5LB1A

Crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with thionitrobenzoate (tnb) adduct at the active site cysteine-354
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
b'HLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Binding and processing of beta-lactam antibiotics by the transpeptidase LdtMt2 from Mycobacterium tuberculosis.
pubmed doi rcsb
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5lb1A02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lb1A01
1Y7MA 5DU7A 4A52A 3U1PA 4XVOA 3U1QA 4JMNA 5DUJA 5DZJA 5E5LA 3VAEA 4K73A 4Z7AA 5E51A 4GSQA 5D7HA 5DCCA 4LPQA 2MTZA 4GSRA 5E1GA 4A1KA 1ZATA 3TURA 4QRBA 5DZPA 4LZHA 2HKLA 5E1IA 4HU2A 4GSUA 3VYNA 3ZG4A 4A1JA 4JMXA 3ZGPA 4QR7A 5DVPA 4ZFQA 5LB1A 3TX4A 5K69A 4QTFA 3VYPA 4HUCA 3VYOA 5LBGA 4QRAA 3ZQDA 4A1IA 5DC2A
chains in the Genus database with same CATH superfamily
1YC8A 4KX7A 3AITA 4R0LC 3SCMD 1YY9D 3SZKC 1OGAA 3H1ZA 1T2QH 4G9DA 3TYFA 4ETQB 4H5SA 4OCWL 2NTSP 4NKOA 1LLAA 1XX9C 5HVFB 3EDJA 4W81A 3VWKB 2HVBA 2AK1H 1J9SA 1NBQA 3HC3H 5ID1A 3B2DC 3EZ8A 1MDTA 3D9AH 5I6XB 4XO9A 4I0PA 4DZBB 1PLBA 2Z35A 4DP5X 2X4SB 4ZAKA 3ZGPA 3KGRA 2J6EA 1JXJA 1XV8A 3D2UA 3OJMB 2X1OA 4KMTH 2FVNA 1VESA 3V55A 5AVRB 2FHCA 1PPIA 2QADD 2Y6SD 1EAPB 3WEMA 4YZWA 3O3BB 4C47A 2YEZB 3C9NB 3KYNB 3VI3E 2LU4A 3E1F1 5I1KH 1GZHC 4PJDE 1NEUA 1IQDB 2EH8L 1UJ3C 2QGEA 3IRZA 4IU3A 3RPIB 5HYJB 3D08A 2DM4A 3FHQA 4M1GL 4ZI8A 4KZDL 1IC5H 2ZUWA 1QZNA 2N7AA 3GM0A 1RZ8B 2VJXA 4BSWB 1EZSA 2C9PA 5FCUH 4JY4B 1CYGA 3SYCA 2EDWA 3D5OF 4NO3A 3BSHA 4L0ZA 1W9XA 1AY1H 5EEUA 3JYBA 1CN4A 4H40A 2EDMA 5D5MB 1WBXB 1CXEA 1Z3GH 1KCSH 1ZPLA 2MKWA 4OTXH 4C57C 5DJ0B 4DNLA 4HOMA 3MOAH 3U1PA 2AXGA 3AQZA 3MLYH 1CE1L 2HJKA 4KO9A 3B9EA 1TFPA 2LTQB 4FQXC 4FXGB 3UTZB 3KPMB 3V6BR 4ZRGA 5TK4A 5ILTH 3SE8H 2EO1A 2W65B 1VRSA 3ZGIA 1LEKA 3BMVA 1WZAA 1CFMA 2ZYSA 4NZJA 5BOZG 3HI1A 3PWJB 5LKNA 2WGXA 3PHQA 3H7BB 4I3SH 5E6IB 3TNMB 2CO1A 4PCKA 2W81C 3UAAA 2UY7B 4FNLH 5DT1L 1KDJA 3KPRE 3CSFA 5EBLA 3BGMA 4JPKH 4LVOB 1OCOB 3L81A 4F91B 2VM4A 1SJXA 1JP5A 3IU4H 3TF7C 5JTWA 1A5FL 1U8HA 4AYID 4EOWL 2WYZA 2EH7L 2XVLA 2PWFA 5E5LA 4IS6B 3HAEA 4NWUH 3T4YA 3H9SD 4IOFD 4P2OA 1KZQA 2F54E 3RVVC 1SHWA 2PCFB 3WEXB 2XWBB 2P8MB 2AXWA 1BAFL 4DKFL 4Q89A 7FABL 1GZPB 2IF7A 3Q9QA 2GI0A 3F04A 1U6AH 4R96A 3IMVA 2DLFH 5FO7B 4ABWA 2LT9A 2WBXA 1UYWH 4M1CC 4N2HA 1CLOH 1KB9K 1FF5A 2E4TA 2GBVA 4ZUVB 3JXAA 1SMOA 3UG3A 2EDOA 4K2UH 4AGNA 1BA9A 3QIBB 2ZOLB 1AO7B 3A4AA 1I7ZA 4WV1B 4OFKA 3TFBA 5CEYA 2VW4A 3KXFA 2FEEL 3QFJD 3LJ3A 1H5BA 4JO5A 1N0XL 3KCPB 4YXLL 4S10A 5D93B 1DO5A 3MLVL 1RZKC 3ZT7A 3RX7A 3D05A 4F57L 3QFJA 2QQQA 4MAYB 1ZKAA 2GCYA 4YGVB 4UT9H 3ZKSD 4L2LA 5K93A 3WE6B 4WUUB 4TQ8A 2YD9A 1UOVA 3QUXB 1F8TL 1PD0A 5D7LA 1KTDB 2CGRH 3FU9A 3CFKA 3D69B 5HHPA 2XDHA 1DSFL 2APTA 4JR9H 4X6FA 3OXRA 5DVLA 1RSFA 1S7UA 3ARED 4S0TD 1LK2B 3B83A 1JPTH 3MV7D 4O02A 3FO2A 2GQHA 4ERSL 4OZIE 5DO2C 2Z64C 5EF2A 3FTZA 2YD0A 3DOIA 3SGEH 5CJOH 3LPFA 4ATTA 3DXAA 1CICC 4N0FA 3MV7B 4TTDC 2HKFL 2F7OA 3A4EA 1C8QA 4PJ8B 3KPOA 2VXUH 3V0VB 5GSVB 5BRQA 1HI6B 5I74B 4G6AD 1V05A 3A22A 4OD1H 4JDEB 3LZQA 4OGAD 5IBTH 4BE5A 1BOYA 3QDJE 1JVOA 5H35A 3LQAL 1RZKL 1AHMA 5J1AA 3WNIA 4DUWA 3ASWA 5C0RL 3BI9X 1KYFA 3P02A 1N6UA 3MVSA 4AM0Q 3LSOA 3RIAK 2V7NB 4LLUB 1GW6A 4TV3A 5EU5B 3FJTA 3BWAA 4A39A 3NDYE 4XBEH 5HDBE 2PUQT 3S4SG 1E4KC 3B9KC 3PGDB 1M6OB 4X9GA 4D7BA 2ZXWB 4ZMXA 2VSCA 2YMXL 3CFNA 1OLZA 1IC0A 5J9PB 5D7SH 3L2MA 4ZOAA 3QQ9D 5I66A 2ZSWA 3ORJA 4G9FD 5F8QC 1XF2B 4ADIA 5JQIB 4NN7C 4CSPA 4M5SA 5EO9B 3I9IA 2VR3A 5I1LA 4UT9L 4KJYA 3IAPA 3VH8B 5HBBA 2BCMA 3EAKA 1QRNB 5D1XD 2EXWD 3UAEA 1KJ3H 1T0NB 3VSUA 4YXLH 1A65A 3FH8A 5GS1B 3FB5B 5CR8A 3JWOC 1ZT7A 1N5YH 3AB0B 1RZ7H 5IM7B 3UTSE 5L0QB 3QPKA 5D7KE 4U3CA 1UB5A 4P2CG 3U46A 4HIJA 3P3RA 4RISH 4YSTA 5BRZA 2C1OA 3Q6FB 5CSZA 3U0TB 4EUPA 3BZEB 1FP5A 3MRCA 1I8LA 4RZCA 1FVCA 4OLVL 1CLOL 1UYWL 4KHTL 3GKWH 2VO8A 4H44C 4HHAB 5FYKU 3RVXD 4X4YB 4A7GA 1AH1A 2EEFA 4GSXA 5E4AA 4H8HA 1JGEA 3GEFA 5I76B 1G9MC 4J3OG 4APQD 3FTWA 4DERA 1Z66A 4UM9A 1JF1A 1SJMA 3D0LB 3IJ7A 2B4CL 5C08A 4HUVA 1WWBX 1G6RB 4P9MH 2V2TB 5GISH 1KGJA 3K2UL 4Y4KB 2GBTA 4WGVB 4YE4H 2PW1A 5CNHA 5D7JB 3VXMD 5GJTH 4ZFGH 5FWRA 4QLRA 3H3PL 1H15B 3J07A 4Q7DA 4DP8X 15C8H 2F53D 2CA3A 3QFGA 1Z5LB 4YWGL 4NQTA 4W4OC 2W38A 3WIHA 1TJXA 5F9JA 1AQ8A 2K8MA 2W9DH 2PR9A 1U0QA 3DO4A 3H0TB 1QASA 4Y19A 5HYJD 2RMNA 3FRPB 2DQCH 4BZ2H 4HUUA 5DTFB 1MG2C 3IU3B 2B7DT 1WBZA 4PJXE 1VKXA 3ULVL 5TDPB 5I1IL 3OJVC 1YPZB 3VD5A 2X6MA 3EYQC 5CD3B 3QUZD 4P59H 1B0RB 1Z3GL 1DFBH 3VFVA 1FNSL 3C5JA 4TQPA 4XB7A 3HVNA 3BDBA 5K1JA 4PD4J 1XL6A 4LHJB 4H4NA 4DOHE 5JR1L 3HE6C 4NJ9H 1QI5A 1I1AD 3ARDC 4A63A 4Y19E 3B7TA 1EZVY 3ABKB 5CCJA 1IC5L 4ABVA 5JA8B 4KZDH 3BPNC 4F8NA 2CCWA 2ADIB 4U4BA 1MZZA 2WJ5A 1V8HA 4XZUA 3RDTC 3EO1A 2EZ0C 2XQYA 5EN2B 5HYSB 3UGEA 2YEQA 1VFAA 1I7RA 1D7BA 4WI3A 4U1IA 4LRIC 1A4KB 5EO1A 4LP5A 3NJJA 2V9QA 3FK3A 4HXAL 1RZJC 3LIZA 1G9NL 3WFCH 3GHEH 3MV9A 2R59A 1TMCB 3GPEA 4HIJB 2ADGB 4BDVB 4XMPL 1CDUA 2JKSA 5F72S 3FSOA 2E9WA 4XZUB 2ROXA 4OV6F 5CUSH 