5LB1A

Crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with thionitrobenzoate (tnb) adduct at the active site cysteine-354
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
HLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Binding and processing of beta-lactam antibiotics by the transpeptidase LdtMt2 from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5lb1A02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lb1A01
1ZATA 5LB1A 3VYOA 3VYNA 4Z7AA 5E51A 3U1PA 3ZGPA 4LZHA 5K69A 2HKLA 1Y7MA 5DC2A 5E5LA 4QRBA 5E1GA 4QRAA 4XVOA 3VAEA 5LBGA 3VYPA 5D7HA 4ZFQA 4A1KA 5DU7A 4A52A 4JMNA 5DUJA 4K73A 4JMXA 5DZJA 4HUCA 5DZPA 4HU2A 3TURA 5DVPA 5DCCA 3ZG4A 4A1JA 4GSRA 4GSUA 3TX4A 4LPQA 4A1IA 5E1IA 4GSQA 4QR7A 2MTZA 3ZQDA 3U1QA 4QTFA
chains in the Genus database with same CATH superfamily
4H4NA 3W5MA 1FO0L 3BAJA 4QRTB 1O0VA 4KK6C 2PMZA 1DFBL 35C8L 4WGVB 2E9IA 5A40E 4BZ2H 4R83A 1U3HC 3O0LA 3TNMA 4Z3IA 2HJLA 1A7RH 2Z31D 3V0VB 3S3SA 2OMVB 2BVQB 2Z65C 3UBXI 1CICB 4HJTA 1CXFA 1H8SA 2ZZUT 4KZCA 2XI9A 2VXSH 1Q0XH 2YZ1A 3CFMA 2IAMD 1IL1B 1E4WL 4HFWA 1UURA 3RTQC 1E9QB 2WLLB 4BFIA 5I8CB 3F7YB 4NZRL 4PRPE 2XWBB 4UF7C 4WFFE 3Q1SL 3OMIB 1W72B 2LLNA 5DHVH 3ZZLA 1A4KA 2Q9OA 4IRJD 5FFOA 3WY3A 5I0ZA 2DLEA 3QC6X 4XVTL 3MUJA 2AK1H 3OKOB 3H4HA 3QNXA 4ZS7H 1J8RA 2FBJL 1AP2B 1PZ3A 2A74C 3TOPA 5FYLL 1UH4A 4RMUA 1BBJA 3AGVA 4J8QA 2F74B 4ZX3A 1FV1B 3MO1A 4P05A 5HDBF 4NZDA 2NY5C 4R5TA 3RVVC 1ID5I 2BS71 2D3NA 3UJJH 1OPGL 2YQ3A 2Z9TA 4MJIE 4E42B 4XR8C 2IOOA 2HAZA 2K6ZA 4AKPA 1P6FA 3OZ9L 4MDJB 1DVFB 5TQ2L 4N6RB 3HC0A 1MJJA 1P4LB 4MA8H 2DTSA 2XXFA 2IBZY 1FLRH 1JPFA 4I2XA 2WLHA 4O2EA 1D9KA 5AAMA 2GC4C 3UBGA 1VKXA 4Z95L 2BS8A 5FA4A 2AZUA 2XN9D 3E6FA 5TPWH 2LAAA 3VWJA 3SDXF 4ZRGA 1MFBL 3STLA 5F96L 3MBWB 1AXSA 3FQWB 3FQTB 2XG5B 2DY2A 1KT2B 1KDJA 1H6EA 2BNUB 4UQCA 2IDTA 5HHVH 4WW2C 1IVTA 4J1UA 2J1KA 3VU1A 4GKSA 1CJYA 4LF3A 1RK1A 3QZBA 1I9EA 2AEQH 2OSLB 4Y2LA 2YQ2A 1GSKA 4NQCA 4TRPL 1O7DE 5I16A 1SYVB 4N0YL 4A6YH 1G7IB 4WI6A 5TDOB 4XZ4A 1IAOA 3RZWA 2JJSA 4YC2C 1H5BA 2HMIC 3PL6D 4P2YA 1MJUH 3O6FC 1AC0A 4LARL 4S1RH 1EAPB 1M1XA 1P7QB 2CHXA 3ECUA 1UJ3B 2RGSA 4NQDE 1USQA 2OZ4L 3MOBL 4WFGE 1NIDA 4FERA 5EH1A 1QHPA 4KDWA 3RWJB 3VG0H 1TU2A 5B1KA 4R26H 4NHUA 1MWAL 4PREB 3CQPA 4NKOA 4DZ8B 3CZEA 1KGYE 1R19A 3FFDB 2XZCL 5I1EL 1JHTA 4YVUA 3V0HA 4PJGE 1QFWM 1K8IA 4WKZB 5KYXB 3ESOA 2V9RA 5IJVA 1CFTB 3LVTA 2QQLL 2VC2H 5C2BL 1NCDH 2EDRA 1WFOA 3KJ6H 4XP1L 5CP3A 4YGVA 4DEPB 3UPRB 5J1TC 1KIUA 4Z7VF 1Q90A 2I5YH 3BQVA 2VJXA 1ORQA 4MZIA 1IJ9A 1EDQA 1G9HA 3PIQB 3M88A 4NQXB 1NFKA 1Y18A 1HXMB 1BYPA 4HUWA 3KLDA 43C9A 2PP8A 3WXWL 32C2A 1TEGA 1Z5HA 1J8HB 4OFQA 1Z7JA 2B7DT 3C6EA 1XF4A 1L6XA 2CH8A 3R0NA 3GQFA 4Z7QB 3HHSA 1ZWIB 3MGTA 4B96A 1R34A 3AG4B 3RFRA 4IEFA 1E6JH 4NBZB 4Y1AD 4GAAA 4Y2DA 1YEDB 5ILTL 5D4QA 1A02N 2IFFH 1DVTA 3CFIC 4QNPF 4YLCA 4ZFFB 1HCYA 4ZMVA 5IIEB 1ACZA 1PU0A 2X12A 2DIAA 1DQDH 1AJ7L 4O5LH 4R3SA 3VYOA 5DJCB 4KXCA 4GRLB 5EEXA 5KSUA 1OAUL 2XTJC 5FO7A 4FG4A 3N41B 1DJYA 3DWTA 2PO6D 2V5TA 5IBLD 2XIDA 2OQJB 3CN2A 3BVXA 2A77H 3U6RA 4DEWA 2VDQH 5EOTB 3STBA 3L1OH 1VESA 5EF3A 2B16A 3VFTB 3FYEB 4PJ7E 1IAIL 3HBZA 3NCXA 2BHYA 2I85A 1CGUA 3IWVA 4MBRA 2IWKA 1S78C 3FN3A 5TK2A 1UC6A 4NNYB 5JHLH 1DVXA 3ESVF 3BUBA 4YXHH 1U8IA 2EEFA 3MCKB 4GO9A 2BPBA 3PWPB 3FUEA 5PAZA 2Q86B 5KVEE 1FAKT 4PJ5E 3VJ6A 4B0MB 1NCAL 4FD0A 1UJTA 3WOVA 2AEWA 3A67L 1NEZB 4WI0A 4M1DL 3N1FC 1KG0A 5DD1L 2MHAB 1N4XL 4OJCA 3D3VA 1YY8B 4UTBL 1LILA 3TBBA 3KS0J 3MV9D 4Q89A 4GKZB 3MZGB 1I4FA 1GS7A 4JM4L 3MPCA 1MCHA 1HVXA 1JNHB 4ZUSB 2E59A 1P6AB 4N85A 4G9DB 4G80B 4GEIA 4QRRD 3BUIA 1DJIA 3GF8A 3MLSL 5JW4R 4M8UA 1I7ZA 1RUKH 3MRCA 1U2YA 5BO1L 3V4LA 3BN3B 4NC0B 4FP8H 2DQUH 2F61A 1R33A 4L8SC 4XTRD 2HRHA 4I3SH 3MJ8B 4E9LA 4LKCA 4UQ3A 3C5SA 3NA9H 2EADA 1B2WL 5FYKH 4UNVA 2VXVL 4MQSB 5GSRA 4X6BB 1ZOXA 4IRSC 2VDRL 1AZUA 4HIQA 4PBVC 3LN5B 3UADA 4DPRA 2XV3A 4LFHG 3CZLA 2QFRA 3OXSB 4FQIH 4N1CA 5DUBB 5JPNC 3RVUD 4Q14A 3ULVH 3EOAB 3LHPH 4TNVK 3VFRA 4WTWA 3VA6A 2Y06H 3WDIA 1P5UA 2NY0D 2HT3C 3DMMD 3FCTB 4YSQA 3QUXB 2IH8A 3QUZC 4KJWD 4U6VH 5E9AA 5GISH 3RE0A 4HUNB 3M45A 1HINL 2AGJH 3T6WA 2QADC 1Z32X 1H3WM 4TS6A 3RWCB 1YY9C 2WP3O 5DO8A 1Z9OA 1PBYA 3IU3A 3O3EB 3FFCB 2JJTA 1HCVA 1R4XA 4JKKA 3KGUA 5F8RC 4I4WB 4NN5C 5DYOA 1ZTXL 1OP3H 1OE1A 2A6IB 3SGEI 1KMGA 1A3ZA 1JAEA 5C0CD 5DXWA 5CUSH 3RPBA 4CADB 4PY7A 4PGCB 4BKSC 1D7CA 5JHDD 4Y89A 3FN0L 3GZPA 1JCKA 3WG7B 4AC2A 4NQSA 4QRAA 1KJMB 3QUKB 5HHXL 5DQDL 5EUOA 1N5AA 2XFGB 1I8KA 4OFKA 4LGRB 1W0VA 2IVFC 1CLZH 5DMIH 4AX3A 1BVOA 3BP6A 1MVFA 3WXVL 1P2CB 3INOA 3MCG1 4XWGL 4EBQH 4J3SA 3ZSTA 3VDAA 1V27A 3RNKB 3U0PA 4M03A 1AO7D 2LT9A 3VH8B 4B5ZA 3E38A 3RHWK 5CEZH 2J88L 5ACZB 3ZYIA 3BZFA 1C5BL 4N8CH 2OSXA 4Y8DC 3TWCL 4JO4L 2HLFD 1ORSB 1GGUA 4N90E 1TQUA 3LRSA 1HQRA 2TSBA 4CVZA 2EYTA 3OJMB 1TDQA 1Q9WB 3L2MA 2DQJL 3A4DA 3P77A 4E0RA 1TETL 2WXJA 2O4EA 2UZIL 1RFDH 2FB4H 1IFRA 4G6JL 5KOVC 4OJFL 5GGTL 1YPZE 1OTUD 4KROD 5AVTB 1SJEB 4JY4A 3DHJA 3TGXA 3P30H 3RVXD 4P99A 4RRPA 4N2KA 4PRDA 5A3IC 1TTUA 4M8VA 1SEBA 