IAOA 1E4XI 3OR7A 3ZE0B 5ANMB 5DURD 1MFUA 1XO8A 3B1UA 2V2WA 3FPYA 3QJSB 1AXSB 1CG9B 1MWAB 4WI4A 3QO0A 1AD9B 2BP0A 4AW7A 1S7TB 1Z3RA 4XC1L 4NM4H 1WWBX 1R3KB 3TN0A 2H26A 2PP9A 3SE4A 1NCNA 4CGUB 5A6LA 2PYEE 4WU5A 4S0SD 4XCCL 1HWWA 5DDHB 4ZMYA 1UG9A 5I6KA 1YEIL 4OGQC 1P5VA 3U7AA 2OXHA 1O5DT 4GMSH 3LKRB 1KGCD 4N0UB 1JXFA 4FXKA 1A14L 5IHZB 1MHEA 4F9PC 2EJ1A 3D07A 5BS0E 3EDJA 2E47A 4HUMB 1FL5A 2NOYA 3NQKA 3UZVA 5IK3A 1Q9LA 3BC9A 2V7HA 3AREB 1KLUB 4Y5VB 3RU8H 4R2GD 4XWOD 2NW2B 4KROB 5I66A 1KCKA 3VFRA 3K4AA 4TMPA 3QBTB 3WN5B 4S2SA 5C7ZA 3VXSE 2EO1A 3IDNA 5JW3H 3ZOAA 4DW2H 1GOHA 4YAQA 1KYDA 43CAA 5DZOA 4ACTA 4DP6X 5B39A 5L2JA 2R9HC 3GSVA 5C0IA 4ZZKA 3FO1B 4L3CA 1I82A 5FX3A 3MXVL 3VFMB 5C0DA 5FUCE 4I5BA 1LNUB 3RDTC 2RFXA 2YFNA 3G5WA 3R1GL 5IB3A 1CTNA 4PQXA 3ARTA 4NI6A 1BLNB 4KBPA 4WW1A 3Q6GL 2FGWH 3EXLA 4R83A 1NCGA 5ETUB 4AMWA 4QYOB 1O7DC 1QBML 2WWOA 4HD5A 2CKBL 2EDOA 2ZWNA 1X5KA 3ARDB 3QGVA 1T80A 4I18B 1NINA 2I07A 4JRXE 5MERB 3T2QA 3D4GA 1HSAB 3MA7A 2W60B 1SZNA 1S5IL 1AZRA 4KTGA 3RURA 5DYFA 5H4YA 5GRJH 4FFVD 4LL4A 5DJ2B 3BOVA 4NO2B 3KYOB 1VGKB 4H8WH 3P9MA 3UO1L 2APTA 3ABKB 4JLRA 4XPHL 2Y1ZA 5D2NA 4TUJB 2Z91B 5DC0A 1E5CA 3WKNA 2ICES 3QNYB 3C6EA 3II1A 3H42L 3QHZH 4LAJH 5CBEA 4Z7OE 6CGTA 1M6OB 4LPWA 4YDJB 4S1RH 1ID2A 4LDOB 3K0YA 4HA1A 3IGFA 4JO3H 5L88H 2BMKB 3U2SA 2LU3A 4QRPA 2XKUA 4U7MA 1IL1A 3MLZH 3QCTH 2CJUL 3OGCB 1NDGA 2HFEB 2R83A 3S34H 2VDKH 3LSOB 4NQED 3ORJA 5BRPA 2DQIH 3ZTJG 1FBIH 5HHMB 1MW3A 4ETYA 1RK0B 4AYFB 5MHSD 4X0KA 4Z95H 4M7JH 2W91A 2BSSB 2KERA 1T6VN 2UZIH 2BW5A 3MV7E 4XAWL 5E08H 3AG2B 1RSYA 2HSIA 4M5ZL 4Z7UB 3V6FB 1ASPA 4R0LB 3IDJA 1Y0LB 1TO5A 5CSZA 3BKMH 1S46A 3OTTA 2MCPL 4UQ9A 4S1DC 5A2LH 3EG9B 2ZKWA 4NM8H 3D0LA 4M8QA 1U91A 3K6NA 2CGZA 3L4ZA 3WIIL 2YUZA 2D7OA 3T1FB 1H5BC 1MCOL 2JIXD 4JNXA 3RWCB 2GSGA 3TCLB 4X4KA 7PCYA 5TJWK 2FX9H 1MHPH 1X9LA 4KJPC 3NFNB 5ES4B 1UJ3C 1TO4A 2D8KA 4JQIH 2VW4A 2ENSA 4JPKL 2NNAB 1TTCA 2VCOA 4EKXA 5SWZD 3ZQXA 1MG2C 3OKMA 1DYZA 4UT7L 4BWUA 3FHEA 3X3FL 1SEBA 4NPJA 1XBRA 4OLZH 3NJNA 3T0EB 5LVEA 9PCYA 4G3YH 1ZGLP 4WGKA 5A2BA 4PJIB 4NYLB 2JKSA 3MREA 4GBXB 1KCUH 4NBZB 2V4LA 3TNNB 4R7LA 2ZYRA 3RVUC 4ZZFA 1OKEA 5DHDA 3RJQB 3REVA 4N0YH 1DBBL 5JUEL 3W1ZA 1EJ6A 5DHVB 2R4SL 1UM4L 3T6XA 2CDGA 3WYRA 4M3HA 3BI9X 3FRUA 4IDJH 4FQJH 1F90H 3SGKA 1NIAA 4MQ7B 3DPDA 3P4MB 4EI5C 1E7UA 3DI3B 4L1DA 2OW7A 4MRCA 4J5VA 2QVFB 1SOKA 4BCXA 2WO4A 3RUGB 4YHOL 3U1SH 1LP9B 4EZLA 2YO3A 5AOKA 1IGCL 1L3NA 5I19L 3GKWL 5J5EA 3GTVA 4HIXH 4PRAA 2GAZA 2AV1B 2JF1A 3L4XA 4OLEA 4FD0A 4OCLC 5EZLB 2A9MH 4P4RB 3QULB 4Y1AD 5GGRB 5FO8B 3JWDH 1E3ZA 5A2KH 1BYPA 2GHZA 3S3JA 5LLIC 2NPLX 4B5EA 3O0LA 2BJML 2V8LA 4HULB 1X5IA 5E24E 1X4YA 2HFFA 1AGEB 5D4HA 2EYTA 1BZ7A 2GI7A 2MOQA 4XCYB 5IB2B 3CDGB 3UJIL 1P6WA 3UTZB 4HAGA 1QR1A 1K8IA 1SDYA 3CHQA 4MAUL 3R0MA 3GINA 2R2BA 4WEBH 4QNPE 4DP4X 2DQCL 3QZBA 4WKZA 4RGOH 5HHOD 3WY3A 2WMPA 1YUKB 3ZO9A 2YD1A 4C83B 1YY9D 1W8NA 1R75A 1F86A 2YWZA 3BQUD 4NQSA 1TZAA 1KYOK 1URZA 1V3MA 3NAAL 5EZOH 4XX1E 3MV01 3QEHA 2IPUG 2R69L 4F7MB 1NSNH 4DFIA 2ZG2A 3LIZL 3MRBA 4RQQB 3T77A 4E42B 4QGYA 3V4VH 4ODBD 5IFAH 1KGYE 4RSYA 1K6QH 5AENA 5KZCB 1WAAA 3EYVA 1U58A 3IFPB 4LSRL 5DEFA 3GS7A 4IOSA 3F7VB 3L4YA 4J4PA 5G55A 2DLFL 3MRFA 5DMIL 4ZFOL 2X4UB 4BGDA 3HRZC 5LCVA 3LH9A 2VXTH 3RA7L 1YN7A 3MYZA 5F9OL 4BE6A 1OZUA 3IAGC 2YKLL 4H8VA 3QIUD 5CCKH 1WTLA 3PGFL 2VIRA 1UM6L 2XRAH 3J7HA 4N9GB 4LPQA 3LHAA 5AZUA 4TQ8A 5JOFB 3O6LH 2ZX6A 1RUQH 5EUOF 3R06B 4NQXA 