5AVQB 1VFBA 3ZR6A 1CD0A 1U8IB 2YJQA 4Q4EA 1FFPB 1OGPA 3EIFA 2CHWA 3LD8B 4XNYL 1IE5A 1PDKA 4P23B 4NSKB 1T2QL 1XTMA 4HA1A 3ZE0F 3VJ6A 1YYMH 1R3IH 1F3JB 3OLDA 4HKBA 3CSBA 2JJTC 5ALBL 4X7SL 3WIHH 4ALAC 1AXTL 4Z3EA 5HJDA 5I9QB 4N8CH 1JCKA 4K5MA 2P5WD 2P1YA 2WXLA 1VEMA 1WITA 1IC1A 3CX5K 4LRIA 3S3BB 1R4XA 1TQBB 3OC8A 5I75C 3MRPB 3SGJC 2A9AA 3PGDA 3CIAA 2ID5A 3WFEH 2D31A 5CM1A 5ETUA 2JTYA 4TSAL 3RJQB 1E43A 5KSBE 5ADOH 2J8UB 4JRXB 5B3NA 2WN3A 3ET9F 4LLUA 1NDMA 3O0LA 5J6GB 4MNGA 3OMIB 4E41A 3BZ4A 4NO2A 5LNEA 1UOLA 5JQ6L 4Y88A 4HWBA 4EDWH 2ZTBA 3KDPB 4GG6E 2WSKA 4WW2B 3O2WH 5ACLA 3IGAB 3D3VA 4N20A 4XMUA 3L6FA 3HE7D 1OTSC 3Q44A 3SPVB 3O0RH 4H25B 2N0KA 1SEBA 4L48A 3LB6D 5F9OH 1WAPA 4G9FE 2PN5A 4S2SB 3MCYA 2DQJH 5JPNB 2ARJB 3I02B 3Q13A 2P42B 3FQUA 5DJ8B 5DFAA 3L48A 2QTEA 2W9LA 3ELAT 4UQ2B 3KW8A 5AVTB 5E24E 4NUGH 4XP4L 3VO0A 3VD3A 2E9GA 5C1MB 3VSTA 5FHBH 2MOGA 1FLTX 3KLHD 1F13A 1TQSA 2CIKB 3W1ZA 4ZMWA 4HWEL 4H26B 4LIQL 3IJSB 3O3UN 4C56E 5JHBA 3FCSA 4S1QH 5CJBA 4PW3A 1E5UI 3K6FA 5BRZB 2QTVA 1J48A 1J0IA 1IQWH 1SRDA 4JHVA 1UKTA 3HRZB 3L4ZA 3RZCD 2ZUYA 4YHML 1ZTXE 2XTJD 4PRHE 5IM7A 3NDZE 5EBMB 1NWOA 3MODH 4OAWA 3DYOA 3NPZB 1XBRA 5DS8B 2OP4L 5LBSA 3FO9A 2VLRB 4NKIH 2LAGB 3FO1A 4U6XB 5AAWC 3TPUA 4B9ZA 2V5YA 3RJDA 4M5YL 1SOKA 5IVZA 4WW2C 3PGFH 2MQCA 4EDXA 4QIRA 3MJ8A 2ADFH 2UUDH 4D0DA 4MJ6B 5EZOH 5LN8A 1XR8A 3BVVA 3EBAA 3U2JA 4FXKC 1AGEB 3GF8A 3L9BA 5FC9A 4HS8H 1T1YB 1MFDL 3QI9C 3IDJB 3T1WA 2UYLA 1CICD 4Z7OF 4OU3A 4NQDA 2BIQA 2YRBA 3IDMA 4NQDD 2OSXA 1QUNB 3WN5A 1OW0C 2EQDA 3ZUNC 1CFTB 5L8LB 3TO4C 2CZNA 1PFCA 2B08A 2VXQL 1KPVB 3PPSA 5BNXD 1JYWA 3DJZA 3L7FB 2DWDB 2KUTA 3RUGB 1BCIA 1M1XA 5GPRA 4H8QA 4NZFA 2YAOA 3L54A 2V6HA 1OARH 3GMQB 4Z7AA 4OJCA 1KIRB 4NQEA 5JZ7C 4GUOA 3OPZL 3GSRB 3X3FH 4K3EL 2CDEB 1I9JL 1N8ZB 1RIHH 2R29H 5ISZE 2BXYA 4PGEA 1HL8A 4L9DA 4HOXA 1PIGA 2XV2A 5AVWB 4B3VA 1KJ2H 1JWMA 1WS7A 3MFFB 3ETBF 4TQEH 3QW9A 3VXPA 1TTAA 3H42L 3MXWL 4L9LA 3L3OA 1FGNH 4KKZA 4MA3A 4M6OL 1IKNA 3GSWB 4GPVA 4HC1H 3NJHA 5JIPA 3NCWA 4GRWF 3MTRA 3O2DL 1J8HA 2J72A 4YHYC 4PHXA 3QI9B 4B0MB 1RUQH 1G9EA 5J4MA 5KANG 2X2UA 2MPAL 3BUDA 3V8OA 2WBWB 3BQVA 3HS0C 2DMCA 3KJ4B 4U1NA 3NA9L 1NCIA 2Y36H 1ZWIB 2JTDA 1IAKA 1RZGB 4QEGA 2EDQA 2YK1H 1TQVA 2ZWKA 3DNKA 1E30A 3VXMB 1ODAA 1WS8A 5GRXG 1DVFD 4QRPA 2TSBA 4MZ2A 3K72A 1YUKB 3H4HA 3NFPA 4FD0A 5E6SB 5I8CB 3MJ8B 4F92B 4XR8C 4E41D 3IDNB 3RFZA 3MNWB 4NQSA 3B7SA 4ZW6A 4AEHL 5KVFH 3ARZA 2WZAA 3ZDZF 4XNXL 2GUYA 4BGDA 5B8CB 3FKUS 2ITCB 3HZYA 2MJWA 4O2FB 2A4ZA 1HHKA 1OAQH 4OBRA 3H53A 1XF4A 3NZHL 4F24A 2C7FA 4DZBA 2DQTL 1GZPA 2IAMB 4C4UA 4JUSA 3H9ZA 1SEBB 3UH8A 2F68X 4KTGA 2FT7A 3LOWA 4APXA 5LHDA 3VFRB 3TWCH 2F6AA 3ZE2B 4OFDA 2NXYB 1G6VK 2FHBA 2CO6B 2FYYB 1IKFL 1NIEA 1ZLDA 3MXVH 1A6UH 5EOCJ 3ZTCC 1S78D 1XGRA 4CADA 4I8DA 1FE8L 5DK0A 5DFVC 2NSQA 3O3EB 4PB9H 3K0YA 3DVNA 1XCWA 5C0GB 4P05A 3MFFA 3WS6A 5KOVC 3BGMB 4DEPC 4LRNH 3RX8A 4EF3A 3AXIA 4LKXA 4ANXA 3SYOA 1R5VA 4JLRA 1YUHB 3OB0K 1F3DJ 3MV9E 4KAQL 5E4EC 4AGMA 3TZVC 5E56A 4AW7A 5F1SA 4P04A 1QTYT 4BA0A 3P11H 3VFOA 3GJFA 3SPVA 2Y1VA 3TV3L 4X7CC 5EV7A 4JO2H 3V0AC 2YPKB 4W6WB 1BQSA 4JL2A 4J3WA 3ULUC 1F3DH 5C0JB 5HHVL 4K4KA 1P6FA 3E6FB 4MS8C 3CG8A 4PLKD 2RQ8A 1MQ8A 2H3NB 4Q6IB 4WDIA 3VI3A 1M6UA 2E27L 1IGCH 4GQZA 1K2DA 1RI8A 4YLBA 3SE3A 3WL9B 4ZOEA 2JXMB 1BQKA 1SOXA 5TQ0L 2CRYA 3QFDA 1RFDL 4X8GA 2K45A 1KBWA 4PRDB 3SPHA 1AGEA 5CCKL 1YEIH 4LVHC 4LGRB 2IDUA 3F2LA 2XUWA 3SE4A 3IDYC 5DSCA 2HUHA 2IQ9L 4M62L 3KLLA 3HB3C 4NFBA 2ZYHA 4QF1B 4YNYB 3S34H 3AU1A 3FTVA 1AGDA 4F1SA 1YEFH 4N0UB 4UQAA 4DN4H 1BP3B 3TA3D 1QNIA 1ZS8B 1C16A 3MUJA 3QUXD 2A9ML 4OCRL 1GOFA 2OR9H 4N2GA 5BS0D 1K6QH 1INDH 4HF5H 2Z35B 5E6ID 3UG5A 2V7HB 2PPDA 3LNFA 4Y4HD 3IMRA 5KEZA 5DZ9A 1IGML 3SOTA 2OJZL 1BLNA 4G6FB 4A1RA 4XRCB 3SDYH 1J0ZA 2HMIC 4UOZA 1OB1A 3AGWA 3U4BL 2EDYA 2CBMA 1TDQA 3WO4B 3GSXA 2XPGA 1JPSL 3WTUA 5B3JE 1FZMB 5HYSA 1XBDA 1HWGB 3LNDA 2CE6A 3ZTNL 4OCMC 3IU3A 1WFOA 1FGVH 1S7RB 1LO4L 1JERA 2VDPB 1UG9A 2ILLA 2QV4A 2R4SL 3PL6C 2H41A 5HYQB 5CINH 1P5VB 3OHXB 1L4IA 1U8PB 2NQDA 3C5XA 4FFZL 1TCRA 2ZOUA 2NNXA 4TNVK 1A6TA 1AMYA 3V4UH 1GR7A 2X4PA 5MHSD 3K0WA 4K55A 4LSTH 2N3JA 3FT1A 3RTQB 2OZ4A 5HHOE 3CGTA 4KNSA 4Q0XH 2KL6A 4JFTA 4EIZC 2QVTA 5TDPA 1O7SA 3CH1B 4J6RH 4J2XA 4U6HB 4QRRB 4OLUH 4JFPA 4OLWL 4PJ8C 2XA8H 4FQQB 4Z7UA 1FORH 1DBBL 4JFDB 3A67L 3VI4B 3DHPA 3DURA 4WWNA 3BAWA 2VLJD 3SKJL 4WI6A 2UWEF 1JHKH 2R2EA 3QXWA 4QPEA 3OKKB 5GRYA 4LCCC 5LBSH 4YX2H 1A7QH 4PWIA 1D9KB 2PW1B 4NI3A 2A73A 4Q6YA 3T0XA 5JHLL 2IAMA 4WUUD 3NPSB 1UM5H 1ML0A 3ENEA 3FH5A 3PGCA 4HAFA 5ESAA 4GFXA 7PCYA 5F7MC 4RETB 1BIIB 1L9RA 4PG2A 5TPWL 4K7FB 2HT4C 5B8CA 3H56A 1X5GA 5AOIA 1T1XB 4IEFA 3E3QC 4QHUB 4AYFB 4F37K 1V7NH 3HLAA 4OLXL 4U6TA 3PAVA 1YMHB 4OBSA 2AQQA 3DX1A 3MCKB 4LNRA 4S1DC 3S8FB 4YDVA 3BSGA 5BW7A 5TE4L 4TNFA 4JFFA 4GMSH 4KKRA 3QUML 3T3ME 4FQ2H 4J5VA 4J12A 2G4EA 3GS0A 4J4PA 3VX1A 4DF9A 3P40A 1EAOA 1KNOA 1TTRA 3LXAA 5L2KB 3LV3A 4BRVA 5AQ0A 3OAYH 3ECBB 2WLMA 5F3FA 3RILA 3VXRE 5IUSA 3OX8B 4BHUI 5FUOL 1YNLL 4XPTL 2R29A 3OKNB 4JREB 5B38B 3VH8A 4G5AA 