2CO2A 3HE7D 2JE8A 3RKDC 4GBXC 3K8MA 1V8HA 2EH8L 1F6AA 5IK3A 5C0EA 4F8LA 3E8UL 4U1KB 4ZFGH 4KUCF 2DLIA 1BQLL 3BVDB 1D6VH 3HBQA 5KVGH 3DUHA 2W0PA 3NA4A 5I1LA 4JMXA 4WUUA 5L2JA 3P02A 4WAFA 1P53A 4YBHA 3QB7C 3FRUA 3NH7H 3DOSA 5BJTA 5DD0L 2HT2C 3MFGB 1Z5YD 1JYWA 4NM8H 1DJSA 2QLVB 3KYMB 1FZOB 2CG9X 1RURL 4JM2D 4JVPA 3EHBD 3GYRA 2DPKA 3UERA 1PNCA 4JQVC 3BIKA 4MD5B 2BC4A 3LIUA 5AFAA 4L3EE 4OZGF 1VGKA 1NSNH 1ZSDA 3ARBC 4L8BA 4AYFB 3Q8EA 4Q6IA 5J0BA 5A2KH 2DTMH 1T5WB 1MWOA 5EWIL 4A38A 5FDWA 1I1YA 2EYRA 4KXZH 1D7DA 2P80D 4UT9A 4FXKC 3I02A 1NH6A 4PU2A 3F6IA 4L4TD 4JO3L 2XVLA 4L8DB 2MFNA 1YNTF 3MV7E 4DERA 3BT2H 1CICC 2Q8BL 1NICA 2JV6A 3U4EA 5IWLA 3B2DC 3D07A 5EFIB 2OCJA 2QQNH 5CFHA 5AEAA 1YQ2A 3T3PE 2B3IA 1G0YR 3HEIB 1B9KA 5JIHA 5SWQA 3AVEA 1ZK9A 4TQPA 5AOZA 5TGBB 4FZEH 2E4FA 5D2NC 2NW3A 4M4PA 1MEXH 4UOQA 4ZDHB 1J9CT 3MREB 1NUDA 2HLAB 4QGTA 4FFTA 3L5XL 2J6WA 1S3KH 4ODSH 3U7AA 4LDCA 1K3ZA 4M6MH 2ZWKA 3C5JB 1RH8A 2HCZX 4WSKA 2NY1C 1K4DB 1T4KB 4YDIH 3QFJA 1K85A 4GW4A 5HD8C 2ZNXA 3H7BA 1LE9B 4FEMA 4EI6B 4KUZH 1EXUB 4ZTOH 4MCZA 3ULVC 5GZOD 5KG9B 5BZWA 5DS1A 3W9DB 4F7TA 1JUFA 1XMEB 3SCMA 4BGLA 4M62H 3JUZA 1ZVSA 3KLQA 4WI9A 2MEJB 4ANWA 2JH2A 4YO0A 1T2JA 1BVNT 2B1AH 3IDIA 1AKJD 3BKCH 3T0VA 3T6XA 5KSBF 4Y9BA 2GSGA 4X0KA 3ARFD 5DQJB 1R3LB 3V6OA 4JRYB 4QRUA 4JDVB 1ODAA 1TZOA 3EKCA 4HIHB 1BVKB 3TYFA 1L9OA 3CGTA 1JXJA 5E4IA 5F1KC 1UCBH 4R7XA 2IH1A 3IRPX 1MHHA 4PB0H 4WEEA 2C3HA 4PJ9D 1YDPA 1F3DJ 3W0WA 2DWDB 4P49A 3CZNA 2ZOWA 1MFAL 5DZNA 4K7PY 3ORJA 3OAUL 5DJZA 3WY2A 2AJ3B 1ZHLA 2ZUVA 1G7MA 2HN7A 3UC0L 3VXRD 2LAGB 3SDXA 4HHAA 1UCTA 3US9A 5I0WA 5J12B 3QFDA 3I9IA 4Z0XB 2AQSA 2OKMA 3TT3L 4DGYH 1F4YH 4TUJA 5EO9A 4KHTL 3FQUB 2ZF8A 4HBQA 4OF8A 4F7EB 5IJCC 1IGYA 3WFDL 1EO7A 2E3VA 3CSYB 1Z6JT 2NUPA 2WJ7A 1LEIB 4NX0A 1OE2A 2B14A 4B27A 2YAOA 4Y4FD 2HJKB 1CFMA 4EUPH 4PGEA 5GGVL 4LLDB 1NEZG 3IDNA 1A3RH 4YXKL 2AJZA 1BYNA 4I1NB 5KSAC 5GGUB 1ROCA 1AC6A 2Q8AH 4O51A 2WUBL 4OFYD 3RIKA 1MVUA 2OZNA 2MQ0A 3HI6H 1WG3A 3IJ9A 3FQNA 3PP3K 5C70A 1Z1WA 4WGKA 4Y19E 2JK5A 3MUY1 4K71B 4POZD 1KYAA 1J1PL 4FFYL 4IHOB 4AJWA 1UD3A 1XMWA 2GSIA 3MA9L 3OGCA 3DO3A 1D7BA 4BFJA 4DKAA 3CN0A 3E9TA 4O2CA 1L9TA 1GC1L 4GRMB 3MA7A 3MLUH 4JO5A 2WLNA 1MRFL 3PP3H 1FG9C 2HVJB 2P44B 2W0KA 3GSQA 1HZKA 1JTOA 1N7ML 2DL9A 2COVD 2YMXL 4N25A 5D9SB 5IB3B 4KRLB 5C0DA 3O41B 4G7YH 4N0UA 2YD6A 4FLRA 4G9FD 3CH1A 1Q38A 3ZIMA 3O6KH 3HI1A 9CGTA 5E70A 3ZKSD 1B4TA 3TURA 5CINL 4W6XB 5AUMB 1LE5B 4A1JA 3EFFA 5F3FA 2FX7L 4N2EA 3G9AB 5J11C 2PYED 5DFVD 5KVEH 4BELD 3KWTA 3HMXL 5KVFE 5FGSA 4P2QD 4BQ9A 4ABQA 5DTFB 3UBXG 1T03H 5IQOA 3O4OC 3IJ7A 4F2ME 4HKBB 3NFNB 3QDGD 3C5ZD 2AK4B 2OR8A 4URKA 3L17A 4XVJL 5CR1A 4H8WL 1CFNA 1QBLH 5I18H 1J5OH 3ZTNL 4LCCC 1I1CA 4LEXL 2FEJA 3SD5A 2VR9A 1JYXA 1DCLA 1JFQL 4Y4KB 2WPGA 5HTSA 3P4OA 4YHML 3W37A 2CKBB 4N8UA 1EHNA 4XHJD 2G3NA 3CVIL 3BUPA 1DN0A 1L0YA 1JZIA 2BVEA 2YFOA 2BNQA 1E6OL 2V5YA 4IBUA 2WTRA 4N2HA 5MEPA 3UZQA 4Z1PA 1YEEH 3TZVC 4WJKB 1UT9A 4ODWB 3D9AH 1UH3A 4V1DA 3BOVA 4ZTPL 1ZEAH 1ZT7A 2I9LA 2J7LA 3ARVA 3GM8A 5BQ7B 1BF8A 1KV3A 3LS4H 2J8UE 1AI1H 3GSXA 2P26A 4J4PA 1ZIAA 4B9IA 5CSZB 3S2AA 5HI5D 5FYJL 3AFLA 1HHIB 4HOZA 2WB1A 1BD2E 4PV9B 2C3GA 2FWSA 4R84A 2NY6B 5AW6B 5MP6L 1PG7X 1VPOL 1YEHL 1S7TB 2EXWC 1EAQA 1S7RB 4QOKB 3FC8A 1X5HA 2Z7YA 3F05A 1NOLA 3SGKC 5DHYA 5E2VL 1TZIA 3B2XA 5DRXB 1XH0A 2F54D 2EDOA 3OJDB 5D7KE 2KBGA 4JK0D 5DI8B 3E3QC 4EKXA 5E1GA 1PIGA 5E7BA 4AY0A 4FNRA 4JPWL 5E9DB 1YYLL 2DQDL 3PXJA 2YD0A 5IFAH 4FZ8H 1TMCB 2CM5A 4LLYB 3BEVB 5DF0A 2X5PA 1WTGT 2NTFB 3BAIA 2W91A 3L3KA 3R7RA 5D1ZD 4EZMA 3IDXH 4X99A 4OZFH 4CKVX 4PJIB 3QYNA 1HYSC 3AS0A 4G8EA 4OGXL 4UUJB 4KJPC 4A7SA 4FOMA 3U2SB 3U4KA 3DURA 2PXYD 1Z5LB 4HIJB 1FORL 3CLEH 3QNYA 3U6XS 3VXSA 2QKIC 4I18A 1FGVL 5IBUG 1QR4A 1E90A 5JZ7C 1DQLL 5ICZA 3LSOB 3NJNA 4R96A 2BIHA 2YGPA 4ZSOB 3IJSB 5EEVA 2JXMA 1J86A 4M4RA 4YUEL 5D1QA 2VSCA 2BOBB 2VDLB 1E8YA 2QLYA 2MQGA 3D39D 4HH8A 4UB0L 1Z2KA 1DEEA 5JQIB 3IKKA 4XVUC 2HRPL 4DN3H 2DQCH 1FBIL 5E5LA 3ARGB 3RZCB 4RWHA 2VLRE 3ZDZE 1C12B 1CD8A 5IV2B 1CLOL 3C6LC 4X7SL 3OD3A 3U7YL 3LYRA 4C83A 1R3JA 3L3OC 2WWKO 4HKZB 1RV6X 3II2A 5T33H 4D9QE 3EF4A 1HZLA 4H40A 5G4MA 2XT1B 2R1YA 3MRRB 4MKTA 4C56D 1KFAL 4Z7OE 5FDYA 1HH6B 1YEKH 3HPLA 4PRAB 3L1EA 3FU5A 1TNMA 1I1AD 2PPEA 2QTEA 3KXFD 2UWEE 3BFWA 1CFQB 2DQTL 2XWTA 3ZO0A 1SNRA 4X4YB 1BVNP 1TSRA 3HNVH 4IBYA 4OD2B 3Q6GH 2V3DA 4NFBA 3FTGA 2NZ9C 2GQHA 2YBRB 5ID1B 1BM7A 1BHGA 4U7MA 3WN5C 1E42A 3OLGA 1NL0L 4U1HB 4UU9A 3BKYL 4B9KC 5DFWH 3FO2A 3TBYA 4U6XB 3ZZQA 2DWTA 2K4AA 4GAJH 4HIXH 2BX5A 3NTCH 1U2HA 3DX8A 3FKUS 2X4RA 3PWVA 4KQ4L 2R2EA 1XZWA 2E47A 4LIQE 2YC1A 4L2LA 4HIIB 5EC2B 4FQQA 5SX5K 1IGFH 2DQGH 2UZYA 2LTQC 5AVXB 4WHCA 3QIWC 5I73B 2K9UA 3OR7A 4AYMC 1OTSC 4X9YA 4G6FB 4GUCA 3ATEA 2HT4D 4G8AC 4BKLB 2V8LA 4JPQA 2DL2A 1I9RH 2WSDA 5EORL 5SX5H 2WKGA 4R4FH 1FA4A 5CLWA 4OIIH 2DRUA 3FO0H 4UBDC 3ABMB 3SD2A 3MRLA 1NCOA 5BRZB 3ZW3A 2AEPL 4J27A 4UV4L 1LO4H 2OXHA 3ARYA 4I77H 2B2XL 3E2HC 3ISWA 3VB9A 2PR4H 1XIWD 5K69A 3QEQE 1NGPL 2DI9A 5HPOA 4YAQB 5BXFA 4ENEC 1P7KB 5B7EA 