3IFLL 5DFWH 2CXKA 5IJVB 2CHZA 1YAIA 3D3VA 4PGJA 5EOCL 3RVTD 3LKOA 2FNWA 3QXWA 4OAWA 1WZLA 1IAII 3S5YA 2CPCA 5CUSH 2OMXA 4X0NA 4R5TA 3W0WE 4K7PH 1RURH 1RVFH 2XACC 4Z8FL 2XA8H 4L18A 4TRPL 1NCWH 4NRZB 2XC8A 4GSXA 2ZONA 4P2QD 2CRZA 2B3IA 3K8MA 3Q8BA 5LQBH 1JBJA 1RY7B 4PJEA 2FWSA 5CJBA 1TNNA 2AHIA 3HAEH 1SPDA 2FATH 1F13A 2Z0BA 4JRXB 2V5YA 4AVIA 2PLTA 2I60L 4MNGA 1XSIA 4LT7A 2M2DA 1G7QB 5L2KB 5C7XH 4HJGB 4BFIA 3DURB 2I24N 3ZSTA 3IJHA 3ILDA 4UNTA 3TO2B 2JMRA 2CG9X 3GJFH 5TQ2H 2ED8A 5F96H 1F2XK 2AABL 1A1NB 1AE6H 4HWBH 4ETQB 1JWSB 4PY7B 4LHUB 3TA4D 3MJ9H 4UM8A 4JK0D 4XCEA 4BZ2L 2W65A 5JXAL 1IJ9A 1R5VB 2E3VA 2HT4D 3QEQD 4PJFE 4U05A 1DEDA 4G7VL 4PGZA 2FX7H 1ADQH 3KDMA 4LCWD 1AS6A 2R1XA 1FLRH 1VPOL 2OJ1A 4RDQF 1PG7X 5HGDA 1A1OA 1A47A 1I1AC 3IEAA 5JW4M 4OZ4B 1JPSH 1TZ8A 3HZ3A 4NBXB 2P46B 4RMWA 1WHOA 4ZAKD 2Y2YA 4KAQL 1OCCB 2BNQB 4CSPA 1B4JH 1HQ4B 2J1YA 2NY1C 1CTMA 4NO3A 1A4KA 3S3DB 4C59B 3GWJA 1G84A 1ILSA 1ZLVK 1U8LA 1KJ2L 3GSNB 3HNSH 1U8QA 1IKNC 3QJXA 4Z3IA 5EV7A 1A6VL 2MMXA 5F6IC 4JEGB 3PHOA 4U6HB 2NQ3A 4MSWA 1AHWC 1IKFL 1RHHA 4K23L 3VWJA 3I9AA 1UJ3B 3PDDA 5AYQA 2O30A 2OMYB 5BCAA 2NT1A 3ARQA 5FGBC 5ESVA 2XZQH 4ZFGL 1THAA 1DQLH 1KJMB 1Y18B 1AP2A 3MFFB 1NBQA 3MJWA 3OLDA 4MNQA 3G5ZB 3GBDA 5JDJA 2WLYA 4YPGB 3M86A 3N50A 2MPAH 3EHBD 4M7ZC 2WLJA 2UZYB 1VFBB 3TVMC 3AQDA 4MDJA 5E03A 5KW9H 4PBDA 4G8FA 3ESVF 1N8OE 1LO5B 3RWDB 5DD6B 4Y1TA 1T89A 4UYQA 5I1DB 2IWKA 5CD3B 1FGNH 2YAOA 3D39B 2EZ0C 1N7ML 3FAXA 3RRQA 2HTLC 4K7PY 1HAUA 4HUUA 2IG2H 5JR1H 2VQ1A 1CDHA 4JJ5B 2ZWZA 4EI5B 5JW4Q 5DHYA 1LXMA 3A6BL 4JFVA 3RY5A 4JKPH 3LTVA 4KDTA 3I50H 4LEBA 4PV8B 4UDUB 2X9XA 1ZA3B 5JPMA 1AGFA 5D1ZC 3T4AA 4Z7NE 5GS2H 4YHMH 1AYRA 4FI8A 1JOIA 1MJ8H 2ZKXA 1UASA 3VQMA 2NQDA 4XBEL 3SCMD 3L17A 4GG8B 5FC9A 3NCYS 1JN6A 4Z7UF 1TQTA 4XE0A 1N8ZB 5D2NE 3E6FB 2J6EA 1P7KB 4XE5B 4Y4HD 1JZ5A 3VGHA 4LSVH 3FHAA 3BZFB 1PLAA 3ZQDA 2ESVA 3HI1B 3EOTL 3QE5A 3VFTB 4S0HA 5L7XH 3WFCH 5I75B 2JIXA 3AAZA 4QRPE 3EOAB 2DD8H 4DVRL 4DOHB 3C9NA 3U4BH 1HHKA 4DH2A 1KT2A 1OGPA 5EU6D 5E6IC 3ZDYB 4WTXA 3KMDA 5DJZB 2ZUSA 1TJHL 1USQA 2J55A 3TT1L 3V4PB 2Y7SA 5K9JH 4IS6A 1P5UC 5F1NB 3AM8C 5JA9A 1HIMH 1EHLH 5ICXA 3MBXH 1CD1B 4DKEL 5DWUH 3WNOA 1JFQL 4PJIF 4PJGA 4KJWC 2PWFA 3LDBB 2YLHA 4YXHH 4ZMTA 2YD8A 3QHFH 3ZTJH 4BK5A 4J39A 3MU3A 3NACH 4X6CA 1SLUA 4Y5XA 4ZS6D 1BOGB 1W72H 1E2VA 3U83A 5A2FA 3QQ3B 3VFWB 1E8YA 3EJTA 2FO4A 2GT9A 3HE6D 5AZEH 2OR9L 3HRZB 2NY3C 5BZDA 5I8CA 2IWEA 4I48A 5D70H 2FGZA 1RZKC 4PJ5E 5DHEA 2NY5C 3P9LB 3LKPA 3KS0J 3II3A 5ERWB 1K8DA 1UWEL 3FHQA 1JTTA 3QIWD 3KGRA 1WEJH 1GC1L 5IWLC 3EFDH 3IE4A 5DSCA 3WY2A 4HXBH 3RWHB 5J56B 3RUGF 1A2YA 4L8DB 5CJXA 1LP9F 4JFSA 3QYMA 2YXWA 1YO4A 3WHE1 3BH8B 3GNML 4D9QE 1RUPH 2YA2A 3CDZA 1OD7A 4BUGA 4Y1AA 4G6FB 1C1EL 4XO4A 1GJUA 4HCRL 3WTSA 1TTAA 3MTRA 4BSWA 1OAKH 5C08D 3DIDA 1FHNA 1J0IA 3FQRB 2VDRB 2XVLA 4ZUUB 2I5YH 2IV9A 3SKMA 2PTVA 5I16B 4KXCA 2NY0D 4QRTB 5E9AA 5JOPE 2CA4A 3IMTA 2Z64C 1EJFA 3D85D 2CLVA 4OBRA 5CU9A 1F56A 5HHOA 1HXYA 1KLGB 4LIQH 2OL3H 1U30A 3OKDA 4LIQE 4RGMB 3CG8A 3NGBC 5E2VH 3V52L 3PXLA 4R4ND 4LZHA 5HBBA 1JPFB 3BQUA 5T3XL 3CTTA 1KCVL 4WWNA 1UA7A 2P8PA 2FJHA 3HNTH 4QHMB 2O6FA 3K6OA 4QY8B 4JPWL 4FADA 5ALBH 4UBDC 4IRSB 1AS7A 4M5YL 5FV1L 3GZKA 3KLSA 3EOBA 1N5AA 3DX1A 5DK0A 4DGYH 2AJSL 1FE8L 2ZJSH 4UANA 5I1GH 4GUQA 2UZXB 1A6ZA 4FFYL 3QQ9D 1MNNA 4IOFD 2GCYA 3P40A 1Z9NA 5EN2A 3WDJA 3TBTA 4JMXA 3MRQB 4I2XB 2BERA 1IAOB 3OR7B 3QIUA 1JHLH 2OMUB 1I1AB 4BCYA 2HVKA 4FQQA 3KZ8A 