2VC2L

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vc2L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vc2L01
1NDMB 1J12A 3L5IA 1MCWM 4I2XB 1K8IA 1E28B 3DO3A 3VXNA 1JZ7A 1YJDC 1GIGL 3QQNA 4NZUH 1K3IA 1RVFH 3WFDH 1FIGH 3GK8L 4R4BB 4PJ8C 3S5LA 1AGFA 3RIAK 4WY7H 5D1XA 4PJFE 1MSPA 1I1AD 1FYTB 1YNLH 1NGYB 5T1DH 3VG0H 1T04B 3PV6B 5FB8A 4L8SC 4NQEE 2FECL 1BJ8A 3LVEA 2R56H 5T3ZD 1F2QA 2R2BB 5M95B 3PHOB 1QKZH 2XN9E 4M9OA 4X6DA 5FUCE 2VLMD 2X4UB 2PTUA 4HX1A 2FBJH 3TBVA 4JHBA 1FGVH 5IHUH 4P48A 2UZYB 1A7PL 4LARH 3DMMA 4LKCA 3SBWA 4YNYA 2QTEA 5FYLH 2NNAA 1OW0C 4MHHG 5KS9E 5CZVL 5JW4Q 1TNMA 2R2HB 4KZEL 2VABA 3RL1A 1SJHA 5GS2D 4NC0B 2HLAA 4NO3B 2VLJD 4L5FL 1K5NA 3VFRA 5HHVL 2JJWA 2W07A 2R0WH 2VZTA 4Y2DA 4OFDA 3F65A 2YMXL 5DQ9B 2DQUH 2FX8H 4UNTA 3V6OC 4XAKD 3X3FL 3IKCB 3MA9L 4UV4H 2HN7B 1NLDH 1T66C 4MNHB 5DJ6B 4QHKJ 5K9JH 1N0LA 3VXME 4CN6A 4Z78A 1F4YH 1S7TB 2E5EA 5BW7C 2EDWA 5E5MA 3D5OF 4DCQB 3KPOB 2YPLD 3MACL 5KSBA 2O5XH 5EC2B 5TF1H 1F6FB 3LB6D 4POZC 5KSUB 3G5ZA 4J3TA 5DD3L 1I3RB 5D1XD 4JO4H 1MJJA 3V4UH 4ZSOA 2J4WL 4NO5A 4WWKD 5MEOB 3VFVB 1IKFH 1MFCH 5IW1B 5J3HD 3NN8B 3TH2T 3T2PA 1CXHA 1X5ZA 5GS1B 4R3SA 5KSVA 5T3XE 1LO5A 5L0QC 2ZCKL 3SDDC 1C5DB 4OQTL 1WBYB 2QHLA 5MEND 4LCIH 1MLCB 4OZHF 1ES0B 3PP4H 1MFAH 2F9BT 2SEBA 3DMMD 5IMMA 4HV8B 3RDTB 2R1YB 5C6TL 4CU7A 3OAUH 4OF5A 4JPKH 3VW3L 4OUUB 1U8JA 4TTDD 5DLML 5JZ7D 4HIIB 3UAJC 5JXAL 1J8KA 5IM7A 3BHBA 3SKJL 1ADQH 4XCFH 2YD1A 3O9WD 2OTUB 4HT1H 4I48A 5GJTL 4LPXA 1JGUH 3QRFM 3V0VB 3F8UB 4BSWA 2OCFD 1D5XB 4NGHL 3DVNB 3C60A 1FL6A 1E6JL 3H9ZA 4MDIB 1KIQA 2OR9L 3BUYA 5KVDL 4K7PX 5GS0L 3HC4L 1MCHA 1HH9A 3NZ8A 2QR0A 1RZ7L 3LHPL 3S34L 4OCWL 1NAMB 1JBJA 3HNTL 1A2YA 2W0KA 1F3DH 3NACH 3SPVA 3GJFB 5DD0H 1NCCH 3B9KA 4FTVB 12E8H 2LV4A 3UCRA 2J12B 3UBXG 4IRZL 1GHFH 2B4CL 3LKNB 4PRHA 1I7TB 2PYEA 4HUUB 1U93B 4R0LA 5C09A 5J06A 2F54B 3QSKB 1SBSH 1LWRA 4TN9A 1MRCL 1J1OH 2D31A 3TYGL 5IOPB 3U7WH 4EOWH 4XC3L 3RWCB 1YMMD 4WUKL 1BVKB 3A6BL 4PY8I 1X5HA 4DWHA 1V3KA 4O51A 3C9NA 3W0WB 5C6PB 5TF0A 1ZT4A 2M8XA 3RVXD 3FB7B 4NKOB 1LDPL 1PZUB 1MFNA 2Z31A 1QFWL 1UFUA 4NNYA 4XI5C 3ZL4L 5GXBB 5LGKA 2AJZA 5E8EA 5CEYA 4NFCA 5ESAA 1IVLA 2OTWB 3WXWL 4LMQE 2YPKB 4WEBL 4Z7OE 1WEJL 3RBGA 1T83C 1JZ8A 5JOFB 2C4FT 3MCLH 4XH2B 3GBLA 3IETA 4XTRC 3Q1SL 1QSEE 3CSPA 3I02A 5IVXF 3QJFA 2X4QA 1Q0YH 1JGDB 1PX4A 1AR1C 2QHRL 3BP5B 3QHFH 4NO2A 4YUEL 5DJYB 1D5IL 2MHAA 5FEBA 1UB5B 1YMHB 2QV2A 1OP3H 1AXSA 1S7VA 4ZXBD 1F4WH 3H3BC 3W11C 1Q9KA 1IAII 4U1NA 3FO1B 3BGAA 4NQDE 2BRRL 2VWEC 3VFSB 4NQCA 3C08H 3LQMA 5FIEA 3U30C 3MRQA 4NSKB 4PJXB 3C8HA 4Z7UB 2XZZA 2FR4A 4G9FE 2ZUTA 4G80A 4KROD 3T0BA 2HT2C 2VKXA 3FQWB 2G75A 2ZSVB 3MRHB 3WDJA 3MUJA 5IHZB 4LSVL 2X1QA 2VDNH 3DO7B 3IDYB 4Y1AA 1OLZA 1B4JH 3NFNA 5KW9L 4ELKA 3T2OA 1OAUH 4B41A 5IEHB 3OKMB 3BH8A 5D7JD 1IKNA 1JNHB 5HGAA 4JGJA 1KBGH 5A1AA 3ARBA 4RMRA 3BPCA 3UJJL 3BD5A 3AU1A 4LDEB 5D1ZD 3GI9H 1JNLH 3S5LB 2Z93A 4G8GE 1DBJH 3H3PL 1UJTA 3GM0A 3QUZA 5HHQA 3QFJA 4BZ2H 4BZ1H 2DLHA 4UINL 4HCRA 3PP3H 3RZCA 4AIXA 1FORH 1KEGL 2GJZA 1HI6B 3JTTB 1J87A 4N0FA 2J2ZA 3I85A 4HX1B 4JPWL 3JV4A 1JPGB 3SGJA 3TBVB 5JHLH 3GUTA 4OZHE 5CAYB 2VB5A 3V6OE 4P0DA 5DZNA 4LKCB 4NQCD 3EYSL 5IW6A 2NNAB 3EO9H 3C09B 5GRUH 2E8YA 4UDTB 1OB1B 1TTGA 2VABB 4LCWA 1R3HA 3DX9B 1I1YA 5IBLC 2HLAB 2BRQA 4ESKA 4LGPB 1E4KC 2DAVA 2WAHA 4OLYL 4Y4KB 3V52L 1TZIA 3GKWL 1EA9C 5HGBA 4OF8A 3CU7A 4Y2DB 4XBGA 2A6KA 4IRJA 4JO1L 2GUOB 2W60B 3U9PL 4RGND 2BVQA 3INUL 2VZUA 4CDHA 5EIIA 5JW3L 2YZ1A 3OJDA 3LRGA 3QR2A 1LO2L 4G5ZL 3VFGL 2ID5A 3UTQA 1SYSA 5DJCA 4IHOB 3S35L 3SQBA 1S7UA 1OM3L 5E5MB 4JM4H 5KVFH 2DBJA 1BQHA 1JK8A 5KSBB 4ORZC 3L6FA 1B0GA 5ID1A 3EOAA 3W9EB 4D9RD 1ACYH 3IU4H 1KG0B 4GLRH 4KQ4H 4ZSOB 4L3AA 3RNKB 3I9GH 1G6RA 2FH8A 3MGAA 5JOPD 1NCDH 1NSNH 4YBQC 1WTGT 2AJ3B 5KSVB 1LO5B 1W2KT 4Y16A 4GQ9H 1FO0L 1MQ8A 1S78D 4DGVH 3GSNL 3U36B 5J13B 2PXYA 2RAMA 5FA4A 1DVFD 3CMOH 1RI8A 3BP4A 1Q9WA 1WV7T 4OKVA 5HYIA 5KVGH 5IG7B 2DBLL 3FFCD 3QRGH 4KZDL 5HGDA 4PJBA 2YK1L 3BHBB 4AEIL 4XPTL 5IFHL 1YEEL 1UKQA 2NZ9C 3J7HA 5TQ2H 3KLAB 3TO4B 1I8IA 1FL3B 1RIUL 4ZFGH 5E8DL 2OJEB 2HRPL 3WLWC 4P4KC 5BXFA 4I13B 5D71H 1CGWA 2H32A 3OQ3B 1KIQB 5FK9A 1HQRA 1O7VA 4JDZA 3SDYL 1HH9B 2EYTB 3NZ8B 4Z8FH 2DICA 3QG7L 5IVXE 3QO1A 3FTGA 2CDFB 2ZKHL 5I1HH 2A74B 1WWWX 2DLFL 4U0QB 1I9EA 2P5EA 3B9KB 4X6BB 1LP9F 1VSCA 2WM0A 3QIWA 2OL3B 4M3KB 3T0XA 1C7SA 2PYEB 1E6OH 2PO6D 4R0LB 2J7LA 3KHQA 3PWPA 3JXAA 2B4CC 4TVPD 1ZEAH 2CPCA 3U46B 1EHLL 4MNGE 4DKDC 1QFUL 3MOAL 1CF8L 1YYMH 3KPRE 5DK3A 5I18H 1IZKA 5F8QC 1ZA6A 4WI3A 1JTPA 4JY4B 4I9WE 4KVCH 4XVJH 3VXUA 3JUZA 3IJHA 5ITFA 3ZKND 5E0QA 3UJTL 2ZCLL 1QFPA 5HHOA 5T1KD 1IC7H 1VEMA 2WLZA 3BRDA 2Z31B 1CE1L 3WBDA 3UMTA 5CEYB 3M45A 5ESAB 3QDJA 1NANI 3SHSA 4HJJH 4L9LC 1Y0LB 3LDBB 2BOCA 3F7YB 2YD7A 1FH5L 1MCPL 4M61A 3CUPA 1XEDA 1WBXA 4ZUVB 4JVPA 1D9KC 4PJDE 2R23A 1QBMH 1T1ZA 5I74C 3I02B 1GZPA 2X40A 2VWEE 3ZYZA 5ALBL 2EDDA 2VXUH 2VDPL 5DJXA 4NO2B 3QZWA 1JF6A 2ESVA 2MHAB 4L8DA 3B2UC 3VFMA 1AXSB 1S7VB 3PWPD 4LFHD 4GSDH 4OM1H 