2VXVL 4EAEA 1BJMA 3L4VA 4NRXA 3MV11 5CLTA 4DTGL 5EORL 2XZQL 5EF3A 4PJ7F 4LNVA 1QFPA 4HUWA 4HIIB 3REVA 4F93B 4TM9A 4CUCA 1ZHLA 3D51A 3E3QE 1J0YA 4MJ5B 5TFSL 2KYIA 1FL6B 1VF5C 3D2TA 5KBKA 5KVFE 3GBNH 3MNMA 5IFJB 1DE4A 3IPEA 4LVHB 1X4YA 1KGUA 3VACA 1WWAX 3MRLB 3LNGA 2GY7B 2ICCA 2ZWLT 4IJ3B 3EUDA 5B38G 4AIZB 1U91B 3EH1A 4JHBA 2WZ0A 1FG2B 4BFOA 5C0AD 5I6NA 5IIEA 3IKKA 3ZUCA 5F7HA 4TSCL 5H35B 5JPMB 1SY6H 2ICWA 3GUFA 1YLBB 1KB5A 3MRHB 1ERNA 2B1HL 3B2UC 4NCC2 4AE0A 1UTDA 1UZ8B 5I17A 2Y7QA 4GQQA 4QT5B 4WUUE 5E08H 2NY2D 3U7YH 4UM9B 1W8OA 5J5EA 4NQDB 5GZOA 1A9BB 1TZ8A 2VLMD 3I3BA 2GK2A 1A4JB 4O5LH 3VX0A 4EI5D 2NOYA 4MQSB 3BVNA 4Y8AA 3EHBC 3VSVA 2Z31A 3AWGA 1AR1D 3OB0H 5DUJA 1FYTA 3K6DA 4FTVA 2V33A 3BXNA 2I5YH 4O2EA 1M4KA 2HH0L 4HCIA 2R69H 1RHHA 4KXDA 2VLJE 1GGCL 3QQNA 1CL7I 4OM1H 2UZIL 4KXZH 1RZJH 5IVZB 3CZFA 4QRBA 3QJFA 5IHWA 4L4TD 3AADB 5HI4C 3D69A 2HTKD 5HHPB 4G7VL 4HX1A 1C5BL 4PCTA 2H26A 2OMTB 3N1MC 5DURD 4HU8A 3V4PB 4D9LH 1HOEA 5CU5A 4B9JA 2EVIA 4X4XB 5LAPA 1AGBA 1IRAY 2R0LL 3BE1L 3N1PC 1MI5D 5AKTA 1XZ0A 3W38A 1MVUA 3KXFD 4YFLI 1KJ2B 2V3DA 3JTTB 4MWFB 3SGEI 1LQBC 4XNUH 3TBWB 2P5PA 1A64A 1KENL 1IFHL 1OAZH 1X7QA 5IFAL 4KXAA 3AG2B 4KGJA 3FQYA 1VCAA 3MV01 3IJEB 5DMYA 1KXVC 3MRMB 2CIKA 5C0CE 3I9GL 2CGYA 3EYSH 3GHBL 3IMUA 1DDHB 1M05A 3C6LD 3BP7B 4LHUA 4Q74A 3VFTB 1IGIL 1CBVH 1A1OA 4RDBA 1BXUA 2Q3AA 2CLZB 4KJQD 4Z3IA 4ZW3A 1KJMA 1JMXA 3GSUA 3LH2H 5DC0A 1UM6L 2V7NA 2DAVA 2H2SD 4L5FL 3FONB 1U3HA 3CZLA 3OJDA 3LDBB 3QNZB 1GGUA 5E4OA 3MROB 2J20A 3HR5B 3N5AA 3VXSD 2NY4C 4PVBA 2YD4A 4RBPH 2XKNA 2ZP0T 3CAFA 2FIRT 4JFYA 4ZFZA 1QRNE 2KZKA 3FQWB 3OC5A 3HG2A 4KMQA 5D71H 4D2NA 2V2XB 1ZTXH 1UA6L 3GK8H 3EGDB 1LWHA 5F3BB 2VMJA 3WN6A 5FYLH 1XH1A 4UDTB 4L3EB 4XHJD 3MU3A 1G0XA 1W72L 4PRHB 2BRQA 1XEDA 1XCTA 3DX0A 2EO7A 1AMXA 3K46A 3TPKA 2X87A 1JXGA 5DEJA 1BM3L 4OZ4A 3RPIA 4NPYA 3RNQB 4ZUSA 5D2LA 2GK0A 2Z65C 4IRZA 4R9HA 5F6IB 2XVBA 1VB9A 5C0DA 2DYRB 4GKSA 5JZ7D 4OIFA 1CF1A 4NWTL 4B9KC 5I6OA 4JO4L 5F0PB 5G5DB 1KTDA 4HMEA 3VWJC 3HS0B 4ELKB 1L7TH 4WEBL 1NLDH 4YEEA 2OJEA 4PJCB 1VFBB 4YGVA 3LKQA 3P3TA 3UIYA 5B22A 4EMZA 4GRLC 2E76C 3M17B 1OCZB 1INEL 3A3YB 1JNHB 3DX9A 1FNGB 4U6YA 5FYJU 3VXSE 4CDGC 4GBXA 4PVMA 4FZ8H 4GI8A 1PW3A 4WLCA 3ISWA 2XN9D 3W0WA 3WIIH 3O4LD 4AGPA 2IH3A 4CSSA 2EADA 5ICXA 4NRZB 4IRSB 4KDVA 1F11A 3OKOB 3PWPD 3CFBA 1RUML 2A1WL 2PO6C 1P4BH 4QAWA 5E8OA 5IVOA 5INDA 5T1DL 2GUOA 1AVAA 4ZMVA 3NSCA 4DKEL 5CWSB 3H4FA 3F6IA 5EA0L 2BOLA 2DIBA 4JG1L 4OUUB 5D2NE 1EHLL 5K69A 1JRHL 1ZAGA 5C0CD 1DVYA 2BP3A 3ZZLA 5ICUA 1E6OL 4DVRH 2ADIA 5F3HB 1OK8A 3GIZH 1PKOA 1E3FA 3OB8A 4AJWA 4YO0A 1KIQA 4X6CB 1T04A 1ZA3A 4P07A 5C97A 4U1GB 5GRWA 5E8PB 5D5MF 1KCKA 4W4OA 3ROOB 2ZOWA 3D25B 3UZEC 1RMFH 5JPMC 2O5ZL 4U1SB 3AS1A 4UIMA 1NEPA 1PZ5B 1F45A 1FRGL 4WCYL 4GMTL 3WMSA 1LP9E 2I85A 5DRZB 1Q9WA 4D9RE 3KPTA 5EZIL 1JGUL 5JYLA 1U8HB 1Q4NX 4BSJA 2AJSH 3N85H 4P2QA 4CC1A 5KVDH 3IFOB 1N2RA 3L16A 2XQ0A 1C9SA 1VZGA 3I9AA 4KPHH 3QUKB 3SGKA 3HS9A 3CFMA 4MKTA 3SKNA 1SF5A 2QPSA 5DC9B 3DJ9A 2MIZA 2UV3A 4Y5YA 2E74C 3O2VH 4EO5A 3ZHLA 2N59A 1OB0A 4I77H 5LUMA 5C0BA 1VPOL 4N5ED 2WVTA 1A02N 1VDGA 2AQSA 1J10A 5IHUH 3ESOA 1ZLWK 3BT0A 2YQ3A 4JQVC 1QBLH 2H2PD 4H7VA 4NKMA 4P5TC 1J9CT 4X80L 4XP5L 1DVFC 5T5NG 4LL4A 1EFQA 4JKMA 4WFHD 5DQDH 4ZODA 1ADQL 2W0KA 4IU3B 2B3IA 2Z93A 4N6RA 1M57B 3GSQA 3ECQA 1HS6A 4GQRA 1GVIA 3IETA 4KMLB 4JE0A 3T8VA 3CMOL 4QCIB 2R1WB 3AG3B 3EHBD 4B7IA 3VD4A 4MYWB 3UDWA 1O5DT 4YHZL 3BLKA 4QI3A 4U6VL 1OAJA 4RA3A 1ECZA 3OZKA 5T1KD 5T5FL 3E2HB 3F7LA 5CFHA 1PZSA 5H2BA 4XMWA 2XN9E 4OD2A 1BQLH 4ONFH 4RGOL 5JUEH 5D7EA 4HH8A 5T3ZH 3EFDL 1GXEA 4PJDF 1OP3K 3F6LA 3DETC 5LGJB 5DJCA 3RWCA 7TAAA 3VXTA 4HUXA 3FU3A 2HKLA 3FUEA 1FFNA 1OGAB 1N2RB 3RKDC 4R4BB 5I2IB 5IY5B 5JW4N 1M1SA 4OZFB 4B3EA 2X6AA 5AZ2L 3U9UB 1A8ZA 2DDQH 4I18C 3VA6A 2Y3NA 1Q9WB 1OE2A 3KWWA 3T2NL 4DVBA 1PYWA 4O02H 3WBDA 4N90D 5DZJA 2XZAH 2EECA 3NRQA 1E42A 1GCYA 2SEBA 4TUJA 5D7IA 2PCPB 1UH3A 1A6VL 4RLDA 4G6KL 3RL1B 3RWIA 1F6AB 4C56B 4F7KA 4XNAA 5H94A 4RGMC 2GY5A 3GIVB 1NIBA 2R15A 4NQED 1T2JA 4WEUD 4LSRL 5EF0A 3Q9PA 5E9DE 1OAYH 5HD8D 3RGHA 1FZJB 3CFJA 3CZEA 3HG1A 2OBGA 3CDZA 2ZKWA 3QIUD 4HJJL 3F8UB 1H8SA 1OGTB 2V0AA 4JM4H 2WKOF 2IFFH 4NHUA 1JZJA 2VQ1A 2AQRA 1MRFH 5T3XH 4XC3H 4N1EA 2ENSA 3B2VH 1XH3B 4FP8L 3CLFH 4DGWC 3TBCA 5I15L 3NH7H 2ICES 5IHBA 3NJXA 1IAOB 2VZOA 3ZL4L 2VAAB 1A1NB 5BMFH 4GJTB 4FFVD 4GIAA 3BT2H 4KHXH 4WJ5B 4PJCA 2XTJC 4JPWL 1HL4A 2F08A 2NXZB 5C08E 4E9LA 4JRYA 2K6YA 3KYMA 1SQMA 3ZL1A 1E6JL 3WE6A 5ESQB 3QWNA 2QQLH 2VRQA 4KTEH 2UX7A 4PJBB 3CXDL 1O75A 3ARQA 4G6FD 4YL4A 3VXNB 2VL5B 4FXKA 2EEBA 4XMKL 3KYKH 1MG3C 4X6BA 25C8L 2RCSL 1HDMA 4PGCA 1U8QA 3ZDWA 1A3LH 1OSPH 2F0CA 4LP4A 3VWKC 4GG8B 3X13B 4J1UA 4QXUL 4W9FC 3TF4A 2I9TA 2HFGH 1H3TA 2J88L 1Q1JH 2ENJA 5EBWB 4KVNL 2BK8A 2OMYA 4G3YL 2BVTA 2VL4A 1C1EL 1NMBL 4MCYA 4R5TA 3SCMC 2YPLA 3CC1A 1DBKL 2F61A 3HCVB 8CGTA 1QO3B 3LRLA 1MF2L 3DGDA 4FTVE 2OSLA 4KDWA 2MQGA 1M7XA 2A99A 1JNNH 4EBQL 1FIGH 4NM8H 3SJVA 3QUHA 3IE4A 1I1FA 4PJ9C 3ZL2A 4BKLA 4XAKE 1U3HB 5EDSA 4IS6A 3CZSA 5E8PA 