25C8L 2F74B 3T0DA 2V2WB 4G8GD 3E6HA 1SY6A 4OLUH 1AHKA 3BZDA 3GXPA 2WY3B 4I9WD 3TN0B 3QH3B 1YYCA 4U1GB 1BDYA 3OJDB 4PG2C 2NR6D 4RGNE 4EQ2A 4OIFA 2NY1B 3TIDA 4BEIA 4OZIA 4J3XA 3DUHA 1WZAA 3GSXA 1XB8A 3B2VH 3B6SA 2IFFL 3O8XD 4FXKB 4P2QA 1AI1H 2GJ6D 2GSIA 1S8DA 4EZMA 4WUUD 1T1WB 1YN6A 3TJEL 3ZDZE 5ACLA 4ZW3A 1HS6A 1IM3D 1UQSA 1AHWB 3FUIA 2IAMC 4JM2D 1FIGL 4MMZC 2Q8BH 1TUPA 2VGLM 3NZ8A 3PABB 1Q9LB 3GHBL 2V7HB 3ZZSA 1F1GA 4OJAA 4MXVF 3MRLA 4M6NL 4IU3A 5I6MA 1M6UA 1QG3A 4J28A 4OLYL 1IGIH 1DLHA 3VFRB 3VFUB 2KQNA 4S2SB 1CU4L 3V6OA 4LRNH 1M57B 5BOJA 3C5SA 3QDJD 2YGNA 5I1LA 3D9AH 5CZVH 4FQLH 3ZHFA 1RK1A 1HE8A 1G7MA 1KTKE 2X12A 4YAQB 1OP9A 5IQNA 1CB4A 4C8XA 4S1QH 43CAB 3GXTA 1TETL 5L2JB 4X98B 5C0IB 3PL6C 5JIDA 4KY2A 5CGYD 4XAKD 1WE5A 1OCWL 4L3CB 3D52A 4K2UH 5JW4R 2XICA 3OZ9L 2Z1PA 3STLB 2EXTA 3JSSA 4Z7OF 3QEQA 5DJDB 4BA8A 5C0DB 5D1XD 3P4OA 2KS0A 1MSPA 3QJFA 5I1AA 1UXLA 3F64A 4YFDB 5IB3B 5IUSA 5DU7A 2GEEA 2WQVA 4HALA 3AU1B 4WW1B 4JFHD 3IDIA 1NL0H 3KLLA 2DYPD 2D2CC 3FRPA 3LN9A 1BLIA 4YDNA 5D1ZB 2MKLC 3MLXH 3GXDA 4DGVL 4ZAKA 2Y2WA 5HDBB 5EEZA 3OPUA 4GLRI 5ICYA 3GUTA 1KGCE 4GAGL 2L8AA 4OUUB 4GSRA 3CFQA 2W0FA 3IXTB 3ARYA 2VOTA 4FJZA 4ADGA 4Z7QE 1EAQA 2ITDA 3WY4A 5FYKD 3HI5H 5GPRA 1L9SA 2B2XH 3RPIB 3DVGB 4Y5YA 3NFSH 3TO4C 4DQAA 1I9RL 2BSBA 2D73A 2XVGA 4DKFH 4QJ5B 5CBEB 4LMQI 5F7EH 4KTEL 4JB9H 2A1WL 4XPTH 3BDBA 2NY2D 2ZCHH 1GGIH 3P0GB 4FQXD 1P5UB 3GRBA 3DRQA 1C5BL 1IL1B 4Y16D 3INUL 5CP3A 1K3ZA 3U4KA 3M45A 1NDGB 1K4DB 2UYLA 4NENB 1OTTC 1G9NH 4J12A 5CLZA 3Q06A 4ZYKA 4TNFA 1R34A 4XMVA 1CYGA 2GW5A 3IJEA 3DJRA 4OJFH 3FS9A 5FOBA 5DVPA 4GLRH 1H3XA 5B7FA 3HB3D 2JK5A 4N8UA 4BQ9A 9CGTA 4E5XA 4OD2B 4OQTA 1RLBA 1YNLH 3KGTA 4WWKC 3SPCA 5T3ZH 4JRLA 1DJZA 1RZ8A 2V17L 1GMIA 4TNVK 4U4BA 3SBQA 1OSPL 4LAQL 4Y89A 3DX6B 4AIZA 2C9AA 1GGUA 1FVEA 3ZKNC 3P73B 3IDJB 2VITB 3I6GA 1Q9OA 5CSZB 3QI9D 3UJJH 3T2NH 2IXQA 4B9CA 1J1OL 3ZK0A 4N90D 1BAWA 1LLAA 4LMQE 4F33A 3D0LB 1XGYL 1PDKA 5IMLA 3WMSA 1U3JA 3SCMA 1DBAH 2A99A 4MBRA 3L6FA 2D03H 5IVNA 4UTCA 1L6ZA 3K4DA 2PCYA 4LL9A 2XFGB 3FAWA 4Y4HA 5IUCA 4MNQE 3HJEA 4DN4L 4XXWC 3C2SA 1BQUA 1I9IL 3DX3A 1YECH 1FFRA 4OGYH 4JHBA 3C2AL 5HYQA 2ETWA 3DUUA 1LQBC 1SEBB 1Z66A 4GO8A 3ULUD 1CGXA 4NT6B 5EOCJ 4NWTH 5DWPA 5EU6A 2R0WL 3AQXA 4UV4L 3TH4T 3GDBA 4FEIA 1U92B 3MREB 3NGBB 4U1IB 4R7NB 1O9VA 4E9YA 3TA3D 2DQDL 4OCWL 3ZDYF 3GRWH 4I89A 5J3HD 2E9GA 4XBMA 3FFCB 3E7JA 1XGQB 2WTRA 3G3LA 1O0VA 3H9ZA 1CXLA 4PJ8C 5JHDA 1KJ3H 1KTJA 4DN3L 5MHSE 3EO0A 4OIIL 1U3ZA 4I0PD 3FRUB 4S1SH 2F5AL 2VMDA 3KLHD 1XZ0A 1TYJA 2HJLA 3IJYA 5G4OA 3CSTA 5LAPA 3HE6A 3QZWA 2CWRA 1HCYA 1DVFA 3D08A 5DJXA 1WUNT 1ZEAL 4K9EH 3CDYA 2EVIA 1K5NA 1NMCC 1SXCA 1UZ6E 3VXUD 1SJHA 1FNFA 3LD8C 2JKRM 3VSUA 3QIWA 2XWTB 4JANA 2GAZB 4EPSA 2BM3A 2ESVE 1GHFH 2DQMA 3WSQL 1PZ2A 3F00A 2V2XA 3Q44A 1YYMH 3ZDXE 2WWMC 1M7XA 4DCQA 1E9QA 32C2B 1CLOH 3GIZL 5BW7C 2HFFB 1GMEA 3UTSB 3G08B 3AGWA 4PVLA 3L3IA 1FVDB 3BIBX 2BHZA 1ZT7A 3LJ3A 3QPXH 5AKTA 1K8IB 2BFVH 5C08A 5BO1L 4LCUB 3OHMB 2VO5A 3U9PL 3ULVD 3BX7C 4PBVC 5J0BA 3QS3A 4FNPA 2IAMB 4MXWH 4MMZB 4ODSL 5FUZL 1E6OL 4OV5A 4NQSB 5D7SL 5GRZA 4HGMA 4OI8A 4X6CE 5E9DE 1I7RB 4GAAA 2J25A 4A63A 4ZMVA 3JV5A 1KB9K 4IHOB 4OVUA 3TBYA 3QEHB 1YA5A 3ZHKA 1RULL 4QO1A 2AK4D 2FD6H 5F9JA 1BVZA 4K15A 5LDSA 1MOEA 1G7IA 4OW6A 5I0VA 3Q9PA 2BH0A 5DEFB 1MJ7L 1ACYL 5DRWB 2O61B 2VWEC 4JL1A 3PL6B 1CLZL 4G42A 1S5HA 1P53A 1ZWIA 4DK6A 1CYWA 3U36B 4YHKL 3P11H 1I4FA 5DHMC 5A16B 3CFKB 2QVIA 2F68X 2X6BA 