4C58B 2WXFA 2PR9A 2EJ1A 1OV8A 3HG1D 1OGSA 4JFUA 5ALCH 1AH1A 1NFAA 3ARUA 2Y4SA 1MWAB 4PP1D 1NMCC 3B3IB 3H9HB 4WK2B 2ICWI 5KS9F 2C9SA 3GSVA 1IAKB 3CG8A 3FHAA 4BFFA 1FRGH 3NIGF 3V95A 4QT5A 1ZTXE 4K3DL 3FH5A 1OANA 3GKWL 4IU3A 5E6IA 5GS2D 3GC3A 3MV01 3UTSE 1UD5A 4B9PA 2ADFH 1XH2A 5KTEL 2F58L 5E2TH 4KVCH 4BK5A 2AXJA 1HL5A 3MRMA 1MNUH 2HTKD 1QRNB 4PLKC 3PV7A 3A4FA 1RZ7L 5CWSB 5TDNA 4AGMA 2H26A 5IW6B 2PPCA 2XQBH 4U4IA 1WIOA 1TZAA 5JHAA 3DDFA 2W38A 1U8NA 1MFNA 3POCA 4RSVA 4XBPB 5C0BA 1A1MB 1CL7I 2GTWB 2N59A 2FX8L 4M5YH 4AV0A 3D09A 4F9PA 1TPXB 1XSJA 1F56A 2IWFA 4PRBB 4P3DB 4LE8A 3FUKA 1A21A 4QXGL 4PJGA 4M1CC 3GSNL 2H3NA 1YNTA 3W81A 3DTXB 3BH4A 2FYVA 1OB1A 1CFSB 1EAJA 2O30A 1NLBH 2E74C 2AQ3A 3QJZA 4K2UH 3BDXA 4JPKL 4RAVB 5G5DA 3QG6A 1HESA 5CGYC 3Q06A 3FYIB 2OMXA 2GK2A 5IROD 3N04A 1UYWL 1RY7B 2XHNA 3WKML 3G5XA 1TYEB 2G3XA 4FMFA 5EU6B 1G7QA 3U9PL 5D1QD 5DT1L 5HGDB 3T4AA 1SY6H 1DLHB 4JKLA 4WUKL 3WSQH 4PQXA 5JXEA 4U1GB 1CGSH 3CPLA 4F7PA 2VSDA 2UZXB 2ICWJ 5GJSH 1KN2L 4ISVB 5GZNC 3I6LE 2V37A 4JFDA 4IRZL 4BFNA 2H3KA 4FABL 3UROR 5MHSD 4PJCF 3MRJB 3CDGB 5T3XD 1U95B 4WEUD 5DVMA 4BHUA 4GUPB 1E4KA 2YN5A 4KO6A 2ZP8A 1JK9A 2VABA 3O6ML 1TYJA 2K45A 3I9GH 4NWTL 4H2CA 3NZUA 2A73A 4HJ0C 3CDFA 4N24A 2PCFB 1WEJL 1XGPB 5I8EB 1FO0H 1NCBL 2DYPA 1DFBH 2B39A 3ULUD 1U8LA 3C9NB 4WK0B 1C5CL 3RY6C 5DDHA 3FT2B 2B5IB 3MJ7A 4N2CA 3IGAB 3SGDH 2GJ6E 1RVFH 3LKPA 1R3HB 2WKLA 2J6EA 4IIZA 2WLZA 3PXLA 4ZFQA 2VKXA 3MBXL 4AIEA 2J57A 4JMNA 2YXWA 1NUFA 4FQXD 4FTVA 4ZO9A 3MODL 4OJAA 1HT6A 4KKLC 2BRRH 2RQ8A 5FKAA 1J12A 2WO4A 2OPCA 4XVTH 4AI7A 1SGKA 1JCVA 1W8EA 1FH5L 4DP2X 2XQ0A 2FBJH 2XZQL 3K1DA 4QKTA 1VFBA 5FYLH 2MPVA 3HI5H 3I9PA 4ANUA 3FT9A 1NAML 1EJ8A 2VXTL 3QIUB 4K8RL 2IWGA 4XP5L 5T1MB 2O26U 1E27B 1OAJA 3DBXB 4NEHB 4HUVB 4NKDB 1AZZC 1BLNB 1WAAF 1NCHA 3QPXL 4QHLB 4W4OC 3GMNB 5GS0D 3NSFA 4IDJL 1C7TA 1OPGH 3K6FA 2VDRB 4UILL 2H1PH 3PHAA 3SDAB 4IKKA 1TZHA 3MNZA 3OZ9H 2EILB 1RUAL 2IANB 4ZOBA 5TQ2H 1OSEA 1QTPA 3DYPA 3ALWA 3BAWA 3CFKA 3QULA 5JA9A 1RZPA 3KL5A 3QCTL 2K9FB 3GSRA 1BDYA 1N9PA 2YKKA 4JDZA 1G7LA 3QH3A 4Z95H 4E9SA 3AQDA 1ETB1 4KUCD 4WV1C 2UX6A 3WEAA 3LEYL 3JV6A 4JFHE 5PCYA 1MFBH 4EDWL 3QORB 4QEGA 1U8QB 5F96H 5G2NA 3WU1A 3HFML 2ZWSA 3AY2A 3DDGA 4N3UA 5EC1A 3QIBA 2P4AB 3ES6B 1MAML 2BVPB 5A1AA 1DDHB 3GSUA 1LO5A 1XT5A 2ZOKA 3AMKA 1PJWA 4R4BA 3CVDA 4AG4L 4Y4HC 4MMYA 4HS3A 4RISL 2Y6SC 1BEYH 3EIFA 4N0YH 3MJ9A 4F24A 5BO0D 1DFXA 5C0ND 1W0WB 2Q0ZX 2BNRA 4LARH 4NPJA 3QXTA 2N56A 4G3YL 4XH2A 2IGFL 4N68A 3VXTB 1NOAA 3B6SA 2VLJD 1GGIL 3BCFA 2EP6A 3RGHA 3OKDA 3IFNL 3TBCA 1WYJA 5IB4B 3OF6A 4JPIA 1JGLL 3WIHH 1QLEH 1M2VB 5D2LB 2XZCH 5I1EH 4DJMA 1FZJA 2LFEA 5A7EA 3B9KC 3QNFA 3WLBA 4ZMXA 4CN4A 1NM4A 1M7DB 4LVHB 1OP9A 3PREA 1SN2A 2OMTA 2D3VA 2QQLH 5C2BH 3L3HA 5BV7L 4XP1H 1NEUA 4M8QA 5BOZG 3VFPA 3IETA 1NBZA 3LKSB 3SDDC 2LABA 3DA0A 5DJ6A 4J3BA 4UIMA 4JFFB 4KZDL 4X6DE 3QZLA 2MQ3A 3WXWH 3JXAA 2WLIA 5ENWA 2QHLA 4LCWE 2ATPB 4K5LA 1K8DA 2CNYA 5IMMA 1U33A 2WIIB 3FB6A 4J3WA 4MMZB 1FVEA 3ZQDA 2MKLC 2WKOF 5IB5B 4K23L 3UJIL 1HQ4B 1D6EA 5C08A 4B9YA 2AI0L 4QHKI 2X0WA 4ABWA 1JD9A 1XZ0B 2A7BA 4L2YA 4ZAKA 5ILTH 2NRDA 4TMPA 1KPRB 5MI0C 1A14L 4Q9RL 1HWHB 3C60C 1I7UB 1YQVL 2H8PA 3H1ZA 3GLEA 3QQ3A 5CILL 1WWBX 4KRPC 3HRZB 5F1NB 4A2DA 1YPZA 5D93C 5I0XA 1AJ7H 2Y3AA 3K6OA 4LLUA 4YHYB 2EDQA 3CC5A 2NSQA 3OM3B 2P7TA 1T66C 1MHCA 5LLIC 4TPRL 3DETD 5HYQA 2FECI 1F86A 4JN2A 3HB3C 2GBUA 2NY2C 2J1XA 3MVSA 4I3RH 3AG2B 4LCIL 3IFOB 4PS4L 4CC4A 4BUGA 3QJHB 4PJHB 3N43B 2EIZA 1VZGA 2IPKB 1W6LA 1OPOA 1M57B 2FJHB 2VAJA 4GXUM 4KMLB 4DNLA 1KNOA 1CB4A 2J43A 5DJ8A 4UAOB 5B1BB 3DHUA 4G6AD 3QDMB 2A6KA 4H20L 3APDA 4NPYA 3HZVB 3U2JA 1C1EL 3RGVB 1Q94A 2WWNA 3VX0A 4O4YH 5HDRA 1RU9L 1I9JH 3ROLB 3JWDH 4PGBB 4CVXA 1XF3B 5G55A 3CZKA 1NCAH 4NT6B 2VWEC 3T77B 2DLHA 4PGDA 4FLHA 7FABL 3A67H 1UACH 2OJZL 4M1DH 3RWHA 3X17A 2QDVA 2Y2WA 1PGRB 5LNEA 1LEKA 3KYAA 1QBBA 3O81A 4DVRL 4ZUWA 5IT2L 1N4XH 3CN4A 3QJFA 5LBGA 4UTBH 4F7CB 3MLXL 4PJBB 3MC0A 4P06A 4PJAF 1MAJA 2ZX8A 4QHKJ 5I6PA 2E7MA 4JFOB 5C09D 5F3HB 5HVGB 3II3A 4W6YB 2FWOA 5HYSB 4U1MA 3T65A 3QI9D 5BO1H 2YAMA 4L23A 1HXYA 1PAZA 3CQQA 3U1SL 1WCBA 4FA6A 4AUYA 1XGRB 4WZ9A 3REVB 5C0AA 2MPAL 2FO1A 1OARL 5F1IB 2AJXL 4KXAA 5EIVA 1FYHB 4PJ8B 5FW6A 5FO8B 2RQEA 1CIUA 1A7QH 2HKLA 2VXVH 4ALAL 1X7QA 2K3TA 1SDDB 3DJTA 3CHXA 5I2IB 5EU7C 2DMBA 1O5DT 4D9RD 5IQNA 3B9EA 3FCBA 5C0GB 3ZUCA 3FF7A 1ZE3H 2P5EB 3NUKA 4MCMA 3OHMB 1AANA 5GIRA 1URLA 2Z91B 4AW7A 2QVFB 1HH9A 3G6AA 4AH2A 5DLMH 2BNRD 4LL1A 2R4RL 3MSPA 4YN3A 4P3WA 3HOGA 4P23D 3VXOA 1KJ2L 2PLTA 2D03L 3BO8B 4XNZC 3KVPA 1H8OA 1VEOA 1HINH 2AFNA 4DGVH 2Z31B 4M7JH 4LQFL 1I3UA 2ILLA 3D4YA 4M7KL 2CUHA 4DCQA 2JCCE 3V9EA 4E9XA 2IAMB 4GG8A 5HHQA 5DQ9A 1ZTXH 3T4YA 3ETBJ 3T0ED 4KOBA 4IRJB 2V2XA 5KVMC 4D0CB 2K70A 3LN4B 5I74B 3TIDB 1WTLA 3FN0H 4FG6D 5CXPA 1UOWA 2PYFB 2WYHA 1J8HE 5HHXH 5DQDH 2GVYA 3ATDA 4ZPVA 2GUOA 2Z34A 5BQDA 4Z7QE 3QDAA 4XWGH 4G5ZH 2DAVA 2FO4B 2DD8L 3U7WH 2NYYC 3J2PA 4KH9A 4XN8A 3BSHA 3VFMA 5L0QB 4O2FB 3SE3A 1XCTB 5E1HB 1C5BH 4LVEA 2AJSL 2V2TB 5B22A 4EXPX 3TWCH 