3ROOA 5HYSG 4POZD 1YMMD 2AEIT 1F97A 3FSAA 4BRJA 4XOAA 3MCG1 5ANME 2FE0A 4DK5A 3QA3B 2F7RA 1NCAL 2BOCA 3FU6A 1U95B 1T7XA 3QDMB 4OUUA 3M45A 4J27A 5INCA 4GW5B 5D6CA 4IRZH 1DQLH 3DUHA 4KQ3L 3MRMA 1F11B 3D18B 3MBWA 3IAQA 3SD5A 4WK0B 3PAZA 3LS4H 1M7IB 2EICA 3X13A 2BFVL 4P5KA 4NCC1 4XVJH 4UV4L 3W9DB 3Q7JA 5I1EH 3SDCC 4KOCA 1KGXA 1E0OB 5CR1A 3TESA 4ZMYA 5AVZB 1RH8A 2VL5A 3H9YA 3U6XA 1W8EA 3F12B 2F8IA 4F2MA 3V52L 2W8CA 1BAGA 3UCRA 1GCFA 3M8OL 3T3MB 1U92B 4YSEA 2F9BT 4AYMC 3B3IA 1U4EA 4DK6A 3MZGB 4PMEA 3V6FA 1NMAH 1OHZA 1T7WA 2WIMA 2FH8A 3PHSA 2ORBH 2O26U 3G9AB 1PGRB 4PI2A 3SBQA 1RK1B 4DO4A 4NAMA 2R0KH 1TYJA 4PS4L 1E4WH 3MV9D 4XPAH 2K7QA 1E27A 2ZSVB 1I8IB 4Y16B 1UD2A 4Z5RA 4XCCH 4R97C 4NHUB 2ED7A 4RESB 1Y07A 3W2DL 4RRPA 2B0SL 2GJZB 5TE7H 1Q72H 1UZ8A 2EINB 3N41B 4N5EC 4XN4A 5SX5H 5HYJE 2B2XH 2MNWA 4MJHA 3CVIH 5CN2A 3WEAA 2H1PL 5CZRA 2J6EL 4RDQF 3EFFB 5AW9B 2I60H 2BP0B 4BE6A 2R51A 4TVSa 3DMMB 4FQXD 2PR4L 3LMJH 4NIYE 3FT4B 4NKQB 4P2QE 3SE4C 2VDQL 5E6ZA 3U7AA 1UJ3A 2BX5A 4DPAX 1PNDA 2R4RL 3OJDB 2ZAHA 3T08A 3NEEA 2QJDA 3QH3A 1NFDF 3TASA 2YMTA 3DX6A 1ILUA 1YCSA 5A1AA 4P46A 1KN4H 3K4DA 3NJFA 3FB6B 3AQDA 3TZVA 5AKRA 2C4XA 2Y25A 3UMNA 3KH4A 4BYHA 1P5UA 2E8YA 3VFUA 1OGTA 5GRUH 1GYCA 2VITA 2YSSA 3TT3L 4LEEA 5GGRA 1U8LA 2J43A 1DP0A 5D7IF 4R84A 3TA4D 4C83A 2FUQA 2YD1A 3S4SB 1DN2A 1RPUA 2W0FA 4AJVA 3GIVA 5J13B 4H1LA 2PPFA 3HPLB 2DB8A 3HN3A 1MCOH 3QQ4A 1OT4A 3QCUL 4Z7UE 5DJ6B 3IVKB 3ABLB 2NY5H 3QNYB 3S35X 4FYRA 3ZSTA 1HIML 4QWWD 4A6YB 1WD9A 1GGIH 3K1KC 3MLTA 9PCYA 4LSQL 1Q8MA 3B9VA 3I3DA 1TQUA 4F27A 1KFAH 4NC1E 4QXWA 1ZLEA 4HPOL 2F54B 2NW2B 3WUWB 4MJIB 1UWGH 3GD1C 4TULH 5L2KA 1AOZA 2BIPA 2OMYB 3EOYG 1C7TA 2ZUTA 5EULV 3HE7A 4GRWB 3CZFB 4G9FA 4DKAA 2DY2A 5C8JB 5KS9E 1BZOA 4H2AA 4XC1L 2D3LA 4DQOH 4LCWA 1IM9A 4FMVA 2VN4A 1UD6A 2Q5BA 3K8MA 4GXFA 4NKMB 3FQ1A 3ZQWA 1S2EA 1AO7E 1P6AB 2J73A 1FZOB 2HLFC 5GJSH 2AJYL 2C1PB 3GMMA 4ZXBA 4MJJA 5I26A 5ES4B 2JKNA 1OT1A 3FQTA 5D2LE 5FXCH 4CVUA 3OV6A 4GEJA 2JCCA 5E00B 3BEWA 3MA7A 4OZFH 2NZIA 5TDNB 1MQKH 2ZXGA 3DIFA 3P2TA 2R39A 4PP2A 3GO1H 2C9RA 4PREB 4QGTA 1JYNA 4IHOA 5FOBB 3F84A 3F85A 1GZQA 3U2SA 4YSAA 4P8QA 4P4KD 2YHGA 1LNUA 3STZA 3V5KA 4C58B 2E4FA 2YBGA 3OAZH 1HILA 1B4JH 3QXTA 3ZSSA 2VOTA 5BZDB 1CLYH 4QRSA 2FIKA 2AEPH 4Z77B 1D6VH 5EWIL 1QLEB 2EE2A 3WY3A 1FN4A 4YHPA 1AAJA 2F58L 4NZRL 5B3SB 5EZJA 5DO8A 1INQB 4WNQA 1DQQA 5JXEA 1J8SA 3QNYA 4ETYA 4GAJH 1LYQA 4YHNB 1PKQA 4FA6A 3KPQA 5ACZA 5DMGD 5EC2A 5ANHA 5IROC 3ESNA 4PSPA 1R3KB 5GS0D 2DJSA 3ZKXC 4DQOL 3BW9A 3TVMB 5I8OL 4LF3B 3QEQD 1TVDA 3IPBA 4QHMA 1D6EA 5I6XC 3V4VB 3I6SA 1SOSA 1B6UA 1N68A 3GI9L 5A40E 5E94B 1AHKA 3PXHA 5JHDD 1KSRA 3X3GL 2XYBA 1LO3H 1J18A 3QDJB 3T0EA 1RLWA 2ARWA 1U8OA 1ZVSB 2FQEA 3CX5J 1IC7L 3GSXB 3AREC 1NTDA 2O6EA 1MPAL 4U1GC 1UEYA 1P2CB 4FFYL 4APQA 3QZWA 3DIDA 3HJ0A 4UM8A 2CNYA 1DUYB 4GI9A 4EUPG 1XO8A 1IUZA 3OWRA 4L29B 2J21A 5GZND 4MDIB 3WHXA 5F96H 3Q2VA 5JHDB 2AITA 2F7PA 1I7UA 3QDJD 1K8DB 4PVNA 1QFWL 4CMHB 2I07A 5KSUB 3TT3H 2ICEC 2P46B 4MMXB 4PJCF 2FSDA 3V9FA 5GRUL 1RULH 4R4FH 2F54D 3V4PH 1W0WA 1E8XA 2EXTA 1OOWA 4RCAA 1J7VR 2NY6C 4N6QA 5FGBC 4YDLB 3HNVH 3O9WC 3NRFA 5DEGB 1AFVL 3IJHB 4HSAC 2V9RA 3ME0A 3WGUB 3RE0A 5CLYA 3LMJL 4HGKC 4KI5E 3N0AA 4XP9L 1CDYA 1ROCA 4ORGB 3VGAC 4CA4A 5EIVA 5AVYB 3NACL 3EGDA 1BVLB 4X9YA 5F21B 4HCRH 5IGXL 1E40A 2UZXB 2B0SH 5DD5L 1UGNA 2X4QA 4K23H 3Q8AA 3QJVB 1N0LB 1CS6A 5JIIA 4Z3JA 3F7VB 2J1WA 3A4DA 2GK0B 4GBXD 4WI9A 1FFTB 4BCXA 2YXMA 3QNZA 2IGLA 3ZZQA 2GSIB 2CMRH 2N01B 3PP3K 5D1ZI 5AL8A 1DN0B 1FBIH 2ZYIA 5AOMA 3N0PB 3O6FB 5A7BA 4L3FA 4OH2A 4LKXB 4QJ4B 3LRSA 2D0HA 1MHHB 1CZ8H 4FNUA 2KLRA 3ASNB 4ODTH 5DK0B 2QBWA 1SVZA 5F3BA 3NJIA 1QFOA 1E2VA 3P73B 3M8OH 5FV2A 4DETA 5IWLA 43CAB 3FB6A 4HKJA 4B97A 3SQOH 4D9RD 5I8EB 3IJ9A 4YHIA 2I9LA 1FYTE 1WH0A 5EU6E 1PZ5A 3RDTA 4HSCX 1S3KH 1JN6A 4PJFB 3U82B 1AIFB 4MWFA 2CJ3A 1I1AB 1U93A 2Q3XA 3DXAD 1JZ4A 2YXVA 3ZE2F 1LGVA 1LO2H 2G30A 2PYEB 4IRZL 1PZ2A 2A6DA 3ZDXE 3V4PA 2X3BA 3RWGA 3V7AG 4HIHA 3NCEB 5K59E 2UY6B 1IZJA 1MFMA 1NCAH 3W9EB 2W91A 1CI5A 4K23L 4FG0A 5GS3A 5IG7A 3BWUF 1YPZF 4JK0D 1YEEH 2VLKA 1X7QB 5DMIL 2WD0A 2R23B 3IGKA 2UUDK 1FH5L 3BVUA 3PUUA 4ZW5A 4E9QA 3TN0D 3REWB 3QDGE 1PZAA 3Q2CA 1JTPA 3GI8L 3NSYA 1GYAA 3MUGA 1C1EH 2WLIB 4UT7H 4G3YH 1EO8H 4XWGL 2ICWI 4DUVA 3CFQA 4GEIA 5JPMA 2OPCA 3F12A 3MRGB 3F00A 4Q9BA 4F9LA 5HHQB 4JFZL 2HJLB 2NZ9C 5AVSB 4N86A 5EG6C 2GEQA 2C7UB 4M5TA 4XBGB 1IAOA 1OSPL 4ZUSB 3RNQA 3CSGA 1BFOB 2RCSH 4P5KB 1FYTB 2WVVA 4PV1C 3B9KB 5GGSA 2W95A 4YE0A 3TH4T 3LN5B 3ECWA 2DI9A 4XMLH 5TF1H 3SPIA 1KBGH 2QKIB 3MBWB 2CH8A 3CVHA 3LIUA 1B4RA 3VWJA 4Z3GA 2NY0B 3ZDXF 5IBUG 1T0PB 3L8QA 1AGCA 3UADA 5D93C 1AZBA 1FL6A 2UVEA 4L3EE 4HLEA 2E6QA 4K8RC 2NLJB 3QA3A 1YMME 2VERA 1CFVH 1P84K 2PTVA 1IZKA 3E1ZA 1AE6H 4CU8A 4XXWA 2CDEA 4GH7B 4TNEA 1SN2A 4HK0A 4OJEH 2W0LA 2E7CA 4PI0A 3T9WA 2ZWYA 2M26A 1WEJL 2SEBB 1KTKE 1CGYA 2H45A 3D33A 4JN2B 2DWDA 2FECI 3RUGA 2WSDA 2X4UB 2DQIL 3HFFA 4FJZA 4PJ6A 5ALCH 1MRFL 2J8UE 4NKDA 4HJ0C 4X5LA 2IFFL 5LXGL 2IANB 3SGJA 4ZQKA 2ITCA 1I4FB 3FTUA 5GGUB 2JJSA 