3ARVA 2UZIH 1FNLA 1J1PL 2GQHA 2JJSC 4U1NB 4WEMB 4O2FB 4RFEA 4FA8A 5IB4A 5BRZA 5C08A 5K9OB 1AC6A 4BELD 4KC3B 2C4XA 2KZWA 3X17A 3MRQB 2VL5B 5C3LD 4UDUB 3CH1A 5SV4A 4WW1A 4G80B 4XNUH 5GRYA 5TFSL 3QAZC 4PJIA 3MLVL 2O5YL 4UB0L 2DTMH 1R3JA 3JVGC 1C16A 3OGCA 3P4NA 1VADB 3ULUL 5GGUA 1QRNA 4J8RB 3L7EA 2O5ZH 4HKZB 4HIJA 4R2GC 3RKPA 2BY1A 4ENED 1H15B 3OAZH 3MTRA 4M7JL 4FQ1L 2Z35A 1S5IL 3ARBB 5L6YH 3BPCB 2UWEA 4BSVB 2ADIA 5I2IA 3AU1B 1WC7A 3ZKMC 4YHML 4G9DA 2BVTA 6FABL 1CD8A 3AC0A 1ERNA 4J3SA 2Q87A 2KBGA 2VXQL 4ZUSA 4OQ1A 4OCSL 4NN6B 5I9QB 1NBVL 3HE7D 2NXZC 1OCWH 2BHUA 4P2OC 5IF0B 1X5KA 1ZT1A 1TXKA 3KGRA 4PTTB 3QNYB 2DWDB 5DWUL 1A64A 1MF2H 2GJZB 3GIVA 5EZLB 1QG3A 4PB9H 4RX4A 5DT1L 3JV4B 1X4YA 2XPGB 5C08D 3LSOA 4QRPA 1V3LA 5BZDA 4LCWB 2I24N 1K8DB 5A16A 4YDIL 2XQYK 1I1YB 3GIZH 3IFPB 4AIOA 2ZP0T 1HWHB 4FQXA 4XBGB 3QDMD 4IRJB 5D7IA 3D69A 1LE5B 4S1SL 4IDJH 2BVQB 1CXEA 4MXQD 5EIIB 2E27L 3KXFD 2L4OA 5IT2L 5L8LB 2OM5A 4P46D 5DJCB 1KPVA 3ARFC 4ONFH 1BQHB 2Q6WB 5GZND 3HRZB 3B5HA 4BQ6A 4BH8A 2ZNXA 4NBXB 1SJXA 3C5JA 1HYRC 3VFTA 1B0GB 1UQSB 2NX5A 3EOAB 3UROR 4YDVB 3ARQA 4WV1B 3RJQB 1LP9E 4MNQD 5JPMB 4R7NB 2WBJB 1P84K 4KHTL 5BMFL 4OJFH 1AO7E 4L4TE 3QQ4A 4Y16B 5BVPL 5I1AA 2XKSA 1OP9A 4HUNB 2PXYB 1UWXH 4FFVC 5FA4B 3VFPA 4U6YA 3PWLB 3MGTA 3QDHA 5D5MB 3L5XL 1NFDA 4PJCB 4MXWL 3HCVB 2FB4H 4DOHB 1DBMH 4C55A 3UJIL 4EI5C 1OL0A 5I30H 1QSFA 2P5WA 1I1RA 4YXHL 4E5XA 1S7WA 4OZFB 3QUXC 3G6JA 1DBBL 4OV5A 2OJZH 4PJAF 5C0CE 4JFYA 1DQTA 2J1KA 2OK0H 1YA5A 2W92A 5FK9B 3LQAH 1MHEA 1JUFA 4JDZB 2OYPA 3HZYA 2HT3C 4WNQA 1KN2H 1NGWA 5FECB 2JIXB 2YRZA 3O6MH 4JY5L 1RZJC 2FX7L 2P5EB 4IDLA 1GSMA 3QIWB 4WVRA 2V2WB 3MZTA 2HFTA 4LCYA 2JB5H 4GMTL 2GY7B 1MREH 4YC2B 3NAAL 3O4LE 3ULVH 2NY3C 1FNSL 3JV5A 5IB2B 5ESVA 3QDGE 2IAMC 4ONHA 4PJEB 1Q0XL 3OXSA 2VR9A 4KHXL 1DANU 2ZG3A 3O4OC 1F6AA 4JO3L 4J6RL 3JWNC 3EIFA 3C8DA 4NFBA 4HFUH 4HWUA 2V5MA 2MOVA 1D6VH 4CADA 3QDJB 5DC4B 4LLAA 4XRCA 4XNZB 3SDCA 4Y4HD 4YDKL 4Y5XC 2VISA 4LIQL 2AK1L 1ZE3C 4DQOH 1LK3H 5GRWA 1N64H 3MUY1 4AEHL 3HKFA 3MLYH 2VE6A 4M61B 3CUPB 3TESA 1LGVA 1WBXB 4WHTA 5IMOA 5SV3A 5T3ZL 5FKPB 2R23B 1T1ZB 3FQNB 1KELL 2DM3A 1GZPB 3SOBH 5F3BA 4WCYH 1WWAX 4M6NL 3VGFA 1DFBL 5CUSL 5I1EL 5JIIA 1KYOK 1WSST 2ESVB 3QCVL 3FJTA 3VFMB 4K3JH 3QXDA 5HYQB 2R29L 1A9EB 5EG6C 1F97A 3N1QC 3LPGA 1KJ3H 2EDHA 4JB9L 4O02L 1CK0L 1U3JA 3MNVA 5DK2B 4KDWA 4QRTA 1QYGH 1BD2A 1MFEH 3B4NA 1TCMA 2F8VA 3HE6A 3CH1B 2RBLA 1YEIL 2MQ0A 4Q7DA 2Z4QA 4ODBD 1WCBA 4HWEL 5C0AD 3GMLB 3O11A 2VTFA 4PJIB 5BO1H 1YC7A 4GG6E 4PJGA 3OGCB 3P4NB 3DXAD 2VZSA 1QLFA 3PABA 1FDLL 5HI5C 5GGQH 4FQCH 4P57A 4BQ9A 3QIUC 1YPZE 5A2IH 5D7LA 2AJUH 4LQ1A 1Z3GH 2GSGA 5DJAA 3ULUC 2IMNA 3ILQD 2EZ0C 2CUIA 1SY6A 2UWEB 1NBYA 4ODXA 3Q6GL 4OZ4B 2QADD 3FQRA 3OR7B 1GIGH 1F6LL 3I3EA 1R3KB 3NCYP 3AREB 4EQ2A 4RIRA 3GK8H 4JM2A 2P8PB 4OZGF 3WL9B 5ALCH 3T1FB 5EZIL 2ZJSL 2DI9A 1C1EH 5E4EB 4F7CA 3K74B 4ZNEA 3G5XB 2K7QA 4PJHB 1OAQL 1I3GL 3GSVB 1MCSA 3TA3A 1A6TA 5T1LB 3BP6A 1I4FA 2CDGB 2OLDA 5GISL 1BD2D 4JN1L 4GRLA 4NZRL 4QRPB 5L9DL 4XP6L 4WDIA 5JUEL 1IGTA 5A16B 2HJFA 5CZVH 1A1OA 1K4CA 2JK5B 4NWTL 4KZEH 3G9AB 5HHVH 4M4PA 5D7IB 1WGOA 2CGRH 4LEOB 5MI0B 3BJLA 5FGBC 1J0JA 4CBPA 3X3FH 5FFLA 2HAZA 1KLGB 2DQDH 3N1GC 1CFTB 1KPVB 2W0LA 4K9EH 5J7CC 5C0GB 5GS1C 5IJKA 3TCLB 4TYUA 3C5JB 3OKKA 5E00A 1EAPB 1EERB 4CMHB 2NX5B 1RZ8A 4JFDA 4S0SD 2Q8AL 4PJ9C 1IEHA 2WQ8A 1WWBX 2XACC 1FYTD 1HH6B 3K81A 3OKOA 2IADB 2J4WH 3RDTC 3VXMB 3S96A 5ICYB 2HFFA 5IFJA 3NFSL 3BEWA 3QQ4B 2Q20A 3LKRB 2ZCKH 1X6NA 1FFOA 4OQTH 1T7XA 3TIDA 2YA0A 5TJWK 2EC9T 4IJ3B 3VFPB 4PRAB 3MGTB 1HHHB 1U2HA 1EFXB 4DN4L 1NFDB 5ESQB 1MQKL 1N26A 3TBWB 2ZCHL 3VW3H 2R2EA 3BN9D 4S1RL 3ELAT 4E5XB 3AB0C 1WFUA 1BHGA 5JQHC 1D3CA 3GJEA 3WIHA 1ZV5A 4Z7QF 3G6JB 5GJTH 2VZOA 1W72H 4O9HL 1CQKA 3RWDA 4MDJA 4NGHH 1OGAA 4OKDA 5C7XL 5IK3A 1AHWC 5L88L 1MHEB 1JUFB 2OR9H 1HIML 1CLOL 4WNQB 5KVDH 5GS0H 1JPFB 4OUOA 4WJ5A 3TFKC 1VA9A 1RZ7H 3LHPH 2C7UA 4OCWH 1I7ZA 3VG9B 3IS0X 3O0RL 5CGYC 5D7KE 1QSVA 3MA7A 3PDDA 5IHLB 1G7QA 4M3JA 3MV8E 4WFFD 1M7DB 4AENA 4U1HA 4IRZH 4N8VA 5E1AB 3ESVF 4M7ZB 3FCTB 2VDQH 4LF3A 4XBPA 3H9HA 3D87B 3K80A 1LEIB 1MRCH 1L7IL 3HZVA 3TYGH 2PW1B 4XPAH 4TULL 1B6DA 3SY0B 1FCGA 4ONHB 4XC3H 4HPYH 2WINA 3SKMA 3OXSB 1H3XA 1JTOA 3A6BH 3HA0A 4ZYKA 3EZ8A 3KPSA 3OJ2C 1KXQE 4G7VL 5FOBA 3MXVH 1KIUA 1F6AB 3F7QA 2NLJA 3HMWL 4EN3B 1DSFL 1NGQL 5C0JB 1T1XA 4UNUA 2W0FA 5ECJE 5EULV 5GJSL 4AT6A 1LDPH 4HKBB 4WTXA 3FKUS 4L1DA 4CADB 5SWZE 3SDCB 5FHAH 3ZL4H 5DC0A 3LOWA 2J6EA 2XWBA 3WXWH 2YA1A 4Q6IA 4WEBH 3U82B 5IMOB 4WHTB 2QSCL 2OR8A 1YYLL 3NIFE 1E0OB 1FNEA 1S9XA 3T0DA 2AK4D 3CPLA 3OX8B 5D2NB 2AGJL 4OLXL 1OGTA 3DURB 3RWIA 4WFEE 4Y8DC 3ULSA 4OZGE 1HILA 3EDJA 4FTVD 3UYOD 4G43A 5TQ0L 2QHRH 1PZ5A 1D5IH 1T1WB 3UTTE 2DQCL 1ZHBB 2F54D 4QRRA 5EU6D 1JIBA 3ZTNL 3RAJL 1X5JA 1WIUA 4QRTB 4OCLC 5ID0B 3KLHD 3FOMA 2BRRH 4JZNB 4MAUL 4ETQA 1XF3A 2NY0C 3ULUE 3FO2B 3VWJB 2DIBA 3KPSD 1ZHLA 2E9JA 1JI2A 2FCBA 1EEZB 3LB6C 4LSVH 1ZK9A 5LGHL 5KW9H 4L8BA 4X4MA 3WFHB 2HG5B 1FBIL 1G7HA 5D1XC 