2VC2L

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vc2L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vc2L01
2ARJQ 1DBAL 4RMVA 3RWFA 1T7ZA 2IADB 2HJLB 3MXWH 5AEAA 1HQ4B 3L3KB 1CE6A 4O4YL 5JXEA 3VG0H 2C1OB 5A16A 5C09E 5AG8A 4XVJL 2PYFB 2AJXH 2ATPA 4NJAH 3SDXE 4KK5C 1EAPA 4XPTL 1VSCA 3NH7L 3MRNA 5M95B 2Y07L 3MGAA 4HKBA 2EXYD 4H0IA 3QXDA 2V9TA 2W9DH 2JB5L 5AWNH 1Z5LA 1WLHA 4J3UA 1S9YB 4TTDC 4TQEL 4NKOB 1N2RB 5DUBB 2PTVA 2FX9L 3IAPA 3N1GC 3TCXA 5IGXL 3OXSA 3IF1A 4EQ2A 5HI3C 1EXUB 1JTTA 4G7VH 4ERSL 1U8QB 2Z0BA 3O4OB 2OYPA 4LCWE 4PJDF 4XPHH 4OZIB 3L3JB 1UADC 4NO2A 3REVB 5DRNA 1H5BB 1F58H 4XCEB 3VGDA 1A1MB 2QSCL 4JPWH 1CFTB 1DN0A 2AXGA 2H1PL 5I8EB 5C3LD 3B9KB 1HHGB 1UG9A 3QRGL 4OCRH 2ZOLA 2R0ZL 4LPVA 4MA7L 5HYJB 2ZJSH 3MBXL 1KSRA 3L3OA 3R4DA 4FQ1L 4DK3A 3MFFB 3ARDA 2YD4A 2P5EB 4ODVL 4H1LH 3OKMA 1G7LB 3P0GB 2Q6WA 3B9EA 2ARJA 5D1XC 1IE5A 1KB9J 5D1QD 5F9AC 1UWXH 1FNLA 4JZJA 1ZK9A 4EUPG 3RHWF 3GM8A 4Z78A 3P9LB 2GY5A 5IVNA 5JA9A 5HHVL 2DN7A 2WLZA 2SEBB 3BUYA 5IJKC 3D0VB 3LKRB 1BMGA 3EDJA 4FABL 2NY1C 3DROB 1GIGH 2VQTA 1YEGL 1EK3A 1ZV5A 3S4SA 1YEEH 4NYLB 3ZYOA 2FWOA 2FX7L 2EIZB 3K46A 1C12B 3G5VA 4D3CL 2Y9RT 1L7TH 5D8JL 4KKCC 5K9OB 5TFSL 5IW6A 3NABH 4H8WH 3QP3A 3HB3C 4R9HA 4BZ1L 2NMSA 1JPFB 3V4PL 3WL9B 3QIBC 4Y5XB 5KZCB 5FUCE 4LQFH 4PUBL 2ZKHL 1B0WA 2Z4QB 1DQDL 4WJ5A 3C2SA 1HH6B 4P2OB 4HXAL 2D03L 4I3RL 3PHQB 4QXGH 2VLRB 5F6HJ 2PYEE 3GSWA 3OB0K 1JPTL 1WTGT 1MJUL 2AQ3A 3STLA 2NY7H 1R3KA 1EHAA 1R5WB 2BVQA 4UBDD 4LF3A 1IRAY 3RVVC 1NBYA 1IM3B 4PJXB 4P99A 1FGVL 1CLOH 1ONQA 1WBZA 2J8UA 1YYLL 2UZXB 2ZUQB 3VXUE 4KGLA 1HN1A 1YJDC 2FECL 5KSBE 5C0GA 4BH8B 1EO7A 4UU9A 4F8QA 2QHRH 3ULVF 1L7IH 5DJXA 5EU3B 2YZ8A 3T4AB 3HUJE 2HT3D 1J11A 3QRFM 2GTWA 4JY4B 4X6CA 5DI8A 2VXSL 2CUMA 2C3VA 1BJ8A 2J8UE 4OQTA 4ODXA 4JFYB 3FQNA 5FAAA 3RWEA 1MHHA 4YHKL 3ZTNL 5EOTB 1HWGB 1XIWD 1ORSB 5JOPD 1GCFA 5HDBE 3F8UB 3JV6A 4J3SA 2X7LA 1G7HB 2AK1H 3LN5A 4O00A 4KZDL 3TNNA 4WU5A 2OJEB 1G6RB 4NNXA 5KSVA 5DJYB 3BRGC 5EPMA 1KB5L 1UWXK 2Y1VA 5DD0H 1I85C 2HFGL 3IFOB 4NRZA 4POZC 1YNLL 2HVJB 4BSVB 3WFDH 3V6OE 1NAKH 2D4FA 1M7XA 4Q97A 4Y2DB 1XGPA 5I1AB 3VD9A 2ADIA 4XNXH 4DEPC 4QOKE 1DE4B 4OF7A 4HXBH 4PRIE 2VR5A 2YK1L 3NCEB 2ICWI 3W9DA 4YHZL 2NZ9C 2LTQB 2Z35A 1AJ7H 5I0ZA 3L6FB 4HF5L 3ZE1E 1BAFL 2J88L 3TJEL 1BZQK 1IQWH 1MFEH 1JMZA 2EDQA 1VADA 5GHWL 1QLFB 2DQUH 5J3HC 2D7PA 5HXMA 4OTXL 3BQUA 1U8NB 4UZGA 5D72H 4WW2A 4WTZA 3VFGL 3A67H 5MEPA 1DUYB 1U3HB 1I3VA 5EU5B 1FV1A 1I3UA 4GXUM 3O11A 3ROOA 3MJ8B 1YQVL 4YDJA 3T77A 3LIZH 1RJYA 2DYPB 3BEWB 4PJAF 3DX8A 3GUTA 4S1QH 3DXAD 3G9VA 4R4FH 4YX2L 4QRTA 3LQZB 4RGNB 1JYXA 1EDQA 3TC9A 4X4MA 1ZT7B 2WBJC 3GMRA 4LIQH 5EU6A 5EWIH 4F58L 2GUOB 4UT6L 1ACZA 2AJUH 1NMAH 3I50H 4XPBH 1XCTA 5HHMD 4QEGA 2QKIB 5HHNA 4PRHD 4GW1A 9CGTA 3R8BB 1QO3B 5I6XB 4FXKA 1U9KA 1YMMD 1CDGA 1PSKL 3ARFA 2BDNH 3ARBA 3QDGB 2DL2A 4OZFA 4V1DA 1E28B 4QGYA 2VO5A 1CVSC 2D2OA 4KTDH 5E0QA 5EH1A 3WHXA 5DGRA 2BNQD 1HI6B 4N1CA 5T1LD 1FLTX 3SGEH 3QEQE 4G5ZL 1AKJA 3EOBA 4AIZB 2BHZA 2V7HB 3PWPD 4ZO6A 4LSUH 4V2BA 4V1DE 3H9SB 3I9GL 2W60B 2EDRA 5FA3B 4MQ7B 4AL8L 5A3ID 5HDQL 4U7KA 1KJ3H 2IMMA 5CBEB 5I9QB 2BSTA 5CJBA 2P4AB 4S1SH 4EIZC 2XPGB 2JJSC 1GAFH 2VC2L 3KGRA 1INDH 2HJLA 4WCYH 3ZL4H 1KELL 5GGVY 2LU4A 3FB8B 1R5VB 4NZTL 4TUKH 4QRPD 4QNPF 1F3JA 2PYFA 5T3ZH 1C16B 3VXRA 3O9WD 1TQCB 2J4WH 5TE4L 5SWZA 4DGYL 2FL5B 1JRHL 4CADB 2YHGA 1J9CT 4MD4A 4F7PB 4RCAA 3IYLW 4P23B 1U58B 1YJDL 4ZDHA 1TCRB 5DQJB 1X7QA 1L9NA 3DRTA 4ZFGL 3JXAA 3CSGA 3SKMA 3GHEL 5E7BA 4LMQE 5DUBA 3H9HA 5F96H 3EOAB 5D9SA 1CD0A 2C5DC 2R39A 3EYUL 5F9JB 3IDGA 4YC2B 5FM4A 3VXRE 3UTZB 1FN4A 1ZWIB 4IOSD 3PWLB 1U8QA 5CJXC 3EO9L 3B2UC 3DOSA 2PO6C 1I8KB 2QSVA 3O2VH 1JPGB 3F65A 1A1MA 1DQMH 4TYUA 4ODSH 1N5YH 4MQXC 4BUHA 3FCTB 2Y36L 4GS7C 3T1FB 1VHPA 1UZ8A 2H6PB 4LSTH 4X9BA 2EYRB 1SYSB 4U1SA 2DQHL 1N4XL 1NGPL 1K4DB 4OZIE 4XHJC 1U0QA 3BPOC 1ERNA 4L3AA 4JEGB 2P7TB 2FATL 3WXVL 4LL9A 1JZ3A 1A9BA 1CFNB 4UOW0 3QBTB 3V4UH 3ROLA 3QCTL 3HAEA 5T1MA 4HHAA 1VEPA 5TDOB 3MBEA 4F2MB 3DUUB 5HYJE 3O6LH 1IC5L 1QKZL 1OP3H 2DQDL 1DQLL 1HHHB 5DQ9B 1UB6B 3P9LA 5B4MC 3FB7A 1J8HB 2JJUA 2BOCB 3ZE2F 4KMTL 2QBWA 3Q2CA 2OLDA 1A0QL 4GAGH 3QUXB 3D0VA 5HVHB 2ADJB 5L2KD 3UROR 4MB4A 1PKQB 3KLDA 3DROA 4S11A 3PV6A 1N6QL 4N0YL 1J1PL 1JVKA 4HX1B 1SBSL 1RIUL 3NH7H 3RGVC 1AE6L 3HCVB 3VWKD 3WS6C 2A2QT 1LO5B 1AXTL 1C12A 2JB5H 2H2PD 3CU7A 3Q6GH 5TGBA 3U30B 3NACH 1TTGA 1F5WA 4OCSH 4XNZC 1HQRB 2DQGH 2J5LC 4TVSa 3TBWB 3QHZL 4ERSH 2HAZA 1JZ6A 4P2OA 5GS1B 5CCKL 4D9RD 2UY7A 3F6LA 1GZPA 5C86A 3ES6A 3NCYP 4TULL 4ZO9A 2NXYB 5T3ZD 5E8PA 2QSCH 4F37K 1R5WA 4YDKH 3HC0B 2X1OA 3QRGH 1IM3A 4HIHB 4PJXA 2D0FA 3VWJA 3O6KL 1S78C 4M1DL 4BH8A 4D94A 3P4OB 1PY9A 1LQSR 1UM6L 1JGLH 4FQ1H 4JQXC 3R0NA 3RZCC 2VLRE 5FGSA 1CGUA 2FYYA 3GRWL 2C4FT 5I8KL 3P4MB 1OGAA 1A3RL 2R1XB 4PJXE 3DX6B 2VXVL 3SDAD 4WI3A 4Y5VA 3LHPH 3WFEL 2Z9TA 1HIML 1I1AD 2ORBL 4RFOL 3HE6B 2NLJA 5EOTA 1BFVL 1T2JA 3EHBD 4LCUB 4KQ4L 5E2WL 2EECA 5ICZB 3QHFL 1G7HA 4YDIL 3TEUA 3EO0B 4OD3H 1B0GA 5L7XH 