4HPOH 3ZKQD 2HG5A 1HESA 1Q72L 4M43L 4P4KC 3D3VB 5DUML 3UPCA 4OAWB 2LTQC 5FYJH 5FYJE 4AJVA 4NJAL 2OMXB 2EAEA 5DURB 4ZUWB 4K5PA 4G8GA 3V7AG 1R33A 4L05A 2GC4C 4PP2A 4Y4FA 3H7BA 3WS6A 1T7VA 3EH2A 5D71L 3U30C 2NR6A 2GK0A 3NIDE 1T3FA 2WXFA 4PJEB 3P3YA 2X0UA 2JSFA 4IKKA 4TS6A 1FNAA 1PFCA 1Z6JT 2E6QA 5G4MA 3S36H 3T6ZA 3O8XA 4MNGB 3B9KD 3IK2A 4CMHC 4F24A 1IKOP 3S37H 5FHBL 2JLPA 3DDFA 2R29A 3KPSD 4ONGL 4NRYA 1CBVL 4R2GB 3B8YA 4ABWA 4JO4L 5J7CC 1IEAA 4RAUA 1S78D 4NWUH 2XYBA 1G7PA 1JTOA 3QDJA 4JO2H 4UM8B 5GJSH 5H8DA 1XSOA 1SJMA 2OX5B 3QJUB 4E41D 5FK9A 1PZ5A 2W65B 4TVPE 4AJ0A 1XHHA 2MSPA 3MJ7A 4PJAA 2B9AA 2W0KA 4RSVA 3A6CL 1BF2A 1T83A 5E9NA 1Z3GL 3I9IA 2DL2A 5BZZA 1JGDA 3KDMB 4CMMB 2DDQH 4KKCC 3CSGA 2WV3A 3BAJA 2PPDA 3AMKA 3CC5A 1A1OB 2GBVA 5DHXB 4LLMA 4OZIE 4NZFA 1DJIA 2R2EB 3N5AA 4WWKB 4J3BA 2RD0A 2NCEA 1I8LC 4XN8A 3OMNB 1NGPL 3MLVH 4Y2LA 1LO3H 3QXDB 4OZHB 2E4FA 3AGVA 5JIQA 4LHUG 5LNEA 1Q9KA 3OHXC 2ED7A 2DYPA 2Y36L 2XXCB 5G4NA 3WI9A 3OAZK 1WA2X 4JY4B 5C70A 1M56B 4NO3B 3O6FC 4AZUA 5AQ0A 2OKMA 1U8LB 4F8PA 5HDBF 4OLXL 3LZLA 3WGUB 3FT4A 5C9JA 1KPVA 3NDZE 3A3YB 3DYOA 3BP4B 5IJKA 2WSDA 4MSWB 1CE1L 1SLVA 2CO1A 3BLBA 5D96C 1IIKA 2JNZA 3NA9H 3V6OE 2QQQA 3CZGA 4GSQA 3N91A 4XVJL 5BRZD 2EECA 2VRAA 5E6RB 1LE9A 4HOWA 2ZUXA 1SBBA 5ESVB 1FUNA 4C4BA 2NZ1A 1AP2B 3CAFA 4J2XA 1X9RA 1DVSA 4BD4A 2G5BB 4WI5A 1DL7L 4O2EB 1QQDB 4DP5X 5F71A 1NLBL 4Z77A 1Q1JH 4F7EB 4DK5A 2V2TB 1TMQA 3I74A 3NCCB 4M4PA 4QRSB 1DSWA 2FH6A 3TU6A 5KYXA 1ZLEA 3QB7C 4HHAB 5IQMA 5IP4A 2WLZA 4PJ8B 4IM8A 5IHUH 3AG3B 2OSWA 3BPCB 4NQEB 1XSKA 2VQ1B 4W6YB 6PCYA 1BQRA 1HFUA 5HGBA 1WC7A 2NZIA 3S98A 2AXGA 3JTSB 3BWUF 1YJDH 5CAYB 3BVXA 2G3MA 5DHYB 3RLSA 4A52A 1YNTA 5FO9A 1HL8A 1FZJB 5DQJB 4GW1A 4UILH 4HS6A 5FXCH 1IQDA 5CFHA 2YMXH 5I15H 1Z7JA 4HFWA 4HETA 1AGFB 4MD0A 1BQHG 2WZ0A 2HRPH 3LD8B 3KD4A 4U1HB 3IE9A 2IAAC 4U6TA 3VXQA 3EGDA 2EE3A 4NM4L 3QI9A 4V1DE 5FFOA 1SJVA 4NZUH 4UUJB 4MVBD 2HRGA 2Y69B 2JJSC 1W0VB 4GMSL 3T8VA 3JVFC 1YQVH 3PDGA 4LPYA 4ZPVA 2E4TA 4PRBB 2R0LH 3NFPA 3AAZB 1I7UA 3PFQA 4OGXH 4RX4D 5AW6B 5T5FA 4EVNB 1KT2B 3DETD 3F58H 1XZWA 3VGGA 3D8MA 2JJTC 3RU8L 1JXJA 1N3NA 1XR8A 5SWZB 1I8MA 4Y4KC 2BIPA 1NKRA 2GTQA 2YD2A 3AADB 4FNLH 1FRGH 5I2IA 4JFFA 4YDVA 4DW2L 1SEQH 2ZF8A 3IRCA 3PIQB 3PWVB 1KXVC 5FO7A 3TA3A 4PJGB 4NN5C 4ZUSB 2ZXDA 5C71A 1EZVY 4HV8A 4POYA 1A4JB 4QRAA 2DQ6A 4LOUC 5E7BA 2GT9B 3L48A 2WXGA 2IGTA 2PW1B 2P26A 4FXGC 4G80A 5I8CB 2WIIB 5C09A 1UOKA 2FHBA 3HMWH 2OM5A 4Q52A 3LKPB 3U6RA 3G6AA 2W9EH 3LKQA 1PD1A 4NAJA 3MRIB 2IIJA 4MNHA 1NCBL 1YVLA 2FGWL 1A2YB 2CBQA 3FJTA 2CCWA 3QUXA 3APCA 3VXUA 3TF4A 2LTQB 4Y88A 2G9HA 2LOEA 4U3HA 1F00I 3BN3B 4NO0B 5DEJA 2JTYA 5GGTA 2FZ3A 1K9TA 4Y1AB 3ZO0A 3ELQA 4NQDD 3BISA 4P9HH 5LDUA 1EZUA 4KU1A 4BSWB 4GRWB 3BHBB 3SKOB 3VXME 1XF2B 5GRJL 3U30B 5EU6E 2GFBB 1BGXH 1EO8H 1QSEE 2XN9E 5EO9B 3SKMB 1DVXA 1BXVA 4PW3A 2EIZA 5GSRA 1JNLH 2IADB 4NO5A 2XJKA 4NPKA 2EUZA 1B90A 4ES9A 2Z6FA 3KVDD 4N86A 1AJ7H 3QHZL 5HHOB 5JHDE 4CMHB 3OKDB 1OM9A 1M53A 1OAXH 1VGEH 1NIBA 4YX2H 4JO3L 5L88L 1SM3L 3HHMA 1WBXB 2P8PB 5HJ3A 1CGVA 5HJBA 2DQUH 5CEZH 2FJHB 4ENEC 2AQTA 5CEZE 3MLZL 4M5TA 3U0PA 4OZGB 2RAMA 1T66C 2X3CA 3RI5F 3VH8A 2AK4A 3V5DA 3ZG4A 1X5ZA 3CPLA 2Z7UA 4J3OD 3S34L 1LE5A 1IE4A 2FEEL 2P8MA 2VDKL 3EOBB 1N5AB 3GTNA 2D4DA 1OK8A 2DQIL 3ESOA 1A6ZB 3ZE1E 1WAAF 4EUPB 3F85A 4MHHG 3S4SB 3RFZC 3V2AR 3D33A 1A6TA 4JKLA 4M7JL 5C6WH 3MV11 5CCGE 1UM5H 1UFUA 2VXSH 3P3TA 1KGJA 2UZIL 3QIUB 1VZGA 1NOAA 1UVQA 