3TT3H 3MNWB 5D7LB 4NHUA 4PJXF 2IBZX 4AH2A 2EE3A 4Z7UF 1N59B 2APWA 4YAQB 5J3HC 2IF7A 2FZ3A 5DJZA 3UBXB 3V0WL 4XVUC 3FQRB 3UJJH 4O2CA 5J11B 4JRXA 1UGNA 4RIRB 2ERJC 3V2AR 3H3PH 4MB3A 1MI5D 3DMMC 4URTB 3PDGA 3SBWC 1RUML 2APXA 4UINH 3C09C 4EXPX 5C0IA 1IAIM 2EXWC 4OFYA 4N5ED 4YHYC 3TA3B 5JZ7C 2OI9B 1KEGH 3NABL 3BP6B 5I17B 1INDL 3N85L 4DVRH 3MLSL 4JPWH 4Y2DC 4NO0A 5DSCA 2PR4L 3EYSH 2AJXL 1JFQL 4KXZH 3WHE0 4MJIB 5C0BE 4NUGL 4YZFE 1LEGA 1AKJA 1IQDA 1ROWA 4HKJA 4NQVB 2IGFL 1BPVA 1T21A 2VLKD 3C8KA 4W6WB 2N1KA 2VDLL 2ZUQB 4OLYH 5D1QA 5DVMA 4JZJB 4X6DF 3V52H 2P49B 1OPGL 3GKWH 4FQIL 3WD5L 4HIEA 3P9WB 3QFDA 1G6RL 4WI6A 3UO1L 5SWSE 1R3IL 2IH1A 4Z7QE 3U9PH 2J8OA 3O3BA 3INUH 5JW3H 2A0LD 1LO2H 4G5ZH 3VFGH 5DGRA 4R8WL 3MRNB 3S35H 4TVPL 1OM3H 1FAKT 5E6ZA 4ZUUB 5E00B 2Y5TA 3RL2B 3TP4A 3MRFA 5IMLA 4DW2L 1RZ8B 3BKYL 2FLRT 4JFDB 1XCQB 1QVOA 1NFKA 1J8HA 2I9LA 5E6ID 3QWOB 4MJ6B 2NW2B 3OKOB 5HDBF 1ZA3A 4PRID 3ARUA 2UVEA 3S96B 5DYOA 2HFFB 5MHSD 1BZ7B 4C83A 4GLRI 5KSBF 4HAGA 1WZ1H 4P2QA 1CE6A 1FO0H 2WBKA 5H35A 3FT3B 3GSNH 1PG7X 5AWNH 3MLXL 1N5AA 3C60C 4HKXA 2DBLH 3D9AL 3MFFA 4Y4KD 4M1CC 1Q1JL 2YK1H 1RU9L 5E2TL 4XPTH 4YXKH 1TJHL 3GJEB 3BAEL 1YEEH 4GG8B 3P73A 4CVZB 3RUGB 3FRPG 4FNLL 2CO7B 2UZXB 4JFQB 4OLEA 4ZO9A 3RWDB 1RIUH 4JFFD 4QLRA 1MCFA 1YY8A 2R15A 4HZAA 1H3GA 2HRPH 3V5HB 4U1GB 5A40E 1BZ9A 3C5ZA 1IQWH 2FNBA 2R8SH 4ZXBC 5BQ7A 5GS3A 2GYSA 5E9DD 3SDYH 1IE5A 2A6IB 4ZO7A 2C7UB 2NY6B 2OXGA 1HYSD 1CLCA 4BFGA 3DV4A 3DETC 4XMPL 3O3EA 3S6CA 1G7QB 4LPTA 4AENB 4U1HB 4P59L 1UXSB 4N8VB 4ZPVA 3DRTA 1A1NA 4X9IA 2XTJD 3RWGA 3U0TB 1CFQA 1FVDB 1MCEA 1DQLL 1RMFL 1WZKA 3HUJB 2P8MA 1JVKA 4LF3B 4XBPB 3DGCR 2Z31C 1KIRB 1VEOA 1EHLH 3HZVB 4GT7A 4OF7A 1QFUH 5FYLD 2KQNA 3MOAH 1CF8H 5EOCL 3LDBC 3SKMB 3UC0L 1RUPL 4LIQE 1CDIA 3L5JA 3E8UH 3BPLB 2VR5A 5IROC 2ZCLH 3EBAA 1RUKL 5T5FH 1ADQA 1P53A 1IILE 3BSZL 4GH7B 1CE1H 4U05A 2OP4L 1JYVA 2AVGA 4U1IA 4TQEH 3P4MA 2XWBB 4UIMA 4PJXE 3DUUB 4Z7UE 4POUB 5F6IC 1MCPH 1WAAA 4XNXH 3QP3A 1NEZA 2VLJE 5DMIL 3DJ9A 3BRGC 4KK6C 5D72L 3RWIB 1OGTB 1I7UB 3ULSB 2NY5H 1WJ3A 1DUZA 1HILB 3LEVL 5IQ9A 5A2LH 2HTKD 3IT8D 1KEML 4YWGH 1UZ6E 1PLGL 3SEPA 4QRRB 1BOGA 3RTQB 5E1HB 3A6OA 5JW5A 3SE4A 4YHZH 3ROOA 3NGBB 4OTXL 2V9RA 5CP7A 3FOMB 1FZJA 4HWZA 4ETQB 4ZAKA 3O6FA 5I73B 1EGJH 2EXYD 4KJQD 3OG4B 3MV9D 4XPHL 1IKNC 2WUBL 4KI1A 3MUZ1 3D25A 1L9NA 1AH1A 1ZHLB 2ICWJ 3P3YA 2V17L 1QA9A 3D0VA 5L8KB 4X6DE 2O5YH 3LKPB 4L8BB 1T5XA 3ULUH 5EO0B 4NHCL 4I18A 1G7HB 3QUZC 3TZVB 3VXTA 5EB9A 1ZHKB 3WKNA 4AH2B 5AYQA 1J7VR 3GMPB 4M7JH 4M7LH 1TDQA 2V9TA 5DMGD 4ODWA 3RZCC 1S5IH 2FZ3B 5DJZB 5FYKD 3TM6A 5BJTA 3FAWA 4O2CB 4YHMH 4JRXB 4LEXL 2VQ1A 4LSTL 4OCSH 1DVFC 5HDBE 5IMKA 2CLVA 4FFZL 4QCIA 5C0IB 1P84J 1VKXA 1JCKA 3QUKA 5CIPH 5DWUH 1KNOA 3IAGC 2Q86A 3F7PC 1IGCL 4M93B 1E4WL 3RGVA 4ZNCD 5DT1H 2ORBL 4NN5C 5DSCB 2W38A 4ZODA 2Z0BA 5C0NC 4AQ1B 3O6FD 4JN2A 1JZ4A 1QD0A 1JPST 3RJDA 4NDMB 1LEGB 2V6HA 2Y72A 1IQDB 3GSOA 4HKJB 4U2YA 3MPCA 1UA6L 4FHBD 4GMSL 4H0IA 4TUKH 1GOFA 1T21B 3EYQC 5D1QB 3IFLH 1EV2E 2H2PC 3QFDB 4J12A 4IS6A 4GRMA 4NCDA 4S1SH 2WLYA 1J5OL 5ACZA 2CIKB 2E27H 5EWIL 5IT2H 4E42B 3O6LL 3BGMA 1JP5A 4NKMA 2MPAL 1A5FL 4MYWB 2PO6C 4UTBH 4QY8A 3WFBL 1RIHH 4Y16C 4ELMA 4G6JL 2W91A 4ODTH 1DEDA 3JSSA 3MRGA 1J8HB 5FM5O 2I9LB 3OF6A 5I1CL 1EBAA 5L2JA 4N9OB 1IZJA 3P0VL 5INDA 4F7MA 5DYOB 1BLNB 1ORQA 1MWAB 1TZGL 2DJSA 4C83B 2ED7A 4XNQA 1BEYL 2G5RA 5DA0B 2H2SD 2CR6A 4P2QB 3CLFH 5BVPH 3R06B 4PG2A 2RHEA 2ADGA 4YH6A 2EDXA 3WKML 4JFPA 4Y5VB 1RAMA 4ZFOB 3MC0A 3BIKA 2VLRD 4G6FD 4QYOB 4HKXB 4DVBB 5EO9A 3L5XH 4N0YL 3EW3B 4MXWH 4PRHE 1QOKA 2P46B 5C09E 2XN9A 2JJVA 3Q2CA 4K2UH 4YXHH 2FSEA 1T5WA 2GJ6B 4Z5RB 1XH3A 5LBSL 3CFJB 1JHTA 2VITA 1DBBH 4PJCF 2KQMA 2E3VA 1BZ9B 1MCRA 5C0FA 4F9LA 4RAVA 3HG1A 1LILA 1DP0A 4P9HC 2ILLA 5EDXA 1WBZA 5EIQA 4KH2A 4MD4A 4MA3A 1BFOB 4JY5H 1VGKA 3VGGA 1KYOJ 2EDJA 3ECBA 3ZT5A 4JKMA 4GW5A 2ENYA 2F74B 3WFEL 4U2ZA 2WBJD 3MRLA 1U8KA 5JW4N 3NIDF 4KRPB 4ZPVB 4OCYL 3DRTB 2DDQL 3D0LB 3DPBA 1CFQB 5F7DA 5HHPB 1N3NA 3K8KA 4X5WB 1W8NA 2ZWLT 4PJ5A 2DOCA 4UQ3B 3GHEL 1M4KA 4XNZC 3KLDA 3QA3A 4KPHH 3SCMB 1FNSH 3DSFL 1UM5H 5D8JL 4LVEA 1BIIA 1DR9A 4ENEC 5DFVD 2CKNA 1Q0XH 4F37K 3U7AA 3BDXA 4KI5F 4J6RH 3V6FA 4V1DB 3N50A 1RHFA 4QGYA 2CSPA 4XGZB 2P43B 3P4MB 1C5CH 3JV6B 4NQCE 4YDKH 4UIMB 3MLUL 4PJEF 5AEAA 2XZQL 2JJUA 1A1MB 1HXMA 3CK0L 4HIHA 5EC1A 1A6WH 5T3ZH 3HG1D 1QBLH 5HHMD 1ND0A 3VWKB 1NEZB 1U2CA 2VH5H 1FAIL 4LPCA 5J12B 1MCKA 2JIXD 2Q7YA 4Y1AE 2YXMA 2WUCL 1DUZB 5LAXB 3UDWA 1NMCC 5IQ9B 1D6EA 4FMKA 4M6NH 4RA0C 1GH7A 1DFBH 4M6ML 5B8CA 5CUSH 5I1EH 2Y06H 1KFAL 5KTEL 3CLEL 3QCVH 5GS2H 4JFOA 1U91A 1YEJL 2B5IB 1BOGB 3BW9B 5JW5B 5KN5A 1FIEA 2R29H 4JFEB 2JCCE 5AUMA 3R8BB 3BFOA 1H3VA 4PJ5D 1HSAA 1RULH 4JB9H 4O02H 1CK0H 4B50A 1IM9B 3IF1A 4HWZB 3QFJE 4ZAKB 1SY6L 3T2NL 4LRNL 4MXQC 5JDSA 2AI0L 2BXZA 1U36A 2P47B 4KY1H 4P23B 3CSBA 2JJTA 1YEIH 5CCKH 1KTLA 2DYPB 2Q1EA 3CFEB 3D25B 2FJHB 1AI1L 4OD1L 1ZLWK 5ILTL 4HWEH 3WS3B 1Q9LA 2I60H 5GZNC 3KPMA 2G2RA 1FVCB 3FN3A 4U0RB 1NCWH 1P9MA 2X2YA 