3O11B 3FUKA 5FO8B 5KSAA 4PP1C 2HMID 2VXSH 1QLFA 4HUWB 4GINA 2WVSA 4F2ME 3QRBA 4LNRB 1CLCA 2OW6A 3NFPB 4E42B 4OKDA 1X5YA 4PRIE 2UX6A 2LE9A 2QZ5A 4AVHA 1XGZA 2D73A 3CFUA 4DQAA 1BIIA 2H32H 2A6IA 3ATEA 4E2OA 4QR7A 2HP4A 2BNQD 2J2ZA 3A21A 5ESQA 4X4XA 3SPCA 1A2YB 3R4RA 1UOKA 3RDJA 1WZMA 3V4VH 1N6QL 1R19A 4WHTA 5EF1A 4G7YH 2ARJQ 4KFZC 1Y7VA 1VA9A 2VM3A 3PDDA 3HUJA 2IAMD 3T3PB 1PG7X 3LS5H 3CHRA 1DQTA 1NCWH 1QZ1A 1S7QA 1NFIA 5GJSL 2ZKXA 5IV2A 2DWXA 2BVEA 4UOW0 3KNBA 3TH3T 2YGQA 1OALA 5HDOA 4Z7QE 1QWNA 2O72A 3OXSB 3GUTA 4K3JH 2B1AH 2VCOA 4M8UA 4M7KL 1NCUA 3HBGA 2FWOA 2OI9C 4U6VH 3PGCB 2KQMA 4B9IA 3SO3C 3V6ZA 1AE6L 1U36A 4XT1C 3D3VB 3NQKA 1Q9KA 1KIRA 4NQEB 1BHGA 3J2PA 2YN3A 1KFAL 1KELL 1J1OL 4E9VA 5DR5H 4BFGA 1K4CB 1PCXA 2JV6A 1T1ZA 1KBGL 2YXFA 3TEWA 1AYRA 4PGJA 3QUMA 4LBEA 1PF3A 3QCUH 1KGCE 3MLRH 1Q9LA 3QR1A 1CFTA 3ZU8A 5AAPA 3L7EB 4Y5VC 1IGJB 1P1ZB 4LMQI 4U6HA 1L0XA 3EFOA 5J0BA 4LLMB 3G6DH 3S3CB 1BZ7A 2GIYA 1HNFA 2JIXB 4UT7L 4XWGH 1UACL 4KX8A 3PAUA 4DEWA 1F3JA 2Y06L 2BIHA 1NZRA 2MOVA 2OJ1A 3PQYA 2A9DA 4MAZA 2VDRH 2WIIA 4XCEA 1LQSR 1WFIA 4EZKA 1WGVA 2Z0BA 2G3MA 1C16B 1A21A 1CDIA 3QJHB 5CN1A 5FYLD 5GRJH 3X14A 3FUMA 3VD2A 3MREA 4OCLC 1KNOB 2E9IA 2KLTA 3CQPA 3IETB 2VNCA 1GPOH 2DH3A 4DJMA 5EZLB 3QEGL 5CP7B 3NZUA 4NJAH 1Q72L 4ZS6D 3ZKQD 4WU5B 4YHKL 3UX9B 3AGVA 3W2DH 1QEWA 3H2WA 3BRDA 2A5UA 4XCCL 3BQUA 5I0WA 2E9BA 3PAYA 2OZ4L 3IFPA 4HJTA 2WYHA 3TLRA 3BDXA 3DUSB 4AC4A 4AMKL 4Z78B 4JG1H 3CDGA 3MN8A 1SBSH 4LAJH 2NY7L 4JFXA 3WFBL 4DP6X 1YNKH 1XVSA 1VEPA 5EFIB 4BZ1A 5T3ZE 2HRHA 4G6JH 1KYDA 1T66D 3JWDL 3JWDH 3SGDI 5F89B 4WKZA 3PWPE 5I1HH 3EGSA 1TNMA 4RFNB 2B59B 2WBJC 1QSFB 4FZ8L 3ULVC 3U30C 1WHPA 3FFCB 3P4NA 3VYNA 3EADA 4HWZB 4PV9B 1E4KA 2C34A 4PR5B 3ESVF 1MCDA 3QJUB 3NSFA 3ZE2E 4CGTA 1DVSA 3HLKA 4NAQA 1B3IA 3VXRA 1NLDL 5HDQL 2DPKA 3DUUA 5E2TL 1T1ZB 3CFIC 4JO4H 1TO5A 2XQBH 2WWKT 1S3RA 1MRDL 5IEHA 4YHKH 4ZFZB 2C9QA 4XN7A 3B7UX 2YPKA 3NACH 5DK2A 1E9QB 2APWA 1ZE3C 1T5XB 4HS3B 3G6JE 4GNKB 1F58L 5HPMA 2CCLA 1EDHA 1RIUH 2J25A 4JMXA 4JLRB 4QMEA 3ULVE 3P3YA 2ENPA 5C08B 1H19A 1JNNL 3BPLB 4J23A 2KMWA 3OXSA 3GUTB 1A1OB 3ZJAA 2DIAA 4ZNEE 2ESVD 4BQ6A 4OZGA 1JGLL 5C6PB 5D6DA 1JFHA 2Y5TA 3QPXH 2Y06H 4J4PC 4LCIL 3RWFB 4Z95L 5T1LB 1QYGH 3RL2A 3QWRA 4GP4B 1ZVNA 4E0RA 2P7TB 5FB8A 1WFMA 1JZHA 4WY7H 3N9GL 4JO3L 1QRND 2GJPA 1ONQA 1NGPH 4YLQT 3TBWA 4MKMA 2Q2LA 4GKZB 3G6DL 5HI3C 2G9KA 3PHOA 2PO6B 2L4OA 4GT0A 2DLGA 1U2CA 3WY4A 1QSFE 3OKDA 3X14B 2XBDA 3S2AA 3RVTC 6PAZA 4PW9A 3ARFB 1BBJB 1CE6A 4YHLL 2FWLB 5FGCE 3WE1A 4ELKA 3TEZA 3MRBA 3P1VA 3JYCA 2DWTA 2A9CA 2FSEB 3SDAA 1I1YA 5DYOB 4O2CA 3P77B 5LAXB 2P45B 3ZKMC 2D7TH 3WTSA 4MAUH 1J1OH 2QT6A 4CBPA 3ARGD 1T83C 2KI6A 3C5JB 2BSEA 5C07E 1LO3L 2VDKH 2OSYA 1KENH 4P4KB 1WCBB 4ZD3L 3RFZC 3ARFD 5EUKB 2FJHA 3O11A 3OTTA 4NERA 3AG4B 2EDJA 5BMFL 1T21A 4DK3A 2IPUG 3Q06A 4K3JL 3BE1H 4KK5D 4CDHA 5IJBC 2WV3A 4QJ3B 1DHKA 3ETSA 4J3BA 4GAJL 1N8ZA 2V2XA 5B1BB 3V5HA 4Z7NF 3C6LB 1Z5LA 3EDFA 2NSMA 2WB1A 4FNTA 3KYOA 1H15A 3K6IA 5C7XH 1C12B 4HJJH 4YDLC 4F5CE 4M56A 4JM2D 1KB9J 2HH0H 1QR4A 5C9KA 4KITB 1NBYB 3GZKA 3SDXE 4KJPD 4XODA 4GSUA 1N6QH 1T83A 5HHXL 2Y7MA 3DARA 2VWEE 4O5LL 4XCNA 5DWPA 2BSCA 4B5ZA 4G6KH 1R3HB 5AVVB 5C09A 1AGCB 1ZLUH 4YPJA 2VTFA 1UUNA 5BS0E 1NC4A 1MCQA 4WEMB 3AS2A 4MMZC 3RGVB 4XPHL 1JOIA 4P4KA 2B16A 4P99A 3BN9C 1EHNA 1XCQB 4FC3E 1UXMA 3T1FB 4TSCH 1TJIH 2ZNWA 1NIFA 3HUJB 3RVUD 1O6VA 4P3CH 5E9DD 4EUPB 2AXJA 1JGVL 2AJYH 3U36A 4EQ2A 3OAWA 3HNTH 3VI4E 3US1A 2GSGB 3CFKB 3L3JB 1KJ2A 3NJGA 3FO9B 2ZG3A 4WJG3 2MEJB 3KPRA 3TBTB 3ZTDC 5JMRA 2BCKA 2G2RB 4BKSC 1F1GA 4G72B 1JV5B 2CLRA 3MKGA 1QR1A 4M7ZB 2W07A 2H26B 2OMTA 2DQIH 4HIPA 4ONFL 3FQXB 4R83A 2J3SA 2A4EA 3BP6B 1WEJH 4RAHA 1I31A 2XZZA 3FCGA 4L4TB 3TBVB 1XR8B 3TEUA 2WQAA 3MAWA 4WWKB 4H0GA 1A3RH 1H0DB 4YHZH 4QXTB 2Q86A 1JK8B 1I7ZB 2ZKHL 4QRPB 4HDIA 4WV1A 4PJ5D 4Y5XA 5IG7B 2O5XH 4AENB 5I66B 3RJOA 3FDWA 4JX0A 3WXWH 5B7MA 3BP6A 4DEPB 5AW8B 5FUOH 1P4IL 4FXLA 4ZMOA 4K7FA 3NSDA 5A6LA 3FUHA 4IDLA 2A6DB 2SODB 3HE6D 2FWUA 4R96B 4WTZG 1U93B 5TF1L 2H4EA 3RAJL 3CLWA 1JVKA 4H25A 1JZ3A 3QUMH 5GGRY 2HTKC 4FQHA 1JS4A 3KYOB 3L5JA 4HC1A 4J7RA 4UILH 1IEHA 1U8MA 2DQFA 1SXCA 3CN3A 4S0HA 2PNDA 5BW7C 3DO3A 1EO8L 3IDGA 4NQXA 4I77L 3MRLA 5KJ7E 3FTXA 3VXRB 5AKVA 3VMOA 5TPWH 2R4RH 2CRMA 4MS6A 4KRPD 4MVBC 4L37A 3WELA 4ADJA 1UM5L 1HYSC 1Z3RA 1UM4H 3MRIB 5DVOA 1DN0A 1S6NA 3PWJA 3UTTB 4I1PA 2X70B 2BSBA 2X44D 3ARRA 2XA3A 5F2FA 2PPEA 3EYUL 2WQUA 5LBSL 2B2XL 2C7UA 4NRXB 2G2NA 1IL1A 2Y6SC 3P4OA 4JPQA 1N0LA 3UBXI 1P6WA 1L7IL 5EZIH 3ABGA 4LCCA 4E41B 4IBSA 5K9QI 3VW3H 1BD2A 1FORL 1RZPA 3ARFA 2V5SA 3MI6A 2RR3A 2PO6A 3K2IA 4HLZH 2ZUSA 1DZ0A 2HCZX 4KY2A 3CC5A 4FA8A 1OF0A 1HZLA 2RQEA 4FYTA 1I1AC 3GZPA 2X42A 3GPSA 3FQRA 2BVQB 4E0RB 4YSUA 4P3DB 3ZOAA 1PZCA 4KC3B 3E8VA 4ELMA 3V52H 4OZHA 1BLNB 2OMZB 5T8IA 3DX4A 2UY6A 5DURB 4FFZH 2JKJA 4EI0A 4UDUA 3WIIL 1KTBA 3WMPA 5I1EL 2CDFB 4YSDA 3KPNA 2BFVH 3MJ9A 2VDMB 1KLFB 1INEH 2IC2A 2X1PA 1JCVA 2CMRL 5JYMA 4LVNC 2E47A 2P5WA 4U3SA 1YVLA 3BZ5A 2DBLH 5FB8B 2FL5B 3QNXB 3SDYL 2FHFA 1U3HC 1WYJA 1VFAB 