4EVNA 1IGJA 1LGVA 4M93B 3TPUB 4P5TB 4XWOC 2OMBA 4MD0A 4D0BA 1SM3H 2NY3C 2HVJA 4BSVA 3D85D 3FFCB 2G5BA 5I1AA 1KJ2A 1ZHKB 3G6AB 4PV8A 4CW1A 4N0FB 5LGJA 1HSAB 3GIVB 4BZ1H 5SWSD 3V4PH 4GG8B 1DE4A 3IU3A 3W39B 1QLEL 4X6DF 3HC3H 4BQ8A 1DL7H 4JREB 4KTEL 1JE6A 3LV3B 3IXTB 1IL1B 3M8OL 4NRYA 1T3FA 5LJYH 1EHLL 2OK0H 3BT2H 1KXTB 3NFPA 4ZUSA 5MENB 1BFSA 3SO3C 4JHZA 2QTEA 2R15A 3F12B 1XGTA 2DMBA 1FDLL 3AROA 5ITFB 1FGVH 1BQLL 4HKJB 4JY6A 5HHOB 1C8PA 2CK0H 4JFXB 4GFTB 4GRWE 5ESQB 4P9ML 2C3GA 2P8PA 3WSQH 1QBBA 5ID0B 3DMMB 3SQOL 1KCRL 1OP5H 4CAGA 3BDBA 1EX0A 4YDLC 4FQ2L 1WWBX 1RSFA 2YMXL 3MJ8A 2VXSH 1A3LL 4P9HC 1F6FB 4WFFD 5C08B 3LKSA 5F89B 2EC9T 1N59A 3INUH 2WUBH 3WKMH 2ESVB 1T83C 5E5UB 3LQZA 1BBDL 1U92B 5TQ2L 3PL6B 4M6NH 2IAND 5D2LB 2YXFA 2K9UA 4NZUH 1TZIA 4KVCL 3RIAK 3ZE0F 3WNPA 1R0AH 3T0BA 4KY1L 2B0SL 3FHQA 4G7YH 1DR9A 4U7MA 2AJ3A 1T0MA 1QSZA 4LCIH 3AB0B 5K9JL 1KB5H 2FO4B 1EJ6A 4RGNE 2HFGH 3OV6A 3ULUC 3IGAB 2PKDA 4PRPB 1KIRA 1A7QH 2FJFB 4NNPH 5C0IA 2OI9C 3IS1X 5FECA 1VCAA 4UV7L 5BW7A 4AM0B 5C0JB 2XNAB 2ICWJ 1IQDA 2XKSA 3HZMA 4NC1C 1CLCA 2CR6A 3BPLC 2XWBA 1BGXL 3SDYL 4HG4K 4FQLL 3ARRA 1KJVA 5FA3A 5IMMA 4M43L 2EICA 3JV4B 4M02A 3SGEI 4HF5H 2XICA 5DT1L 5TDPB 1K4CA 5DO2C 4FG6D 3TJEH 4MLSA 5DTFB 5C07A 3GFUA 4HC1H 4Y5YB 1BF2A 4CMMA 4LVHB 5GHWH 4PB9L 2R69H 4DWHA 4JKPH 3K1DA 2C4FU 1GC1C 1MEXL 4EZMA 5J6HA 1KIPA 2I60L 5KSUB 3MNZA 3D9AL 3MA9L 3PP3H 1E4WL 4YH6A 4DKEL 1O7SA 2YUXA 2DDQH 3MJ9A 1LE9A 1ZA3A 2QLVB 3K1KC 1MCEA 1BECA 3K2UH 5A2FA 2CMRH 4LAQH 1T7WA 4RFEA 5ICYA 4N5UA 2WUCL 2AEPH 5IVXA 1JWMB 4ZSOB 5DQJA 1WCQA 4LQ1A 4FQXB 3ULUF 3SPVB 4QHUA 1LEIB 3BKYH 2W91A 1OP5K 3UTZA 3VFWB 5JIHA 3PWLA 1YECH 4GKNA 4OZGA 5B3JF 1MCSA 2CIIB 1D9KC 4RGOH 1HK6A 4K7FB 4I18B 2EDWA 1JPGA 3CLFL 4XWGH 3SBWC 3AVEA 4Z9KB 1FL5A 5GGRB 1PD6A 1U93B 3ULVH 2R2EA 4U1IB 4NRXA 2H6PA 4URTB 3DX7B 2F53A 3QEUA 4HK3N 2VR4A 4K3EH 6FABL 1WT5A 3QQ9C 2I26N 4XX1G 1K4DA 3DX9A 3EJJX 4DUWA 4WFGE 3T65B 1RHHB 3B2VH 1YNTB 2JCCA 4OIIH 1XEDA 1J1OL 1FSKB 3UJJH 4WGVB 5LKNA 4GRLB 1FYTB 1CFVH 2F8VA 3HMWH 4Y4HC 1OAKH 1GGBL 3V0WL 1NEZG 4Y7MA 1L4IA 4YFLF 3V52H 3MA7B 1G6VK 2QADC 3SGKA 4GMSH 1Y18A 5FM5O 2L0DA 1S7UB 4X6FA 1UB6A 5DQ9A 2JCCE 2VC2H 1XZ0B 3P3YA 1J8HA 4NCC1 3P11L 3T0EB 1I75A 3KPNA 1OTSC 1FE8L 1I1YA 3RHWK 4HEME 3QUXA 1A9EB 4NZTH 4P46B 4O2EA 1CDUA 1QVOA 4OAWA 2QJDA 4L8SB 4LP4A 1WC7A 4U1NB 4J3WA 3UTPD 2WZPD 1CT8A 1J8HE 3MUHL 4IRJD 3NZHL 3PP3K 4J8RB 3TBVB 4ONGH 1J12A 4ZYKB 4ZFGH 1SEBB 2ED7A 4YR6B 5ACLA 4NQUA 4DCQA 1GOFA 2YWZA 2XTJE 1PKQE 4WY7H 4X4ZA 4HUUB 4BSJA 2JIXB 3FT4B 3MO1A 5HI3D 2NW3A 5KOVC 4G43B 4P9HL 4LCCA 4EI5B 4NP4H 1T21B 4N90D 4Y8AA 4DN4H 5DRXB 1NFDA 4LSRL 5CP7B 2EKJA 3HC0A 2Y36H 4B7IA 4WFEE 5JMRA 3TYGH 2A77H 4I3SH 1CXLA 3FQRA 4F9LA 1N4XH 4HS3B 1YA5A 1YEFL 3N85H 3PE9A 2DI9A 1CTNA 3NPSC 3QAZB 4FRWA 2CLZA 5I1IL 1Z2KA 3DETD 4JRYB 5IB2B 4I5BB 3QNXA 3ULUL 2CGRH 4R4ND 5CZKA 5C6PB 1FG9C 2GSGB 2JE8A 1WQVT 3V6ZB 4OLUH 2PCPB 4PS4H 3MROB 4A6YL 1IC5H 4XC1H 4XGZA 3ULVD 4O58L 4JFHD 3KWWB 1IAIH 4LCUA 5IM7A 3GEWB 2EEBA 4MCZB 1VDGA 3UAJC 5E8OA 3EO0A 4UAOB 5L9DL 2XT1B 4FFZH 4LLMB 3LEXA 3SE9L 2DQCH 5KAQG 4IMKA 1N6QH 1HH9B 1FNHA 1F90L 1KCUH 4O5LH 4MX7B 3VD5A 4PJ8B 5TPWL 2PTTA 5ADPL 1GC1L 3OR7A 4P3CH 1PBYA 3QUZC 4H20H 3U4EB 5F21B 1A21A 1MCNA 1WAAF 1U91A 4N0FA 4RISH 2P46B 3GIVA 4LCYA 4L1DA 2Q76B 3NA9L 2HRLA 4XPAL 4ZXBB 5J13C 4PJCA 1X5JA 5HD8C 1VGKA 4S0SD 1QFWL 2COQA 4O2FA 1LEKA 4D9QE 4L29B 3OG4B 2QV2A 3IRZA 5HYSG 2ZCLH 5E00A 5MENA 2GIYA 5I1LB 3FFCE 5DHVA 5A2KH 2APWA 2NXZD 2ZOKA 5LGHH 3DURB 3RVVD 2ZCKL 4HUVB 1YNKL 3GJFH 5INDA 5BO1L 4HKJA 3KYNB 4P4KD 4R7NB 1G9MC 4GXUN 2UZIL 5A2LH 3EIFA 3GSNB 4EJ1C 3V6FA 1UM6H 1UEMA 3WUWB 1LK3H 4LBEB 5FHBL 3CNKA 5MENE 4P59H 1BEYL 2DBLH 4U0RB 1MWAH 1BQHA 1VFOA 4L3CA 4WTWA 1W0VA 5I8KH 3J8F7 4K55A 3WFBH 5EO0B 3OR6B 2I5YL 5AZ2L 2VE6A 3LB6C 5HHOE 3EGSB 4LEOB 4LLDA 1AIFA 4ZOAA 3WFEH 1SJXA 4Q9QL 1HIMH 1YC7A 4LU5L 4NN5B 5I2IA 1KEGH 2HVKB 1QR1B 1M7DB 3VXSD 3I2CL 3ARTA 4WNQB 2DBJA 5E9DD 1FZJA 4F9PC 3HE7B 4K7PL 4YDIH 3Q48A 3KPLB 2RCSH 2G60H 2D7OA 4OLZL 4XBEL 4UQ3B 3V8OA 5ESVB 1FBIL 3LCYA 4ZOBA 2JJWA 3E6HA 4KPHL 3OKDB 5DJAA 1KV3A 4TRPL 4CVWA 1XF4A 4U05A 4AK1A 5D6DA 3ARXA 3SKJL 4RA0C 3IGAA 4XB7A 5D2LE 1I9JH 3PHOB 3PDGA 4ZS7H 1UEYA 2IQ9H 4G6FD 1PZ5B 2R4SL 5F88A 3NIGF 4JHAL 2D9CA 3C6LB 4WHTA 3BJ91 1MUJA 4OM1L 1B4RA 4JDZB 5FYLL 1CK0L 4PRPE 1FL3A 5EUKB 2G5RA 4PJGB 4P4RB 1RJLA 5JNYB 2NY2B 2PXYB 2X4RB 4GG6A 1LO4L 5KAQF 4MJIA 4WI9A 1FDLH 5J3HD 3FN9A 3HFML 3QJHB 2LFGA 4AIXA 4WEUD 4ISVA 4NHUA 4PJFF 3BKJL 2APXA 2J6EA 2FBJL 4P3DB 3NZ8A 3ZT7A 2VZ3A 5F71A 1IJ9A 2VWEE 5JHDB 4FP8L 2ADGB 3QUYC 4CVXB 1KCRH 3UBXG 4DZBB 3EOYG 4Y1AD 1AGEA 1P7QA 1MFBL 1MIMH 4QF1A 3X11B 1KN2L 3QIWC 3MRIB 4N0UA 2NW2A 4KKBD 1T04B 1RZGA 4JRXB 1Z9MA 4K7PX 4PBWD 3QIUB 3GHBH 5TQ2H 4U1JB 1S9XB 4I77L 1QFPA 3MNWA 3DXAA 3JUZA 5BCAA 5J12C 4WWKD 3P2TA 4Y16B 1ZLVH 4PJBA 2O61A 3RQ3A 4JM2C 1IM9B 4WUUE 4W81A 3FO9B 4K9EC 4HUXB 5D71L 1C08B 3FZUC 3CSBA 1JNHB 1UCBH 5HGBA 2E8ZA 5DK2A 5K9JH 5ENWB 3DV4B 4JFZL 