2R1WB 4FYSA 5CIPA 5D7IB 5FS5A 5B1AB 2HVKB 4F2EA 1TVHB 4BH8B 5E08L 2KT6A 2X5PA 5CJ8A 3CVHA 5F0MB 5IBLC 4H0GA 1WRFA 2FIKA 3NSDA 1J8KA 4KK6D 5DHVH 5ICUA 2NYZA 3AU0A 1VACB 3BKML 4AH2B 5C08E 3OC5A 4LEXL 4DZ8A 1V5JA 3OHXB 4JFED 3RGVC 4CKQA 2C3VB 4G9DB 1ZGLA 1VAHA 4JG1H 1XR9B 1ET8A 1CQYA 4PU2A 5J1AA 3V4UH 3H9HA 3LEXA 3B6SB 3W38A 1TXKA 1G9MC 1FNEA 4P2QB 1S8DB 2FX9L 1MHPL 2CIIA 1UWGL 2JELH 4JQIL 3ZHNA 4FG2A 4QAWA 5EB9A 3PUCA 3H6JA 4PJEF 1ORSA 5AW0B 1OVZA 5I1CL 2M1KA 2YOCA 3B9AA 3IMWA 1SOXA 3RYMA 3DNKA 1JPGA 2N7BA 4P3DB 2RIKA 3B9KA 2X2JA 4GKSB 4GIAA 4PY8I 4G3YL 3DJ9A 4Q9BA 3FO0H 2V3DA 4R4NC 2EH7H 1KCUL 3JYCA 1CE6A 3KPSA 1RK1B 2FB4H 1G7MB 2J4WH 4CC4C 5E7FA 4XWGH 4Z7IA 5A3IC 4N0YL 5F7NC 4KKAC 3ZRSA 5SV4A 5CBAA 5H35A 4G9FD 3STZA 4HUVA 5D2LA 3WS3B 4BM7A 4X7EC 5IG7B 2XQYA 4E41A 4L5FE 2F53B 1RPQA 4IDJL 1F90L 1HXKA 2EE0A 1BJ8A 3QEQB 4XCNB 5HD8D 1D5RA 4Q97A 2J8UA 3P4OB 4LCYA 5LBSH 5AAWC 5I1AB 1ODUA 3LS5L 2JWYA 3WEBA 4LCWB 5MENA 1T4WA 3U1SL 3ECUA 3PFUA 3IT8D 1EHAA 4Q58C 2P24B 4HIXL 1ZK9A 3FRPB 4P2OC 2R23B 1AYOA 2AITA 1IBHA 3V7AE 4JRFA 2J88H 4LF3A 1I85C 4ZAKB 3JWDL 5TE7H 2BVOA 1IEBB 4J3WA 1J9TA 2BOCA 2EDRA 4N2EA 4K8RC 3ZVVA 4LCIH 4OFQA 5B7EA 4OZHF 1HDMB 5DC9B 4L3ED 1OLZA 4XVUC 1INDH 1F18A 1MCIA 1TJXA 3BAIA 4HC1A 3CIAA 4X8JA 2ITDB 2I7OA 1OSYA 1OAJA 4E9VA 2C4FT 5DFVD 4WEBL 2Z8WC 4RGOL 4EZJA 1IBFA 3JT2A 5GZND 3SDXA 2KPWA 4UIKH 3Q1SH 4JM2C 5I5MA 3WKMH 3VI3B 5F8QC 4PJAE 5IJDC 3BAKA 5EZOL 1SVCP 2WNWA 3A4FA 3DX8A 1BZ8A 2Y5TA 1NSNL 3HG1D 2DY2A 4HD9A 1MVUB 1NPJA 1UD3A 4TNWK 4XAKE 4IOIA 3DRQB 5DT1H 5AW1B 1DBJH 1UEYA 3V4VL 3DOIA 3GZOA 3EHBB 2G60H 3HC4L 2VN3A 1K6QL 4FLQA 4LKXA 4DFHA 2NX5D 3KW7A 2MQ0A 4ZYKB 3K46A 4NN5B 1VENA 4HJJH 4PBXA 5E0FA 1G9HA 2VXTL 2P8LA 2YSSA 2M26A 3ZYIA 1RV6X 3DVNB 1IIIA 2BNUA 2VZ1A 1DJGA 2ZD0A 4FG0A 4GAYA 3RJOA 5CCKL 4TTGA 2XRAL 5D1XC 1D9KC 3UZEC 3GGWB 3NSXA 1XF4B 1RUQL 1NIDA 3MRDA 3OKLB 1P4UA 4AMKH 1BM7A 2O6CA 2WGXA 4PRPA 3FL7A 4AIZB 3VM5A 1WBYB 4MFHA 1FVEB 4B7IA 1XF5B 4HKZB 3I6GB 1Q9OB 5CUSL 2J8OA 1NBCA 2LW3A 4G43A 3B2DC 4AX3A 1SQ2N 4K7PL 1MELA 5GGRY 2HA1A 1RVFL 2VDNH 3RNQA 4GS7C 1PDKB 4EBQH 5F0LB 5IMLB 2WXJA 3FSZA 3HN8A 5DZLA 3SCMB 4GB9A 4P5SA 5KS9B 4HH9B 3L6FB 5G5DA 5LQBL 1MI5B 1J5DA 5JYMA 3MZGB 1TQWA 2GI0A 4UMGA 5HVFB 2FATL 2XG4A 2C9QA 3UAJD 1MPAH 3V0EA 1JNJA 3VA2C 3C6SB 5HYQB 4MMYA 3LZRA 1SHWA 4RX4A 1OTSD 1YLBB 4BDVB 1SNRA 2WXKA 5HJGA 3ZDXF 1QSFD 2EE6A 2APSA 4MYPA 1RIHH 5HGHB 4FG4A 5IVOA 2NY2C 2NTFB 3BP6A 5TQ2L 3QPQD 5F96L 1MLCB 1C16A 1AE6L 1YEFH 4HWBL 4IIQA 4FQXC 1NCHA 5EU5B 2HUEA 3GBNH 4Y16C 3MJ9L 3RILA 1DQML 3JTTB 3EO0B 2LABA 4UINH 5JIKA 2FX7L 1ADQL 1ZV9A 3D51A 4PJGF 5F1OB 2HJLB 2J1KA 4LSSH 1BD2A 1FLRL 3OQ3B 5IROD 3HB3C 3QZWB 1VFOA 4U0RC 4B9YA 1QPXA 5LXGH 4WK4B 5J9PA 5DJXB 4X4XA 1JPSL 3ZN6A 1HINH 3TIEB 4N90E 1XEDA 2Y0SA 5DRZA 1SJHB 3PNWA 3MNZB 5I30H 4KH9A 4X5RA 4YWGL 5KYUA 4AL8C 2COQA 3CSPA 3M07A 4HKXA 5HTSA 3I6KA 1B4JL 2PP8A 3SKUD 2E5EA 3BIKB 3IMSA 3I3EA 5IVXB 2RQEA 4PI2A 3D2UD 1LWJA 4P57A 4L4VD 3RGVB 3DJTA 1UD2A 4KKBD 4RRPG 1R3LA 1E9QB 2W0PA 2KUTA 4OFKA 1F3JB 4I4WB 2VE6B 2B1AL 2RR3A 4S0TD 4NQDA 1MXDA 3L1EA 1S9XB 4UIMB 2YN5A 4JFFE 2DWDA 1CUOA 4RA3A 5IVZA 1NGYA 2NY0B 1VEOA 1QATA 3FQTB 3L1GA 3VG9C 4EXPX 4OV5B 2Q8AH 3O45B 1FGVH 2APWA 2Q3ZA 2V5RA 2XZQL 1IGMH 3I6SA 1DQLL 3ULUC 3D85B 3TBYB 4L8BB 3CSYA 2BRRH 5IF0B 5E51A 1SFDA 2NXYD 3VU2A 4JPIA 4QO1B 4AOFA 2OI9B 3IDYC 4X42A 5C86A 3ARBC 4P5TC 5KW9L 5C09E 5FYLH 2GIXA 5F9JB 3APNA 3NCEB 5FAAA 3NCXA 