4JO4H 5EOCJ 5HGAB 1TQWA 5J9PB 2X28A 4NRYB 2JB5H 2KI6A 2XN9B 3A5VA 5D6DA 4Z7NB 3WTUA 2DQJH 3HRPA 4KKCD 5GGSA 4DO4A 3GIVB 3QA3A 5IESH 3PNWB 2NT0A 2UZIH 3QNZA 1F90L 4XMVA 2J5LC 5KS9A 4GUQA 2O6PA 3K2UL 4G6JH 4G8GE 1DSFH 4JEGB 3QJTB 4LSTH 3D50A 2ZUWA 3G3LA 3TVMD 3UTQA 3H4FA 1BM3L 3WHXB 4FI8A 3SYOA 1XGQA 3Q05A 1E4XL 2H4EA 2Y69B 5CU5A 4HKJB 1XR8B 3PL6B 2AJYL 5I71C 4K94L 3E8UH 4ZTEA 1BQLH 1YAZA 3TA3A 4XPAL 1T22A 4U3XA 4Y19A 4HZ1A 5GRXG 4EZJA 4U1JA 1PQZA 2ENYA 1V3JA 2JSFA 4U1GC 2IDCA 2L04A 5DJDB 4D0DB 1SPDA 2WQXA 4HMEA 5DD0H 2CIKA 1PG7W 1F11B 3B9AA 5CN3A 4P5RA 2RBLA 3KDMA 1QLFA 1MIML 2NXYD 1RURH 1KEML 3BAYA 3B3BA 4JR9L 4XNDA 5I6XB 4YSUA 2OMWA 3BYYA 1A8ZA 2YPLD 2X6MA 1AY1L 1O6VA 1ET8A 2WZPD 3DJSA 1NC4A 3DUSA 4BFEA 1H8LA 3QXWA 4Z5RB 5J6HA 5DJXB 1EPFA 3P2DA 5EWIH 3MBEC 3TBVA 3VWKC 1KIQA 1X5JA 2VMEA 4GFXA 4OBRA 4PJXB 1XQ4A 4HOXA 1PLAA 3JWDC 3L9EA 4C4KT 1ILSA 2YPVL 4LRIC 1KBKA 2VQTA 4JO3H 3IMTA 3F7VA 1WZMA 2Q8BH 4KK5C 3FRPG 4WW1A 4FXGB 5F6IC 4XWOC 5D1XD 1V5JA 4XMUA 1A65A 2LU5A 2KPNA 3KLAA 2Z8VC 4JFEE 1IGMH 4FA8A 1HL4A 4Y1AB 4JPSA 3TJHC 4AOFA 4M7ZB 1S7VB 5LJYH 4MTMA 4OB5L 4E5XB 3VSQA 2A9MH 2D7PA 1HX0A 3C09C 2VDNL 4HUUB 4R2GC 2L0DA 4WFHE 2X3AA 3EGSB 3CFNA 3S5LB 3PUCA 1QEXA 2W92A 1UGNA 3JTSA 2RFXB 4MA1C 5HJ3B 2XA8L 3ME0A 4MZ3A 1L7IH 3TPKA 3L4UA 3L5XH 2WTOA 1UB5B 4GSQA 3RGBA 3WLWC 3IU4L 1NTDA 4FADA 1LDPH 1MQ8A 3DLQR 4NQUA 4J5VA 3IFPA 1AYOA 4OLXL 5BRQA 3JZYA 3ARRA 1VA9A 2JIXD 5AAPA 4OKDA 3SDAC 3LKRA 3CSFA 2PO6B 3X12A 5DC2A 3BVWA 1ZE3C 2JKRM 1J0HA 3FHQA 2D31B 3AMLA 2YA0A 3LZFL 1QUNA 4MB5A 1RZKL 3EO9L 2OYKA 2XIBA 1BD2A 5FGCE 3VD5A 5T3XL 1GJUA 2H47C 1XEUA 3F5WA 1C9SA 1JRHH 3B34A 4ZPTB 1F3JA 2XQYA 1S7WB 4FQCL 3O4LD 5FLVA 1QSFD 3FPXA 3AY4C 1NC2A 3GD1C 4LZKA 3RX8A 1MFCH 1KYDA 1M1SA 3EO1A 3KD4A 3A6CL 4UM8A 3ULUL 2J2ZA 2GIXA 4QYAA 5ITBL 4PVBA 2R0ZL 2MWCA 4FL4B 1KN4L 4IGBA 3QXDA 1FN4A 1PYWA 4UT6L 2FL5A 2IQAB 3Q01A 5K1NA 3PFUA 1MCPL 1U36A 3MV9B 2BOLA 3NIFF 4YLQT 3RRQA 3IJYB 1XF2A 3NCWA 1BZ8A 3VFVB 5MENE 1I1FA 4P4RB 3A4EA 3KBPA 3VRJA 5L88H 1NFDE 2MNJB 1MFAH 2W88A 3AS3A 4OD3L 4QRRB 1V54B 3VI3B 5D4JA 4HCRL 4WHTB 3OAUH 1LO2L 3KPMA 25C8L 4F8OA 2VISA 3MRIA 3UC0H 5FGBA 3UAJD 2WNXA 5CZXC 3ULVF 3SQRA 4MBOA 3VWJB 1ZS2A 4KO7A 1IGTB 1DE4A 2CDFA 3REWB 1WK0A 2X0UA 3TT3H 3VO0A 4KHTH 2DJMA 1XB8A 4K3JL 2APFA 1I8IA 3WFDH 3ZIYA 4JAMA 4MA3A 4TTDC 5CIPA 3O8XA 4XCYA 4HCIA 4P5TC 4TNVF 4IS6B 4U1IB 2EC9T 1QQDA 4WNQB 3E6HA 2KYIA 3ZE1E 2PCPB 2C8NA 4PVMA 1BJMA 5KYYB 5FB8A 1PIFA 1JV2A 1R5IB 4PJFB 2NY0B 5C6TH 2NY4C 1PFOA 3QDJE 1AHWB 2YAEA 3PGDA 3WJMA 2A9NH 3UYRL 2X53A 1J48A 2WUBH 3KR3L 2JKTM 1JGEA 2CO7B 4NERA 4CDHA 3TASA 5T3ZD 4ZO7A 4LCVA 4AYID 2H2SC 3FMGL 1EHAA 3K6DA 5HYSG 3X3FL 3GMRB 3FZUD 5C0JA 1A6TB 1ZLSH 4FFYH 5AENA 2R1XB 3DI3B 2NX5D 3MA9H 2DQHH 2V6HA 4XOBA 2ZX9A 5DJ2A 1MKFA 1TLMA 5IR1A 1GC1H 2UWEA 5C0CB 3JV0A 2BSED 5GRUH 5I24A 1PKQA 5IJVB 3TT1L 3WFEL 1H0DA 1R9FA 3IDGA 5JHDB 1XF1A 3BPCA 1N7MH 1T6BX 2XZAH 2YD5A 3HW7A 5DGQA 3VRIA 4F2FA 1VGEH 4KAQL 4GI6A 4JFYB 5C07D 3SO3C 3FONB 1AQDB 2XWJB 4K9JA 2BP0A 3LRMA 4HWBL 4YHYC 4AXWA 4F15C 3NZ8B 5HI4D 3S3BB 5I76A 3NEXA 3F7RA 5CINH 1YC7A 3DUUB 1WBYB 2FGWL 4ONHA 4LNVA 3X11B 3CVHL 4XCEB 2FX7H 5H2BB 2E5EA 3RHWF 1TVBA 3NPZB 3HMXH 3UXFA 2WB7A 4I9WD 4HJJL 1G1KA 1N70A 2B8OT 3OX8A 5AOKA 3O0RH 3Q1EA 3SBRA 2WAQA 5E99L 1HI6B 3GSOA 1MUJA 4PWJA 4F58L 4XVJH 1HHJA 4H8WH 4P9HL 2W59A 1CDGA 4ZXBC 5CCHE 3ZTNH 5HYJD 3TFKC 1XO8A 2ZX6A 4P2OD 1JFHA 4JB9H 5F21B 3UPCA 1JF1B 4D9LH 2Q2LA 2XETA 3RPKA 3D0LA 4KKNA 4XI5C 1MQKL 2X2HA 1XGTA 2HSIA 4HEPG 1ED3B 2FNBA 3O3UN 3MRNB 5EBWA 2W5PA 4KROB 4TVPL 1H3GA 3BRGC 1GY1A 1RZGB 4XNYH 4ZTPH 1HNGA 5EZJB 1T7YA 3APNA 3D05A 4ONFL 3GMMB 3HE7B 5D8JH 3UCRA 4G2AA 3LNFA 3QFGA 4JY5L 4BJLA 1E50A 5FYJH 2OTUB 3N41F 5JW4N 1TJGH 3MRFA 4TKWA 4AZUA 2QV4A 4NI6A 1QO3A 3NT0A 1URIA 4IBQA 1VPOH 5LN8A 3BKJL 2AEIT 5EOQL 1YEHH 3TH3T 1IZJA 5ID0A 5IJKC 1PSKL 1TEFA 2EZ0D 3GSNB 4RWYL 1HOCB 5E2VH 3V4VA 1ZVNA 4A7QA 2ZIDA 2O93L 2NR6D 4LGSB 1X5MA 2IMNA 2XWCA 1KG0B 4JM2B 4AVKA 3KYOA 3PRZA 4JPWH 1UA7A 3EHBB 2X7LB 3HNSL 5AAWA 4DOHE 4PJAA 3UTTA 2DQDH 3FJTA 1A7OH 3H9SE 2A6JA 4CU8A 1U3HD 3FO9A 1P84K 3MLVL 3OPZL 1PY9A 3VXMD 2N3JA 4X0NA 5IVNA 4YR6B 3K6SA 4F7MA 3MRKA 4JFVA 4JLRB 4WWKD 3KBHE 5TE7L 3VFOA 4L4TB 1B0GA 5HGHA 5A2LH 3T2QA 3RTQD 4S0HA 1S7UA 3GRWA 4D8PA 1J0YA 1CGTA 3B7TA 3SDCD 2LLGA 3S88L 1FORH 1IFGA 2BXZA 2L7EA 4X4ME 1B4RA 1FGVH 1I3VA 3X2QB 1GJWA 4F1ZA 2YFNA 3V4PB 3GJEA 4BZ2A 3L5JA 4OJYA 2D9CA 3HA0A 1AOHA 2B15A 1YN6B 5EIIG 3C2AL 3N0PB 4M6AA 4EIZC 1AQHA 3L13A 2NQ3A 1AR2A 3VFRB 3QISA 4JX0A 1PG7H 4UB0H 2VXQH 2WMPA 1A1OA 3HAEH 4OY9A 3RVVD 5IFJA 5GJTL 4LOEA 5F3BA 5JOFA 2HRPH 4ZUVB 3RIAK 3QUYA 4K0OA 1OCZB 2N1KA 2VL4A 3FU9A 4RNRA 3US0A 4Y2OB 3WJJA 1EHLH 3FQXA 4P5KA 4W9ZA 3U7YH 5HHNA 3DRQB 4HC1L 1EGJA 1VFOA 4XP6L 3F65A 3Q6FB 1JWMB 2QDWA 3HMWH 4HV8B 1T5XA 3GJFK 5GSVA 1Q9KB 4RFEB 1U8HA 3S37X 4A7UA 2LV4A 5JQ6L 1XBRA 3QJUB 4JZJB 2IV8A 4X42A 1GZPA 3DX1A 4JW3A 4ODHH 2DQTH 4IRSA 5FECB 1VFUA 2UYLB 4MNQE 1AKJB 3RWFB 4ODUB 3ZDYB 3GJFH 1A2YA 3S5LG 1KFGA 3SYAA 1ASPA 