3H3BC 1JBJA 1YMMA 4JQVC 3BIKB 4U1IA 4GSDL 1Q94B 5HBBA 2C3XA 3CZFB 4IJ3C 2X4SB 4M1GL 1FQ9C 4UV7H 3MGTB 2GITB 4LPXA 3N1QC 3S97C 2BMKA 4OB5H 3K4DA 2Q3ZA 3MRPA 1BGXH 1YN7B 4GKSA 1UM4H 3T2OA 4LSSL 1FO0H 32C2A 4YXLL 1VA9A 2IBBA 3FQTA 5DT1H 1DQTA 2BVTA 3PWPA 3PXJA 1D5XB 3NIFF 4MMXC 4DTGH 4G8GB 4PB9H 2XKNB 3EFDH 4RMUA 3RAJL 4TVPE 3V5KB 5D2NC 1DUZB 3BSZL 3CFKB 4HQQH 2D3VA 5GRJL 5HHXH 1FYTE 3D0LB 1U3JA 3C60C 4QYOA 2NY6C 4K3JL 4M7ZC 1RJZB 4PGZA 4HIXL 2WINB 2YN5A 3G5XA 2WUCH 1XH3A 2DQIH 4QRPA 4ZPTA 4YHML 1WBYA 2GCYA 1FORL 1G9ML 5ICXA 3O9WA 3TT1H 1CLZL 1NUDA 2RB8A 4NPYA 3T0EE 3LN4A 3QYCA 4XCYB 1QD0A 4JGJA 1L6ZA 4MCYA 1T1XA 4P5MA 3O3AA 5FF6B 3LZFL 1OD7A 3FT4A 3T8XA 1X4YA 1F4WL 4G43A 1MHCB 2AK4B 2WBWB 3DVGA 2PO6D 3FO1A 3ZKXB 5EBMA 5F97E 4EI5A 1J0ZA 3GGWB 4X0KA 5F1NA 3DIFB 3NCBB 5JW5B 5DRXA 3HI6L 4U1HB 4WI7A 3QB7C 5KSAB 3BJLA 3V95A 3PNWB 2EXWC 2VLKB 2DIBA 4KUZL 4MNQB 5DMGD 3STZB 1BLNA 4KK8C 3S98A 1QFHA 3UZEA 4EN3C 3ZDXF 3NGBC 35C8H 5IOPB 1EZVY 3L3DA 1H3UA 3QDJD 1RFDL 2NTFB 4M5YL 4RSVA 1T66C 3IDMA 5DLMH 4IRSB 3T2QA 2VABB 3REWA 5LWYH 5IB2A 3OZ9L 4RX4D 4F7EB 3JBG7 1I3RA 1MJJA 4G8IB 4Q2ZA 1D5ZA 3QO1A 1ZTXL 1L0QA 1A47A 1BVLA 2UZYB 1Q0XH 5F9WC 3OPZL 2EDYA 2AAVA 2Z31D 3RWJA 3BGAA 4C83A 3AUVA 4WV1B 1U95B 1HOCA 3JWOH 2YD9A 4JDVA 2DTMH 3MLVL 3RY4A 4JRYE 1A7PH 2YWYA 2YOCA 3FT2A 2HLFD 2R0KH 4HS6B 4JFEA 5DD1H 2FIKA 2OX5A 5I30L 1IAII 1R24B 5IT2H 3O45A 1DVFA 2QQLH 4IBLT 3D3VD 4X6BB 3H9ZA 4XP1L 5GGQH 5BZDA 4U6VL 4FNLH 4ZFOL 3HR5A 1FAKT 3IJYA 3BPCA 4LHUG 4NQEB 4E41D 4KJWC 1I1FB 1NFIA 4UB0L 2G75A 3VWKA 4KI5F 3NOIA 2X42A 3P73A 3O2DL 3MV8B 3VGHA 1C5BH 3AU1A 4AEIH 5GGSB 4WIQA 4BFEA 4X9HA 5GGTL 3S5LB 4APQA 3GKWL 5D7LA 4I1NB 3O4LD 3EJYC 3H42L 3DURA 1MAML 1FL6B 4PJEB 4HV8B 4R7NA 5F7DB 5JORB 1CDBA 1S78D 1MPAH 1YEFH 3MUGB 4K9EL 4E42A 4U1LB 3RZCD 5KG9A 4OLYH 5D7LE 1N6VA 4BM7A 1P4LB 4HH9A 4NDMA 2WLYA 2D31B 1FZMA 2HJFA 3EGSA 5IROC 5KJRL 1NCNA 2GSIB 2FBOJ 3TNMB 2A6IB 5D1XB 3V8CA 4HULB 1T0PB 3S3PA 5KVMC 5CINL 1WTLA 4E5XA 4HBCH 5EIIA 4B5EA 3IVKA 1TJIL 4MJ5A 1WWWX 2W0FB 5TF0A 4M62H 5EZIL 4PJIF 4ZTPL 1HSBA 3PGDB 2NY3D 3EYOB 5GQBA 4EBQL 2DOCA 1R3LB 2NY1B 1MIEL 2MMXA 43C9B 3UPAA 4OSUL 3UTQA 1P2CA 3DYPA 5CIPB 3G6JB 1AHWA 1QBAA 1UXWB 3ZKSD 4BK4A 1AP2A 1FFOB 3KXFD 1PZ5A 3D85A 3LMJL 4OKDA 3NA9H 4XPAH 1IGIH 2Y25A 1YPZB 3GMNA 5DA0B 2V2TB 1QFWH 4LLWA 3W81A 3QZWB 4ORGB 3QG7L 4P2CG 4EN3A 5SWSA 3O0RH 1E4KA 2ITCB 3JVGA 3N1PC 4H26B 1WGOA 4JKMA 2IH3A 5FO9A 3WE6A 1XGQA 3D39D 4FMFA 4P4RA 4U2YA 1VFAB 2EIDA 1PJ9A 1YNKH 5GSRB 3UZQA 3DVNA 1JZ2A 1BIIA 5DD3L 1U8PB 5BZWA 4GQ9L 1EIBA 4PJ7A 1XF5B 3KHOA 2X05A 3O8XC 1JNLL 4X4YA 1UKQA 2ADGA 5JUEH 1LP9A 4EUPB 3SDXF 1KUMA 3QDMB 2DI7A 4PJGE 4WI5A 1E6OL 4DZBA 4IIQA 1ZVYA 1OW0C 3EW3B 1MH5A 5E95B 4PJ7E 3TVMA 5I1GL 1JZ8A 3F7YA 1ED3A 1K5NA 4WO4A 1I8MA 4QHLB 1MCJA 2EDKA 3CC5B 5JHDE 1JN6B 3G08A 5T3XL 5DS8A 4HCRL 5AAWA 4HK0B 3IXAA 4DGIH 2F5AH 3RUGB 3AS0A 5TH2A 3WJJC 3TBYB 4Y16A 2EH8L 1W72L 2QR0B 1C08A 2CDEA 2IANA 1FBIH 1JNHA 3BP4B 5IFHH 2EKSB 1RI8A 4JRXE 1CICC 3TO4C 3DV4A 1D5MB 3VH8A 1W0YT 3GSRA 3SKJH 1LO2L 2DWEA 1Q94A 2VLLB 1NC4B 5DGQA 2WIIB 5JPMB 3RY6C 4NGHL 1XF2B 5I18L 3L5WA 3MGTA 1J5OL 2GITA 2R4SH 1C7SA 4ZAKD 1T5WA 4G6AC 3LY6A 1TLKA 2H8PB 1YN7A 5C6WH 4FTVB 5IEHB 1DFBH 4DEPB 3LKPB 1G7PB 3IDXL 1JFQH 5FYLH 1QA9A 3MLTB 2GFBA 5C92A 4GAJH 3ZDYE 4K8RC 3AS3A 1HHJB 3C5JA 4GRMA 1T03L 4BZ2L 4LOUD 4XNUH 5DMKA 1FIGL 4PJ5B 5DRWB 3OJDA 5D6CB 4S1DD 1MCPH 3CFKA 3PGFL 1SJHB 4U31A 2CRIA 3MRFA 2O26U 1IGYA 5E8NA 4CVUA 1FRGL 3MJ6A 1KN4L 2JTDA 4UQ2B 4Q9BA 2ZUSA 5ITBH 1D5IL 3CFCH 3RNQA 1ZLSH 1NC2A 4G8GE 5KVGL 1A6ZA 3MV9B 5E6YA 3VFTA 2O5ZL 3ZKNC 4AT6B 2UYLA 1CGWA 4G6JL 4YHYC 1F00I 4XCYA 1ZXQA 5DRZB 1J10A 1N64L 3I6KA 3V79C 5IB5B 3P30H 1KLUB 3X13A 1S7VB 5EZLA 1I7TB 3V6OC 2WBJB 5I71B 4POYA 1D9KD 3RDTB 5BMFL 3FT3B 3MPCA 4P5KB 5KSAA 4JPVL 5CHNA 1CGYA 4G42B 1T1YB 4JGUA 4GSDH 2VLKA 5KSBF 2K7QA 4R26H 2HFTA 4YHNA 1NGQL 5FXCH 3EUUA 2R29L 2A73A 1RUPL 4QWWC 4JPIB 4QO1A 2AKRA 3RPIB 3HUJF 4JZOA 1PG7L 3VXMD 3UJTH 2ENSA 3T3ME 3UC0H 1V5JA 4JHWL 2IPKB 4IRSA 1B4JH 4WHDA 2VABA 3HMXL 4L4VB 1F2XK 4XRCB 1LILA 2AEQL 3ARGC 5I1HL 1IAKB 2J8UF 2CD0A 4LSSH 4F7EA 2HTKC 1GGIH 2FZ3A 2OSLB 2VLKE 2Z8RA 5FB8B 5CMAB 4G80B 4J1UB 5C2BH 4PTTB 5E6ID 5HDBF 2QADD 4HIJA 1JPST 4U2ZA 4NBXB 2V2XB 2XZQL 3QI9C 5MEOA 4JFOB 5CEZH 2J2ZA 5HPMB 1A6VH 1KB5A 2YUZA 3ZKQD 2AJVL 3MLUH 4FXGA 2ZP0T 1OTSD 3UPRB 3VFNB 3QG6B 5C9JA 2JK5A 4RWYH 3ZZ1A 2Z93B 3C5ZC 4K3JH 4PIRF 1VPOL 3VA2C 2R4RH 1RHFA 2ILLA 2CIKB 3MRLB 3AREB 4YEFA 4DW2L 4X9GA 4G9FD 5FYLD 3QULB 3W2DL 2ICEB 1MCKA 2ICWB 1KT2B 4KMQA 4OGYL 1FYHB 5EC2A 1JGDB 3VFPB 2HRPL 3L1OL 3FHAA 4Y89A 3VXNB 3BH8B 1RZ7L 4MAYB 3ZE1F 3MV8A 4N8VG 5GGSA 5MEQB 1DEEA 4Y8DC 2XWTB 2VDLH 3MLWH 3QO0B 5C8JA 3RKDD 4YXHL 2AJZB 2A1WH 4KRMB 1ZEAH 3MRHA 4NQEE 2Y06H 3VFOB 4L9LB 4LLAA 5B38B 3MOQA 4HJJL 1PG7X 1F4XH 1O5DT 3EJZD 1YEKL 2PW1A 3MV8E 1I8IB 4JJHA 5E2UL 2BY3A 4R2GC 3KS0H 1RFDH 4OLEA 3EYFB 1TZGL 4UNVA 3HNTL 5E6ZA 1LEGA 1OPGL 1OLLA 1NCDL 1F3DH 2VRAA 4RFNB 2MJWA 4WW2F 