4N28A 4J8RA 1S7QB 4BSVA 5E99H 3GSRB 2WVVB 3KE0A 3WE6A 3MUJA 4G42B 4N1EA 1S5HB 4HSQA 4NC1C 4OZGF 4XI5C 5EBMA 2NW3A 3BYTA 3ECWA 2IG2L 1ITBB 4I0PC 4Y7MA 3RVWC 3KWWB 4ZXBA 2H32A 3CMGA 4HUNB 2BP3A 3IN2A 4ZMZA 4JKPL 3L54A 4QJ4B 4W9JC 4GG6B 3I50L 3CFDA 4X50A 3GMLA 3TF7C 2BVQA 3Q8FA 1E2ZA 4ISVA 2EDKA 4G8IA 4YHML 4LCCC 4O02B 4P2OB 3LQMA 1MJ8L 3ZT7A 4BWTA 4XN1A 3ILPA 4G8GB 3JBG7 5F1IA 4PP2B 1ZV2A 4XNXH 2AEOA 3E8UL 3H7BB 3DYPA 4JFEA 1RJCA 1D5XA 1MUJA 3EDEA 3MGOA 1I3GH 2WINA 4HWNA 2JCWA 4LSVL 4UNUA 3T3MB 1J9CT 5JQ6L 4Q74A 4U3CA 5L7XL 3WFCL 5E4IA 1KXHA 4GUPB 4K5LA 2DD8L 3WIFA 3PXHA 4BSJA 3O8XB 2NSMA 2GJ6B 3U4BL 3IGAA 2ADIA 4HK0A 4WUUB 5JO5A 5C0NC 1IM3B 4JM2B 5KWYC 3SYCA 3HN3A 1N0LA 5FOJA 1UJTA 1F3DH 4NRYB 2UWEB 5F8RC 5K9JL 3O0RH 3S8FB 1I7ZA 2X7LB 2C5DC 1Z9SB 1GJIA 1UCBH 2MKWA 1M9SA 5L4IA 4FA7B 2JE8A 3D18B 4L1LA 5CR8A 3MBXL 3TJHD 5DWUL 1G7PB 2HJKA 3EYQD 5BNXD 3QDJB 4YXHL 3G6JB 4A37A 1X5AA 2ZXEB 4BRVA 1H15A 4P23C 5JMRA 3QHFL 1R0AH 1PZ5B 3NACL 2RMNA 1W72L 3JVGC 3R4RA 1ZS8A 5AZEL 1XTLA 4JCWA 1JGDB 4KFMA 4G9FA 3I9GH 1ICTA 3KYNB 3OXSB 3P4NA 3BRGC 5D70L 4NP9A 3O3UN 1QFUH 3CC5B 1NUGA 4R26L 1QWNA 3PWPB 1D9KB 4QWWC 5D1XB 1UXWA 4KNQA 1IGTA 1WEJL 2HLFD 5E8NA 4D0BA 5KSVB 4HXBL 3SQBA 1BMZA 3BAYA 2W95A 5HHNA 1CQKA 2HH0L 1Q9KB 3HCVB 3N1QC 1ROWA 3KDPB 5F7UA 4NHCH 1DE4A 1RUPL 2F58H 1D3CA 4GS7B 3NIFE 1N10A 3GBMH 5I0XA 3Q13A 4HLJA 3JQOB 5DJ0B 4XB7A 4FHKA 4L3EA 3FT4B 3RHWF 2PPEA 2I5YL 4LU5L 4JM4H 2AJYH 3UP1A 3VFNA 4W9CC 4P2CG 2JQAA 3UCRA 3P30H 4RESB 2H1LM 1CC3A 3D0VA 3CXHK 1LE9B 3FQ4A 3K7UA 4PYGA 4PTUA 4F9LA 1QEXA 1OZTG 5GZNA 2OL3L 5I1EH 2MCAA 1UWXH 5D2LE 2UXFA 4D9LH 1QI3A 3U4AA 1XIWD 4E41E 1ZHLB 4W9DC 2I9TA 1PPIA 3BUBA 3P4LA 4Z77B 1KYUA 2V9RA 2LAGB 2J8UE 2NY2B 1KEML 2VUYA 3F8UB 3GT6A 4WHCA 3HNTL 2X0WA 3HG1A 4FQXB 1S78C 5ALBL 3A24A 4H8HA 2W8CA 5MENE 5ISZD 1T22B 4LLAA 4A7SA 4Y16B 3DX2A 3UEZA 3UACA 4LSQH 4IBVA 3P2TA 5AOZA 1YNKH 4G70B 3O6KH 3NIGE 3MKGA 4AEFA 4DIXA 4DGYL 2NX5A 2ZJSL 5I1GL 1Q0XH 2OYLA 2DBJA 1LEGA 1WC7B 4UT6A 4NLAA 2YPLD 1OE2A 4EDXB 1CZ8H 3HB3B 3QQXA 4U0RB 4YHLH 2A6KA 5FO9B 2BC4A 4YBHA 4GW1B 1JHLL 1ZHKA 2E9BA 3ARSA 4I0KA 1U95A 2VLJB 1ZXKA 4HFWB 4YHZH 2MH4A 4KVCH 5AOJA 3BLKA 3SN6N 4OLUL 2QV2A 2YD5A 5FHAL 5I5IA 3T4YB 3K5RA 4K3GA 2V9TA 7PAZA 1U8IB 2QQKH 1P84J 3RWJA 1KGXA 2PW2B 3LN4A 4ZO7A 4H1LA 4N6QA 1Y6MR 2BSTA 3SDXE 3IFOB 3V79C 2BP8A 1XTMA 2AEPH 4PG9A 3B2VL 1HEZB 4AEEA 3IPBA 1AMXA 1A3LL 2I9LA 2R2HB 1KC5H 1TEGA 1MEXH 3DPBA 4X9HA 5KS9F 1I7UB 5EBWA 4XNYL 1AAJA 5HDOA 2E56A 1FN4A 4OTXH 3NMEA 1RZJL 2Q8BL 3GK8H 2J1ZA 4P8QA 3UAJA 3DSFH 3PREA 4JFDE 2OYPA 5JZ7C 2QPFA 4K73A 3VG9B 1N3NB 2CALA 4NS0A 1SBSL 4X5WA 5B3NA 1I8MB 1TPXB 2ICWJ 3MGTB 4XMPH 4FCAA 4LKCA 3ILQD 3FBQA 2YARA 4HOXA 4LRNL 3ETBF 1QSFA 4NSKA 3D9AL 3LQAC 5EUKA 3HS9A 3IDYB 4FQLL 4Z0XA 5CZVL 2HKLA 2CXGA 2CH8A 3EYOA 4LGRB 5F7BA 1WISA 1NCCH 4F37K 2D0GA 3X11A 4ZW8A 4GPVA 3DWTA 3GRGA 4S1QL 4B9GA 5EA0H 4ANKA 4HV8B 4PRPE 4K2UL 2H6OA 2AMUA 3VRJB 4HS3A 5ELIA 1RJZA 4HIHA 1FO0A 1B0IA 4I0PB 1YMME 5KBLA 1NGZB 4JO1H 5DS8B 4LQFH 4QLWA 3U6RB 3LKQB 3PV6A 1TITA 4W9ZA 2C1OB 2NY7H 3PPEA 3US1A 1NL0L 4MNHB 2EEFA 4H2AA 4KOCA 4HJEA 3J8F7 2VL4A 3QEUB 3VXUB 4LVOC 3GXUB 3MLXL 5DJ6B 1OP5H 2Q86B 1XBDA 3I75A 1PAZA 2OSYA 3QS2A 3U2IA 3Q8AA 1SHMA 4BKLA 4UTBA 2A9AA 3GMPA 5INDA 3UBGA 1X5GA 4LEEA 4LHQB 4QKXB 3D2UA 4L4VA 4AUUA 4NPYB 1T0NA 2XT1B 1RZKH 5F89A 4XMKH 2NY5H 2RBLA 3GXIA 1EXUB 3PCYA 1TVBA 1PVHA 3HI5L 4L8SC 4ZFZB 2B2XL 3MCYA 2VLLA 1GKEA 