5IB2B 5IP4A 3ARFB 1ZMYA 3BFOA 43CAB 1NL0H 4QXTB 1NMAL 3U4BL 1AE6L 2ZCKL 2HMID 2AJVL 3F58L 3TNNB 2UXFA 4LLMA 1GC1C 3O6FD 2RCSL 5TTRA 5KVDE 2X4PA 4KQ4H 3AUWB 4PJ9B 4TN9A 3ABLB 2WQ8A 3OKNB 5CEYA 3CXDH 1INQB 1II4E 2AXGA 2ADJB 1E7VA 1K2DA 3WNJA 1WWCA 2XICA 2AV7B 1OO2A 3QARA 5DZAA 3VXRB 5TE6H 4A6YA 2PP7A 3WJLC 5L6YL 3U30B 3QRFM 5ESQA 3PHQB 2X6VA 1AGBA 4Z77B 1FJ1B 3TBSA 2WVTA 3JTBA 1G6RL 1KB3A 3ULSA 3TP4A 5FO9A 5C8JB 2FT6A 2FJFA 4LCYB 1R24B 4QRPD 2AEPH 4FQHB 4UV4H 2DEWX 1U30A 5EF2A 2SEBA 1YUHA 4Y4FB 2A6DB 3RJQB 2OMYB 3PDDA 3VDCA 3G5VB 5TH2B 3RWDA 4WWOA 5A43C 1T2QL 3GPEA 2B2XH 4H8WC 1T1YA 3CHSA 1RUML 1S7SA 2XIIA 5IVXB 4S1SL 4QOKE 3R06B 1QPPA 1F0LA 2Q7AA 3NPSB 2XWZA 4H88L 4PS7A 1A5FL 4HEMA 1RAMA 4YDLC 2UY7A 3MFFA 1EXHA 4E9TA 1BX2B 5DRNA 4BFOA 3AT9A 1SLVA 3CVBA 4YHZL 3MNVA 2CE6A 4NLAA 4X6CE 1IEAB 1D5BA 4IIQB 4UYQA 5ECGA 2CIIB 3HNTL 3IPBA 2CLRA 4K3DH 2OI9C 1PTZA 1WPCA 1K4CB 4YBLC 1S9WB 1J0KA 2GJZB 4F5CA 1LK3L 5KTEH 2F58H 3T0BA 5BV7B 1FFNB 2UVEA 4XODA 4NQEE 1EJFA 3BIKB 3G08B 2BC4B 2VDML 4PJIE 4XPBL 1GGCH 1UOLA 2NNRA 1JMXA 1UUNA 3H54A 1BQ5A 1DVSA 4HS8L 4EJ1C 4UDTA 2R8SL 2FX8H 5DLLA 4G9FB 4RIRA 2XTJD 3HG2A 4YHIA 4FQ2H 5G4NA 5EN2A 5DD6B 1TT6A 3L3JB 2R0KL 5K9OA 2PYEB 3IE9A 1TR7A 1RJZA 1FFQA 2PO6C 1GOHA 2V8MA 3A22A 3B56A 4R4NC 4ZSOE 5IBLC 5CCGE 4XMKL 3U4EB 4P2QB 1M6OB 1S78D 4ORGA 4XCCL 2JTDA 4K5PA 1KCBA 4H8QA 4MQ7A 4DP1X 4FEIA 2RH0A 4N8VB 1OT1A 2APSA 3BPOC 2Q3XA 1MXDA 3HIZA 1UYWH 4NO3B 3WKMH 3QDGB 5SWQB 3C5ZB 4Q9BA 1LWHA 4I7ZC 3FTWA 3P54A 5E94B 4G43A 1W8OA 5SV3A 3MI6A 1OOWA 3VGEA 1AD0B 4WUKH 3VCLB 2WINA 1JPEA 1U8CB 2DQEL 5FK9B 3PHOA 4BFRA 4ZFOL 4JN1L 2V2WA 1EVUA 1CDCA 4UNTA 4QJ5B 1KN2H 4AEIL 5GRVL 3J07A 1N8ZA 3F6JA 3MUZ1 4IRZH 3TTYA 4B6ZA 4QRTA 4BZ1H 3ZOAA 3BJLA 3C8KB 3FU0A 1JSYA 3D12B 4EAEA 5C1MB 1YUKB 3C5XA 3IPEA 4KXDA 3V0VA 1H6FA 2OMVA 2BVQA 5L8JB 3NCCB 1CICA 1JUFB 4ES9A 2AXFB 5LCVH 1J5CA 3E7JA 4GG6F 1G84A 5HHOE 1B90A 1UZ6E 1IL1A 1ZCRA 3JV5A 1E9QA 5I8CA 3GINA 2ZAIA 3F7YA 5IQ7L 4Y9EA 4BFKA 2F9BT 1C5CH 1QEWB 1ZHKB 2F54B 1B9ZA 4XC1H 4JRWA 4DAGL 2EABA 5D2NA 3QPKA 2EVHA 5HDBB 2NW2B 4K9EC 4IQHA 4HPOL 1AP2A 4BK4A 1N64L 4JUTA 3SEPA 2HT3D 3GLAA 4Q74A 2F74A 3RPIB 3P73B 1FV1A 3QUZD 3MODH 4F27A 1YDPB 2F53E 1KXHA 3C87A 3OQ3B 1AHWC 2QADD 3DMMC 1X9UA 3WEXB 1YY9D 4MDJA 5D1ZB 5E0QA 1DVFA 2XZQH 4DUVA 4BSWB 4PWEA 2HN7B 4XC3L 1L0PA 4JE0A 1ZJAA 4HHAB 3SDXB 5I8KH 1P4LA 1NAMH 4K8RH 4FHBD 4XP5H 5D6CB 5AB9A 3RURA 5KBKA 5BRZE 1I7TB 1AD9B 3NABL 1F58L 2ZUTA 4NC1E 3KS0H 4PRHE 4UILH 4CVWA 4KDTA 1NFIA 1YEGL 5IW3A 3MBWA 4OCXL 3FQWA 2NUPB 3FQTA 2XG5A 4PY8I 5DJYB 1KT2A 4Z7WE 2PW2B 5EZIL 2BNUA 3Q8BA 3NAAL 2DM2A 3LPPA 1MRDL 5F9OL 4KNQA 1C5DB 2A9AA 2APWA 2Q10A 3D39B 4ONGH 1A25A 4A2EA 2OSLA 4K7FB 5E8PB 1WITA 4A67A 3JWOL 4GSXA 1SYVA 4IKJA 4MMXC 3BZEB 1ILUA 1G7IA 1MVYA 4MX7B 2FLBT 3FQNB 1PZDA 4PJEF 3IKCB 1MAMH 3EYQC 1EAPA 4NRZA 1P7QA 3D4GA 3LZPA 4EDXA 1QRNE 5LVEA 4AG4H 4P4KD 4RX4D 5GGRY 3RWJA 5J6GB 2E6QA 4N9OB 2ZYSA 3MA7B 4PREA 4C56B 4ZMAT 1KGWA 1WZAA 1UXSB 4DZ8A 2BVUA 3FFDA 2R23B 4P0DA 1A3LL 3S3DB 1I1AB 1MCQA 3KXFB 4TULL 4Z7VB 3RAJH 4G3YH 4A7GF 4LZHA 4WKZA 5KYXA 1IO4C 4BIKA 1BAFL 4N0UB 1CFTA 1PFCA 1GGIH 2IXQB 4LT7A 4WHYG 1EDYA 1UM6L 4PP2B 3UPRA 3IFNH 4YFLI 5A3ID 1JGLH 3RKDD 4HUKB 4GBXD 4Z8FH 5CHNB 3KHOA 1LP9F 1HXMA 4UQ9A 3IAPA 3HE7C 2C9QA 1N2RB 3MAWA 5EU6E 3BSZH 3N1MC 4PY8J 3NRFA 4NZTL 1QZ1A 3O45B 1T0MB 1J8HA 1W0YT 1FYTA 5EZLB 5DS2A 1S9VB 5BV7H 3O6LL 2DMGA 5CJQL 2B1HH 2HT2D 4P04A 1ZHBB 1WBZB 1ZWIA 3KNBB 1LJMA 1KXTB 1IU1A 3JVGA 4RDBA 4NO2B 3VRLF 1TQCB 4DP5X 4KZDH 3EO0B 1DQML 2BCKB 1OTTD 2X38A 1YEDA 1GVIA 3P4OB 2YMTA 4DQOH 5LWYH 4Q58C 2E7LC 1XWVA 1A0QH 4I3GA 5I1GL 4ZFFA 5C7XH 5IIEA 3NGBC 1N18A 2CA3A 1HSAB 3OMZA 5MEPB 4K23H 3ARBD 1UM4L 3AW5A 5EU4B 3TO4C 2K6YA 2HFGL 2N4IA 3IGUA 2WXHA 3VM7A 4FA7B 1TJMA 2E86A 2LFGA 3ZZ1A 4NQTA 3I3BA 3EGDB 5DJCA 1XIWB 1RUPH 4R6UA 4GRLA 2YAHA 4BHUI 3ABZA 5I30L 3OKLB 1H19A 2JKIS 1T6VN 1IC7L 2G75B 2OQJA 2R59A 4NNXA 4KKBC 5EOTA 2WNWA 2LVEA 4LBAA 3TF7C 3HG1B 4AQ8A 2VIRA 5FUCC 1L9RA 3VFTA 3ZE2B 4NRXB 3ZKNC 2NY3C 2CO6B 3F01A 3ISRA 5J3HC 1S2EA 1DL7L 4GXFA 2O5ZL 2H5UA 5CJOL 2VL5B 5GHWL 4AUJA 2YSSB 1IBBA 4TPRH 3PYCA 1I3GH 2ZOLB 1V10A 1QI4A 4BWUA 4LCIH 3SGEH 4PS4H 3MCKA 3M17B 2H6OA 2XXCB 2ZOOA 4IBWA 2HH0L 3PWPA 3HC3L 2Q86A 2QQKH 1I8MB 3QT2A 3WTTA 4XVSL 1PZAA 1NEZA 3K74B 2ODHA 5AOJA 2NY1D 3OMNB 5I1HL 1WAPA 2CALA 2MHAA 5HD8D 4RRPG 1YY8A 3FS9A 5F7MC 4DUWA 2NT1A 3G6JB 1X5LA 4GKZA 3ULVD 1RU9H 1JNHA 5ES4B 4CMHC 1KCVL 1OF2B 2Z7UA 4G9DA 4G80A 1AGCB 2IANE 3AU1B 3PJNA 2OJZH 1G7PB 3MTXA 4P59L 5ACMA 4P5SA 3IMRA 5E1QA 1CR9L 4I18B 5IT2H 5BVPL 2EKJA 1WA2X 3MJ8A 3MLXH 3APFA 4JHAL 1MCIA 2A5UA 1E43A 3SGKA 1OHZA 3D4CA 1WBXB 3FT0A 3P11L 4JZJC 5L2KE 4X6BA 5D1QB 4L9DA 1Y07A 1G4MA 3KDPB 4R9HA 1OAXL 3LN5A 4K8RC 4KRNA 3U1SH 4WFEE 1UD6A 5DUBA 3OXSA 3TU6A 1MELA 3RFZC 3RI5K 3NFSH 4D7BA 3EOAA 1OARH 2WANA 2AJXH 2O61B 1FL5B 1M4KA 3FO1B 4ALAH 4H7VA 4R90L 3W11C 1CFBA 4KTDL 5B8CB 3FCTA 4U0QB 3VQ2C 3QUXA 3R4RA 1A22B 2P5WD 4RGOL 5I75B 1R3JB 3AACA 1ECZA 1U8OB 1WE5A 1GMEA 1H15B 1DBJH 4N2IA 