4J2QA 4ODSL 4JY6A 4YIQA 3RVUC 3S5YA 4HFUH 3GMOB 4LLVB 3X1GA 3SIKA 3N1FC 2BPBA 2QSQA 3II2A 3L4TA 1SF3A 2ADJB 2LVCA 3FRPA 3OMNB 4EBQH 2A9MH 4LBEB 1XB8A 1VENA 4XP9H 1ID2A 4WDIB 4OM0L 4LF3A 3LNIA 4MNQB 1UGKA 3C2AH 4WKXA 3S34L 5C0JA 5DUBB 4ZMAT 3HNVL 4Y1AD 1MFVA 1X5KA 4OVUA 3UTZA 1YEIL 4XAWH 3P4LA 1MJUH 4K8RD 4PWHA 3BSZH 4JUTA 4QOKE 5FECA 4I1NB 1GRWA 4MNQA 3QUXC 5JLZB 1VFMA 1E9PA 5CHNB 1E5AA 3PV7A 5BV7B 2J8UA 1X9RA 1YNTF 2HN7B 4QRTA 2XV0A 5J11C 5LBGA 1QFWH 2C9SA 4U1HA 5KANI 1OTSD 2E27H 2L7EA 3H0TA 4Y1AB 2P24B 2CK2A 1RKRA 3FFCA 2UZYB 1MHPL 3AU0A 4ZYKB 3VWJD 2E7LC 1S7QB 2B15A 2DF3A 2ZUUA 4KTEL 1FVEA 2L8AA 3PQYD 3MZTA 5C3IA 1M2VA 1E6JH 1IGIH 1SXZA 3E6HA 1UURA 2AI0L 3NK3A 4NEHB 3GHBH 5L8JB 3EYSL 4JFFE 4OD3H 3AC0A 3ZTJH 2YEZA 1ZIAA 2F2HA 3C9NA 2WQRA 1QSEB 3P11L 4K07A 3U46B 2OAAA 3BUIA 3WKNA 4JFXB 4GQ9H 4NSKA 4KAQH 3MRDB 4N87A 3X3GH 4PY7B 3SBWA 3FQTB 3VFPA 5IFAH 3NH7L 1SLVA 4FMFA 1T0NA 5GGTH 4U4IA 1I1CA 1LWRA 1EK3A 1FE8H 2UXFA 4NXSA 3T04D 3K81A 1QHOA 3D34A 3S35L 4EXPX 4V1DE 1A6UL 1A8JH 4QRFA 3RZCC 1HESA 2AXHA 1IBZA 4Z7UF 4WWKA 5CZXC 1C5BH 2Y22A 3BZEA 3T0WA 4PRNA 3VXMA 3S9DB 4ICXA 5KVDE 5MHSE 1D6VL 2AMUA 5EWIH 3EFOB 4HEPA 3II3A 3EO1B 4JKLA 4UT6L 2OYLA 3GJFK 4Z0XA 3BGFB 3MJWA 5FF6B 1OAQL 2WZPD 3SDAD 2K4AA 2YA0A 5C08D 4MD5B 3D4CA 3WS3A 3MLWH 4MXQD 4KKLD 2WIIB 2GSGA 3L3JA 3T2NH 3WNLA 4N8UA 2JKRM 3NZ8A 4G8EA 2FJGA 1U33A 4QHKJ 1OE3A 4D9QE 1IL1B 1SHMA 4GRWH 5EO9A 3GO1L 2EDEA 4GP5B 3TFKC 4XX1E 4R7LA 4NDMB 3L5XL 4P2OD 3BH9A 5KBDA 2X70A 3QIWD 4ZOBA 1DVTA 4H88L 2BNRE 4XVSH 3TS8A 4A38A 3L3OB 3PPEA 1R5VB 2B77A 4IOIA 1MUJA 1QSEE 4IMKC 2GJ6E 1L9NA 4KKBC 3IBEA 3QO1B 1AJ7H 1AZVA 1X5HA 3G6AA 5T3ZL 3K74B 1EJFA 5JPNC 1J0KA 2VQUA 5F7YC 1BQLL 3DBXB 3QWQB 4LSVL 1HH9B 4WI7A 1R0AH 5T5FH 1UJ3B 1MREL 1QBMH 4DPBX 1S7UB 3ARUA 4X2UA 2Z9TA 4ELME 4D7PA 4FG6D 3CUPA 3O2DH 5HHQA 3NIDF 2FEEI 4PY8I 5KVGH 1JK9B 4UI2A 3PU7A 3C6LA 3MGAA 2MFNA 1X7SA 3FUJA 3BHBA 3K91A 1CD1A 4PJ8A 3B34A 4TQEL 2NRDA 1XFPA 2R83A 3QSKB 5DQDL 4MMXC 1GGIL 1PZUB 1QUNA 5TD4A 1T21B 1HIMH 1D7CA 1UH4A 1QBLL 1ZXKA 1RIHL 4TL5A 1EJ6A 2OM5A 2QZQA 1ICTA 4O9HL 4JQXC 2Q7YB 3T77A 5EIIG 5CEYB 4HT1L 3OXRB 4F3FB 1ED3A 2IALB 1QLFB 1WTGT 3MFGB 3TBVA 4F15C 4IOFC 5A2BA 5CMAA 2XZCH 1OOAA 4GMSL 2AEWA 2FCBA 4JFSA 2YOAA 1E5CA 3CD4A 1L0YA 1AOHA 3QVAA 4LCUB 1HH6B 4MA7H 4Y4FC 4Y5VA 5D7KD 1C08B 3NG5A 2X5PA 1U92A 2VC2H 3ES6A 1BX2B 4ZMTA 2R1YA 4J8RA 4OZFG 1EZLA 5GS1A 3N42B 3MGTA 5DJYB 1N7MH 2J71A 4UYQA 2A0LC 2F19H 3HPLA 3HG4A 4AM0B 2ATKA 5KVDL 4V11A 5I1LB 5JXAL 4JFEE 4TUOB 3CWGA 2ZCZA 5AZEH 4W93A 3ARWA 1XCQA 3BN3B 4B60A 4HG4J 2PP9A 5JHLH 1HSAA 3Q1SH 2XN9B 4I9XA 2MNUA 5SWZE 3RWFA 2XXCB 4G1MA 2FR4B 3VXUD 1OTUC 3P9MB 1WGOA 2WMPA 4PJ9B 4UQ3B 1P7QB 4OIBA 1JHKL 3VD7A 2OP4H 2Q7AA 2UXTA 1DJGA 3EGXB 3HG5A 5F93C 2BH0A 4A1IA 2O5ZH 3KL5A 1EV2E 3UEZA 5IVNA 2Z7UA 5HGDB 5TDOB 1T0OA 1N4XH 2NW3A 1FG9C 1UD5A 4YSRA 3RKPA 3L9EA 1ROWA 4HS3A 4KU1A 1TYEB 1E6OH 4DVRL 2D3VA 1W91A 4LK4A 1N3NA 2HX8A 2HJLA 1EHLH 4KI5C 3GMLA 4Y2NA 2P26A 8FABB 1EERB 4FTVD 2JLLA 3O9WD 4IU2B 3CPLA 5T1DH 2OA9A 3NFNA 2V5MA 1KFGA 3PWLA 4PRPE 4LSTL 2QQNL 3EO0B 1UB6B 2N1TE 4KOBA 4KUCF 3DK0A 2R2BB 2ALAA 2VDOH 3IDMB 4YSCA 3QORC 5MENA 2WXFA 3NN8A 1MI5A 3QNFA 1NANI 2EIKB 4XI5C 1BF8A 2IXQA 2GFBA 1QX1A 5SX5K 2GC7C 2VDMH 3EGSB 1IGTB 4PGDB 4ATWA 4K73A 4OGAC 2XQYG 2MSPA 4M3JA 4FXGA 3LDBC 2K3TA 3MOQA 3O3BA 1DQLL 1RK7A 2LHAA 2CPCA 4FL4C 2J57A 2VLRA 4KKCC 3RY6A 3U4BH 4X4MA 3ZQDA 3WDHA 4PAZA 2DRUA 1BM3H 4NQCB 4OGYH 1CLZH 3VD0A 4GKZA 1JZ5A 2CUMA 1SYSB 3RDTB 3PJSB 4G43B 3VNYA 3CN1A 4X7SH 1O9VA 1U58B 2RGSA 1Q0XH 4DN4L 4NBZB 1SUHA 1K3IA 4JRWA 4QAMB 4QTHA 3WDIA 3WUWG 4LLYA 5K1NA 2IQ9H 4RGNE 3WI9A 1PAMA 3CX2A 4WRLA 2ZCLH 3RWEB 3RWGB 1X5IA 2G60H 5CCKH 1DLHA 5AW4B 1SM3L 1D6EB 5E7FA 4P46C 4QXUH 1Z9LA 4TXVB 2PXYB 1N9PA 1PD6A 1NCHA 1MFEL 1YY8A 1A3LL 1DSYA 4JFED 3BWUC 4KO5A 1A9EA 1F90H 2ZG2A 4G8AC 25C8H 3EZJB 4HBCH 4NCDA 3JWNC 4NNXB 5JIMA 3R06B 1XGQB 2ICWJ 5J57B 4R7NA 3MACH 3CXDH 1W6LA 2O6DA 3ALWA 3C87A 2QQLL 3AT9A 4JO2L 4MCYB 3TV3H 3N6YA 5CJQL 2Z8VC 4FFYA 4I0PD 1OAZL 4NIKB 4BWWA 4CGUB 4UQCA 2OSWA 4KHXL 4PV9A 4L8SA 2A38A 4PBXA 2YAEA 5FX3A 1NPJA 4NJ9L 4GG8A 5CGMA 1XSIA 3LKSB 5JR1H 4PM1A 2D4FA 5I15H 5DEFB 2VR6A 4WEEA 1L3WA 4A68A 4X6BB 1DJHA 4YQXH 3BEVA 4UWQB 2ZXAA 4KKBD 3HOGA 3MXVL 2FZ3A 2N7SA 3HBQA 4JM4L 4M03A 3QXAB 3QZLA 1G4MA 2F5AL 3DTUB 4WSGA 3VQ2C 1FFPA 1R3JA 3ULVH 4JDTH 5D5MA 1TTUA 3CE1A 5D5ME 2R69L 1KBBA 1WAAE 2JJWA 4R90H 3TIDB 2OV0A 1Z5YD 1AO7D 5AAMC 2RJMA 4L8BB 4LLWA 2W9DL 2DL9A 3L13A 4M1DH 4P23C 5TTRA 4L8CA 1RZQA 3FCUB 1BSIA 3ILEA 3MRFA 4CAGA 3U6RA 3HTLX 3EJJX 4F7EB 5AOLA 3QZWB 3O8XA 2XZAL 4X5PA 2CK0H 5DEGA 4CMHC 2P8LA 3WXVH 4ELDA 1NAMH 4TPRH 3KPSB 5IMOB 2IGFL 1NGZB 4KDTC 2Q76B 5HHNB 3GSNA 2WO4A 3I75B 4NQQA 5HGAA 1WDAA 5AD0A 2HVJA 1OSZB 4R2GD 1YJDH 2RFXB 4IOSA 4LDCA 2BNRD 1QLRB 4OQTH 2AVFA 4X5QA 1TJHH 3BUBA 3FFCD 4KJWC 3QG6A 4QHKI 1A4BA 2YLHA 3D8MA 3VGAB 3PWNA 4DH2A 1P2CA 3DX8A 4P5MB 5DZPA 4Z7VE 4A7TA 4MB5A 5CN3A 1A14L 3I6GB 2JIXA 1XL4A 3DX7A 4RISL 1T89C 1E4XI 2OTPA 4FYSA 2JKIS 3MBEB 1MAKA 