2OMTB 3QG7H 3AITA 4NO5B 4GXUN 3NFSL 4JRWA 2AS5M 2EVHA 3HUJB 2WCSA 5BO0D 3DXAD 5C6PB 5F7EL 2F8OA 2ADYA 3L3KA 4JB9L 4KXBA 2GY5A 2NY4C 3ECVA 5DK3A 4XPTL 1F02I 3T3PB 2ZCHL 4Y2OA 3NZHH 4KVPA 1GGIL 1MW2A 2F6AA 2FAUA 3WFEH 1UYWH 1XD1A 1AC6A 3U0PB 4TM9A 1BD2E 2DV6A 2AK4B 3BSZA 3BZ5A 3CPLB 1G9NL 4MJIE 1CR9H 1LE5B 2A5UA 2HLAB 4E0RB 2IBBA 2WB1A 1PNCA 2W81C 4WTZA 4OJFL 3VUAA 1MCLA 4FA8A 2VLRD 1BZEA 3PWUA 3HE7D 2L7EA 4YR6B 1XF1A 2ZG1A 3QNZA 5E6UB 5FM4A 5T3ZL 4PLKD 2BIHA 3PWJA 1CICC 2I69A 3KPPA 3VI4B 3BGAA 4FC3E 2FIKB 3L7FB 1H6EA 5D7JD 4R3SB 4AIXA 4AQAA 1OSZA 3UJJL 3T2NL 3K5SA 4GG6F 2FJGA 2EIJB 3DGGB 4AV0A 2YKKA 4N0FB 1DBAL 4CVXA 4RZCA 2FR4B 3BT0A 2D03L 4AVJA 5GZOA 4KO7A 4Z7VA 1XGTA 1AO7D 4EUPG 3H9HB 1SJXA 4A6YA 5JQIB 3IKCA 3PJSA 2BK8A 3S4SG 3GDCA 3KYMA 2H0EA 1KBWA 2CIIB 1WK0A 3FSAA 2CRYA 1J0HA 1IQWH 2DLGA 3GLDA 1E5YA 3T3MF 1M2OA 1YECL 5IMKB 4OGYL 5JW5B 1EZVX 3MLUH 2P4AB 4KK8C 3D25A 4X8CA 5B8CA 2YEZB 2CKBA 2XY1A 3QC6X 5JORA 1H8NA 1MHCB 3EOYG 3B9KB 2QELA 1QTPA 1U33A 2BCKA 3CHXA 5GGQH 1GGTA 4ATTA 3FONB 5AUMA 4MGXA 3ULVL 5AVQB 3GRWL 4JM2F 3SQRA 1AH1A 3KPSB 1QZ1A 1EAOA 4NCDA 3W5NA 3DK2A 4WTWA 5I8EA 4HOMA 5LGHH 1ETZA 4A7GF 1EGJL 1MWOA 3STZB 4HUVB 2N0MA 2YQBA 3IAQA 3QA3A 5IFJA 4S1SL 2DI7A 4JFTA 1NDTA 2XTSA 1W2KT 1JZEA 5DVKA 4YE4H 5E1AA 1MAJA 4DWHA 3TZVC 1L4IA 5CEXA 2CNZA 4DVBA 2R56H 2DTSA 4PJ7A 4PRDA 4K9EL 2B3RA 4JFEE 4X6FB 4HLZG 1QX1A 3US9A 2DH2A 3QWOA 1BVKA 1GHFL 4LF3B 2H7WA 2DEXX 5IR1A 2VISB 4W70A 3L4UA 1T1YA 2QBWA 1FZMA 1RZGA 2TRHA 3I6LD 3W5MA 4CL7A 1CLOL 1GIGH 4KDVA 3C09C 2XNAA 1YEKH 3SDDC 5DEZA 1A1MA 4B53A 2XPYA 2FHFA 5AW5B 4X7TA 4LFHD 3QPXL 3EF7A 1H8LA 2EDFA 3ZKXB 3BCDA 2KBGA 2JXMA 3DROA 4ZX3A 5I1IH 2H2SD 4HGWA 2Y72A 3EKCA 4KMTL 3VB9A 2ZWKA 4MXWL 1VFAB 3PHAA 4AGQA 1U3HD 2J6WA 4FTVB 5F7YC 4JR9H 5BRZB 4F7TB 4HCGA 5L8JB 5CEYA 2A77H 3KGUA 1NCIA 2APVA 2FD6L 2BFGA 5HSFA 1TLKA 4KI1A 1XIWA 1SDAB 2OMZA 1YYLH 3DMMD 1UH2A 2YPKB 1M2VA 3WJMA 1QA9A 2ITCB 5HHQA 3OG4B 1NIEA 1I8IA 2XV2A 3U4EA 3UAAA 2H45A 3HHSA 2P8LB 2OYMA 1TJGL 2ZOOA 1HHGA 1YDPA 3OGOE 1JZHA 1U2HA 1NGWA 1U8JA 4GAYB 1E4KC 3P11L 3WO4C 1TMCB 4EIZC 4HPOL 2HLEB 3DO3A 1FVCA 1W8EA 2EXWD 1A6AB 5LBVA 1LVEA 3WKPA 5DC2A 2WQUA 3FUFA 4Q56A 2HKAA 2WQ8A 4URKA 2VDOB 2ZG3A 1GAFH 2Y7MA 1YNTF 5FYJL 4XPBH 3WL9B 4L3EE 4WZ9A 1MFVA 1ZXQA 3NJIA 1OB0A 3FSOA 3TTYA 4JKNA 2B7DT 1BWMA 4LVOB 1LD9A 3H9SD 4MAYD 3RNQB 2IOIA 2OMVB 2HZHA 2BNRA 1CL7I 5FECA 3V9CA 2MCG1 2EIMB 3KPLA 1YMHA 4N0CD 3FO9B 1WZMA 1S7SB 3ECBB 1OO2A 4BZ1A 3JV4A 3RHWK 2EVJA 2ZUWA 4YGVA 3RIFF 1V27A 4OCYH 3IMVA 1PCXA 4PJBB 4QRUB 3SEPA 1R9FA 1R3JA 3SJVD 1HTYA 4X9FA 2DEWX 4MMYB 3HG1E 3L5HA 4ONHA 4YIQB 2PCXA 3S37L 4H44C 3GMNB 1D6EA 2X4TB 5JQHC 1L5GB 2NY4B 2X0VA 3HHRB 1ITCA 4LLQA 2VW6A 3N40P 3OXRB 4PJXA 4NWUL 3T0VA 1JZDC 4GRLD 3ULUF 4JO2L 1PSKH 1U21A 5GJSL 4BXSV 2VXQH 1FL3A 2Q9OA 2XX0A 1E6JH 5FA3A 5FFLA 3W39A 1M05A 1KWKA 1T0MA 5IB1A 4XN4A 1B0RB 3NSJA 5T3XD 2DDQL 1OT4A 1RFDH 5D93B 1ZTXH 2Y06H 2VDPB 1WPCA 1BMWA 3FFDB 3ARPA 2R69A 3AXLA 3HBZA 4X4XB 2BSCA 3LIZA 4TSCH 3GS0A 1DANT 2OJZH 1MKFA 2MOGA 5DRZB 4YEFA 5DVMA 4TKWA 5KYUB 3BPNC 4FRWA 1NLDL 1LO3L 3QNFA 4P5RA 3D48R 1ROCA 4HKXB 3DV6B 4PLJD 1I1YB 3EGSA 5IBTH 3BH4A 3H2PA 4ZFOA 1NPUA 3DV4A 4MXQC 4YFLF 4F91B 2EYRA 3VD7A 2N01B 4HUWB 5I8OH 4V2BA 2EDJA 3GS4A 5AB2A 2CCVA 3AZUA 4KHXH 4CBPA 1DBKH 4JDZA 4NQDB 4IJ3C 4UI2A 5T5NF 4BFKA 1B0GA 2QPEB 5AW3B 1YC7A 2B8OT 4AE0A 3NA9L 3L95B 2A9NH 5EU7C 4JE4B 3B3IA 3PNRB 1AY1H 3B9VA 4ZPTA 1N12A 