4MQTB 3CFBB 3RWCA 2ESVE 1OD7A 5ADOL 4B9ZA 1FWXA 2ZYHA 3O3EA 1TTRA 4Z78A 4MQXD 3FFCA 4GSRA 2QKIA 2R4RH 2Z1KA 4I4WA 3SPGA 2XWTB 3AWFA 2A6IA 3OTTA 3V52H 1KJ2H 1KB5L 2D03H 4CADA 4H0IA 4LK4A 4PGCA 4LQFH 3BE1L 1KTJA 4AGNA 4K7PL 4M7KH 3VAEA 1INEH 4C54A 4OCWH 1KJMA 4HH9B 5AYUL 5KSAD 3ZXAC 1L4IA 2DQ6A 4E9QA 4B53A 4FQXB 1S46A 3S3PA 1JHLL 4ICXA 1AOZA 3K8KA 1VFAB 3LKOB 1P2CA 2ZONA 3OKEB 4N86A 4GJTB 2GHZA 4XBEL 3I75B 1YEIL 1TQSA 1E5ZA 2VUYA 3RNKA 3PABB 3P0VL 1FYTD 5CJ8A 4XCFL 3N6YA 1ET7A 1MI5D 3VH8A 2H9GB 5EBGA 1AS8A 5C3TA 5ACZA 3RUGF 2DWEB 3OR7B 2BERA 3BKML 4YSRA 4URTB 4POZC 1HN1A 2J20A 3OG6B 3S35L 5H94B 1JXGA 1ORSA 2C9XA 1CC3A 3FPYA 3OLIA 4UMGA 4XXDB 4IIQC 2DQFB 1BA9A 1H9DA 3PGFL 4X80L 2DD8H 1F3DH 1Q9WA 1ADQA 4ABVA 1V55B 5J6SA 3QCVL 5BV7C 4L37B 2AJSH 4RFNB 1DO5A 1BZOA 2VR4A 5E00A 4QR7A 4JGUA 2OXHB 1IBHA 3WN5A 4LSDA 5E24E 4HK0B 1SJEA 2Q6WB 4UNIA 3T8XB 1OB0A 1EFXD 3T3MF 2EDYA 2BO0A 4TNFA 1E9PA 3GXDA 2R29H 4ELDA 2J8UF 5ECJE 3BAEH 3MXWL 4U1KA 1J9RA 1F90H 4PJHE 4WFFD 3CV5A 1FNSL 5HHPB 3K2UH 3QHFH 2YJQA 4B7IA 1MJ8L 2VUKA 1JPSL 3KJ4B 3B8SA 2HPTA 1AGFB 2EH7L 3KCWA 4EI5C 1G87A 5I5MA 4RMWA 3VYNA 2VJ8A 5CBEB 2AJYH 4TYUA 1XGUB 3U79A 3SGJC 3G04B 2JTYA 1YECH 5TDNB 4OI9A 3RKPA 4YSEA 3PQYA 4XPAH 4OZGB 2C3WA 3KYMA 5TD4A 1Q72L 4KMTL 1FZOA 3FQ4A 4LVOB 5I6KA 3ZUNC 4MJID 5LBSL 3TZVD 2VLJB 1J0JA 2EDDA 2V7HB 1OZTG 2WCPA 1LM8V 4MD5A 4X5LA 1BZ7B 1IGJA 5D7SH 3CVHB 5CS7A 1QASA 4OCMC 3ZO9A 1A1NB 1DBML 15C8H 1T5WA 1YNTB 3VXNB 3BMVA 3MRQB 4IMKC 1P9MA 3GPSA 1OHQA 4ELMB 1XSIA 2WXNA 1KEMH 3D48R 5GS2H 5GRYA 1KGJA 4L8DA 2QHRL 2EXWD 1Z3GH 1AY1H 1JPGB 2GBTA 3TEWA 4XXWA 7CGTA 5I15H 5EFIA 1WHOA 4M1GL 4M56A 1RKRA 3QO0B 1AZRA 2EEDA 4PJDE 1JDAA 3J7HA 5JYLA 3N1GC 2JQAA 4HKXB 4XNAA 5FUOL 5TGBA 4IJTA 1UH2A 3S4SA 2VN4A 2CBTA 4LU5L 4RCAA 4C55A 3KWVA 2WTPA 4ZDHA 1B88A 2EICA 2A3TA 2HLAA 4YK4C 4JFDB 1NEPA 1TYRA 3BP4B 3CC1A 3TCTA 2PNDA 2QZQA 3C5JA 3BUQA 4N5EC 4NQDD 4XP9L 3LKNA 4FKEA 4R0LC 4OB5H 3V0GA 1K4DA 1T4KA 3SOTA 1HYSD 2VDNH 4KJPD 5FO2A 6PCYA 4WVRA 1D2PA 5SWZE 1LE9A 4EI6A 4GG6A 4R97C 4HCGA 1EXUA 3FSAA 3KLHC 2EVGA 4WI7A 3B2VH 2XA8H 3VACA 1Q0XL 5KG9A 3W9DA 1ECYA 2J5WA 5JZ7D 2PXYC 1WT5C 4ALAC 2LE9A 4YL9A 3NSDA 5KSBB 4OLXH 2TRHA 2Q7NA 5FOBB 2AK1L 4EE2A 2FHCA 2L8AA 1EUUA 3K5RA 4ZS7L 3HS8A 3LZFH 3KVQA 1D5MB 3D2UD 2WCGA 5BNXD 4XVUD 1JOIA 2P49B 4GW1B 5DQJA 5IOKA 1R3LA 1W15A 4JRYA 5ABDE 2ZAHA 3BRDA 4GMSH 4JDVA 2LU4A 4HIHA 1BVKA 1FFPB 3GTTA 3FFOA 1PL3A 1KELH 1RK7A 5KUMA 4OD1L 2AC0A 3C6LD 4NO5B 3BVNB 2OL3B 1PNDA 3M1BA 3TS8A 1JK8B 4DUXA 2DWDA 2BIQA 4MA8L 2O6EA 2QJDA 5ITBH 2Y07H 1FLRL 1KN4H 1P7BA 3UJTL 5C86A 4BA0A 1U3NA 5T1KD 4Y16C 5TPWL 1WGOA 1CWVA 1MCPH 2EXTA 5J13C 4Z0XA 1DJHA 2EVJA 4CC1A 2WBJC 2XN9E 3FQUA 5C09B 4ANKA 4F7EA 3EYVB 4Z7NE 5F9DC 2VZTA 1RZQA 2NZ9D 5HHVL 2BVTA 5J89A 2Y2TA 4OD3H 4Y2NA 3QI9B 3CSYA 4HCRH 3GSRB 1LO2H 25C8H 1LEIA 1G7LB 5JXAL 3F8UB 4L3AA 2HJKA 5AW3B 4MSWB 4KPHL 4PWIA 4LLDA 3R8BB 3L3GB 1F13A 4FYRA 4HT1H 4N9GB 3ELAT 4GSDH 3M6DA 4EN3D 2GIMA 5KAQF 2QGDA 4LB8A 5KYWB 3QIBB 1J1XL 4K3JH 4S1RL 3BISA 4AYGA 3IMVA 4J23A 1CDUA 4QJ4B 4A52A 2CK2A 2W0FB 3MRDB 3QIWD 4JDEB 4UDUB 1BCIA 5I1DB 1THCA 3CFEB 4JCWA 3F12B 3VG0L 1OTSD 1PCXA 5SWSE 4R26L 4W9CC 5AL0A 3WAJA 4JFXB 4IHOA 5E4AA 4PJ5D 2BNRB 4ZQKB 3UYRH 4P23B 2MOGA 3PQYD 4GRMA 2HFFB 2HT4C 3FDWA 1IUZA 3WGUB 2HVJA 1M2OA 2WYTA 3VTMA 3FMGH 3IMSA 4AEEA 3KJ6L 3X3FH 1DTUA 4CNIB 2YRPA 1BXAA 5D9SA 5IB3A 5HI3C 4G8FB 4HQQL 3O41A 5DVLA 4JCLA 3UZEA 4IOSA 3GZKA 4LOUC 5DJAA 4ENED 5C71A 1FZJB 4GQRA 1UXWB 2CK0L 3HBPA 4GP5B 3T0EB 3WLBB 5D7IE 1QABA 5AUMA 4KFZC 4TLUA 5ABAA 1LE5A 1GL4B 4PJXE 3WFEH 3B5TA 1OM3L 3L3HB 5D2LF 3ZE0B 1BXXA 3IETB 1NBZB 1SEQL 1OAYH 2J21A 2ZYIA 3LAFA 5FAAA 5DTFA 2WXMA 3EDEA 4HWBH 4AM0B 3L2LA 5IHHA 1G6RB 3NFNA 3ZBMA 1RHHB 2AK4A 2FGWH 1Y7VA 2OR9L 2IFFL 2WQVA 4PLKD 5KYUB 1AG6A 1CCZA 3TN0C 3DGCR 5CNHA 5EV7A 3MYZA 2ZF9A 3STZA 3VI4E 5H37H 4Y4KA 4HJJH 4HJSA 1QHQA 1ZGLM 4U1NA 1IQWL 2CKBA 1DQDL 4QI3A 4O5LL 4U6YB 5E99H 3V6FB 1JXKA 2VLKE 2J55A 4AQAA 4X8GA 2OX5A 2KH2B 2V33A 4XPGH 4M1CD 4P9HH 2FT7A 3UTZB 2A9DA 3PP4L 5KOMC 1F42A 5KSVB 5IVZB 3B9KA 3DPBB 3AREC 1CE1H 4F20A 1ANUA 5BMFL 4HGMA 4PPTA 4KV5F 4GINA 3WTSA 5KWYC 4LQ1A 3MACH 5CSZA 5A6IA 1NCIA 3OHXB 5E8OB 1HHIA 4JRXD 1MDTA 4N2BA 1OCOB 3SDDA 4TVPH 3U36A 1C16B 3TVMB 3EBGA 4OQTA 4JRLA 4HYTB 1S7RA 1WC7B 4MJ4A 4ONFH 3LQAL 4Z7AA 1GIGL 5E6YA 2VXUL 4KQ3L 2VDMB 3OJDA 4JY5H 1GHFL 4MD0B 1J0IA 4OI7A 1MDAA 5DJ8B 2NLJB 4RGNE 3SIKA 2NYKA 4W9HC 4NN7C 2VOTA 2XTSA 5E9DA 2HP4A 5GZND 5EOQH 4NUPA 3FU3A 1WF5A 1RJYB 1PSKH 1TFHA 3LNDA 5FA3B 1D7FA 4KTEL 2F18A 4RWYH 4W9EC 2BW5A 4F9LC 3CE1A 1SY6A 4LLYA 3BEVA 3MXVH 2BIOA 2Y5EA 3KBEA 4U05A 4DN4H 5B8CC 2NTFA 1MW2A 2NXYB 4N90D 3P0GB 4PJIA 1XBDA 4HJ0D 4FP8L 3ILDA 4HIEA 4QRRE 4UUJA 3HNSH 3VI3E 3QJFB 2EE0A 3CQFA 2A1WL 2YPLB 3LMJL 4U2YA 3NA9L 1SXNA 3EDKA 4HIJA 2HKFL 4MXWH 4X9IA 3TBWB 3MLVH 2C9PA 3OPZH 4EOWH 1NDTA 1PVHA 3IYLW 3KAAA 3LSOA 3CFTA 1FFOB 2QEJA 1SDYA 1QNZL 4FQIL 1WCBB 3X1NA 5TE7H 5C3LD 5GS1C 2BOBA 3O2DA 3QWQB 3KBFA 4NQCE 5D1XB 2D3JA 5DHMC 1F00I 3WO4C 3ZKXB 