4QTIH 4JAMB 1NANH 5ALBL 1AQKL 1AXSA 3C2AL 2ICCA 4GLRI 5D1XA 2Q7YB 3MJGX 5D7KD 3U4BL 3UAJD 5D1ZB 4Z7NE 3ZHKA 3FOLA 2NY4B 2OZ4H 4U6XB 3C6SA 4L3EB 5DD5H 3ZYJA 5CJ8A 3GSVB 4OCYL 3GMLB 3IU4L 1MRCL 4YQXL 5FYKL 5D1QB 1IEHA 2P48B 5KVFL 4K8RL 1KG0B 4OV6F 1KPUB 5IJKA 5DFVC 4XP1H 3SDDC 3VXTA 3QUML 4MXWH 4Z7VB 2XACC 3RTQD 4CVZA 3BZEA 3RGVB 4PG2C 1QZ1A 2DRUA 1UXWA 4UB0H 3BP6A 4FQCL 1FFOA 2AV7B 3DRQA 4EIGB 1FIEA 1S7SA 1R3JB 5HD8D 4R6UA 3CMOL 1ITBB 2LQRA 2FD6L 3TJHC 1NGYB 1GGUA 3VD4A 1GL4B 5EO9B 2BRRL 1G0XA 3QIBA 3Q1SL 4H26A 4NKIH 4XNZB 1CG9B 2E9WA 1NBZA 2IBGA 3O4OC 1RIVL 4XP9L 1QFWI 1VFAA 1H5BC 4NQXA 2NX5D 5DZNA 3QQ4B 2CLRA 1YPZE 4TUJB 5F7KC 3OGCB 1DLHA 3B9KC 4KV5E 1XF5A 4NQDD 3U7AA 5TE6L 4OLXH 4EUPA 3G5ZA 3CK0L 3N1FC 5E1AB 4XT1C 4NT6B 4JJ5A 1NDMB 4OFVA 4WWID 4F8TA 1FZOA 4NO0A 4WI6A 3LB6D 2XYCA 3PWJA 4QHKI 5HSFA 5IEKB 4ZFFB 5FYJU 5EZJB 5KJRH 3ALWA 1WIPA 4OUUB 2Z92B 2VLJD 3U0WH 5IR1A 2GJ6B 5TE7L 3W11C 1DBJH 5MHSD 2VLME 1N0XL 1HCVA 3TBYA 1UCTA 4YIQB 1PQZA 1G7QA 3BI9X 1Q9KB 5F1OB 4ZNEA 5E9DA 1JNNL 1TDQA 4PGCA 1UM5L 3EYVA 3WNOA 1PZUB 2XA8L 4EBQH 4PJAA 1XAUA 1A3QA 1KACB 3MRJB 1XIWB 3V5DB 2R0LH 3RUGE 5GS0H 5HYFA 3KPSB 1MJ7L 1AGBB 1IKFL 3KPOB 4C56D 4OZIF 2NR6D 1I85A 2WIIA 5FCUH 5JPMA 4IS6B 2YD1A 3OJMB 3IDYC 1JI2A 2DKUA 2LAGB 3U2SB 5ANMB 4FTVA 5IEHA 4Y5XC 3QG7H 2Z8WC 1ZHBB 1KCSL 2FB4L 4H1LB 3WIIL 5BV7H 1VEOA 5GGUB 2LVCA 3X12A 3OXRB 1MFCH 4RAVB 4LLYA 3VCLB 4YO0B 2O5YH 1NL0L 3SOBL 1SJEB 3BDYL 4Z5RB 2RFXB 3ET9F 4QGTA 3TYFA 3SO3B 5DD3H 5JIKA 5F70A 4FTVE 2DD8H 4MNHB 1NAMH 3TBSA 2ZUQC 4YPGA 5EUOB 2FHFA 1RV6X 4CU8A 4X8JB 3MRRB 1HCFX 3GO1H 3QIWD 5DFTA 3GMQB 1CD8A 1NCBH 4PJ5E 3H2WA 1NKOA 4YDLB 3BMWA 4Y1AA 2MKWA 4OIAA 4XZUA 1FNSL 1SHMA 1CF8L 3FTGA 4GUPB 5T3XH 3MYJB 4HCRH 4MA8L 4P57A 5IW3A 1U8IB 2F74A 5DUML 1HKLH 1KFAH 5CJ5A 3T09A 2EC8A 4MNGB 4PRNB 2EH8H 3IFNH 1W72H 2V9RA 3MV9E 2OL3L 4NFCA 5AYQA 2DL9A 4WWKA 1ZHNA 3IJHB 5H94A 4QHNB 4F57L 3MLRH 1X5ZA 3W9EB 5T5FH 5FDWB 3AY4A 4G42A 3DUSB 4X4XA 1J0HA 2YBRB 5IVZB 5GIRB 1CXKA 5EO1B 4L5FH 1CR9L 2DS4A 5F7MC 2VXQL 2Q87A 1DP0A 3QNYB 5HHMB 4NGHH 5KN5A 4PRHB 4Y2DC 1JGVH 5HVGB 1TMCB 12E8H 1S9WB 3MACL 4PJXF 4MAUL 4DQOH 4XRCA 3UZVB 2CUHA 4A6YB 5J1SC 1A1OA 1KPVB 2I9TB 3I75A 2DM3A 4RA3A 3IDXH 3BPLB 5EC1B 2OSLA 1UH4A 4P2QD 4ODBD 2LTQC 5J9PA 3CUPA 4XBGB 3JUYA 2CO7B 4XBPB 4PTTA 5CS7A 5T1LB 3BYYA 3CDCA 5I66B 3RP1A 3U7YH 4BZ2H 1WUNT 1QSED 1FIGH 1G7JB 1WZ1L 2HTLD 2E27L 5HPMA 4GO6B 4L4VE 2K1MA 4OD1H 4I0PB 2J8OA 4O51B 4KJQC 4AJ0A 2JJSA 3C60D 2NY6D 5F9OH 4OD2A 3P0VH 2R8SL 3U0PB 1K3ZA 1I7ZB 4Q0XL 4N8CL 5H2BB 2CIKA 1U3HC 3SDCD 5KVGH 3F7VA 4LDEB 1T2QH 5D7JD 3T4YA 1EVUA 1LK2B 3WS3A 3B8SA 5SX5H 2ZG1A 3Q5TA 1A2YA 4K2UL 2BJML 2LV4A 4RGNC 1LDPL 3HC4H 5IFJB 1KLGB 5BVJA 5MEQA 4YBQC 5E03A 1BJMA 1RUAL 2UUDK 1IGCL 4BELD 5I6XC 3F7QA 4PLNC 5CJXA 4JPVH 2PO6A 4KI5D 5CLTA 2EXWD 3VFOA 3X3FH 5F8RC 2GTZA 5CJQL 3PP4H 2BSSA 4EN3D 1GOGA 4Z7UB 3K4AA 5T3XD 1KTLB 1PG7H 1T66D 3IDIB 2LABA 4UTBL 3EYFA 1L6XA 4UUJA 4GMTH 1P1ZB 2X4QA 1OF2A 5T1KB 2IG2H 2VQ1B 3GMMA 1MCCA 4HKXB 4S2SB 5EZOH 1ES0B 3MCKB 1CFSA 2YKLH 5CUSL 4TNVF 1YN6B 5F7FA 5I16A 4HFUL 5I9QC 3L3HB 3V0VA 4NQSB 5E5MB 5L88L 1R5IA 5SWQA 2Y7QB 1NANI 3QXUA 3RFZC 5I19H 5CSGA 2VXUL 5CILL 1JHKH 1TQBC 5ECJE 1YEJH 1VPOH 1GSMA 1EJOL 1RUQH 2IJ0C 1KPUA 5CSZB 3MRBA 2IMNA 5IQ7H 3MLSL 2C7UB 2Q86B 1TQCC 1VESA 5LCVL 4Z7VA 3D3VA 4KDTC 4KJWD 2BCKA 2BY0A 5IP4A 1N7ML 3WS6A 2YPLB 4LKCB 3CFJB 4P23C 2MFNA 1K6QH 4L3EE 4NC0B 4RQQB 3CVHB 1F42A 5L2KB 5C0BD 4DAGL 1T89C 4E41A 3CXDH 5EBWB 3LH2H 4KROB 4PPTA 4ETQB 4YC2C 5HY9A 5DURD 2JB6B 2XN9B 3S35L 4KKAD 3WV0A 2X89D 4Z7VE 1RMFH 4Y19B 3MR9A 1WEJL 5DEFA 5E70A 5HGHB 3CSPA 4AQ1B 1KC5L 2N7AA 4WGWB 4N5ED 5F7EH 3QQ4A 4XMPH 1NLBH 4HJJH 2RQ8A 3CFEA 3ABZA 1NEZB 3DECA 2P49B 5EBLA 4X6DA 1H15B 3QDAA 4WUUD 5E1AA 1OAXL 1NDMA 1G6RL 3QFJB 2ZZUT 5DJDB 4JQXA 4QHMA 3RZCA 5ISZB 1XCQB 1XR9B 2VITA 4WTXA 3U9PL 1J0YA 3F5WB 2Z92A 1PLGL 1YMHA 4PP2A 1RK1B 5IKCA 3DNKA 2IPTH 3BOVA 4X98B 2F19L 2A6KB 1IT9H 5ETUB 2ZUXA 1VGEL 4KQ3L 4YIQA 1T4KA 1DBKL 1DTUA 5JXED 1LHZA 3QDHA 5IIEA 2XI9A 4OCYH 3IU4H 3PWVB 4YQXH 4AH2B 4K8RH 5HVHC 4XP5H 4MWFA 1I1AB 3RU8H 3GI8L 4Q7DA 1B0RA 2GJ6E 3V5HB 3BVNB 1IEAB 3FONB 1NBVL 4K23L 2V17L 1AGBA 3KPOA 4LCWD 4LLVA 4P3WA 4FQCH 3DHMA 2PN5A 4OI8A 4D0CA 3S35X 1HINH 3FFDA 3EZ8A 4PRBA 3ZLQC 1MHEB 1P4BL 5GGUA 3RWCB 2IEPA 5J13B 3OXRA 1YEIL 3KPSE 3QEGL 5GS1C 3H3PH 3U1SL 3MGOB 4XP9H 5C70A 4OQTH 3JZ7A 4JRWA 1O7VA 3B6SA 1SJEA 2NXYC 1V7NL 3PUCA 2DQTL 4NQVA 1U8LA 1WJ3A 1KPRA 3KYMB 3A6CH 2IAMB 3C8KA 1BD2B 4LPCA 1G0YR 3D39A 5I8CB 1X5GA 4PJ9B 5ANME 4MNHA 1AGDB 1NMBL 2OQJB 3O8XD 5TE6H 3BH9A 2YPVL 3CMGA 4KRPC 2HG5B 2X4OB 2VISA 4QY8A 1KYOK 2XG5A 2XY2A 3MRCB 4QHKJ 5C0DA 3TA3D 1DSFH 2DLFH 4JN1L 1RUML 1Z9LA 4J7RA 3ARWA 4HGWB 4ZS6D 4RWHA 4QRSA 5EUOE 1ND0B 3T0VA 5EOQL 1FPTL 2L7UA 1KNOB 1T83A 2C9AA 3HE6C 2V9QA 5BS0B 1M7IB 4OF5A 4LNRA 1OGTB 3KYAA 3KLAA 2EE9A 3MRMA 4UDTA 1A14L 1JNNH 4GQPH 4MVBC 5JDSB 4RAUB 5LVEA 1CICD 4M93C 4P5TC 3HA0A 1AO7B 1TVBB 2IALA 1AQDB 4P2RA 1CWVA 3MYZA 