3IBOA 1KIUA 2EYRB 4N68A 5EORH 3EJRA 2MTPA 1XXFC 2BHUA 2ODIA 2BHZA 2KH2B 3CMOH 3DMMC 2EC9U 5IUCA 4ANUA 4U1JB 4JFOA 3KCWA 1DZBA 4M7LH 4C4KO 5IEKA 2WWMD 1YNLH 3I6GA 4N0CD 5EU5A 4Z3FA 2KBGA 3LNEA 1GJUA 5D1QE 4MDJB 4BZ1H 5A3IC 2OL3A 3JTSA 2QDWA 2IOOA 1UXSA 4PREA 1I3RB 1TTCA 3OHMB 4ZFOA 1ZHNA 3O41B 1DL7L 2EUVA 1A47A 1DQQB 1T04B 4FQ2L 1Z0MA 4JDVB 1SJHB 5BOPA 2ZUVA 1S4IA 5HGBB 4O58L 2XTJE 4PRHD 5E2UL 5JDJA 3HR6A 3V95A 4AT6A 1KCVH 5BZDA 1HHHB 4UINH 4Y4KC 1V7NL 4G8GE 4N8VB 1BGXH 1NGZA 4XBEL 5HHNA 3VFGH 5JW4R 5FYLE 1YPZE 4GRLB 5ICYB 5ISZD 1CFBA 2VXQH 2HLEB 1MY5A 3QARA 5FYJL 3HKZA 4GLRH 5A2LH 2NZ1A 2KLSA 3GTTA 3SD2A 3VB9A 4LZHA 3LQAH 1S9YB 1MJJB 3DIFB 4PP2B 3MYZA 1WP6A 2D2OA 1OVZA 1ES0A 3BAKA 1KV3A 1ZT7B 4MBRA 4P46D 1OF2A 4P3WA 3SCMB 2DM2A 2LFGA 1KBKA 3MRQB 4PN6A 3DVGA 3SKJH 2L04A 1D2OA 3QFJB 4WFGE 5C0BB 3PREA 1DVFA 4JKNA 1QP1A 3APCA 1FRGH 3CLEL 1I85C 3QIBC 5DJ6A 3ILDA 4ADGA 2EIZB 4ERSH 4XNMA 2XA8L 4MRBA 5TGBB 1E4XL 1YEKL 4KI1A 3WD5L 1ZDQA 1RMFL 5I5IA 3A6BL 2OMUA 4A1KA 3VFWA 1IQWL 3MX0A 5B8CC 4ABUA 1PNCA 3GIZL 1VJSA 4YAQB 1R5WA 1J11A 5E6YA 1Y18B 1LE9A 1U8KA 2WTRB 1F1DA 4M8RA 2ICEB 1U95A 1LD9A 1UD4A 2XBTA 4DKEH 3Q6GL 4N2EA 2ZOTA 4NKDB 1SXAA 1DSWA 2RH0A 2OL3H 4F57H 3A0OA 4NNXA 2YGVA 4XP4H 2EAEA 4UTBH 1R46A 3UFIA 5LQBL 5LCVL 3PE9A 5IB1A 3S5ZA 3GZOA 5GS0C 1FO0L 1RJZA 2ZUXA 1A6ZB 2BVUA 2C4FU 3ZDYE 5I6LA 4Q6KA 1KBPA 2YGOA 3PP3H 5CLXA 3MUZ1 3QXVA 3UTSA 2IBZX 5DJAB 3VWJB 1HQRA 3SE9L 5F7NC 2ZPKL 5E95B 3QH3B 1NCBH 2HVKB 1MVYA 5L0QC 3LVTA 4G43A 2Q20A 3RY5A 4DO6A 1KTRL 1ZOXA 1Z0NA 1NCCL 4MQXC 4FXKB 1DVFB 3CDYA 1EHKB 1WZ1L 2VUOA 1TQBC 4XXCC 5I75B 5B1JA 4EOWH 1CYWA 2O30A 4IKNA 5LB1A 2OFQA 1HHGA 3JVFC 2WLIA 5FYLL 1JI2A 5DXWA 3QRGL 1Y6NR 3FQNB 5BQ7B 1KLUB 5DJXB 4PJIF 1YYML 1UVQB 4JHUA 2OMWA 1NAKL 4BFIB 3N2JA 1MJJA 3FF8A 4QKXB 3HKFA 3LEYL 5DT1H 4TYUA 5FKPB 3CBRA 4TTDD 3REWA 4ZMPA 3WNPA 2GJJA 1GJWA 4PLJD 3VFSA 2BLFA 4QNPF 1CFNB 2X53A 2XLLA 3AVEA 3LRGA 3U0PA 3ME0B 5CUSL 4PJEF 2RIKA 5E9NA 2H3KA 1FV1B 4L5FH 2FO1A 4M6ML 1RUPH 4BH7A 1MI5B 4YGAB 5F6IC 1E8ZA 1UCBH 3CXFA 3L1OH 4N8VA 1UT2A 2GYSA 3GHEL 1DQIA 1G9NH 2HKAA 4AQ1C 5JW5B 4X6DA 4WFFE 3MV8B 1CBVL 1ODUA 1QTPA 2OCJA 1AY1L 3L3HA 4R8WL 4LOVA 1PLGL 2ICWB 3FQWA 2VO5A 1IVTA 1ZHNB 3OD3A 1CU4L 1J1XH 3RKDD 4H0HB 2QVFB 1HXYA 3FRUB 2WCPA 5C07A 2J4WL 3NPSC 2NY5C 2LFEA 4YK4B 3AY2A 5JA9A 1Y0LB 4AVJA 5IESL 1BZDA 5I1KL 2BHFA 5G2NA 1WFUA 2R0LH 3ZDZB 3HCVA 4B41A 5IHLB 5BZWB 4N85A 3N04A 3T6XA 3ULVF 1QI4A 3QP3A 3CFEA 3M07A 3I6KB 3BP4A 4NNYA 4P59L 3PFUA 4MJ5A 5DHEA 5DUPL 3T0EC 4Y19D 2IBBA 3UAJA 3VFWB 1RZJL 3TNMA 3N1QC 1KT2B 3RZCA 4XP1H 3ARBD 4LCVA 2Z4TA 1CGVA 2ATKB 1H3WM 3KVDD 3QG6B 3LKNA 1L3NA 4FG6C 1PKQB 1YDPA 1KYOK 3Q3GA 3AM8A 2EABA 3DVGB 3B7YA 4Y16D 3U7YL 5DJ0A 2IG2H 1SJEB 15C8L 2DW5A 3G5VA 4Z7OB 5C0EB 1EEZB 4PJIE 1Y18A 3GSNB 1LE9B 2YKKA 1TCMA 2IADA 4TQHA 2E75C 3GC3A 4W9EC 2Y7LA 4WV1C 2MCG1 3DOHA 3QAQA 2XG4B 4PTUB 5DD6A 3DVFA 5C71A 4P4RB 3GSNH 2Y36L 3V0WH 1MCBA 2Q7YA 3T77B 3VXQA 3KL3A 4Q14A 3BWZA 3R18A 4WK4B 4XPGH 3U2SB 4Z7NB 4Y89A 2KPNA 4JM2F 2EVHA 4JS7A 4F9LC 1YN7A 1NLBL 2CRIA 3VRIB 1RUQL 3JV6B 3WO4C 1A7NL 4N1CA 4IIQA 1B9ZA 1MCIA 4OLVH 2VN3A 3IFNL 1JBJA 2X9XA 3G5ZB 3SOBH 3UACA 1CDGA 2A6KA 3QEHB 4GXUM 1DYZA 4OR1A 5GGVL 3TTSA 5HJBA 1E67A 3K1DA 3SHSA 3GSVB 1NIDA 3WNOA 4EN3A 1RZ7L 2VAAA 4KNQA 4G6MH 3VWKA 3X2QB 3ALPA 3IMBA 4UQ9A 2V4LA 4LPQA 4QYAA 1ILSA 3DURB 3GGWA 4ANWA 4L0YA 4JW3A 1BLIA 4XN8A 5D55A 4X5XA 4RGMB 3A6CH 4XBPA 3ESMA 4OZFA 2PWHA 1TFHA 4YLCA 1EMTL 4M7JL 3MJ6A 3MCLH 5D7SL 2NY3C 3H9SB 4BWTA 1RD6A 4X0KA 4EI6A 1NH6A 1CCZA 3IDXH 1HT6A 4JGJA 5DJCB 2KZBA 4ODXB 1X5FA 1J9TA 5AKSA 2WM0A 3KH3A 3RL1A 1FLRH 4GB9A 3FOMB 1M42A 3SDCB 1E7UA 2JIXD 4YHNA 1NFDB 3HZKA 4J39A 4GYBA 2GAZA 4HS8L 2VDKB 1URZA 5JHMA 5KSBB 4C59B 4NUJA 2MCMA 2YSSB 5H4YA 4WENB 1PQZA 3SJVE 3F7KA 4PH8A 3RWEA 2E5EA 2R1WA 1RZKH 2E3VA 1UENA 3FFDA 4DKDC 4UAHA 4WO4D 3VCLB 3GMRB 4KVCL 1BMWA 5IBTL 4IOSD 3V6OA 1MAJA 3IYLW 3WFHA 4W4NA 3VUAA 2JK5B 1ZGLP 2EIEA 5IVXA 5I0DA 5K9OB 5E1HB 1S7SB 1D5MB 5E99L 1BVNT 4YHMH 1Q94A 1ZD6A 4F7CB 1LM8V 1RUKL 3M17A 3NFSL 2YGPA 4Z3HA 3TIDA 4OLUL 2XKSA 5FM5O 3IT8D 2JCCB 3MA9H 2CALA 2NT1A 4JY5H 2RFXA 4Y16C 1MFNA 3TJPA 4JM2B 4PRIB 2P5EE 3G5ZA 4JVPA 3ULVD 3W11C 4LQ1A 4PSRA 4JQIL 4JFQA 3AU1B 1X4ZA 1FI8C 3OG4B 4GW1B 1A7BA 3UPRB 1ZHBB 4H20H 1F42A 3IMTA 1N10A 1P4LA 5DEFA 3SKNB 4KNTA 4WHYH 4ZSOA 1XGPB 2IXQB 2VN6A 4BUQA 3EXLA 1RZIB 3E7JA 2ZXEB 3ZTEA 2YWZA 1B0GB 3VCLA 1ZJBA 3QJTB 4A2MA 2IDCA 4Z1PA 3PWLB 3AAZB 4KJQC 2H3NA 4Q6IA 2ZF9A 5D1XB 3NEOA 1A22B 5JQ6H 4PJDB 2Q8AH 1IM3D 4QRRD 2Z0UA 4AV5A 2G75A 2XFXB 1YDPB 3HG0A 5DMKB 1NFDA 1QFUH 4A04A 3ARXA 1CR9L 4CC0A 3LKNB 3LHAA 1MJ7H 4AYGA 1MWAA 2JQMA 3D25A 4OF5A 3EG9B 5C0AA 3TJEH 5F70A 4EI6B 1ZA6B 2VQTA 4DKFH 3TU6A 5SWSB 2WUCH 5GGRB 3MBEC 4K7PL 3EGXA 4OCRH 1BF2A 5DRNB 4L1TA 3KAAA 4TKWA 3MLXL 2JCCE 4G1MB 1AGFB 4PS7A 4R5VA 2Q7NA 5DZVA 5A2IH 4P46B 5GGQH 2WQXA 2A83B 3C60B 1F02I 5FPIA 4XNYH 1NC2D 2BVOB 2ZWSA 2E56A 3QUZC 4GIOA 3UO1L 4BKLB 4F37F 1MDAA 2OXGB 4FTDA 5DQJA 3EJPA 5D6DC 3KDMB 3L4YA 4YFEA 1YY8B 4MGXA 