3DOIA 3II1A 3R7QA 2YUZA 1J0ZA 1DUYB 2DM4A 3ARGA 4YDZA 5ANHA 3UDWC 3RZCA 3C2AH 2AGJL 3WNMA 5TJWK 1C12A 3MV8A 3ABKB 3ARDC 5IV2A 3ZZSA 4AKOA 1A6ZB 3FQRB 2DV6A 1KPVB 4HKZA 4NN6B 5GJTH 1NCCL 3RA7L 5AVRB 3ZL2A 3MRRA 4HPHA 2PWGA 2PUQT 1ETJA 1HH6A 5CCJA 1GZHC 2JIXB 1F1DA 4PRAA 4O02B 4HK3J 4N2DA 4MNHB 4X4YA 1KCRL 2E8ZA 1KGUA 4L3ED 3NIDF 1HHHB 4HC1H 1CLCA 3AJ7A 4XP6H 2MOQA 4MVBD 3TEXA 2IOMA 2YBRA 3H9YA 4NQVB 1NIAA 1WCQA 3V4UH 5ID1A 2EQDA 2HX8A 3D85D 4K73A 4OSUH 5F7FA 2V3EA 4U1HA 4M8RA 3O4LB 4U6XA 1QSFB 1LHZA 3UC2A 3MV7D 4Y5XC 3GXFA 3TCXA 4Z0BH 5D7JC 1IM3D 4Y4HD 4FHKA 4DFHA 4N8CL 3D51A 1IE5A 3ZTEA 3JWNG 2Y6SD 3POHA 3OV6A 2EINB 2ICEB 4HIIA 4Y5VB 5EC2A 2WZ6A 2CJ3A 3G7TA 5DD3H 3UEZA 1AE6H 1RULH 2ZCKH 2AJVH 5A2BA 2BFGA 3WY1A 3KJ4C 4LKXB 5J06A 5F2FA 4WJ5A 1BWMA 2E75C 3D6GA 4GS7B 4BKLA 2ZWNA 3Q3GB 3QJRB 2O6CA 4ZW8A 5B7FA 1W8NA 4BFBD 4LGPB 3BLBA 2FB4L 1SXCA 3B43A 5E1IA 3GXPA 4ZT1A 2IDQA 3EJUA 3U82B 2CHZA 2P52A 5BRZA 3LD8C 4N2FA 5L6YH 5CP7A 1BFOA 1WFNA 5B21A 1Y7MA 1MXGA 5FOJA 2X1OA 2YARA 1D3CA 1G6RH 4M7LT 3WELA 5LKNA 1P7KA 2PW1B 2R39A 4PYGA 4ZFGL 5F7UA 1F6LL 1SMDA 1SJVA 2VO5A 3F7LA 3D0VB 4WEBL 2OZ4A 1KWGA 2A38A 4TLKA 3SDDD 1MCCA 4L9LC 3S37H 3RU8L 1V7NL 3WFCH 3EH3B 3SKNB 1MWAA 5A2CA 1MN4A 5LHDA 1T2QH 3B3IA 3H9HA 3NH7L 1A9VA 4P9HC 2BP5M 1IAKA 1NDGA 1RUMH 1FL6B 4NM8L 3FBQA 2GJRA 3O11B 4U3CA 3DV4A 2X1XR 3ZQWA 1A5FH 2ENSA 3UGXA 4BE6A 3AXLB 1NPUA 1QRNA 5CWSA 5CU9A 1AVAA 5BZDB 2CUAA 4YHZH 5IW6A 2OJEB 3QWNA 1D5XB 2CIKB 1NSNL 4XBPA 3A23A 3NRPA 2GTWA 2NX5B 1E2VA 4YFEA 3ZHFA 1MW3A 2HG5B 3C60D 4P3DA 1BQHB 3BQUC 1LK3H 3AM8A 4KRPD 3NEOA 4M43L 4JL1A 5FFLA 3DTXA 4BRVA 4H2AA 3FB7B 3MYJB 1T66D 4RAVA 5C07B 2APXA 2BSBA 1AGDB 1H3TA 3HB3D 2NY2D 2XTLA 4I5BA 2O1AA 1DVYA 1NJ9A 1WZKA 4AVIA 2RA1A 2QVTA 3A6OA 5EU6A 2R56L 1QNIA 1MEXL 5HGDA 4Q9QH 2X89D 1CVRA 1IKFL 1DLHA 4OCNC 3SE9H 4PLNC 2HXAA 4XMKH 1NAKL 5T5NG 2J71A 1QTSA 5IM7A 1S3KL 5B1JA 2JJVA 4PJCB 4K3HA 4AQEB 4M6ML 1T7WA 3IGFA 2F15A 2XWXA 4DKFL 3WEOA 4ZW5A 5FKPB 4GIPD 3PWJB 2HVKB 3D06A 3MV8D 2FEEL 5GRVK 1JF5A 2ARWA 5HYJB 4KUZL 2O5YL 3LZLA 3CDGA 3BUYA 1J9QA 1U95A 3AU0A 2DQEH 4JJOA 1N26A 2VDOB 3KG5A 1TNNA 4JN1H 4M62L 4YDNA 4N2OA 5FW8A 4GEJA 4F7KA 4AEIH 3DC0A 1XGPA 3NJKA 1Q9OB 5I8EA 2W94A 3LKRB 1H3UA 1N10A 1PLGH 2C9UA 5FYLD 3BKCL 3C9NA 4OLZL 1QUNB 1A6WL 3FT2A 3PCYA 1NM9A 3VQMA 3OMAB 5AG8A 3LNGA 1KBWA 3VDBA 4X6EB 3IGAA 4H0GA 2CUIA 3IT8D 3CMOL 5LQBH 3O2VL 3PJLA 5A2FA 3KVDD 5DU7A 1R3HA 3WYRA 1L9MA 4UTBA 1XB6A 5EUOE 1UCBL 1XGYL 2I25N 4MS6A 3S96A 3QUGA 1BF5A 4W9DC 4PB0L 2HFEB 4ZK8A 5IQ7H 1Z0NA 4L0ZA 5HDWA 4DAGH 4LASL 1LQBC 1HL9A 4HPOH 3L4WA 3D30A 1PYWB 2ORBL 2E27H 4EZKA 2IPUK 1N64H 2EACA 2FL5B 3US1A 2CR0A 1VAHA 3QIUA 5T1MA 3CBJB 3IJ8A 3DBXA 1E27A 3V6ZA 2HUHA 4NKDA 1BLNA 4QHLA 4DGYL 1F4YL 1C8PA 3GMNA 2COQA 1U3HB 4HLZG 2NZIA 1ND0B 3QPQC 1TFPA 1I75A 3VXMB 3SDAA 2WY3B 3O9WC 1PZ5B 3FAXA 4NI3A 2P42B 1TJHL 2IANA 2I69A 3KPMB 4AQ1B 5IKCB 3THMH 2VISB 3OAYK 4WWKB 1I8LC 3RTQB 2FD6L 4FJZA 4KK8C 3T0XA 2DZEA 3SDCB 1WIPA 1ETZB 3VNYA 5BS0D 1HZHL 2BWQA 1QA9B 2D7TH 1P6WA 3G5YB 4B9GA 5EEUA 1I8IB 2D73A 1YEGH 1ZT1B 1EX0A 3AY4A 4PV8B 1M7XA 2X87A 4LHUD 3T0EC 3OAYH 3DPDA 3UG5A 4XN4A 3DO7B 2A74B 5DVKA 3MCYA 3BP7B 3E6HB 3G5WA 2VM3A 3NAAH 5F9OH 2WO3B 5DZ9A 3S5ZA 3VSVA 2IWEA 4WUUE 2FJSA 3BSGA 3PWLB 3RIAF 1EEZB 2ED8A 5F70A 3WE1A 5D7KD 2C5DC 4WO4C 2NYYD 1KB5B 1YYML 2X41A 8FABB 4RDQF 3NBNA 4AL8L 4PJFF 1F97A 1W0WA 5IEHA 1A6AB 4CU7A 1V3KA 1AFVL 4FNTA 4NNPL 3U25A 4AGQA 3VXTA 5JIIA 2RIKA 2J6EL 3QGVA 2QMJA 5KEZA 1IGCH 4TM9A 4YPGB 3VNZA 3O6KL 2X4UA 5DCCA 5IB4A 4LMQI 3CPUA 4G9FE 2BLFA 1M2VA 1A3LH 5D2LA 4AV4A 4WW2B 4JBSA 1B4JH 3TCLB 5KVEL 4TULH 2GW5A 1FZMB 2XACC 4TNWK 1BAFH 1M7DA 5TDPB 1T03L 3QAZC 1UM6H 2CRIA 3F7PC 1P1ZB 2Q2EB 5AKSA 3LKSA 4YC2B 4FQJH 4H13C 2YAPA 4H8PA 3O6FB 1QBLL 3V0DA 3WMSA 5TF1H 2H32H 1MFDH 1TVBB 3LRKA 2YD4A 4JFFA 1SN5A 3BCDA 2EDWA 3GHEL 4Z7UF 1LL1A 2H0FA 3DROB 3GXTA 5E2UL 4AQZA 5GGTA 2ATPA 1SYSB 3O6LH 1FQ9C 2WHVA 4MMZA 5GGRA 5IB5A 2VLRD 4HSCX 3P9WB 1HQ4A 3NJXA 3RVTD 5D5MF 3Q8CA 3QZWB 2VZSA 2G0LA 3CIAA 1ZEAL 1PX8A 3KM1A 2GY7B 5DUML 3QFJE 1DQMH 1XZ0A 3FT3B 3GXUB 3K72B 3LS4L 4D9QD 1O6SB 3W5NA 1KPRA 1YJDL 3LXCA 4DWHA 1JE6A 2C1OB 4X2UA 4QRPB 5F1NA 1UM4H 3HRZA 1CQYA 5EOCH 2HFGH 2HTLC 3MBED 4WI3A 3VWKD 4KI5C 3M8OL 5B3SB 1TJXA 2KZ1B 4L4VD 2AJUH 2CHDA 2VR7A 1OLZA 4XOEA 3EFOB 5C3IA 1JBJA 3EGXB 2DWYA 5DK2B 1GMIA 4JQIA 1E3FA 1T1WB 2VZOA 4PIRF 4Y88A 3S36X 2NNAB 4KK5D 3QJHA 5DR5L 1Q8MA 5I1IH 1GZQA 2DYSB 2NZ1A 4XWOD 1Z9LA 5D7LA 1XCQB 1P5VB 2IPKA 5HDBE 2FJHA 3V6OE 3CZSA 3DXAD 3EF7A 3WDHA 1DANT 2YLHA 3TJHD 5GHWH 2FQGA 3QDMA 2WBKA 4PG9B 3FOLB 4QF1B 3Q9QA 3R4DA 3HZVA 3RX7A 1MLCB 1CD9B 4QHPA 4XOCA 4GIAA 5AW4B 3IDXL 4H0HB 3U9UA 2MOVA 2HH0H 3GMLB 2AMGA 1WRFA 2ZQKA 1XF3A 4PGBA 1CURA 4NT6A 3WLWD 5CP3H 3T77A 4J8RB 1N68A 4XVSH 2XFXB 1QFHA 3SDXE 3CLEL 3KHQA 5HDOA 4TL5A 4Z3TA 4L4JA 3FNKA 4JM2F 3WNPA 5C9JB 2XTJB 4F7CA 5CLXA 4PJBA 4ZS6C 4OV5B 3ZGIA 4JANB 2QPUA 4LSQL 4JFOA 3L8QA 1MOEA 5HGHB 1B0GB 2R0LH 4ZYKB 1KCVH 3GEWB 5HYSA 5JIQA 4D8PB 2CM6A 3QEQD 1N0XL 4P59H 