5GRJL 3SGKC 1LO0H 5CINL 1J18A 1FDLH 1JPSL 2YKLL 1L0QA 2W1NA 3V79C 3OKNB 2APBA 3WN5A 4UOW0 5F7WC 1KC5L 2DJUA 4LHUA 4ODWB 4H5SB 4LCWE 4TRPL 1I1CA 4QHLA 3Q6GH 3MLZL 4PJIF 4P2CG 5D4QA 3EOTL 4RBPK 4FZ8L 5JXEA 2X9XA 3BIBX 4MJ5A 5IMKB 3BEVB 4M1DL 4QCIB 2ZJSH 1OT1A 1C8PA 4YO0B 3PWJA 3S3JA 1VKXB 1T7YA 1QSEA 1UXWA 1KPUB 2UWEF 3QUKB 3MZGB 4P5MA 1NQBA 2Q86B 1I3GH 2L7JA 3GNML 4CL7A 3EGSB 4PD4K 1F58L 4FQXC 5FV2A 4EEEA 3E6FA 2FECI 3MRCB 3HS0A 1IC1A 5ABDE 4PYGA 4JN2B 3MRIB 3K2UH 1L7TH 5L9DH 3VD9A 4XP6H 1RJYA 4XNYL 4C56A 1MCLA 2DQHH 3GSOB 2NY2B 4XNMB 3QEUA 4PJHF 1TPXC 4LPWA 1NL0H 1XF4B 4NQDA 1HZHL 3T4YA 4K3EH 2EE6A 3G08B 4TVPE 1TQCB 4XCCL 5FDYA 2ITDB 1EJOH 2Q7NA 3U1SL 3QBTB 3MV7A 5ACZB 5E94A 2XXCB 5H94A 3KYKH 3OB8A 2GAZA 3JZ7A 1WVZA 4GXUM 1BECA 4PJBE 3RY6A 4ODUA 3IDNA 3ARED 4PY7B 4QRSA 1A6UL 4YHOL 5DHYA 5D7IF 3TWCL 4B7IA 1V8HA 3KWWA 4I5BA 2VERN 5H37G 2Q8AH 4A2MA 5L2JB 5IB1A 2C3XA 1G7IA 2QQNH 5INDB 2P4AB 1BM3L 3P9MB 4GKOA 3TPKA 3NIDE 3L3HB 3WIHL 5T1LD 5J6HB 2ADGB 4S1DD 4PJFB 3KNBA 3BDYL 5F1IA 3TPUA 4X80L 1ZLUH 2R69L 1CFVL 4F80A 4NQEB 4N1HB 5DQJA 1PQZA 4RWYL 4DN4H 2DQJH 2L7UA 2QQQA 3TBSA 1MRFH 32C2B 1MQKH 1NCNA 1JWSA 2XN9B 3WHXA 2ZCHH 3PWPE 4UQ2B 1K85A 1MELA 3JWDC 2X4NA 1CQYA 4F15B 2KZ1B 2FSEB 1T5WB 2XQYG 2C3VA 3O8XD 3FQUA 3DX6B 3NOIA 5KS9B 3U0PA 1XIWD 1A7RL 1JHTB 3P0GB 4JGUA 5HI4D 3VCLB 4D2NA 1JZ2A 4O9HH 1NFDF 5HD8D 3VXRD 3ZT7A 1DQJB 3VXUE 5C7XH 5C0FB 1N7ML 1XGPA 3HC3L 5HYSG 2VOTA 1H3TA 3GMMA 4EUPH 5HHOE 3HPLB 1KN4L 1UM6H 4KMQA 4K3DH 1HIMH 1CLOH 3PL6A 4G8EB 3PE9A 3IXTA 4PLOB 4MD4B 4MA3B 3QDJE 3G6JF 1VGKB 4YLQT 2GFBB 2H6PA 4GW5B 5CKGA 5T33L 3BE1L 1U8KB 3VD7A 2BSSA 3GM8A 4LLUA 4JZOA 4ZQKA 5FXCH 4L29A 2KPNA 1XCTB 3B2VL 4APQA 1N3NB 1AD9A 3PXJA 5A2FA 1C7TA 1ZTXL 3N9GL 3U4AA 1MHHA 2QKIB 2YN5A 1LD9A 1LE9B 4G6AD 5JNYA 2CO6B 1UYWL 4IOFD 3UZQA 4DK3A 4Q58C 1EAJA 1IAKB 1L7IH 5I15L 3QIBD 2ESVE 3RHWK 4TULH 1BIIB 1CTOA 3LKSA 1J0HA 3LRSA 2IANA 2B8OT 2FX9L 1JYXA 3BKML 2WMPA 1MRDL 3V6FB 4Y2OA 1NGQH 5FF6B 1T2QL 2UYLB 5GJSH 2YUVA 1QR1A 2K7PA 5C08E 5BRZE 1LK2B 3VGEA 3L3JA 3SJVA 3KYNB 4A6YB 4M43L 5EC1B 1HXMB 3DNKA 4K94C 1ND0B 3H6JA 3QNZA 5KSAA 2AXGB 2CK0H 1I7RB 1YYLH 4PR5B 1DEEA 1PDKA 2WWKO 4R4NC 3MRPA 3RVVD 5FCSH 1QRNE 2AGJH 4OLXH 4RMSA 1CIUA 3AS3A 4QT5B 3CZJA 5K93A 3OKLB 5F7KC 1DZBA 3HE6C 4NC2B 3CXHK 4JFOB 5A2KH 4WFHE 3TYFB 5KN5B 4GW1B 2DQCH 3JUYA 2XA8L 5E08L 4PV9A 3GMOB 1CBVL 3ZTNH 3M8OL 2E7MA 4DTGL 3QI9B 1RZFL 4J2XA 1A6ZB 2YRLA 1P69B 4MAUH 3IFNH 5JDSB 3PWNA 4RRPA 2IAND 1G7MA 1GGIL 4PREA 4WU5A 4J4PD 3PWVA 4XCYA 1VDGA 5KZCD 4EN3D 3HAEH 5DK0B 3KYOB 5E99L 4XP1L 3KPMB 4OLUH 4OFIA 4P49A 1MFBL 4LSUH 4RNRB 5IP4A 5LGHH 4JM2C 3D39A 5H2BA 3WNMA 4G42A 3KJ4C 3V0AC 1FBIH 4OAWA 1A6PA 2E9WA 5SX5H 4LHUB 3L5HA 4PP2B 5T1MA 3IDXH 5DD5L 2N4IA 3K4AA 3V0WH 4PJGF 3TA3C 3ARGD 3NCMA 1FZMB 5DJ0B 4KRNA 2V7NA 2DWEB 1NLBL 1FNGA 4W70A 4GRLC 4I3RH 3PWJB 5MEPA 1QSEB 4I8DA 4I0PD 3BN3B 2NX5E 4MA8L 4JM2F 1TJGL 3Q5TA 1I9JH 3MLSH 3CFBA 3ARDD 3BPNB 3VWJD 1RJYB 3UEZA 1F3JA 2PR4H 5D7SL 2AJXH 3QEUB 4MA7L 1JFQH 2A6JB 2D9QB 3T65A 1LMKA 3QUMH 1YQVL 3MYJB 2IGFH 4NQDB 2HTLC 3N0PB 4KXZI 1CD9B 1FZKB 2VDLH 1NMBL 3QUYB 2DF3A 1OPGH 4FQIH 3WD5H 5T1DL 3D39D 4G9FB 3ME0A 3UO1H 1R3IH 4TSCL 2R56L 3MCKA 1T22A 4U1KB 4ZMAT 2XNAA 1QKZL 5DRXA 3FB6A 2EYSB 4HC1L 4PJ8B 2IG2L 1QSFE 4R8WH 2FBJL 2P5WE 5I1KL 5IHUL 3WNLA 4JLRB 3IDNB 1FJ1A 4QRSB 3KHOA 2AEQL 1GGBL 5FYLL 4DW2H 3LQZA 3V4PL 4L8SB 5TGBB 4UT7L 3G6JE 3HZKA 1JPTL 1M7IB 4Q6YA 5J6GA 3BZDA 3H7BA 1I9IL 2R0WL 4MQXD 2YBRA 3IXAB 4G8GB 3V8CA 1GYAA 2FX8L 4GRWH 3V8OA 3M07A 4UV4L 1NLDL 5F1IB 1BVZA 4OFVA 1U6AH 3TPUB 5K9JL 4JANA 5EBMA 4JDTL 1H3PH 3STLB 5DQJB 1PQZB 4MJID 3MLXH 3TBSB 3X13A 5TF1L 1MEXL 1Q72L 3ILPB 3I3BA 4GW4B 3S3SA 3WHXB 4MVBC 2EDTA 3D9AH 1F90L 3IDGA 5IB3A 4JPVL 4FFYL 4HGWB 4KMLB 3HPJA 1Q1JH 3OZ9H 1MJ8H 4CW1B 5E2TH 1P7QD 1IKFL 3KG5A 3U0PB 2RR3A 4FNLH 4HW6A 4Y4FD 1DBKL 1RHHA 2QEJA 3RVWD 3GMMB 1VFAA 3PP4L 4OGXH 5C0AE 3IXTB 5TDNA 3T0AA 1MVUA 2HJLA 3LY6A 3TIEA 3WV0A 2EC8A 1U8IB 4DZ8A 2H6PB 1CD1A 4XMPH 5EBLA 1SJVA 5L0QB 1NC4A 3GGWB 2BSSB 3SDDB 3WCYA 4JZOB 1ADQL 4XCFL 4L29B 4J3VA 3WIFA 4HT1L 4P59H 4IRSA 1IBGH 2BY2A 1DQLH 4ZD3L 2OTPA 4OQTA 3CDCA 3DUSA 5DZLA 1LD9B 1OAZH 1NFIB 4EDXB 5JNYB 4YDLB 1ACZA 5GZOD 2O61A 2VZ1A 3T3MF 5IKCA 3AAZB 5FYKL 5JQ6L 1JN6B 4Q6IC 3NIGF 5EOCH 43CAA 1RUPH 1D5BA 2HKFH 1B0RB 2F5BL 3UTZA 5FYJD 2CIIB 4U6TA 1MAKA 5DD0L 2NYYC 3BSZH 4W4OA 2X89A 1BGXL 3D85B 1YEHL 2FYYB 1W72A 4ZUTA 1BD2E 1CG9A 3DVGA 4KJPC 3O6KL 5GGTL 5C0DA 3WYRA 4U6VL 2X4TB 1DEEB 5E2VL 3FO9A 1CT8B 4PJGE 3U7WL 3QYCA 2NY6D 1DBAL 4IM8A 3MRPB 5D72H 2BMKB 2X05A 4WUUA 1G7JA 4NZDA 3LEVH 5B3JF 1FG2B 2BY3A 5GGRY 1CDJA 5I73C 5F3HB 1PSKL 4MXVF 1KEMH 4WTZA 3VDAA 2I9TA 4PV9B 2PF6A 3UPRA 1A7NH 4OTXH 4LAJH 5GGRA 2KL6A 4QOKA 3PWNB 2Y5EA 4ZNEE 1G7MB 4WU5B 4D0CB 4XCYB 1OAKL 2DM7A 2WUBH 2A0LC 3VE0A 3DROA 5C3TA 1AGBA 4EDWL 4MNGB 1TZHA 2V17H 4X99A 1T1YB 3KPRB 3AFLA 1T80A 3L95A 3FQXA 1IEAA 3EDFA 5HSFA 2NPLX 4HH9B 2LABA 1D9KA 3N06B 4NHCH 2ZZUT 1NGPL 3MMEA 5EU5B 5T1MB 