2OM5A 5HYSB 1IKFH 4MNGE 5EO1A 1PFCA 3QPXH 3G5YA 4W68A 2PYED 1OSPH 3MZTA 1RURH 4K07A 3ZT5A 3CH1B 1FG2A 2FX8L 4JREC 5DR5L 3VXUD 1IAOB 5IESL 5D93B 3MOBL 3O3BB 1BBJB 3FQUA 5CP3A 2CXGA 4XBGA 4K8RD 1JWUA 2Q3AA 4HAGA 5I66A 1NCUA 4BUGA 3FRPG 3PABB 3UJIH 4PY7B 1U8KA 1UVQA 5KW9L 2ZG3A 3BW9A 4O51A 2ZG2A 4NC1E 5KANG 1KENL 4X6EB 3CFBA 4X7TB 5I1CL 2AV1B 5J4MA 1OWRM 3HS0A 3S3SA 1VEMA 1X5IA 3DMMC 1ORQA 3IJSA 3TFKC 4OZFH 4HW6A 4YZFE 3CFDB 2HP4A 1U8MB 1RU9L 3BHBA 4I4WB 2AERT 4AEHH 1FNSH 3ZKND 4GKZB 1QRKA 1WCBB 3LQAH 4OGXL 1EA9C 3M07A 3U36B 4RMWA 8FABB 4R8WH 1A6UL 3CX5K 1K2DB 3PL6C 5CGMA 3HZYA 1CD1A 1BFOA 4HWZB 5K93A 4U6HB 3O41B 3WN5B 5J12B 1FFRA 4JM2B 1GGCH 4CMHB 4QOKD 4RNRB 1W8NA 4UILL 5HJ3A 2C3HA 1QFOA 4PRID 5J89A 1D9KA 3JWDH 3MODL 3EOTL 1AY1H 3BWUC 3AB0C 4OCLC 3QCUL 5CBAB 5DJ8B 4XCFH 1P5UA 4YDVA 1DQQB 4ZUTA 4QWWD 4Q58C 4Z7UA 1P9MC 4IHOB 4MDJA 3VFRA 4IJ3B 1UACL 2VDML 3OAUL 1ZS8B 4YHOL 1T1ZA 2X6MA 4S1RL 4HDIA 1F4YH 2AJYH 5T1KA 2HTKD 3B8YA 3AFLA 4Z0BL 4ZFZA 4PGBB 1F6LL 1KLFA 3MCKA 1SEQL 3RZWA 3UBXB 2VDRL 4Z7UE 1MLCA 2CH8A 5JDJA 2BFVH 4PJDB 3L3HA 4Y4HA 4Y5YC 4EI6B 5CFHA 2E27H 5DC9B 3PV7A 3MFGB 2Y5TB 4KAQH 4ODUB 5JHLH 2FR4B 3BQUD 4EQ3A 3IAGC 2R2HB 4JG1H 5D2NB 5DJCB 3QWOA 4BQ6A 3T0DA 3BXNB 2FGWL 4ZUUA 1OL0A 1A7NL 2ZSWB 5HVFB 5D2LF 3TN0B 4JFDB 3KJ4B 3QXVA 4G8EA 1FLRH 2YSSB 1G0DA 2YPLA 1OAQL 4K2UH 1A5FH 3SE4C 3CCHB 4KK9D 4RQQA 3GSQB 4Z76B 3GMPA 5FA4B 4HUWB 4FQXC 4UT9L 5EU6D 1TIUA 3LSOA 3K2MC 1F45A 2BZDA 3BPNB 2GW5A 4NO5B 4F15C 3QEQD 2F8XC 3SY0B 1T5XB 1M71A 3HAEH 2YPLE 3Q6FA 2ZUTA 1U42A 4ORZC 4AMKL 2D7TL 4I18C 4V1DD 5L2KE 4ALAH 2RJMA 3MC0A 3P0YH 4UIMB 3GNMH 1WAAA 2X2YA 1H3PH 4MB5A 2XQBL 5JPNB 5D7SH 2X70A 2XN9E 3B43A 2B1HH 4OI7A 4FXLA 3DO7A 4Y19E 2VAAB 4YBLB 1PAMA 3P77A 1TNMA 3WUZA 3IS0X 5CGYC 1FSKC 1WZLA 1JUFA 2VXTL 4GRLC 3SCMB 1F3DJ 4MZ3A 4PV9A 4WW1A 1YUHA 1ZMYA 1H3TA 4C55A 3EO1A 3NFSH 5T1DL 1XGYH 5L88H 3ILPA 2BVOB 1BVKB 3FQWA 4Q6YA 5F9WB 3CDGB 3M17B 1LNUB 3QFJE 3LOWA 4FQJL 5FDYA 1DLFH 1VFBA 5IFAH 3T1WA 4UINH 2W0PA 2FH8A 3TZVB 1FZKB 5ISZE 1OAZL 4NQCB 1RZIB 3T0EC 2QQNH 4MDIB 1M05A 3IFLL 5GJSH 4P46C 5DFVD 2R56L 5ADOL 3VXRD 5HI4D 3MLSH 2I07A 4L8SC 3ZKMC 2YA2A 3KPMB 4G9DA 3FONA 1RK0B 1BZ9B 1P7KA 1JPSH 1R3HA 1D6EB 1WBXA 5CJOL 2VDQL 4MHHI 3V4VL 3QUZA 4N9OB 4DAGH 4YHLH 3TJHD 1RULL 4WHYG 5DC4B 4HKZB 3BIAX 4KHXL 2P5WB 5AZEH 1ZA6A 2XZCH 4HMDA 5FV2A 5GISH 3PG2A 2XZZA 1WEJH 2A83B 3RWIB 2BK8A 2X4TA 1T0NA 2X4PB 2F58H 4LSQL 1NCCL 4GXVH 3B9KD 4FFYH 3RA7H 4DUXA 1F6AB 1U41A 4X99A 2MQ3A 2VDPL 5DD6A 1T80A 3FMGL 3S4SG 2P45B 5C0RL 5HYJD 1GGTA 1U2CA 1I3GH 5MP6L 2Z91A 1G6RH 3QAZC 4OM0H 4ZUVB 1HILB 3NFNB 4EXPX 1BD2E 5CZVH 3K3QA 4AIOA 2DLGA 4W4NA 2H3NA 2V7NA 3ARDC 1PLGH 3MBED 4OCNC 4PJFA 1ND0A 4LVNB 4PREB 1MRFH 2Q8AH 4KHTL 1KNOA 3NA4A 5F1IA 4MS8D 3VRLE 4KQ3H 4LHUB 2AP2A 3IFPB 2DLHA 4GRWH 5CD3B 3WUWG 1LD9A 2Q1EA 4UAOC 5EOCL 5JDSA 3KYKH 5DMIL 4FZ8H 2WNGA 3GI8H 3RWHA 3FQXB 4PJFE 2DB8A 3VXSB 1JL8A 1ZVHA 1NBVH 1MVFA 2V17H 3TT3H 1CE1L 1S7XB 5BS0E 1MFAH 4PJ8C 5E4IA 2VDNH 3T2NH 4G3YL 1F11A 3KG5A 1Z6JT 4S0TD 1MHPH 3CH1A 5DJZB 4ZXBC 4FQQA 4OKVA 1CL7H 1TVDA 1AO7E 3P9MA 1OB1B 4M48H 3AM8C 1S7QB 4P2OD 4N68A 1BBJA 4JGMA 3U1SH 5TQ0H 5DK0A 4M6OL 3VGEA 4OZ4A 5MERB 2CK2A 2VLRD 2OR7A 2OBGA 5C2UB 2ARWA 2YA1A 1RIHL 1NGZA 5B21A 1REIA 4M7JL 1YEHL 4F3FB 4JO2H 1FJ1A 4QRQA 1FCCA 4X5XB 2V2WA 3OKLA 1A6TA 2D7NA 4XC3H 2HFFB 2HH0H 5GZOC 4ZFOA 2YD7A 1TETH 4YLQT 1IFHL 4Y4FB 5ALCH 3FB5B 1HHKB 1I4FA 4GKOA 5FUZH 5GRZA 2WP3O 4LRNH 4NNYA 3SKNA 3NTCL 2BC4A 3QUYA 1NJ9A 3BDXA 4U0RC 3O2DA 3RJDA 5JTWA 3CDFA 1T7YA 4TSBH 1UA6H 1WCBA 3QIWA 3MREB 1GHFL 3IDNA 4MSWA 4KKLC 3U36A 8FABA 1UWGH 1ZSDB 5AUMB 3LEYH 4OGAD 4NWUH 1CLYH 1BREA 1S3KH 5CEYB 5LXGH 5C7XL 3PF2A 4Y88A 3OAYH 1J0JA 4TVPL 4U4BA 5HPOA 3L5XH 4U6HA 3HE7C 1FGNL 4LFHG 3LKNA 1AFVL 2EDDA 2UVEA 2V5MA 3HNSL 1AR1D 3VJ6B 3NIFE 4JM2A 2ADFH 2CKNA 1AI1H 3ZYIA 2NY5C 2MTPA 3S96A 2C3WA 1F13A 3VFVA 3MRGB 1K8DB 3GJFB 5DJ8A 2GK2A 1A7OL 2I9LB 4BFIB 2W9EL 1DQQA 3TO4B 4NUJB 3BKMH 5FO8A 5KVEL 4JQVA 4Y2DD 5IB1B 1IBGH 5H35B 4AENB 1YEDA 4L8DB 4TPRL 5C0FB 2BVPB 3L3IA 1MWAB 1MY7A 4TOYH 2FX8H 1CGSH 1HDMB 4FFWD 5DR5H 2BXZA 3QCVL 1J88A 1U6AL 3RL2B 3MOBH 3RBGA 5GZNC 1MREH 3C6LC 1F97A 3HLAB 5HGAA 1V7ML 4M00A 4LMQI 5L2JB 5M7QA 4ONFL 1M6OB 3BKCL 1KGCE 3VXPA 3HZKA 1MCWM 2NY2C 2PXYC 2W38A 1EEZA 4YAQA 3KLHC 1QYGL 1BQUA 3D5OF 5KW9H 4TNVK 5C0NC 2Y5TA 1ZAGA 3KVQA 4YE4L 4KJQD 1U2HA 4ODUA 3ARPA 2FR4A 2PW2A 1TZHB 1QOKA 2GJZB 3OKOB 4M1CC 2XWJB 3ARZA 5D2NA 4EXKA 3BIBX 3TV3L 3KR3H 3K80A 2N7BA 2ZSWA 2DLEA 3C60A 5DYOA 5K9QI 3WFHA 5ESAA 2DYPD 3L7FB 1CDHA 3OX8B 4PGEB 2Y6SD 8CGTA 3F58H 3HKFA 2L4OA 5D2NE 3ULSB 3SE8H 2YZ1A 4LEXL 3VXOA 3GSUA 4RGND 4D0DA 2OP4L 1A6UH 3QIUC 4YHYB 1I1CA 4JFDE 1KCKA 2O5XH 4NO5A 4A2MA 2DQJH 4HT1L 3QEHA 4RIRB 1EHXA 1QFUH 5GRWA 2OTUA 1X5AA 1GXEA 3MODH 1W2KT 3EOTH 5TF1H 3UEZA 3O2WH 3QCUH 2OXHA 1IILE 1YZZA 1JF5A 2IH1B 2EDEA 4XI5D 1UQSB 3HI1B 5JPNA 1UKTA 3GK8L 4IM8A 3O3EB 3VGBA 4PJGF 1QEWB 4QRRB 3ARBC 4JLRB 4ZQKA 5H37H 3FOMB 5FGBC 4XVUD 