4IMKC 3DRTA 1ZT4B 2WUCH 3NP4A 3OAUH 3QW9A 1KXQE 3GSOA 3RFZA 3X17A 1MRDH 5F7DB 3HUJF 4A2FA 1GXEA 3ULVF 1GPOH 3PJNA 2B4CC 5B7MA 1CYXA 1LMIA 3HR6A 5DUBA 5HDWA 4J8RB 4FA6A 5HDLA 3OKKB 4ODWA 2LVCA 3WE6B 1MJJB 4HIIB 4L9LA 4M1GL 4N5EC 4IKIA 1RZIA 1QTYT 1YEJH 3HI6H 3W11D 5HYJA 2FL5A 2QKIC 1OHQA 1GS8A 3GPEA 1ZJAA 1RIVL 4N3UA 2VLRA 5HHVL 5IROC 1L9TA 3MMEA 4NN7C 5IESH 3ESPA 2O5XH 4LHJB 4UILL 4RAVA 4XPAH 2WXRA 4M29A 2WZ5A 3ZGIA 2YMXL 3GMLB 1BAFH 2GIMA 1ZATA 4NQQA 1GOFA 2HRPL 1BFOB 2BZDA 4JZOA 4PIBA 3VAEA 4AGOA 4AJWA 1U6AH 4ZDHB 5FO2A 3LKNB 4DPRA 1YY8A 4NZRH 4PD4K 5D7JA 3VI4F 5F1IB 4MTMA 5B22A 3DGCR 5CP7A 5MI0C 1R46A 3GSQA 4NZUL 1D5XB 1MUJB 3B56A 4NEHB 2WINB 3OBAA 1QRNA 4CJ0A 3C09B 1P2CA 3B43A 3SOBH 5I6OA 1JNHA 1XMEB 2JQZA 4FLSA 5AB0A 4Z9KB 3CJJA 1YQVL 3MO1A 2HJFA 4F80A 4KJQD 2R0LL 1AO7A 4LB8A 4OGXL 5BXFB 4RFEB 3VVVA 4KK5D 3ZYOA 3O4LE 1SVBA 2ZSVA 4HK0B 1A7NH 1OGTB 4BE5A 5DZPA 3F58L 1WFNA 1NAMB 4F93B 5JO5B 2KL6A 2ZX7A 4J8QA 5C2BH 4BFGA 4JZNA 1N0LB 1AGDA 1ZHBB 8PAZA 3KPNA 4H7VA 1LO0H 2VLMD 5JHBA 1U8OA 1ED3A 3TXAA 1OW0C 4W93A 3AABA 1I7ZB 2F8XC 1YEHH 4MS8D 4FNLL 5DEGB 4GRWH 1FRGL 5F7LB 2YZ8A 5I73B 1SEQL 1F1DA 5HVWA 3ZKMD 4IIZA 2DWTA 2QQNH 1WLHA 3K2UH 3PAVA 4NERA 3WFBH 3WJJC 1W0WB 2WGNB 4OLVH 4BHUI 1ZS8B 3ALXA 4G6JL 1N64H 4NUPA 4G9FB 4WSJA 2WO2B 4DO5A 4QT5A 3QFJE 3HMWL 3LZFL 5IZ7A 3WLBB 3S5LA 3TEYA 1USZA 3WO4B 1UXWB 2F7OA 2VXUH 3K72B 5I18L 1IGTB 4IGBC 1EHXA 3GXFA 2IQAA 2ATAA 2WBJC 4TNEA 3T65A 4OCSH 1X5MA 5HHNB 4FLOA 3LB6D 2PXYC 3BUQA 4WEEA 4GP8B 4BIKA 4DP7X 2B59B 4FG6D 4KRPD 2YMOA 3NIGF 3SKNA 4WWPA 2W59A 5DJ8A 4MA1C 4J27A 1E9PB 4NQUA 5FGRA 4AVHA 1WIOA 4NZTL 1EAPB 2FEDC 3R0NA 4EUPH 1P69B 4PGBA 5KUMA 5H94B 4AWJC 1VADA 4P9HL 4R96A 1QABA 1GZQB 3MNVA 1TSRA 5EBLA 4MAZA 3VFPA 5I0ZA 1EO8L 5JNYA 3CZNA 3VFNB 1JXGA 1JNLL 2P3YA 4PJDB 4JMNA 5T33H 1JPEA 2OMWB 4MB5A 5IMOA 1AJ7L 3UO1H 4PTUB 4WI3A 4LK4A 2AEQH 4XH2A 3VTTA 1QPPA 1VGEL 1OAXL 5FV2A 4AM0A 5I6XC 3SDXF 4YX2L 2KZKA 1XDTT 3ZDWA 3F01A 1PY9A 4X9GA 2DQUL 1LK2A 1SYVB 3T9WA 1KIUA 4FFWD 4O5LH 4APQA 2JKIS 3EYQC 2G0KA 4PJ7E 4GAFB 3WEXB 3DMMA 3IPEA 3HG5A 3F7RA 2NX5B 1IO4C 2X4PA 1EJOL 3D34A 1LEGB 4IMLA 4GQQA 4NUJB 1KFAH 3CFEA 4YJZL 3VD2A 1G0YR 2VXSL 1UM5L 4WFED 4CSZA 4HLZH 5TK2A 2DS4A 1U95B 2XWBA 4U6XA 4W68A 5DMGD 3PV7A 1FFTB 1HN1A 4A2LA 3BN9D 2AJZB 4G7YL 3UTTE 2DQEL 4HJ0C 1MH5A 3OKEB 2XY2A 4LCVA 3W56A 4MAYA 3H9SA 2FT6A 4E9RA 5F44A 1G43A 1Z9MA 2EH8H 1C08A 2AK1H 2BP8B 4KQ3L 3V4UL 4PG9B 1MCWW 2VSMB 2YD3A 3BAEH 2WLHA 5AKVA 3RB7A 1R24B 2I9LB 2AV7A 1MVYA 3L7EB 4Y2DD 3KLAB 1LHZA 3HPJA 3DPBB 4YSPA 3SODB 1FH5L 1B9ZA 3FO2A 1LWHA 2JELL 3FQNA 3EW3B 4MD4B 3WIIH 3HBQA 4AZ8A 4JAMA 1GJWA 4IEFB 4BUHA 3V9EA 2HN7B 3EO1B 3SDCA 2C1PA 5D5MB 4BZYA 1GSMA 4ZJ9A 4JPKH 2QMJA 2ORBH 3TPUA 1PKQA 4B9KC 5C0FB 3FO0L 3NJFA 4HCRA 3W9EA 4QTHB 2XTJD 3UJTH 1NBYB 2EH7L 1QSFB 3B2XA 5EUKB 1PZSA 3NEEA 2FB4L 1S7RB 2DQFA 1MFDH 1HILB 1FFPB 1IBZA 2J4WL 3BPOC 4XWGL 2CGRH 3X11B 1LDPH 4IKLA 1T7ZA 1IB5A 1ZY9A 3H9YA 2QPSA 5DS1A 2VRQA 2Q3XA 2OZNA 1IAIM 4HS3B 1NFAA 3REWA 5C0CB 2BOBA 5LBSL 5KOVC 4ZO6A 2FRGP 4JS7A 2QKIB 3HC3H 1RPUA 2HPOA 3PV6B 4GQZA 4KK9D 1ACZA 2BNRE 4NP4H 3P0YH 1T5WA 1OL0A 1QLRB 4UQ2A 3ULSA 1GZPB 2NNRA 1OXYA 4C57C 2FDBP 1FNSH 2J88L 1IGCH 5TE7L 3FF7A 1EDHA 5C8JA 4BKLB 4LCIL 3GMPB 3W81A 4GAJH 5K9OA 3D2UB 5MI0B 4L4VB 3ARBA 1GR7A 4PWHA 4Y9BA 4JQVA 1MIEL 4OR1A 1KJVA 2P5EE 4H26A 2ZXBA 3GI9H 4B0MM 2VLLB 1C9SA 5E94A 5FDWA 4PJXE 3RIFK 3V0VA 4IBTA 4UIKL 3Q1SL 1N59B 3WKML