3U4EA 3FQTA 3MNZA 2EO1A 4D8PB 1OVZA 4Z0XA 3BXNA 1OTTD 3C08L 4OIIL 5C07A 4PY8J 2BOBA 4WUUD 1FNGB 1RZIA 5I0ZA 3W9DA 1P7KA 4LSTH 1ZVSA 4OI8A 5MEPB 4PJDB 4FFZH 2RCSH 3RTQD 1UH2A 5M7QA 1OAUL 2R1WA 2NY1D 4JQXA 4CVUA 3U30B 3HRPA 1UVQB 3CFBB 2ORBH 5K9KA 1LNUB 2R4RH 4YXLL 3HFML 4YFEA 4Q2ZA 5DUBA 1QHOA 4WFFE 1NCTA 3L3IA 5ISZA 3JVGA 4UV7H 1UA6H 2NXYC 4MAYA 4J7RA 4PRPA 4BZ1L 2I07A 4GBXA 5DEGA 4E41A 4Q9CA 3WDIA 3BRFA 3IFOA 4G3YH 3TZVD 2VXVL 5EBWA 2XNAB 3HZMA 3ZTJH 1OAXL 4PLKD 4XWOC 5EWIH 3FB6B 3H3KA 5FO9B 3O6LH 4GG6A 3NCYS 5C70A 2IPKB 2MPAH 1A5FH 5HBBA 4MCYB 2YSSA 3WFBH 5C07D 3AROA 5DVNA 2ZOKA 4G6JH 4G6ML 3E6HB 2D9CA 5DURB 4Q9RH 1R3LB 4G8IA 4Y19A 2GK2A 2YEZA 5I1CH 2CRIA 1W0VA 2YD3A 4IMLA 1OGAE 2A9ML 4EUPG 3BQUA 5J6GB 1J0KA 4BFIB 1TZGH 2VN4A 3H7BB 4YFDB 2YBRB 1BEYH 3FAXA 1PEZA 4WIQA 4C54A 1Y18A 5ANMA 3OHXA 3ZDXF 4ZS6C 4Z76A 1AQDA 3T3ME 3NIGE 2NR6D 4N0YH 3C5ZC 1N8ZB 5HYJA 5C0RL 5GGSB 3SKOA 5EU6E 4GBXD 2E7CA 3I9GL 5D6CA 5LBSH 4CMMB 4OCXH 4O5LH 2YUWA 3QCUL 2HYMA 4GQ9L 1KCVL 2FO4B 2AV7A 3RI5F 5I19L 3OSKA 2HTKC 3KPSE 1OP3K 3V4VH 1VFAB 1E4XL 3C5SA 1NCAH 1MVUB 1DN2A 2EDFA 3TIEB 3ARYA 3H0TA 1QQDA 3CX5K 4UBDD 4DZ8B 4Z7VA 2CDEA 2NY4D 4JFZH 2I26N 2XV6B 1NC4B 3G04B 3GDBA 5B3JE 2GK0B 3UTPD 3WFEH 3WIFB 3S36L 2DDQH 1DTUA 3IDIA 3WFDL 3MRDA 4QNPE 4OZIA 1CFSA 1ETZA 1P6AB 3EOBA 5DJ2B 4ZFGL 1FO0A 2EICA 2XWJB 1JHKH 3GSNA 3THML 3CD4A 3BD3A 2MMXA 4I0KA 4TUOB 1CS6A 3S4SA 1LP9B 4QEGA 3TO2B 2AJSL 3GHEH 4EI5A 5IKCB 1MI5E 3MREA 1PEWA 3VXSD 4L4TB 3CH8A 3T4AA 2QQKL 5I8KH 2BSTA 2I27N 5I1HL 3UTZB 4QRRE 3U7YL 4X8JA 1NBQA 3VRJB 3ZE1F 3REWB 4OV6F 3LPFA 4HLJA 3B43A 4P4KB 5DO2C 4MZ3A 2R9HD 1CG9B 2M2DA 1GPOH 1QLEL 3MLUH 1EXUA 3PP3K 4U3CA 4PPTA 3CK0H 2HVKB 3FO9B 2VLKE 4OFKA 5I18L 1FAIH 5C0CB 3W39B 2Q3ZA 2FH6A 4HS8L 2EYRB 1G7JB 4ZOAA 2CMRL 4X4ME 4JG0L 1CCZA 2YXFA 3O6FC 4M6MH 1T0PB 1FVEA 1NANH 2AQ1A 1JGEA 1RD6A 5KTEH 1OARL 1WAAF 3CLEH 2I9TB 1YEJH 4JQIL 1K4DB 4C58B 4PD4J 1OT2A 4TUJB 3UPRB 3WNNA 2XZAL 1SEBA 2ZPKL 4PGJA 4BH7A 5JDJA 1PKQA 5CILL 2H26A 4NNXA 3CDGA 4U6XB 4I18C 3VFWA 3T2NH 4LRNH 2IH3A 4PRIE 3DV6A 2AI0H 3OR6B 5F7FA 1HKFA 3VE0B 1IGYA 3LS5L 5LGJA 1JL8A 1AI1H 3O4LB 2VXUL 1TZHB 4L9LB 4V1DD 4X99B 2AAVA 4Y5XA 5E8NA 5ILTH 2VO5A 3Q3GA 1BX2B 4YFLF 3VH8A 4K8RD 1S7XA 4GUPB 3T0EA 3L95B 4U49A 3HR5B 2WZPD 3FQXB 1BQHG 4JJ5A 1IEAB 2VR4A 5GRJH 4GSDL 4OM1L 1D9KB 1PG7W 5FGRA 1JPSH 2YKLH 2Z9TA 1MCJA 3B5GA 5I74B 3G6AB 1F5WA 1N2RA 3U4EB 3VWKD 5JO5B 4TRPH 3MO1B 2X70B 3T77B 1WITA 4EVNA 1MHCB 2H2SC 4IMKA 3MLZH 3RVUC 1IMHC 4Q74A 3RGVC 3TLRA 3B3IB 4FZ8H 3W9DB 1P7KB 3B9AA 1XMWA 1G0DA 4M1DH 4GAGH 2DTML 4KQ3L 2NY2C 2Y07H 3I6KA 2W9DH 4JFED 3F7VA 2R1WB 2B1AL 5IV2A 2O5ZL 5BZWA 3WO3B 4LLDB 4ZFZA 2PTTA 3EFFA 3GNMH 5E9DE 4PGEB 4YX2L 1J8HE 1IM9D 1TQCC 3ZE2E 3SKUD 3WLBA 1EGJA 3DOSA 2ATPA 3ZDXE 5DUBB 1HCFX 4NT6B 2A1WH 5EU7C 1MIML 5CD3B 1ZGLB 2RGSA 4IOIB 3GEWB 4F2MA 4RMUA 5CKAA 4X5LA 5CP3H 4R2GB 1BBDH 3T0ED 2VRAA 3M1BA 1BVLA 2I07B 5INCB 5JHDD 5E5UB 4XCCH 3U1SH 5KANI 2VDOL 5GRVL 3MRBA 5GSVA 5FYLE 1MF2L 3HZMB 3MOBL 2DKSA 5ICZA 1ZWIA 3E3QC 4GG6B 3R0MA 5CBEA 1DQDL 3IS1X 5DHVH 1ORSA 1DANT 2V5RA 2NXZB 1OWRM 3EO1B 1YPZB 4YHOH 3TWCH 4LFHG 5LCVL 3HMXL 2YEZB 4NRXA 4AIZB 1M6OA 3SE8H 4KK8C 3TEUA 4NFDA 2NZIA 3DHMA 2BNRD 1Z9MA 2XA3A 1GCFA 3LV3B 4MX7B 5CIPA 4WI2A 1JNJA 3WE6A 5DFVC 4WHDA 4ELMF 2WIIB 2QLVB 4G6KH 3WNKA 4PJ7A 3CXDL 1DE4A 4F7TA 2WP3O 1IL1A 3EJZC 2UVFA 4XB7A 3CZFB 3O2WL 2YWZA 4X80H 1AQDB 2R69H 4NRZA 8FABA 4ZUWB 5ADPL 2AXFB 3O41A 4RWYH 3QH3A 3D3VD 5ERWB 5HYJB 4F9LC 3OKEB 3SKOB 4BA8A 1XGUB 2VAJA 2BNUB 3GJFH 3ETBF 5I1DB 2BX5A 2H3NB 2QSTA 4XMLL 3ARFB 1X5XA 1A7RH 2ICCA 2AV7B 4XPFL 5L2KD 3D6GA 4W68A 1N7MH 5H8DA 3HC3H 4LSPH 1MJUL 1T20A 3QZWG 2X4RA 1CZ8H 3C5SB 3P9LA 4X6FA 2D0FA 3MXWL 5KS9F 4G7YL 2R1XA 4R26L 1DBML 3IU3A 2Y23A 5I30L 4QKXB 2ARJB 4GXVL 1F3RB 1UENA 3EKCA 3IDIB 4S2SA 1WAAE 3MRDB 5FYKE 1ETZB 3EOBB 3K4DA 3B2VH 1FO0B 2WSKA 1PYWA 1ZTXH 3N9GH 4ODVL 3CMGA 3LAFA 4YHIA 5EPMA 2EH8L 2ZSWA 2F19H 4EI5B 3LQAL 5JORA 1UYWH 4FQPA 4P5TA 1U8PB 3OAZK 5I15H 3PQYA 3T4AB 3O81A 1ZS8B 1KN2L 5J9PA 4UOJA 3HI1A 5JIKA 4WW2A 3QUXB 3UTOA 1XR9B 3O6ML 4X8JB 2EEBA 3LS4L 1MRDH 5FO8A 1JYWA 2I25N 4N0UA 4U1SA 2O93L 1T2QH 1TENA 4N0CD 1AHWA 1IM3A 3UDWC 3SQOL 1AGEA 4D0DA 4K71C 2AEWA 5B8CC 1P4LA 4M43H 5GRVK 2CJUL 4HLZH 4P2RA 1G7LA 5AZEL 2Y25A 3EAKA 3ULVL 3ZSSA 2P24A 3QNXA 2YUZA 2C1OB 4Z7WA 1KJVA 4WO4A 5LVEA 4LLYA 3PWUA 1FVEB 1D7FA 2V5TA 3NCJL 4HFUL 5DUML 2JJTC 1D6VL 3GSQB 4HDIA 2X4SA 1YNTA 2BVPA 5E08H 3QJHA 3U9UB 1N64L 2IAMB 1CBVH 3M8OH 1TFHA 3MJ7A 3MV8B 1P9MC 3ZHDA 5FGSA 2H26B 1RZFH 2PW2A 3CDGB 3AVEA 4P5TD 1S7SA 1UWEL 3BZFB 5T3XD 4F7EA 2X41A 3DV6B 3WN5C 4BFEA 2B20A 1T7ZA 1BREA 4KKAD 1GGIH 3SOBL 5CEZD 3EYUL 2J88L 3ZHLA 2FGZA 4MCZB 3K46A 4Y5XB 5HYSB 4P4RA 4M6AA 4XP1H 2BDNH 2ED9A 4Z7NE 5JXEC 4XT1C 1QFWM 1I1AA 3B9DA 1MFBH 3DTXA 1YC8A 3EYVA 1JI1A 5CJQL 3TBYA 3BGFC 3X11A 3WDHA 2FDBP 1KJ3L 4PBWD 5I76A 5F9AC 4UTAL 2XFXA 1FFPB 4B5EA 1GOHA 5DD5H 5SWZB 4KKCD 2V5YA 1MFEL 1BAFL 3PJSA 1JHLL 4HMDA 4HXBL 3QEQA 