1YY8A 2VAAA 3DV6A 5ILTL 2EYSB 5F3HB 3WCYA 1AD0B 1EEUA 5I1JL 4NO3A 5DJ0A 5C0CB 4HCRA 5C0EB 4ZO7A 5IG7A 3OKEA 2VSCA 2BVUA 4JPKH 2BSED 4QT5A 3U6RB 3ARGB 3UYRH 3I85A 3VFUA 1W72A 4ELKB 3MV11 3K81A 4ZTOL 2IF7A 3QDJB 1U8OA 2FSEB 2BVOA 4X80L 1BVKA 1QQDB 3L7EA 4ODTL 5TDNB 4JHBA 1Q9WB 1JWSA 4ONOA 1C1EL 4LLUA 5L6YL 5DJ6A 3I6GA 4RZCA 3WO3B 2FIRT 2R1WA 3LRSB 1E4XL 4N9GB 5JW3L 2VDOH 4Z95H 5DQDH 1S9VA 5F3BA 4YHPB 5D70H 1P5VA 2Z31B 3C5ZB 2EEDA 3KPQB 3S3JA 1WV7T 3E8UH 4HWBL 3U0TA 3EFFA 3S37H 1IZKA 4P23D 5GRXG 4NQCE 4IOFC 1T2XA 3H7LA 3F7RA 2GEEA 1IC4L 4EDXB 2XXCB 3FRUA 1FO0B 3MV7B 1NUFA 4ZPVB 5LBSH 3LS4L 3ZDYF 4M6MH 2P47B 1IGMH 5C0BA 4WFGD 3FL7A 2NNAB 3ZKXC 2HJKB 4BYHA 1KYOJ 1ZT4B 1QACA 1OARL 5IV2A 3KDMA 3VGAB 2EDXA 5BRZB 1ZVSA 2CDFA 3OG6B 2P5WE 2FJHA 1NCWH 1NGWA 4OT1L 4PRAA 3O4LB 5JQ6L 4R2GB 2NY5L 3BO8A 2B2XL 4HIIB 2A9NH 1A6AB 3WDHA 3LKOA 3S5LG 4WUUA 2VXTH 1INQA 3MXVH 1F2QA 3TIDB 1D7FA 3LDBB 4JFPB 4J6RH 4KJPC 1MY5A 2BHYA 2HLAB 5IROA 2FHBA 4QRUA 5FKAB 3EDKA 3TBTB 4JANA 5C09A 4WV1C 1AGCA 1J8HD 2EDNA 3SDXA 1TJGL 4C4KO 4WUKL 3QUXD 2KL6A 3L5HA 3FN0L 3SO5A 1KTDB 5DHVH 5ADOH 2XTJD 4JFQB 1MCRA 1J1XH 4N8VB 1ZT1A 2P24B 3I84A 2QQKH 1CXFA 3HMXA 4Z77B 1S7XA 2UWEB 3R06A 1BM3H 3VDCA 3T3MF 1A1NB 4Q74A 3O3DB 2B4CH 2W59A 3B9AA 3SDDB 2P43B 2VDQH 1G7IA 3IETB 4LCWA 4WFED 3I3EA 3OB0H 1I7UA 2AI0L 4HZAA 4UTAH 2ATKA 2KBGA 2FHCA 3VW3L 5FCSH 2EDBA 1A6WL 5C0AB 3ZT6A 4KGJA 1G9EA 5JOFB 4GH7B 4PG9A 4XVTL 4R96B 3KXFB 4JY5L 1CL7I 3FN3A 1JF1A 3AXLB 2VL5A 5DMYA 4UT7L 5C6TL 3BE1L 4M7LT 4I48A 3O6FB 2EZ0C 4X5XA 1FFPA 2N56A 4OZHB 2C1PA 2MHAB 1WFUA 5D7IB 4IOIB 1PDKA 3O8XA 3QZWG 5JIIA 4LAJH 3A6BH 1UWEH 3CX5J 5FO7A 3L9RB 1D3CA 3D18B 2YC1B 1OW0A 5IMLA 5B22A 3MRDA 5AG9A 1P53A 3BGMA 1WFTA 4Z0XB 5BJTA 3TWCL 1MQKL 4JG0L 3TA3A 4M5ZH 1QSFB 5AUMA 4X5WB 5CEXA 2YXMA 3RVTC 4R90H 1VACB 3FB6A 5AYUH 2Q20A 4KC3B 3WJJA 4OF8A 4F7CB 1YYMH 2F5BH 1MOEA 4U1KB 4P5TD 2YPKB 5ACZB 3QA3B 2H2SD 1DZBA 2WWKT 4OLWH 2DQEL 3VFMB 4BSWB 5EU4B 1K8DA 4D9QD 3BZFB 1UYWL 2JELL 3NAAL 3WLWC 3L95B 4BH7B 1CICA 1NUNB 1SMOA 4L8BB 3TO4A 1KIUA 2A74B 4XMKH 2XA3A 2J6EH 3CVIL 3FFCD 1IGFH 2WWMC 2W1NA 5H35A 1TVHA 4L8DA 2FNBA 3RY6A 2VIRB 3QUKB 1HHIA 2BVPA 2EYTB 4PJEF 4JN2A 1KBGL 2B1AH 2HT2D 2PYEA 1EO8L 3IDYB 5I0DA 2RIKA 5GSVA 1P7HL 3EYQC 2YS4A 3LKQA 3STBA 3KHQA 1QLRA 1B2WH 3HLAA 1UB5B 4HGMA 2OTWB 4M3KB 5MEND 4CNIB 2CKBL 4F7MA 3VXUA 5BXFB 5K9KA 1X4ZA 2GK0A 4ZOEA 1A7BA 1N5AB 5JO5A 5KSBA 4Z7NF 5FHAH 1MCWW 4YHIB 1E6JL 1PYWB 5ID1A 2P8MB 4ESKA 5HHOD 2DLTA 3HUJA 1A4JA 3CLEH 1GZQA 3QUMA 5LAXB 5IMOB 3DMMD 1NSNL 4FQIL 3WLBA 4Z7WB 1RUKL 5FYKE 3IDJA 3U9UB 5IB4A 4DZ8A 2R23A 4QCIB 3OX8A 1T6VN 3UTSB 3BD5A 4YGVB 5FOJA 4G6KL 2FEEI 1FFNB 1T1WB 2CDGA 2DM7A 3U46A 5IHZA 3PL6D 1LO0H 5F9DC 4XHQA 1RZKH 5E8DH 1NDGA 2R2BB 3LVEA 2B39A 2E9JA 5CZXD 3G6JF 4MXVE 4YUEL 5HGDB 2CLVA 1EEYA 4MA3B 4JFFB 5ERWB 1QBML 3V6OA 1YPZF 1D5BB 2OCFD 3UO1L 4YK4B 4KV5F 1ZANL 3S36H 1U8HB 4R4BB 1A7OH 1XR8B 4QOKA 4YWGL 2HFEB 3PIQA 1UQSA 4NJ9L 4PRIA 4XP6L 5FK9B 4PRPD 3KAAA 4PR5B 2BOBA 1QEWA 5INCA 4D8PA 4Z8FL 3E6FB 2M1KA 5I1EH 1M4KA 1KJMA 1DBBL 1AD0A 1XT5A 3GBNL 2LE9A 1S7TB 4YNYB 3W0WB 3P40A 2WANA 5F7YC 2FDBP 1EMTL 1SY6L 3GJEA 5I1DB 1V7MH 2IQAA 1NMCB 2ZNXA 3DLQR 4TSAH 1A7RL 1Y6KR 1KIQA 4XMLH 4FQHB 1Q9LA 5LGKA 3ARSA 2WAHA 4QRRE 3X3GL 4M8QB 3VXMB 2X41A 2D9QB 4MJID 5TDNA 5DSCB 1Q9WA 5DWUH 1V3KA 1S8DB 4BFGA 3Q5YA 3WFCL 2XQYG 5C0CE 3LS5L 4DKFL 3QI9A 1XGUB 2VH5L 5HHQB 3LRSA 5IBLC 1FH5H 1R6VA 4RRPG 4GAYA 4H88L 3RUGF 5HI5C 5CWSB 3I02A 1P7QD 3C5ZA 3NMEA 4HLZG 1BZ7B 3BWAB 5C1MB 1G9NH 1Q1JH 4TUOB 1CGTA 3G6DL 3SGJC 3ZYZA 1TTFA 4HPYL 7FABL 1RD6A 2J1KA 1BWWA 4LEXH 5I8OH 5JLZA 4WU7B 3GSOB 2VB5A 4PGDB 4HFWB 4FQXD 1Q9OB 25C8L 4X7DC 2DWDB 4RBPK 2FLBT 3MV7A 1H9VA 2NYYC 5IWLC 5GGVL 2BRQA 3WIHH 1J05B 2ITDB 2PR4H 5I71C 2Q8BL 3RDTC 3PGCB 3MSPA 5FYJL 3QXAB 5DUPH 3ZTJG 3CD4A 1EEQA 3NN8B 3TF7C 3QEQA 3LAFA 4QXTA 1AGFA 1S7RB 3MV7E 4U6YA 4WEBL 5E99H 4JO1L 2AXHA 3VFSB 2AGJH 3BESR 3LN9A 2CR3A 4G8FA 5HHPA 1R3IL 2DQFA 1AD9A 4TVPD 1ADQL 2JF1A 4GBXB 1CI5A 3OKNA 3NCJH 2FJGA 1RZ8B 1HEZA 1X4XA 2WV3A 3MRKB 4GRLD 1FYTD 1SYVB 2VSDA 3HI5L 1F4AA 4XH2A 1MVUA 2VKWA 5BRZE 4H25A 4KWUA 4JR9H 5T33L 4QTHB 2OL3A 4R7DA 3AAZB 5B38G 1QHOA 3O4LE 5FKAA 4M03A 5IBTL 3VGFA 3BFOA 4JZNB 4L8CB 1SMAA 3MMEA 1EH9A 5L6YH 3X14B 1JYWA 3BZ4B 3K7UA 3T0ED 3R8QA 2E7LC 5JW3H 4LDLB 5IW1B 5DDHB 1LO3H 2IADA 1HQ4A 1TQBB 3L3KA 3N06B 3R0MA 5AD0B 4UV4H 5F7LB 1NGXB 2VKXA 3AREC 2C1OA 2MCPH 1P4IL 4MD5B 3BAEH 3B83A 1CVRA 1I9IL 3TP4A 4E9LA 2ZSVB 3SDDA 4NOBA 3GSNH 4RMSA 1ZGLP 2A9ML 3CX2A 2FRGP 3IETA 1IC4H 15C8L 4U1MB 3F7PC 3L3GB 4R97B 3TIEB 3WXWL 3UTTB 4MAYC 1S9YA 2JIXD 4NKOA 5E08H 1N2RA 2NY0B 3T3PE 2UWEE 3RTQB 2R1YB 4EI5D 2EXYC 1MI5B 1OARH 1EXUA 4H0HB 2I25N 3AXLA 4OZIA 3L5IA 5EG6C 5LQBL 3L3JA 5H8DA 4KZEL 3J7HA 4L9LC 4XPGH 4TSCL 3REVA 4EEEA 3AMLA 4XNQB 2YEZB 1H5BA 2GJJA 4XCEA 2VQUA 2H26B 1CFTA 5I8EA 1VKXB 4NKDB 5C0AE 3B9KA 1HHGA 4OIBA 3BGFC 5D7IA 3DTXB 2FEDD 4IOIA 2OR8A 1C5CH 4HUKB 5JQ6H 4HUMB 4F7TB 1XF3B 2XXMB 1TJHH 4BA8A 