2VR8A 1CR9H 1XGRA 4N2MA 3REVA 2ODIA 1A4JB 1GW0A 3FU7B 3ZY7A 5F1IA 2DQCL 3HS0C 4U7SA 2XYBA 4PJ8A 5FO8A 4JHAH 4U1LB 3S36L 1OE3A 3KWXA 4QTIL 1SDDA 2BSTA 3P11H 5I2IA 1UWGH 4X6FB 4KKPA 4JQXA 3K4DA 1AGEB 2RMNA 5A7BA 4X7TA 1BVZA 4W9LC 1OAXH 1AAJA 2P45B 2Y7LA 5C0GA 3UTPE 5IJDC 4MCNA 2P5EA 5DHVB 5F3BB 1U4FA 1CF8H 1GCYA 1QWUA 4UQEA 3K5SA 3SBPA 3ZE1F 3C08H 4MRBA 2NYZA 2Z91A 1ZV9A 4OT1L 2EDTA 3SKMB 1WFJA 4KTDH 4XMTA 4N3TA 2AQPA 4TLSA 3K6IA 3BO8A 1JTPA 4RGOH 5E8NB 3Q6GL 4MAYC 1MCRA 3LRLA 1WFMA 2Z31A 4L8SB 5CZXD 1MPAL 1FCGA 2ZP9A 4D94A 4N0UE 3CH8A 3VGBA 1CG9B 2X2YA 3FTZA 2ZPKL 1GZPB 4JHUA 4TSBL 1SVZA 4TTDD 4IRSB 5AWNH 1L7TL 4P5TD 4IRJA 4HOWA 5JPNB 6TAAA 4D0CA 4HUMB 3TIDA 2WV3A 2YOAA 3EDFA 4EPSA 1IGFL 2DQGL 4HEPA 4CILA 2EDNA 5AYUH 5E8DL 3KLLA 2NY4D 2AZAA 3ZDYF 4LSVH 5A2IH 3LDBC 1ZIBA 3DO4A 3QUZB 2X4PB 5IQ9B 3CX2A 3LCYA 4QNPE 1I9RL 3DBSA 4XBEH 5T1DH 1ADWA 2FO4A 2I24N 2QADB 3IJHB 2AXGB 2R2HA 3P0VH 4XCFH 3K2MC 5F72S 3WFBL 4O2FA 4RGNC 1BSIA 3FO0L 2FDBP 1XCTA 4GRWH 3H2WA 3W38A 3I6LD 3MKKA 2V2TA 2ZG1A 4GB9A 5ETUB 2BNQE 2Y25A 3BKMH 3LH2H 2C4XA 4OLWL 3KW7A 1NBQA 1S9XB 2APVA 3DHPA 3FZUC 4NN5B 4RMTA 4ZOCA 2E9GA 4I77L 2HX9A 1J8KA 2JKLA 4KC3B 2PR4L 5J9PA 5BW7A 4Y9GA 4NRYA 1X5GA 2PP9A 2XX0A 2XN9A 3PGFH 4V1DE 4X80H 3UACA 4JG1L 5HVFB 5AW8B 2J1YA 2DLTA 1KLFB 1N3NB 2BY0A 2ZXAA 2IFGA 3GIVA 3UAFA 3P0YH 4IJ3C 2SEBB 4Y5VC 1KTDB 4WHYH 5AAMC 1D9KC 4FFYA 3RWDB 4X5RA 4B7LA 5JMOC 1X4YA 4OZHF 1E5YA 3CZUB 4QJ3B 2NQCA 3CVCA 4GKLA 3N1PC 1V7ML 3WHXA 2WGXA 2VC2B 2YK1H 4HKJA 1T1XB 1XR8A 3PL6A 4JDTL 4WCYL 1KC5L 3QSKB 5IVXF 2WXOA 3D25B 4AKQA 2OULB 1FNSH 2G5BB 4DK3A 2J44A 2XQBL 2Y7NA 5L4MA 4C57C 3S8GB 4OGZA 4KTGA 4OKVB 5E4OA 3WIIL 4M5YL 4XAKE 4ZXBD 3WJLA 2JJSC 4JKMA 1H5BC 1YYCA 4KGJA 1CXEA 4KGLA 4D0DA 4FJ6A 1GTNA 4JG5A 3TFKD 1HWWA 4XOAA 3C8DA 4DW2L 1F11A 5INCB 3FUIA 5I6MA 1M3IA 4C47A 4XI5D 5HVWA 1OOAA 1NLBL 5HYIA 4P2OC 4JHWL 4WENB 5ICYB 3KPSD 1FI8C 1TXKA 4UDTB 4BM7A 2ZSVB 2XJKA 2Z35B 2ITCB 3BIBX 4YHIB 4F33A 4GBXB 1DBMH 4Z5RA 5DJXA 3NJIA 1YN7B 1OVZA 1FG2B 3I50H 4RMRA 1L3WA 3ZTJG 2DWSA 4XMLH 5D1QE 1CGSL 3GUTB 4JFHD 4NZ8A 1EO8H 4H26B 4MRCA 2QHRH 2JJUA 3AB0C 4FXGA 2F8XC 2J12B 4WI8A 4AZ8B 1CFVL 1BOYA 4FMKA 5CD3B 4M1GH 3SPJA 3C2SA 4Y1AA 3DTUB 1S7VA 3FB8A 2PPFA 4E5XA 1R5VB 3CN1A 2FAUA 4HUUA 5FUOH 5HDLA 3UYPB 4MFHA 2WINB 3EGSA 3JUYA 3S5LA 4CGUB 5MHSE 4LU5H 1AS6A 3WHE0 3PHOB 4G7VL 2RFXA 4E9WA 5HJ3A 3F2LA 4M6OL 3ARBB 3N91A 5KBLA 2VR6A 2P28B 4G42B 1N8ZB 4B3VA 4HMDA 1GKEA 1UB5A 1UWXK 1SZNA 2IPTL 3B1UA 4Y2DC 4E41D 4OZIF 2F7PA 4JKNA 4GP4B 4LFHD 4FXKB 4QDGA 4XP9H 3UZVB 4DEUA 3EAKA 5IHUL 3RL2A 4Z6AT 1EZVX 2ED9A 1QBML 3RWIB 2PO6A 1RVFL 4PD4K 4RESB 4DP7X 2E7BA 4U6HB 4AQ1C 2D31A 3HJ0A 4XRCB 5HVHC 4WWKC 5EO1B 1UWXH 3CX5J 3MLPA 3AQYA 3GXNA 2VITB 3LH8A 3SDCC 2G60H 1FAIL 2BRRL 4ZPTA 1S7WA 3P3SA 5LBVA 2C9AA 5CBAB 5D2NB 2VKWA 1X4XA 1MHEB 1ZLVK 3LZNA 3FTXA 4XMZA 4HIPA 4U33A 1HSBB 3KLKA 4IW4C 3HI5L 4HG4J 5KANI 3NIFB 2VYRE 4L1HA 4TSAL 3VFUB 2NY1B 4GMTL 1RPQA 2H1PL 4LCWD 3MUGB 2IQAA 1ZLVH 4OD1H 3QEGH 4UI2A 2F6AA 3MV9A 1U42A 1DYZA 3IJYA 4PTTB 2DJUA 3VFVA 5KVFL 2Z7WA 4MDIB 4P4RA 4I1RA 1V3LA 3AS1A 3NOIA 3WKPA 4QRRA 3VI3A 2CU9A 1VHPA 4V11A 4WHTA 3WNKA 4APXA 1NCWL 2VW7A 3UJTH 1OAQH 2MNUA 2Y7QB 1KCUH 4LDOB 3EBAA 3PWUB 1NFIB 1IGTA 1OCWL 3BYTA 3REWA 3ILQC 3SSGA 1MFVA 2DS4A 3APMA 4GYBA 4J2XA 4KMQA 1ASOA 4LAQL 1KXVC 1NBYB 3FF8A 2VZ3A 3RI5F 1KXQA 3CDCA 4IS6A 2EIKB 4U1IA 5DRZB 4MASA 5JXAH 2QL1A 3D1MC 4WNQA 5A2AA 2KL6A 2PCPA 2VR5A 1BEYL 2QPFA 1HILB 5KYYA 4KPHH 2BMKB 3T9WA 4K4KA 1R5IA 1NMBL 4PJFA 4JFPA 1CGVA 3LIZL 4YDKL 1AHWA 1J1XH 4ZUUB 3DMMA 4NRZB 3RWGB 2FWLB 3VD9A 1WISA 4EDXB 4I0PC 2P5WB 3VSTA 1CZ8L 2CO7A 3L4TA 3EH5B 2KZWA 4OZGE 3RWEB 1P5UC 2G9KA 4LAJH 5K59F 5LGJB 3GMRA 2CGRH 3CZGA 5C0BE 1F4HA 5AZ2H 3WIHL 2XY2A 2VLJE 1A6TA 1QLEL 2DKMA 2R1XA 3KWWA 4FKHA 3SB3A 4UQAA 4YX2H 3WCYA 1F2XK 4LP5A 1SJXA 1YMHA 2WN3A 5C0CA 3ZKMD 3P1VA 4PUBH 4ZMYA 5JHDA 1ZA3B 4PSRA 4NIKB 1B3IA 5ISZA 2JJTC 1ZA6B 4XHQA 1HHKB 3EOYG 4HQQH 4Q4IA 4JFYA 5KSAB 3FONA 1AQDA 2XWJA 5CN1A 1JZGA 1JZJA 4X5QA 3QZNA 1BEXA 1YC8A 3NZ8A 4KNUA 1N67A 2CK0H 3DUUA 1EH9A 1WBYA 3X11A 3FAWA 3KPQB 4XCEA 1OM3H 5H2BA 4ZW6A 4MD4B 1FYTB 1AO7A 1T89A 1MI5B 1CYWA 1SEQH 5D5MA 4WSGA 4W81A 3GBML 3NESA 4WQOA 4EMZA 1AHKA 4ZMWA 2YD7A 2IH3A 1LMKA 2ED6A 3B8YA 1HCFX 2C1PB 1HI6A 4DP4X 3ZL4H 3JT0A 2OR9H 4JFDE 3IJEB 5FYJD 1KWKA 1B0RB 4GT7A 1OGAD 1R5WB 2D4FA 1KBBA 3MN8A 4NO0A 3J27A 5JW4M 3WTYA 4KKQA 4GNKB 2VDKL 3D5OF 4UTAA 1JF1A 1IQWH 1PY0A 3JWNE 4AYEC 4B5EA 2VZVA 2Z8SA 2DICA 4R7DB 3B7UX 1ED3A 3MRNA 4OVUA 5I19H 1OP5H 5DSCB 2X4QB 1RPKA 1RZGA 1EFXB 5J11B 4I3RL 1TKWA 3PP4H 3H3PL 1U58B 5KSBE 4R4ND 5EZJA 4DKTA 2YUVA 3GMOB 3GMMA 3HE7A 3L6FB 4NNXB 3ARWA 1Q0YH 2C34A 3CN3A 5BMFH 3CIQA 1NPJA 2VIRB 3Q43A 1T1ZB 3ARTA 3O4OB 2OTUA 1PDKB 1XTMA 4HULB 2BWIA 4JE4B 4PG2A 2X9YA 2EUXA 4WGWB 1G7HB 4FTVE 3QYCA 5DZVA 1F1AA 1VJSA 4LCCB 1HJBC 3ZE2F 1EQWA 1TENA 2VW6A 3GSNA 2YRLA 3LQAH 3BH9A 1HOCA 4O4YL 2QZ5A 1GIGH 4WEMB 2VXUH 5C7ZA 1I9JL 3ZL1A 3JWDL 4KQ3H 3PLYA 4GLRI 3HZ3A 1GHFH 2N01B 2BIIA 2YRZA 1RIHL