2D7QA 1UWXK 4OSUL 4S1DC 3ZTJG 2JTDA 3LEXA 3CFKB 4HJGB 2BSRA 3G5VB 3U4BL 1N6UA 3HTLX 3D2UD 5EU7E 2QSQA 3I6KB 4JPIA 2XKNB 1A9BA 1CXKA 2I5YH 3RWJB 4YBLC 3F7VB 3H9SA 4HS3B 5GGQL 3FRUA 4FQCL 2PTTB 4ELME 1MAJA 4ORGA 3QI9D 3O8XC 4MA8H 1TJGH 4KV5E 4YEEA 3UTTB 3DGGA 1XIWC 3KS0H 3E3QE 2NMSA 3MBXL 5HD8C 5D7SH 2YPLA 3V5DA 3T1WA 4MA7H 1XGRA 3EZJB 3QQ9D 1YN6A 1YQVH 3QHZL 1ZGLM 5IHBA 1BP3B 5ALCL 4I4WB 3RY6C 1B4RA 1BVLB 5HVWA 1DQQB 3MFGB 3QIUB 1C1EL 3IYLW 1NMBH 2FL5B 4YHNA 3MRBB 1FFNA 4WWKA 5C1MB 4Q9QL 4CN4A 1HHJB 4TSCH 4ODSL 3OXRB 4UILL 2DMCA 3RRQA 1ORSB 4HC1H 2IG2H 2X1WL 3RNQB 1KTRL 5EOTA 1K6QL 5MENA 5I1KH 3QEQD 2BNQD 1HINL 3MJ6A 3OBAA 1G0YR 2AEQH 1GGBH 3S37H 3NCFB 4BK5A 3V6ZA 4NRXB 3V4PH 1KIPA 5IR1A 2B1HL 2GTZA 2X7LA 4UT7H 1I8KA 2K1MA 5CZXD 1JPTH 4WENB 1I85A 1UJ3A 5FYJL 1YECL 3QIBC 5CIPB 3AM8A 3WE6B 3H9SD 1UWGL 1OD9A 2CGRL 3HG1E 3O9WA 4YPGB 1I9IH 5HHME 3C87A 1CDHA 1DE4B 1IL1B 2P7TA 3ISWA 2DQDL 5HI3D 3ZDYF 3S35X 3IGAA 2FIKB 4K9EL 4NRZB 3WFCL 3TN0D 4JDTH 3F12B 5D2LA 3QH3B 1MEXH 1Q72H 3V5KB 4XBEL 1EPFA 1F90H 1RURL 3AMKA 4JPVH 3QUYD 3EJYC 4FFYH 3PL6C 5D9SA 4PJ5E 1YDPA 5FCUL 5C0BB 4POYA 2OL3H 3RVVC 4HXAL 2C9AA 3SE3C 4F58H 3VU2A 3W81A 1N5YL 2R0KH 2HVJA 1QPPA 1DBKH 2C3GA 5EA0L 4JFXA 2V7HB 2X4RB 4PJ9B 4APQC 2VUYA 5SWSB 4X6FB 5J1AA 1OHQA 2AABH 3LD8C 4UZGA 3GSRB 3KVQA 2ADJB 1QEWB 3L1OH 1X6LA 1YMMA 2PNDA 5JTWA 4YDLC 4WGVB 5J57B 4UT9H 2PCPA 4L3EA 4JDVB 3NCEB 5DEFA 1MUJB 3MRKB 4JKWA 4G8GD 4J4PC 1QBBA 1W72L 4D9LH 2E6QA 4ZD3H 4YHIB 3VFOB 1X5AA 4FS0A 4HK0A 5HHNB 4R90L 1UEMA 2ZSWB 4LDOB 5I1GL 4FQJH 4NKDB 3QEHA 2C1PB 3KR3L 4O4YL 5DRZB 3FONA 3PQYB 3AB0B 1T0NB 4LPYA 5FYKH 1UB6B 3EFDL 5JQ6H 5J9PB 3LQAC 2B2XL 4KK5C 2F5BH 5KSAC 2ZG2A 4JY6B 1XZ0B 1T66D 4U1SB 3MODL 3RGHA 3ARGC 5J56B 1AHWB 5FDWB 4I3SL 4ERSL 4LQFH 3RU8L 1BGXH 1AGEB 1YEHH 2AP2A 4FQHA 1U8NA 3BDBA 3MRRA 5E8PA 1KENL 1P4LB 3PHQA 3F6LA 5CSZA 1MH5A 4ZXBA 2VDQL 3O6KH 1TVDA 1MHPL 4P2RB 1XGQB 1G7LB 2F8XC 3KPPA 1UH4A 3LN4B 5GGTH 1F13A 4EUPA 25C8L 4U6VH 5CSGA 2LAAA 4L4VD 2P24B 2DI7A 3QNXB 5E2VH 4XPAL 2XIDA 2FHCA 4HPYL 1DBAH 4Z7WB 3ULVC 3EUUA 4NP4L 1KJVB 4WO4B 2KH2B 3MXVL 5CEXB 3PWUB 4L3ED 3SDDD 3MRJA 1S7RB 3ARDC 4YR6A 3FFDB 3VFNB 3U79A 3DWTA 1PSKH 4X7TA 1H9VA 1HHIA 4K3GA 4PP1D 4HWBL 5FHAL 2X4SB 5KVMC 4U1MA 2BVPB 2F5AL 4GAYA 3RIAF 5K9QI 5I66A 5C9JA 3QJHB 1QRKA 1H5BC 2HP4A 2BVOA 4M48H 2DKMA 5D7JA 1I75A 3DX7A 1S7SB 4F7EB 1ED3A 2Y1VA 5IROA 4OBSA 4H25A 4RMQA 3EOYG 1BJ1H 1OAKH 4UAOC 5D1ZA 1U95A 4HS6B 1UKSA 3BMWA 5MP6L 4HJ0D 1WWCA 4EDWH 3U0WH 4P4RB 4QRQA 5GPRA 3D85D 3ULVF 1HE7A 3DBXA 1I1AB 1A0QL 1F3DJ 2EE2A 5JLZA 5I8OL 3VFUB 4C56E 3B83A 3TBTA 1NGPH 4XXCA 1T6WA 1NC2D 1P2CA 1REIA 4HF5H 4MQXC 5CD5C 1CICD 1FV1A 4OD2B 1VCAA 4OIIH 1SVCP 3MV7E 3O3DB 4DZBB 4M1GL 5C8JA 4N9GA 1U3HD 4WI7A 1NAKH 1T3FB 5IVZA 2VLJB 4JPIB 3ZYJA 3KPNB 5LWYL 4HUWB 2EDNA 3FRUB 3RZWA 4AM0A 2Y7QA 2NY0B 4NCC2 3TNMB 4EBQL 3TT3L 3U2SA 2PN5A 4KK9C 3ZDYE 2DL2A 2FD6L 4JG1L 1IGJA 1K8IB 4PJDF 3VXNB 4L1HA 4YXLH 4QXTA 3HFMH 3UYPA 3V5DB 4ZFFA 2JCCA 4PIRF 1LO3L 3QXWA 4Y4FC 1YN6B 3HAEA 4IOSD 4ODHH 4OT1L 3CFCH 1AGFB 1FE8L 4FG6C 2NTFA 3MYZA 1Q38A 2Y6SD 5EUOA 5D1XB 1U8OA 1AC0A 4YHNB 3HI6H 4FQQA 3UP1A 4XTRD 5FB8B 2X5PA 4JRWA 2VXVH 1KCRH 2M1KA 5HGHA 1UT9A 1CTNA 4GO6B 4LLWA 2FGWL 1OAXH 1K9TA 4DVRL 4H26A 4X6DB 2ERJB 5MENB 3O45A 3FN0L 3DMMB 1DVFA 1X5FA 5EO1A 4YNYB 4N8VG 1EUUA 3CX5J 1D5ZA 1IGIL 1L9MA 4G6MH 3V6ZB 5FUOL 1A6VH 1KIPB 5DXWA 5KBNC 4GOSA 4M7LT 1SJHB 3FFCA 3RL1B 3RY4A 4YHYB 5GZOC 1UJ3B 3RPIA 1K5NB 2A9MH 3VFRB 4GKZA 1KLUA 4DK6A 5BOZG 4OZFH 5EZJA 5GSRA 1AXIB 2R0LH 2YUXA 4LU5H 3GMRA 3PGDA 1X5IA 3IGAB 5HDOA 4Z78B 5CWSA 4UI2A 2HT2D 5F9JA 1CFBA 3G5ZB 4PLJD 3QUMA 4K9EC 5EORL 3ZKSD 3GMQA 5C0RH 8CGTA 5DJ8A 1MJJB 4JAMA 4NO5B 4BQBA 4P2YA 3VGAC 3VJ6A 4W6XB 2D0HA 4WHYG 3SDAD 4P3CL 1A14H 2PO6A 5DDHA 4R3SB 3QCUH 1WZ1L 5IB5A 2IANE 1KCVH 5E8OA 1V7MH 5I19H 1M71A 4JFXB 4IRSC 3MBED 2SEBB 5TH2A 5IMMB 4CNIA 4YHPA 5AWNL 1E4XH 4D3CH 3BP7A 4AZ8A 1G9ML 1QLRA 2B39A 3I6GA 1U8JB 3UTSD 1F00I 2PCPB 3SJVE 1A3RL 5IM7B 5DEFB 4X9BA 4YXKL 5T1KA 2VDKH 4K8RL 2WW8A 3S36H 4OCRL 4I48B 4KKLD 3CSYA 1SEQL 1YEFL 4BSWB 3BKJL 1JV5A 1U58A 3C60B 4W4OC 3THMH 3QEHB 1FL6B 5ENWA 5IBLD 3UZEA 5M94B 1IQWL 2AJSH 2EDOA 3FONB 2DLIA 2R8SL 4F8QA 3BUYB 1E4JA 3BVNA 1CGVA 2QR0B 4U3HA 4K55A 2QQKH 1A2YB 1T4KA 3U7YH 4PYHA 4L4JA 5GS0C 3SPVB 5HDQH 3BPOC 5A3ID 4CU8A 4LBEA 4AL8H 1OTTC 1VGEL 3ULVE 4YGVA 3ABZA 2FATL 4FQHB 1U8NB 4PRHB 3MRRB 3BISA 3HI5H 3DVIA 5E8PB 5C09B 2D7TL 1MH5B 5CSZB 4ZXBB 1QLEH 1FN4A 2HKHL 4OLZL 4EUPB 2IQ9L 2D31B 1S9VA 1B9ZA 2NY1C 2Z8RA 3QXTA 2Z91A 3D39E 4HS8H 4O51B 3VI4E 3C9NB 2CMRH 3AMLA 2B0SH 3E8UL 4JG0H 1K2DA 1ZT4B 5T5FL 1VFBA 4EIZC 4KTEL 1ZLVH 4PFEA 4NNYB 4NPYA 1XT5A 1OARH 1DUYA 2AJZB 4U1MB 5E8EB 1AGCA 5J1TC 4TQEL 2FWOA 4JQIH 3CCHA 5E03A 2MKWA 2D4FA 5AAMA 1A7QL 2XZAH 5D7JB 2ZPKH 3DX7B 1CDGA 1AO7D 5CILH 4NM4H 4XNXL 4H88L 3IETB 3JWOL 4H25B 4I0CC 2NZ9D 5KOMC 3QJFB 3V6BR 1U95B 2X4QB 4PLKC 4ZDHA 9CGTA 3LS5H 2NY5L 1PKOA 4P4KD 4YJZL 1EBPA 3DBXB 3HE7A 4YWGL 1AIFA 4XVSL 