4JRYD 4QXUH 2V5SA 1MAJA 4MJ6B 2NX5B 5HYJA 4G6ML 2BP3A 3MFFA 1MCOL 4RFNC 2P5EA 2XRAH 1MAKA 2HKHL 3TCLB 1G7LA 4DVBB 5D7IE 2IPUG 1RPQA 2W65B 4Q9RH 3HG1B 4MQTB 4XAWL 3H0TB 1CQKA 4EOWL 2BNUB 5D1ZC 5I1IH 4KH2A 3FKUS 1DBAH 1BX2B 2NY4C 4JFED 1E27B 2P5EE 5KTEL 3C09C 4TTGA 4O4YH 1DVFD 2VLJB 3RNKB 5D1QC 5J06A 2WMPA 1QSFE 3BZFA 2SEBA 3LKRA 3TPKA 3C5SB 4XVJH 4BH7A 4IMLB 4L8BA 1MF2L 4ONHB 2A6DB 5IHUL 1HXYB 5IJVB 2L7JA 4XPTH 4DN3L 1CZ8L 2EIBA 2Y07H 5E8EB 4HJ0C 4NCDA 4NYLA 1A8JH 2EIZA 2VDKL 2W07A 4NKQB 5K9OA 3HPLB 3B3IB 4TQEH 4OJFL 1JPFA 4GW4B 4LPWA 2FX9H 3WL9A 4Y5XA 4C56B 1HYSC 1UB5A 4M7KL 4APQD 5IGXH 5D7LD 5FKPB 4OCWL 2Z4QA 4PLKC 1D6VL 1HH6A 4PP1D 1PY4A 3RI5F 3PHQA 1L0YA 2VLRA 4NKMB 1JP5A 1JHTB 3MX0A 2H1PH 4LSDA 3HRZB 5LAXA 2A0LC 1EAJA 2G9HB 2R0ZH 4H1LG 4KRPB 4N0CC 4MA7H 4LSPL 3TO2B 5IB3B 4JO4L 3MBXH 3BP7B 4UBDC 2YD3A 3KLSA 5EU3A 4ODVH 3T4AA 4JY4A 4CKVX 1FFNA 3GI9L 3CSYB 3T0WA 3QXWA 4M7LL 5KVDL 4JFYA 3HE7D 4Z7VF 4Z7WE 4WDIB 1MJ8L 1ORSA 1AH1A 3UTSE 4JFFA 5HHVH 5ERWA 1CU4L 4NZDA 3RWDB 4NIKB 3PXHA 4R4BA 1WFOA 5IQ9B 2IFGA 2OJEA 4HD9A 1G6RA 4FABH 1XIWC 5DJYA 5B3NA 4X7FC 1YEGH 4W4OC 5I76B 4JB9L 3IFOA 3K8MA 1YC8A 1KB9K 2FX7H 4JFFE 3MCLL 2XZAL 1WK0A 4D3CH 4JDTL 1HXMB 4Y2DA 4ODWB 5D8JH 2VMFA 5TFSH 1UJ3B 3PQYB 5GZND 3PWNB 1WIUA 3QPQD 4X7SL 4PUBH 2ZKHH 1S5IL 4PTUB 1DQDH 3WJLC 2VYRE 4HXAH 2D03H 4I3RH 3L6FA 5JR1L 1E6JH 3DGGB 4Y0GA 3FO0L 1JPTH 3UCRA 1MJUH 4P48A 3W0WE 1QLFA 4LFHD 1YYLH 1U8NA 5MI0B 1OTTD 1FNEB 3VE0B 5CWSA 5FUOL 4LGPB 3VXME 1BZ7A 4FS0A 2HMIC 1QSEB 4MXQD 1DUYA 4FQPA 3PJSB 3C9NB 1U3HA 3TVMD 5EU5A 4WO4D 2IBZY 4JRXD 4HK3J 4NWTL 3EYSL 1EFXB 2DYPA 3ALPA 3BEWA 3QIUD 4H8WC 2D4DA 1EVTC 5E94B 3SDCB 4YHKH 4JM4L 3ZTNH 4Y16D 1I9RL 3HZVB 5DVMA 1IM9D 1Q72L 2B20A 2G2RB 5D7JB 2ITDA 4O2CB 1ZT7A 5F7WC 2GUOA 3PGCA 1UFUA 3HHRB 1A02N 3UO1H 2GAZB 5IHBA 4KZDH 3T0AA 2QKIA 3BD4A 5E2TL 3NN8A 4LLQB 1QO3A 2H9GB 5EORL 3H9YA 4JQIL 1MLBB 4NJ9H 4XP6H 2AXFB 4LVOC 3QDGA 1NAMB 1OSZB 1QRNB 3D69B 1E28A 1YNLH 1K8IB 1K3IA 1S5HB 1HI6A 3FO2B 2AABL 5D96C 1RZ8A 2KQNA 3MRKA 5EUOF 1LE5B 2DMKA 1A7RH 4AIZA 2V7HA 3QDGE 2YK1H 4TNWF 4YHZH 4QTHA 3X3GH 3H9SA 2EDFA 2W60A 4MQ7A 2R0WL 1Q0YL 4G8GD 1BAFH 2J88H 2X4NB 3WFCH 3C08L 5CBEA 1U8JB 1ZGLB 3PWUB 3BZ4A 1JGUL 4I0PC 5JW4R 2XPGA 2GT9B 4J3XA 1UKSA 3OJVC 4OTXH 2YD5A 5A3IC 5L8KB 3D2UB 2BNRB 4XXCC 3H9SE 2Q7NA 3VFGH 2QHLA 1NC2D 1BF8A 3EBAA 1R5VA 3FB8A 3E1F1 1Y0LB 3UYPA 1C16A 3MXWL 1YQVH 4IOFD 5KS9B 2FL5A 4CADA 3RX8A 4KDTA 3VG0L 4F7PA 4U1MA 4P23A 2OXGA 3L3GA 1U58A 4YX2H 1TCRA 2AJXL 5EFIB 4NJAL 1FHGA 1T89A 2GI7A 4F58H 3EOAA 4NCC2 4UT6H 5F9JA 4HZLB 1ZWIA 5AWNL 1W0WB 4RGMB 4F15B 3RWGB 5KSAD 1I8KA 2PF6A 1PSKH 2VLKD 4X7CC 4XNQA 2YEZA 5FOBB 3UTTE 2Z8VC 1IEBB 4G7VL 1L9MA 3FCTA 5FGRA 3T1FA 4XPHL 4MB3A 1R3IH 4YZFF 2EYRA 5A1AA 1SYSA 4IRSD 1MI5E 1F58L 4JPWL 2HT4C 4G5ZH 3QFDB 4ZODA 5CEZE 4FFVD 1BQSA 4XCNB 2P7TA 5DEGB 2APTA 5B8CB 4KJPD 5T33H 3I9GH 5CIPH 1CFNA 3DYMA 3UDWC 4WI8A 4AL8H 3MTRA 2ZJSL 5HDQH 2F54B 2W65A 4OFYA 5TDOA 4F2MA 1FC1A 2BNUA 1ULVA 3DUUA 3V7MA 1HHHA 2ERJC 3OAZK 1E27A 4Y4KB 4UI2A 2BOCA 1KELH 4DFIA 2EC9U 3GKZA 2ADJA 5IMKB 3HG1E 4FZEL 3RWFB 1PKQA 4ONHA 1HXYA 4JVWA 4KK5D 5TE4H 1CE6B 4HX1A 4NQED 1TXKA 4DGYH 1JRHH 2IFFL 3HCVA 5E8EA 1LO5A 15C8H 1CDJA 3AS1A 4EUPH 1CDCA 5A16B 1YJDH 4IRZL 4TTDD 3HPLA 1GIGL 2ATPB 3MV8D 1JNJA 3GHEH 1EAPB 4Z7UF 4KROC 4M9PA 5K33A 1BFTA 5MHSE 4OGZA 1YEEL 1MSPA 3EYUH 4HKBB 3QXDB 1HQRA 5IK3B 3TBWA 4UIKL 1Z5LB 1L7TL 5GS1A 3EO9H 3NABL 4H8WL 1H8NA 3T0XA 4NKMA 3WNLA 5E7FA 4LQFL 1QNZL 2EZ0D 1JHTA 5JXAL 3OXSB 3IF1B 3HRZA 4HIHA 4K3HA 4NO2B 2G9HA 4QXGL 2DQHH 2YD2A 5DRNB 1NGPH 2NY7L 4IEFB 1DN0B 4KMLB 1OAUL 2AXGB 3BP7A 3P4OA 2FATH 3WXVH 2ZOLB 1A64A 1CLOL 1INEL 4BKLB 3P4MA 3DI3B 2R1XA 3DX6A 5D1XD 3L3OB 3QCTH 2QHRL 3ARDB 4XAWH 1L7IL 2K7PA 1IKNC 1QKZH 1DDHB 3GDBA 2DQDH 3HE6A 3OKMB 4WDIA 5BOZG 1DQLH 3SJVB 2Q6WB 1HNFA 2ARJB 3SDAC 4ZMAT 5ICZA 1CDYA 4KMTH 5EOCJ 4HS8L 1A0QH 4JZJB 1I1AC 3WLWD 5HDOA 3D48R 2NY1D 3TPUA 4P5TA 4Z78B 5IHUH 4K3DL 2WWMD 1J1PH 2XKUA 4N0YH 1SBSH 1RIUH 1AE6H 4L4TB 2AK1L 4V2CB 1CGXA 1AXTH 3FFCA 4KKCD 4ODWA 2DI8A 1ZHKA 3G6AA 3EYQD 3HB3D 5E2JA 4JO3L 1HSAA 3PWNA 2H32B 3QIBD 4GG8A 3S4SB 3W39A 4M7KH 2FWOB 4OCWH 3WFDL 1NAKL 3LV3A 3IXTA 1IL1A 3QHZH 4PYGA 1VB9A 1EPFA 5CCKH 2EO9A 4XNXL 3DGGA 4LHJB 4TULH 5F7NC 2IAMC 3ZDZF 1QTYT 3PQYE 4HXBL 4PJ9C 3F12A 3MQIA 3SQBA 1AJ7L 5ITFA 2BY1A 5HHOA 3O6KH 4JFXA 3GSWB 2LU7A 3M45A 4M1DH 2V5YA 1IQWL 1MFEL 2VLMD 5IBUB 5ESQA 3STLB 1R3KB 3OTTA 5ID0A 1NBYB 3DMMA 4NO0D 1WBZB 1ONQB 2JJTC 2FECI 3GRWH 3S7GA 5C0GB 4J3OC 3DO3A 1A3RH 5C08A 3A67L 4UU9B 2VXVH 1OHQA 1QG3A 4M7LH 1LDSA 4U49A 5F89A 1HZHL 5KVDH 5E94A 2YRPA 2ESVA 2ORBH 4RFOH 5JW4N 1SVZA 1MCHA 2GTWB 1U92A 4X6CB 1BFVH 1MQ8A 3PL6A 3LIZL 4Z7QE 2C3VB 3RX5A 4KQ4H 5E2WH 5D2LA 3QHFH 4ODXB 4S1QL 3RWEB 2GAZA 1MHHB 5C08E 4NZJA 5T5NG 1KCLA 4JE4B 4PLOB 2XOTA 5EWIL 1NC4D 2ESVE 2FO4A 3JV6B 2X7LB 3I50L 4POZD 2KQMA 4AQOA 3FRPA 3LN5B 4XCCL 3TNNB 4WU5B 1JMXA 1CXEA 4NNXB 4PRPA 5KSVB 2BDNL 2FJFA 4FTVD 5EPMB 4AM0A 5C0JA 5HYIA 