2DQGL 3UBXB 2QFPA 2P80A 4XMPH 1CYXA 4XE5B 2OLDA 3G5WA 3S37L 2R1XA 3KBHE 5BVJA 1IGCL 2D2CC 1HKFA 2NUTB 4WI0A 2GJZA 2K78A 3MRKB 5JW5A 2Z4QA 1AGDB 5FA3B 3T0DA 3AY4A 3B6SA 2GUOB 12E8L 4WVRA 3AMLA 3MNWA 4NQSB 5CCGE 2WB7A 4OFYD 5J12C 2X7LA 2EIDA 4L4VE 4NRZA 3U0WH 1NOLA 5AYTA 4AWJC 4ZW8A 3L4CA 4FTVB 5HHMD 3VXRD 5CGTA 1EEYA 2VSMB 4Y2DB 5E2JA 2WNKA 3MRRA 2BSDA 5DD6B 3FU7B 2FX9H 1VCBC 4M1GH 4X98A 5L8KB 1HWWA 4P5TD 2Y2TA 4QNPE 5IMMA 2G5UA 1BD2B 1UA7A 3BHBB 2WKGA 1YJDC 1F1AA 3D87B 5FYJE 1G9ML 3ARSA 3Q3GB 1OWWA 4JKPH 3SKMB 3ZMNA 5C0DB 3OAZK 3ETTA 5HVWA 4V1DA 3VXUB 1X9LA 3PWVA 4N2KA 4NT6B 3VFOB 1MW3A 4P5TB 3UTTA 2Q1EA 1FYHB 4OIIH 1AZNA 2DQTH 4H8WL 4NHCH 3HC3L 4TNWF 5J7CC 1NEZG 2R2HB 3QO1A 3A24A 4GQPH 4RMBA 4BFEA 4ZMLA 5C0GA 3SPJA 3NRPA 3U9WA 3APNA 3BP7A 1UB6A 4LHUB 4WW1B 3P9MA 1C5CH 5C6TH 4BEIA 2AJUH 1ETB1 3CPLB 3S98A 3D4ZA 2PKDA 4RAVA 3QUYA 4KGLA 4WIQA 2GEEA 1WT5C 4JO8A 3T6QC 1PFOA 3E80A 3F01A 4OI9A 5G4MA 3OF6A 3ATAA 4Z8FL 1GGTA 3AUVA 4IBQA 5AB0A 1IAIM 3MROA 4D9QD 2VAJA 3LPPA 3RWHA 5KBLA 5DS2A 3OX8A 5DHDA 2IIJA 4YSSA 1GIGL 1LP9A 4N9OB 3P30L 4HWBH 4XN1A 5HDWA 5KUKA 5IOKA 3O81A 4Z0XB 2WYIA 3OLGA 4HULB 3T8MA 1PD1A 2UXVA 1LD9B 5GZOD 1QFWI 2IPKA 5H37A 3PWPA 5FWQA 4PJ9A 4Z7WE 3WMQA 1V54B 3NOIA 4IMLA 3D7PA 5ENWB 2AK4E 2I9TB 4IKIA 3KR3L 3T5WA 32C2B 4F3FA 3QQDA 4KJPC 2VIRB 1EHAA 3NJMA 3WIAA 2QPUA 5BXFA 3ZTJG 3BGAA 4EKXA 3G5YB 1LE5B 2FK9A 4L4TA 5DCCA 3RIKA 1KEMH 2V17H 3H85A 1TZGH 3VFSB 4PCSA 3V7AE 4OD2B 3FQXA 3QJZA 4HIEB 2YRPA 4ANKA 5TH2A 3V0IA 3MGTB 1KJ2L 5IJVB 4OGZA 1IEBA 3MRDA 3OR6B 1EANA 2BMKB 2R29L 4LCUA 2F7QA 5TE6H 2JQAA 3FUDA 3OPZH 4MD4B 3GSQB 3KJ4C 2FX8H 3GNML 2YMXH 3KYAA 5IFHL 1OARL 1CXLA 4BV1A 5PCYA 2X2HA 1A7OL 1DBML 3MA9L 4N0UE 3EH3B 4A7SA 2ZXBA 3ZLQC 4CVXB 3EW3B 1J1PL 1RUKH 3TOPA 3Q5YA 1DE4B 1V10A 3TBSB 1I3GH 1NDTA 1WE5A 2X1QA 5M7QA 1OCCB 3P54A 2OK0H 1NBZB 3CH1A 4N24A 5HGBA 4PGEB 5AAMA 1NKGA 1KIPB 4PRBB 3CFJB 3HG1B 3K6OA 4KVCH 5EZOL 4UV7H 5HHOD 1U30A 1T1WA 5J3HD 1C12A 2KPWA 4MB4A 1VSCA 5HI3D 3E0GA 2FJGB 4EI5C 1QNZL 4KI5D 3IXTA 6TAAA 1TETL 1EFXA 1S7VB 1TCRB 5ITFB 1EXUB 3IMWA 1GSKA 4P4KC 4R2GC 1ZGLA 1AC6A 3PDOA 3B2UD 3A4FA 3GZQA 5HYQA 2ZJSH 3J7HA 5CXPA 1L9PA 4F8PA 1S78C 5IFJA 1BQ5A 3SDXF 4NUMA 3SODB 3QEQB 4JR9L 3D39A 1XAKA 3T0VA 3F7YA 3TGXA 4N26A 3TA3C 5DRZA 5JOEA 1U8CA 4M7JH 4OGQC 2CGRL 4FLOA 4KKQA 3MCKA 3BX7C 1DR9A 1NEZB 5DO2D 5DRWB 3JWNE 5I1CL 1GAFL 5LGJA 3Q8FA 4ENZA 2YPVL 1HEZB 4AIXA 3R1GH 3KPSE 4FJ6A 2PABA 2VW7A 1KLFA 2VKWA 4KRLB 5FHBL 1BF5A 3S3PA 3V9EA 3L5WA 4OFVA 3ZT5A 5CEZL 1T03H 3LPWA 3QB7C 3PP4H 3TNNB 1A4CA 4LASH 1ES0B 1NUDA 4N0UA 4U49A 2A74A 1CFSA 2WTOA 1WG3A 3AFLA 5F7DB 1R9FA 2P48B 4MQ7A 1KWKA 2DM7A 2Q76A 4OZHB 3BLBA 5GGVH 1BQHB 2O4EA 4I7ZC 4M8QA 1KGIA 4GUPB 5FS5A 4YR6A 4YDVB 5BO1L 3WTVA 4U1IB 4MXQC 2CLVB 2DLFL 3HHSB 3PV6A 2VR7A 4R2GB 4HBQA 4AYFA 1NLBH 3K71A 2QVKA 1IEAB 1FNGA 2NX5B 1UXWA 2QHLA 4QY8B 4U6YB 3BAXA 1BYNA 2VLJA 5AOKA 1RAMA 2ZKYA 3VFPB 4NO0A 1UZ6E 1JNJA 3HC4L 4PRAA 4KZEL 2ZWNA 2EH7H 2NCMA 2DYSB 1OHQA 5CGBA 2HG5B 4I48B 1NC2B 3Q01A 1H8LA 3MUHL 5ALBH 1T5XA 1A5FH 1RERA 3RTQA 2UWEB 4DKTA 4JJ5B 1AQMA 4KZCA 4E9WA 1X5XA 1FVEB 4AL8L 3TV8A 2XN0A 1MKFA 5IBUB 5I71B 5EPMA 4FLHA 3LH8A 1PEZA 1G7JA 2EO9A 1TENA 2YIHA 4ZMZA 5GIRA 1F6FB 1XGRB 4XP1L 2CR6A 5HVHB 4LLDA 1KGCD 3UTTD 1CE1H 4X8CA 5DUPH 4XCYA 4YK4C 5FECB 3L1EA 4F7MA 2FL5A 1SN0A 3PL6B 4HXAH 1EBAA 1WFJA 2APVA 4IM8A 4U1MA 5B3JF 3K6SA 3WGVB 4Y9GA 2EEDA 1J9QA 1YN6A 4D94A 3NCFB 2VDNH 2Z8WC 2EE0A 4PQXA 5IVXF 7PAZA 2AJZB 3WTXA 5J06A 2CR3A 2RTTA 3FONA 4Y4KA 3TO4D 4DW2L 4BZYA 4NO0B 3ZHKA 3HMXA 1HK6A 3L3GB 3C5ZD 4JG0L 3RU8L 4XGZA 3Q5OA 1XWVA 2LGNA 1ZT4B 1AKJD 1XIWC 3RU8H 3UTTE 5M94B 3D50A 1T3FA 1IEAA 4HHGA 4LCYA 4U3HA 2WXPA 3KLQA 3QYCA 4W9IC 3PV6B 4PS8A 4R8WH 3RFZB 2YQGA 1CF8H 1F5WA 1NGQH 3GQFA 4KMTL 1U58A 5J12B 5EO1B 3VQ1C 5HHOA 2X4TA 5EZLA 1LEGB 3AG1B 1IGYB 4KI5F 2PMZA 4J3XA 1ET5A 4FLQA 2EXYD 3FN0H 1DQJA 3B3BA 3D9AL 4GAGH 5C0CB 3IN2A 4PJAB 4YHYB 3TX4A 2P49B 4BZ2L 4G2AA 4NC0B 3B1UA 1F86A 1W8NA 1LMKA 2OJEB 2QR0A 3MJGX 1TLKA 1Y1UA 5J13C 3T3MF 3OKEA 2AKRB 2ED9A 3RI5K 2FNWA 1QQDA 1W0VB 1NAKH 3K3QA 1WA1X 3H3PH 2H1LM 1KLGB 2WOBA 4M43L 4P3DA 1CDCA 3ILPA 2XFGB 1IGTA 1WA0X 4PGDA 4PIRF 2CDGB 1JMZA 4BCYA 3NJVA 1AYOA 1A1MA 1D5XA 1QEXA 1TEFA 3FU8A 4FEIA 3WNNA 5J9PA 3S36H 2G4GA 4X4ZA 5EOQL 4JRLA 5GISL 2Y1AA 1CGTA 1PU0A 4AEFA 1NFDE 4L3EA 3GEWB 1UCTA 3OR7A 2PYEE 1NCBL 3LB6C 1K2DB 1E2ZA 1Y7MA 5F7FA 1WF5A 1CTMA 4E68A 1XHHA 2QADB 5E8DH 1LHZA 5CSBA 3ARYA 4DFIA 2EUWA 4KNUA 4B6ZA 5J1AB 3P4OB 3SDDB 4PJGB 1G1CA 3IJYB 3LXBA 4OCSL 3WG7B 5L88H 1RL1A 1U91A 1NM4A 4JHWH 4MNQE 4HJSA 3F65A 4XX5A 3O6LL 4QOKA 2BNQE 2JKWA 4U7MA 3RNKA 2H8PA 3V0VA 4DT2A 2NXYC 3PP4L 2NNRA 1HCFX 4XNQB 5LQBH 5TF0A 3AWEA 1T03L 3RPBA 5GZNA 3DLQR 1NBCA 4Z18A 2I7SA 2C4FT 1G9NC 4N0FB 3TBSA 3UDWC 4HG4K 4PJAE 1LP9F 3IDJA 3V5DB 5KVEL 5IMLA 2FR4A 1BD2D 4DAGL 2WWNA 5IV2B 2Z7ZA 4ZTPL 2YPVH 5LVEA 3HZMA 1J8KA 3OSVA 4BQBA 1FVCB 5IW1A 1NUFA 2VR8A 3KPPB 5GS2D 1K5NA 3TTYA 1BFVH 4F58H 2YUXA 4GSQA 1QUPA 4GSRA 1BVKB 3PRZA 1KXTA 5F7EH 2JJSC 3OHXC 1HU8A