5F6IB 1HOCA 3NFPA 3SE9L 3GBNL 5JLZB 4PRNA 2VIRA 1T0MA 5E2JA 3TBTB 1Q9KB 4LK4A 4YHZL 1I3VA 4CJ0A 2EDKA 4NYLA 1N6VA 4PBXA 4EZMA 3BI9X 4ZS7L 1J0ZA 5C0CD 4NQCB 1EGJL 3F62A 1FV1B 4JQXC 2VN7A 4DFIA 2FR4B 2HWZH 2G75B 3FHQA 3MUHL 1GGUA 1X44A 2FJFA 3FT2A 1RJLA 2D7MA 5CJOL 4KQ3H 4Y1AB 1ZGLP 1RZKL 3NFNB 3RFZC 4ELKB 3QDMA 2Y7QB 4MAYC 2B1AH 3FOLA 3BH8B 4GBXC 3KXFA 4YX2H 1EVTC 4OGZA 5HGAB 4M7LL 2WWKT 4P46A 3U6RA 1IGJB 2JCCB 1YUHA 3KDMA 3P77A 1VHPA 3QXVA 1MIMH 4BUGA 2Z93B 3RA7L 2ZOLA 1N0XL 3SGKA 1Z5LA 4QXUL 4LLQA 3QUZB 5HHQB 3QFJB 1U8OB 3SDXA 3QQ3A 4CVXA 3HN3A 3QDGD 3GZKA 4FQQB 1NH6A 4WTWA 2XZCL 4KRMB 4MNQA 4UBDC 3GRWL 3RZCB 2VDOH 4OIAA 4PG9A 4WWID 4G8FA 2NY4C 3VD4A 4LLWB 3MOBH 3BQUC 4M7KH 4N0FB 3DI2B 3O45B 1DQDH 2VDML 5FYJE 3GUTB 1CYGA 1DVFB 1JF1A 5I75B 5EO1B 5IW6B 1D5ZB 1IGFL 3MLWL 1SJEA 2L0DA 5LCVH 3HMXH 2G9HA 4JJHA 4TUKL 3CVHL 1R3HB 1NCBL 3KLSA 4QXWA 1EO7A 5BVJA 1TZIB 3IFLL 4GG6F 4OI7A 4GKZB 2OQJA 1KLUB 5HGBB 4NN5B 4X7DC 3IRZA 2A6KB 5GSRB 4JRYA 2VXSL 2OS7A 4IIQC 4TNWK 1YPZF 3OJDB 3CXDH 3UTQB 4JVWA 1SYSB 5CWSB 2Q76A 5F9JB 3L3DA 1S7UB 2R9HC 3O2WH 5DJDA 4UTBL 5BS0D 1EEQA 1JK8B 1RIHL 4LKXA 2V2TA 5ADPH 3AY4A 4ODTL 3NH7H 3L6FB 5ID1B 3GMQB 5F7EL 3I75A 1IEBA 4X6EA 1II4E 1G6RB 5E70A 1DL7H 1NEZG 1M1SA 2DMBA 4XMLH 2PO6B 4HULB 4NUJA 1CXIA 1SBBA 3CLFL 5IB5B 2Y9RT 4XPFH 1M71B 1UZ8A 2GSIA 1H0DA 2NXZD 1GC1L 1MJUH 1X5GA 4CNIB 5JIPA 4P2OD 3KPQA 3BP4B 5F7UA 1Q9WB 2AS5M 4KFZC 2J8UE 3DUHA 3MXWH 1JWMA 4OKVB 3I6GB 5FHBH 5T3XL 4AEFA 2YN3A 4G7YH 5HGDB 4R26H 1ZT7A 1KGCD 5CEZL 4PJBB 2X1PA 5DMJB 3CAFA 1AJ7H 2BFVL 4K2UL 1G9MC 1HHKA 4QF1A 1WF5A 1Q9OA 4GXVH 1CXLA 2RJMA 4JRYD 1CVSC 6CGTA 2P45B 2VLLA 1I8IB 2DQIH 4Y4HA 1I8MA 2DD8L 4ODVH 1CN4A 4H0GA 5BXFB 4Z7VF 5ENWB 5TE6L 3WUWA 4WUUE 4XPBL 2H32B 3UX9B 3ZSTA 2D03H 2EH8H 3QCTH 5DMKA 3MUGA 4WI5A 4XCEA 5B38A 1HQRB 3PGCA 3BVNB 2J5LC 4MD5A 3NA9L 4OLWL 1EFQA 3QO1B 3FTGB 5MERA 4OZIF 4OFPA 5ICXA 1KSRA 4XPGL 1HXYA 1UADC 3LS4H 4NOFA 4LBEB 4K7PY 4TOYH 5IVNA 1HSBA 1KF9B 4YGVB 3ARFD 4PGCA 3KPTA 5DD6A 4QOKE 4FOMA 3SQOH 3PWPB 3Q5YA 5GGVH 3ZHKA 1FN4B 5I1LA 2MWCA 5CMAA 2CJUH 5AZEH 1KLFA 1LEKA 2IMMA 2VNCA 4KPHL 3K8MA 4D94A 1UM5L 4O2EA 1ZA6B 4F7PA 3C6LD 2OX5A 4MMXC 5E4IA 3VXUB 3IJHB 5ITFB 1K2DB 5I8EA 1VFBB 5HHOB 5C0AA 2XWTA 4NPYB 3NCJH 5DUMH 4X5XA 2OZ4L 1DUYB 2Z8SA 5FO7A 3DXAA 4MWFA 2FWOB 2MCG1 1C5CL 1JF5A 5C07E 3MR9A 2H9GA 3T0EC 2BOCB 2VAAA 4X4YA 4X98A 4GFTB 1DJSA 1A6WL 1QBLL 3ARXA 5LXGL 2VH5L 1UWEH 3BZEA 4ZDHB 1DDHA 3QUXD 2F53A 3EYUH 3JWOC 2J88H 3L9RA 4EJ1C 5I6XC 1NJ9A 4IMKC 5DJXB 3RX8A 4HUVA 3HE7B 3QZWB 3IJSA 2Y06L 3SO3C 4L8DB 3GSUA 2NY5C 3NFPB 4MSWA 4Z77A 2ARWA 2HT3D 3BWAA 1T0MB 5GRXG 4KUCF 1VACA 1T03H 5CJQH 4NWUL 5ISZE 1I1FA 2F8OA 2BZDA 1CR9H 1RULL 3NPZB 4RFEB 4UTAH 4HD9A 4GAFB 1NMCB 5IB4B 1N6QH 5C08B 4OF0A 4J23A 5BRZB 4PRPE 5FOJA 1F4XL 1BAFH 1JHLH 4HXBH 4E41E 1FCCA 4KY1L 5CCKL 4K7FA 4OSUH 4WW1B 3NCBB 2CKBL 2BHZA 5DD1L 5D93C 5FUZL 3U4BH 1SYVA 1NGXA 1JMXA 1GGCL 3QXAA 2I60L 1UH3A 2FJFB 4MS8C 1LO4L 4QTIL 1R3JB 1Y6KR 1C16B 1NCWL 4GKNA 4HIXL 2NY3D 3QDMB 1LO0L 4FXKA 4QHMA 5GGUB 1QRNB 3L7EB 3FOLB 5D7KD 4HIJB 2IAMD 1UACH 3VMPA 1NDMA 2Z35B 1IAMA 4Y19E 3U6RB 2LFGA 2ADIB 5I2IB 1WC7B 2CD0A 1E28A 3NIFF 4G9DB 3KDMB 3MBXH 3P77B 3LMJH 2F53D 1MFDL 1DQML 2ZOLB 4R4BA 4ZUSB 1OQOA 4HBCL 4LLQB 1KJ2L 3QHZH 3QQ3B 4CVXB 4KDTA 2IFFH 1FYTA 1UEYA 1ZT1B 1NGYA 2EDYA 5ANME 1T04A 2VZ3A 3PV7A 4Q9QH 3T0WA 4NZJA 5DA4A 4RSVA 3GIVB 4ODSH 4HMEA 1JWUA 4UILH 3PHOA 5SWZD 5HYJE 1MNUH 2X4UA 2FHFA 3LSOB 1K6QH 4NQSA 3K2UL 1L7TL 3TJHC 1HINH 3ULUF 2DQHL 5BZDB 1EO8H 5F72S 1NL0L 3TVMD 3HB3C 5C9KA 2B1HH 4NO3A 5BVJB 4K3EL 1A4JA 4RMVA 2X4PA 2OQJB 4HEPG 2FLBT 5FYJH 1YECH 4OLVL 4FQXB 1FYHB 1EJOL 3QULA 4M5ZL 4WFED 3D69B 1UWGH 4BSJA 5DQ9A 3ROLA 4GJTB 3IKCA 3KYKL 2AJVH 2Q76B 4MNHA 1R6VA 4PRDA 4Z7VE 5DJ6A 3UTTD 1TPXB 1S7TA 5DJDB 1GAFL 3WFCH 4DCQA 3KPOA 4LKXB 4BH8B 3OJVC 3VFTB 1GGTA 4OZIE 5CP3A 3I75B 4XBEH 3QIUD 1I3RA 4PJ7F 1RURH 2QQNL 3FB8A 4R7DA 5MEOA 1EEUA 1KB5L 2EZ0D 3VFVA 5FCUH 3NN8A 1RZGA 1XGYL 4B53A 4RISH 1MCQA 1V3MA 2IPTL 4HXAH 5I1AB 1IJ9A 2CUMA 2UY7A 2A2QT 3PDOA 1UZ8B 1WBYA 1N5YH 2GSIB 1CGTA 5DHVA 1MLCA 5EA0H 4HV8A 4U6YB 1R5VA 2R1YA 3T3PE 2DQJL 5IFAH 1MRFL 3OJMB 4OUUA 4YZFF 1ZT7B 5DTFA 4HIIA 1QSFB 1RV6X 2P5WB 2X9WA 4P5TC 1S7WB 2N56A 4KKAC 4WW2C 5LQBL 2VLLB 4Y4HB 3V0VA 4LASH 1CGSH 4OV5B 5E6YA 1NDGA 1D5XA 4JFYB 4MZ2A 5B4MD 4R90H 5I1GH 3FO0H 4MDIA 1X9QA 5B38B 1QZ1A 2VDRH 3KR3H 3HZYB 4O4YH 1UM6L 3PGCB 3S9DB 4K3DL 3EFDH 1NGWB 1ZAGA 5MERB 2AK4A 5ICXB 3QHTC 3VD3A 2B2XH 4KKCC 4LHUG 3GJFA 1UCTA 1HSBB 3MODH 4FTVA 5C0BD 4PUBH 1PKQE 2BK8A 4I3SH 4ERSH 5DD6B 5F9OH 3RU8H 5JR1L 1I3UA 2VC2H 1U93A 4HUUA 4WO4C 5A2JH 4LCYB 1KENH 2F54A 3WFZA 5I1LB 5HXMA 1EHXA 1MHPH 5EU6A 4FABL 4WW2F 5CMAB 3VXPA 4PJ9D 2YPVL 2VJXA 1LEKB 5SWSD 25C8H 5IOPA 3T0EE 3RDTD 3C6SA 4O2EB 5ESVB 5JHDE 2XQBH 4D0BA 1BVKA 5ELIA 5TE7L 4AJ0A 4HAFA 2JB6A 4NP4H 3W0WA 4AK1A 3BYTA 3CGTA 5C0AB 3FB7A 5EOQH 2AW2A 1DLFL 3DXAB 4M9PA 4XRCB 2ATKA 3QQ9C 4HWBH 4JKPH 4HEME 2VISB 3MR9B 2F5AH 2OTWA 5CHNA 