4NRZB 2XNAA 2CRYA 4MJ4A 1QLEH 2X1WL 5D93C 1LE5A 4KTDL 4KTEH 1QRNE 5HVWA 3M8OH 2NZ9D 1EHLH 3VRLF 3JV4A 3ZSTA 1LMKA 5JR1H 5TDPA 3FO0H 3CVHL 5DA4A 5DTFA 5E4EB 1GRWA 4Y5YA 4FMKA 3W9DB 5I74B 2Z35B 2EE3A 1BQLH 3HNVL 5HI5D 1KJ3L 3BUTA 5KSUA 2BNRA 4FG6C 4YJZL 4P9MH 1VADB 1WISA 4S1SL 5I15L 3SQOH 3MV9D 1GAFL 4H5SB 4FQ2H 1INDL 4WCYL 3U7WL 1T20B 2YMXH 2JLLA 3ZL4L 1A3LH 4NWTH 5MEPB 1IC7L 4TUKL 1JWMA 3ARUA 2BNRE 5T3ZL 3SE4A 4ZSOA 1I9RH 2J4WL 1BBDH 3O11B 5I1KL 1Q72H 3T77B 2WBJD 4FQXA 1ITCA 1RJYB 3G9AB 3SPVA 3RDTD 1LEIA 2VZSA 2B5IC 3DX8B 4AYFA 3GUTB 3WN5C 3VFWA 1HE7A 2XQYK 4KVCH 5KS9E 4CMHC 4QRTB 5E2TH 2CIIA 5EORH 4KY1H 2B0SH 5F96L 3GMRB 5EU6B 2ZUUA 4K7FA 4I18A 4ZSOE 1XCTB 5GGRA 3X17A 1U93A 3KPRB 5HHNB 4GW1B 4J4PC 4FXKB 3DX7A 4QKXB 2W9LA 3ARFB 3ARBB 3O2VL 4L4VD 1DQML 3QH3B 2Y23A 3T65A 1RHHA 1FVEB 3QFDA 3RGHA 3LD8B 1YNTA 3IKKA 5EBGA 3WHXB 1F02I 3SDYH 4FQLH 4LSTL 5EU7C 4M43H 4GRLA 1FYTA 1Q0YH 1NQBA 1AKJB 3EOBB 2F54A 1QUNA 4X9FA 5EA0L 3MA7A 3V4UL 4XNMB 1S7UA 1MEXH 1ETZB 1XZ0A 2I60H 1X5FA 3D9AH 3MA9H 2DF3A 3T0EA 1E4WH 1B6UA 4DKEH 3O6LL 1A9EA 3TN0C 2F54E 4P46A 4XNYL 5IMKA 3KJ4C 1A22B 4W6YB 1C5DB 1S7WB 4L8SA 4JM2F 4U1NA 1II4E 1OAYL 4GAGL 2CKBB 4KTYA 1F3JB 2E8YA 4MAYD 3VXRB 4J8RA 3TBVA 4ZYKA 1SEBA 1JRHI 5SWZB 4YR6A 4MD4B 5JMOC 3BPNC 4HUUA 5IK3A 2JIXA 4ZDHB 2PNDA 1CIDA 3Q6GL 4IRJC 3B2UD 1X7QB 3DRTB 3CAFA 3NACL 3SKMB 4HWUA 4BFBD 3H9HB 1T21A 3OWEA 5D9SB 4OCSL 3IDGB 1I9EA 2DQGL 3CLFH 5CP7A 1FN4B 4MQXD 2UVFA 3RI5K 2D7MA 4BQCA 1WITA 3MLXL 6FABH 4HS3A 4YBLC 4M6AA 4GOSA 4XHJD 4YDKL 3UP1A 5KOMC 5FGCB 2QL1A 1UZ8B 4I9WE 3ARYA 4JRYA 1J1OH 3SCMC 4U1SB 4BKLA 1JCKA 4I5BA 3WIHA 1CCZA 1JGLL 2GSGA 1GGBH 1EZVX 3V0WH 1A9BB 3V6ZA 3DETC 5D1ZD 2PCPA 3MROA 1DDHA 2NY4D 5B4MD 3TZVC 1JJUA 2NZIA 4L3ED 3KWWA 3SJVA 3E3QC 3ROLB 4R4NC 3HAEB 5T1MB 4MCZA 3P11H 4HHAB 5JOEA 3MBEB 3LHPL 3VXQB 1FE8H 3DVIA 5JA8B 4LLMA 3VMOA 3ETBF 4FZEH 3ULVC 1IAMA 3FB7B 1HH9A 3C8DA 3RGVD 2IFFH 4MX7A 3QQNA 4L4TA 4HJ0D 4OD3L 4PJ8A 3SJVE 5L7XL 3RVUC 1FCGA 4IRZH 3NZHH 3U4EA 3PV6B 2H32A 1HYSD 1SM3L 2Q76A 1CXHA 4ZXBA 1AC6A 2DJ4A 2IPUK 4PLKD 4UIKH 3AM8A 3OF6D 4N1EA 4P9HH 5EIVA 5TGBB 4L29A 4L4TE 3H7BB 4J12A 4WI4A 5I1LA 3HC3L 1DL7L 2WWKO 1QNZH 4LSRH 5JXAH 1HWHB 4HUVA 3THML 2A0LD 3R1GL 2V5TA 4HWBA 2OK0L 1GZPB 3BT2L 3KYNA 3ES6B 4N0CD 2E7CA 5F7UA 3GSNA 5E8PB 1OAUH 1XGRB 2NXZC 3WUWA 4LBEA 2DIAA 3VWJB 4P4KC 2CK0L 1EFQA 1INEH 4PLJC 5EO0A 3OR6A 3ULUH 2GJ6D 3WSQL 1KCVL 4LEOA 4LVNC 2FYYB 3ZHDA 5DVKA 4A6YH 2HVKA 1QR1A 1M7DA 2V6HA 1OGAB 4O58H 4WNQA 5CAYB 1O0VA 3HE7A 5F72S 4Y5VB 4HS8H 5CP3H 3INUL 2WUBL 4L9DA 3WKML 3KPLA 3LPGA 5L9DH 3UTOA 4L4JA 1RJCA 4UQ3A 2NLJB 5ESVA 4XWOD 3SE9H 3JTSB 3Q0HA 4M6NL 3KPSD 4K3DH 1F90H 3OKDA 4HWEL 3SEPA 4NZUL 4X6CE 4HG4J 1DQJB 5TPWH 1B0GB 5ADPH 1GC1H 4EVNB 1IGJB 1R0AL 3LEVL 4G7YL 2LAAA 3PHOA 4LCIL 1JHLL 4JO3H 3VA6A 4MD0B 4DUVA 4D0BB 2CPCA 4OUOA 1MCFA 4FN0A 1GH7A 1KXQE 3T08A 4C58B 2G5BB 3C6LA 1A7QL 1KJ2B 4NNPL 4PV8B 2XY1A 4CW1B 2EO1A 5LGJB 4JDZA 2E5EA 3IU3B 5EUKA 4PJGA 4TNWK 5JNYA 1IGTB 1CIUA 2PXYA 2X4RA 1MFDL 4CN1A 2ZCKH 4GRWB 4NRYB 1T3FB 2VTFA 3QJHA 3N9GL 5FYKU 3QNZB 5BO1H 1T6WA 3NFPB 4ZUSB 4PGJA 2UZIH 4P3DA 4Y4FC 2HMID 3DGCR 3K4ZA 4HC1L 1XGTB 5JHDA 4OF6A 5FHBH 2R69L 4CVXA 4JKPL 3MLYL 3O3UN 1BEYH 4JY6B 4H5SA 1T20A 1NUGA 3X11A 2I5YH 5AZ2H 2P8PB 3K8KA 3MRIA 4N0RA 2DDQL 1HZHH 3AS2A 1T04A 4PJHB 4Q9QH 1ZE3C 5HYEA 4JRXA 3UX9B 4LU5H 1H3XA 3K2UL 3QIUA 3ECBB 3UYOD 2CMRL 4LAQL 4U1JA 1S9XA 3I2CH 3LKSB 4U1GB 2AEPL 2NPLX 4K7PH 1N59B 3I3DA 4KKBC 4J2XA 1IM9A 3FO9A 4OLZH 5GJTL 4XBEH 4HUXA 4OCXL 4P2RD 5IUSA 3BKYL 4KPHH 5ENWA 3ILQC 4TRPH 4WWKC 1TZIB 4XCCH 3KPRA 3SGDH 1YECL 3ULUD 3BIKA 3AY4C 2E6QA 5L8LB 3CZFA 2AJ3B 1T0MB 4RGOL 2X4SA 4XWGL 3QH3A 5FGBA 1FVEA 1JZ7A 4X4ME 3ULVL 5EU6E 4JHAH 4MMZC 3T04D 1KIRB 4K3EL 5C0IB 3KPRE 5FECB 4OM1H 5GGSY 4CJ1A 1Z0NA 4LRIC 3LPWA 5DO2D 1IQDB 3HZMB 1CK0H 2WBKA 2IWGA 3B2VL 3CVHH 1D5XA 3GSXB 3CGTA 1J0IA 2XWBB 4OIIL 1LO4H 1KJVB 4I0PD 4G8GA 3UJJL 5IMMB 3HFMH 2XKNA 4XNMA 1CFVL 3BKJH 3V5KA 3HNVH 2M8XA 4Q6IC 1ETZA 1K4CB 3HMWL 2UY6A 1OAKL 2FBJH 1DUZA 2J3SA 5C07B 2DMCA 4CMMB 3D0LA 4X7EC 3V52L 4FP8H 2XFXB 5I15H 4GMSL 1C5DA 1RJZA 1S7WA 4AY0A 1MFBH 3U7WH 5DVLA 1KIPB 5J6HB 3MNZB 2R9HC 1KN2H 1QBLL 2WINA 1IC7H 2CKBA 1LE9B 1ZA3B 3IDUA 5I1KH 4I77H 4RFEB 5ICYB 5M94B 5IVXB 5FF6A 1JK8B 3SE3C 1MHCA 2ZUYA 2AK4A 5D71H 4ONGL 3GGWA 4QHUB 3DIFA 5JW5A 1Z9SA 4WY7L 1JYVA 4U1HA 2VOTA 4JFZH 5SWZE 4Z7OE 3PNWA 4GKNB 4OZGB 3WHE0 2QSTA 4XP4L 4MNQA 3STZA 4NP4L 4DN4L 3QQ9D 4DVRL 4M1GH 5IOPA 2HT4D 2AK4E 1FL5B 5T1KD 2NTFA 2R2EB 1UC6A 1NBQA 4NRXB 1PW3A 3TYGL 3RY5A 2F53B 3QEUB 4YPJA 4U3CA 2A77L 4I3SL 5DMGC 1F4HA 4YXLH 4G8IA 3DX9B 3N85L 4Y4HD 4MNQE 3CJJA 4MXVF 2FGZA 4U6TA 2JCCB 2IC2A 5ACMA 5EA0H 1EHNA 3I6LD 4WV1A 5C3TA 3RAJH 1U95A 5FGCE 2CGRL 4GAFB 3BSZH 4M9OA 3VXQA 5GRJH 4OLUL 1JIBA 5J56B 4PS4L 3DWTA 2QQQA 4HS6A 1TPXB 4XC1L 4XNYH 2Z31C 1Y18B 2J12B 4X6FB 1R24A 1IAIL 1OCWL 2ZUWA 3RIFF 4HIXH 3RRQA 4X6BA 1SY6A 2YRZA 1OAYH 2YPLD 2E7BA 3KPNB 1I1YB 4YHMH 3V2AR 4FFZL 2HLFC 1FORH