3NPSC 5DQDL 2JKXA 2VAAB 5JOFA 4Z7WF 4X98B 2VE6B 4RQQA 2DB8A 1I1AC 2DN7A 2FEDD 2CK0L 3BZEB 4JCMA 2MJWA 2BNRE 4XC1L 1DDHB 3NCCB 5F3BB 4TPRL 3L9RB 1NJ9B 5MP6H 1IGMH 4QXGL 2NQCA 5BV7L 5SWQA 4HUVB 5IJVA 1MI5A 3Q48A 4NJAL 1UB5A 3QXDB 1U3ZA 1YMHA 1A0QH 3BD4A 4J3OC 5CZXC 5I8OH 4H1LH 1MLBA 1CVRA 3ZE0E 3ARSA 4ALAH 3FO1A 3V7MA 3D3VE 3MNVB 1J1XH 3VFSA 1BD2B 3IFNL 3HE6B 1TETL 4NSKA 5DRWA 1ZLUK 4BJLA 3EJJX 2Z4QB 5HI3C 3W0WD 1WCBB 4M1GH 3O11B 3FQWA 3TN0C 3MRHA 2QL1A 3VRLF 4PJGB 2VLKA 4GKNB 4OLUL 5D96C 2DLTA 3DO7A 1QLFB 3PABB 3S88L 4LSUL 4ONGH 4FXKB 5LWYH 1HKLL 4P57B 5IEHA 3OKMA 4EBQH 5IEKA 5CJ8A 3LPWA 2GSGB 1JNHA 5DJAB 4WWKC 3LZFL 3IDXL 4HHAA 1A3LL 1NBYB 4ODXB 2FD6H 4JG1H 3PNWA 4ZTPL 3P11L 1LO3H 1CI5A 4JM2B 3CSGA 4OT1H 5F6HI 4DKFL 1FE8H 4I3RL 2W9EL 4PJ7E 3KJ4B 4PLNC 5E6IA 4F7CB 1TNNA 1MAML 4F33A 4PRIA 1UZ6F 1MWAH 1EHAA 3VMOA 4TTDC 3I2CH 1JWUB 1A6TB 1I85C 1HI6A 1UJ3C 5F7YC 3JTTA 2FGWH 3AM8C 1I4FB 1I9JL 1JPGA 3O9WC 4GRLB 4MLIA 4NQSB 3FN0H 4QHUA 4U6HA 4WDIB 5IESL 2LTQC 1IGIH 1IGTB 1IARB 4UDTA 5F9DC 1OB1A 5FUOH 1TQBC 2HJFB 1A1OB 1K4CB 3QUML 3DX9A 1OY3B 1A4JB 3LKQA 2X4PB 4Y4KA 2UY6A 3QULB 3TCXA 2FEEL 2NY0D 2GUOA 2BSED 2W60A 3ROLB 5FYKU 3WJLA 5KVEL 4JFFA 4PRDB 4IHOA 2C3HA 4BK4A 4ZG1A 4N8CH 1AQKL 5DI8A 4U7MA 3O2VH 3OKKB 3BYYA 3OV6A 2BVEA 5E9DA 5HVHC 4JR9L 3A67L 5EORH 3W9EA 5EBGA 3FB8B 1KG0A 1VB9A 4R7DB 1IC4H 3RNKA 4K3HA 1OSPL 2EIZA 5HHXL 3ARZA 1RZGB 3BJ91 4TSBH 4XVUD 5F1SA 5IFJB 2AJ3A 2E7LA 3BEWB 1INEL 4L8CA 4M5YL 4P3CH 3PQYE 5D2LF 3PDOB 3X3GL 3H8NA 1FFOB 5DHVB 3RVXC 5CEZE 3U36A 3TIDB 1U6AL 4HC1A 1M7XA 4PP1C 2GY5A 1H3PL 1Z9LA 1BF8A 4N0UE 1R5WA 1R5VB 4XAWH 2EXWD 5F71A 5IG7A 1G9MH 5DTFB 2R2EB 3ZT6A 1JZ5A 1E4XI 4NKIL 4R6UA 1OP5H 4PS4L 1A3RH 3OZ9L 1MJ8L 1H3UA 4B0MM 4P2RE 5AAWA 4Y2DD 1VENA 4K8RH 1RUQL 3KLAA 4OCRH 3TO4A 4RRPG 1FL3A 4HJ0C 1NDGB 1EO5A 1KJMA 1SEQH 1YEFH 1U42A 4OCMC 3VMNA 2OJEA 3BKJH 4MDJB 1OGAB 5IK3B 4Z7WE 1B90A 4OIBA 1OAYL 2ARJQ 4OGXL 5FV1L 5SX5K 2EYTA 4WJ5B 2AK4B 4NZTL 3JBG7 2CDFA 2A74A 3FMGL 1NUFA 1I7ZB 2VSCA 2YA2A 3MA7B 3TF7C 4X6BA 1FNFA 1CICC 2OL3A 1VGEH 4J3XA 2FATH 2WP3T 2E7BA 3BUTA 4CKVX 1IBGL 2D7TH 1I9RL 1YY9D 1U3HC 4KROC 5EU6B 4NBZB 3VXPB 3H9HB 1NCUA 1OAZL 3U46A 2HKHH 4OLZH 2IQ9H 3B6SA 3PGFL 4LCCC 3C6SB 1QHPA 3HR6A 4D0BB 2WINB 4JY4A 4S11A 5AD0A 2VQUA 2ZUVA 2HKFL 1Z0MA 4ZYKB 4BUHA 2JB6B 3MV9A 3KPSB 5D7JC 4E9LA 4OD3L 5FOBB 4XHQA 2NLJB 1T1XB 2W0FB 4AT6B 4H8WH 4KTEH 4GQPH 3VRLE 5T3ZE 1YNKH 4M62H 4ZO6A 5D1ZC 2ATKB 2VLME 3TO4D 3ZO0A 4CJ1A 5AYUL 5CHNB 1Y0LA 2EDRA 3QEQE 2BNQE 3C60D 2Y6SC 3K2MC 4Q6IB 3F7YA 2V5SA 4RQQB 4WI4A 4KTDH 4LLMA 1A7QH 4M1CD 2BP3A 4HGKC 4ZUVA 1Z0NA 3OWEA 4H88H 1FNEB 3JWOH 4AYFA 2PETA 1S9XB 3CPLB 4W81A 3E2HC 1LQSR 2DLGA 3H9SE 4OGYL 3U83A 4XXCC 5SWQB 3B9KD 5IJVB 4G43B 1MI5B 4XAKE 1G6VK 4PRHD 2PYED 1PZ5B 5C09D 4XVSH 5BV7C 3SE9H 3GBNH 4FQLL 1BFVL 3GMNA 1MLBB 2C26A 2OMNA 5ITBH 2YPLE 4WFGD 5GGTA 4UUJA 4O2FA 1CL7L 1RK0A 1A7NL 3DETD 1WUNT 5FAAA 4ZS7H 5K9OA 1UM4L 1XF3B 1U8MA 3O2DL 3G9VA 3ES6A 4RGNC 2VL5A 5DRWB 3VGHA 4UDUA 4JQVA 1KTDA 4LVHC 2EH7L 2Z31D 2VLKB 1MCBA 4RCAA 3MJ9L 4MMZC 5CJOH 4PLJC 5MENE 1VADA 4XP4H 1RZKH 3WS6C 5E2WH 2APFA 1F2XK 1UCBL 4J8RA 4HKZA 5IEKB 3MJ8A 3LIZH 4DGIL 4NHUB 1H15A 3MROA 4HHAB 4AMKH 4MJ4A 1CDBA 5EUKA 3SDAC 4BSVA 3PNWB 1P5UA 1HEZA 1UG9A 4M00A 1S78C 3RA7H 5I0DA 1N0XH 5LG1A 3MBEC 4QXUH 5J89A 5E6IB 5JOEA 5I75C 4F33B 2AJYL 4PRIB 5IF0A 4FZEL 2RCSL 2XZCH 1A7BA 3E0GA 3EDEA 3GRWH 3QNYA 4PTTA 2DWDA 4RGMC 5IGXL 4KK6D 2JCCF 5EZLA 5D2LE 2NTSP 1X5YA 3TV3L 1J86A 3X12A 5B39A 3RY5A 2DQEL 2XPGA 4H20L 5HPOA 4NO0B 5EUOF 2VDMH 1D5MA 5E56A 2P44B 1BWWA 4KKLC 2R4RL 1CD0A 4QHUB 1O7SA 4U6HB 1LVEA 2XRAL 4KDVA 5DC9B 5HTSA 1IGFH 1MY7A 2VLRA 3HLAA 3MLWH 3OL2A 1AKJB 5L8JB 1K8DA 2PYFA 4RFNC 4UV7L 4TVSa 3CVHH 3LKQB 1NCBH 3IFPA 3C8KB 1MCIA 4RDQF 2AEIT 4Y1AD 5HVFB 3WSQL 4HIEB 1LE5A 4G3YL 4L4VE 2IH1B 2VXSH 3O3BB 3QWQB 4JFFB 4KWUA 5TE4L 1YMME 5A3IC 2LVEA 5JPNA 2GTWA 3ARBD 3ZKXC 1OTUD 5DI8B 4L3EE 2NXYB 2Q6WA 5HPMA 4YQXL 3HRZA 4Y0GA 2Y5TB 3MRFB 2X09A 5E9DB 5IMLB 5DVOA 1UQSA 1AGDA 1QVOB 5AG8A 4Q9RL 3QUZD 3QFJD 5F7EH 4YDVA 2ZUUA 3B9VA 3F6IA 1ZA3B 2EIZB 4WV1A 2Q3AA 5FGCE 3PIQA 4R7NA 5JPMA 3RZCD 2WBJA 5IVOA 2G60H 3NTCH 3MV01 4L8CB 3DYMA 2XTJB 3NA4A 2CLRA 3ZKNC 4LHJB 1CE6B 3T8XA 5GHWL 2ICES 1SQ2N 1P4IH 5H35B 3CJJA 4MHHI 4N90D 3HNSL 3D18A 1GC1H 1R5WB 1F11A 3PWLA 2VUOA 5D5MA 5F96L 4WTZG 4PJCA 1N5AB 3MGOA 2QSVA 3HCVA 4LCWD 5T3XH 4JE4B 2GW5A 3MFFB 5CEZH 2BFVH 4MA1C 4OZFA 4IRJD 5C0ND 3AS2A 1MCNA 3LH2L 3P73B 4LVNC 4OCXL 1KJMB 2YOCA 4O5LL 4BQ8A 1YY8B 2FJGA 2MSPA 1G0XA 2DD8H 4A6YH 4Z6AT 1HQ4A 5TE6H 4OM0H 4AG4L 3V4VL 3EYQD 1DN0A 3C5ZB 4XPBH 4PJBF 3MLRH 2JF1A 1RZJL 5BQ7B 2H2PD 1NCAL 4K7PL 4M6OH 3QT2A 3W82A 5FECA 3NA9H 4OLWH 2JIXA 1URLA 4GRWF 4XPGH 3DV4B 4JFZL 3O3EB 1IFHL 4JCLA 2V2WA 3HC0A 1A1NB 4GXUN 3IAPA 3RWGB 4OF6A 4Y16D 3RKDD 2P8MB 1JHKL 1FPTL 2PXYD 3B6SB 4Y89A 3VDBA 1G9NH 5IB2A 5AD0B 1ZXQA 4PJEA 4H1LG 1F8TL 2ZUXA 3T09A 3MV9B 5EN2A 5I8KL 2X42A 1BIHA 4R4FH 1BOYA 2AV1A 2DIAA 1JGLL 4YK4B 4X8XA 2OZ4H