3GLEA

Crystal structure of the major pilin from streptococcus pyogenes n168a mutant
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
283
structure length
283
Chain Sequence
b'TVVNGAKLTVTKNLDLVNSNALIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAEFDFSEVTFEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGSKVPIQFKASLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQTEASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKNIAGNSTEQETSTDKDMTITFTNKKVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pilin
molecule tags Structural protein
source organism Streptococcus pyogenes serotype m1
publication title Intramolecular isopeptide bonds give thermodynamic and proteolytic stability to the major pilin protein of Streptococcus pyogenes
rcsb
total genus 70
structure length 283
sequence length 283
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 3gleA02
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gleA01
1D2PA 4BUGA 3GLEA 3B2MA 2X9ZA 2XIDA 2XTLA 3RPKA 1D2OA 3KLQA 2X9YA 2X9XA 3GLDA 2X9WA 2XICA 2Y1VA
chains in the Genus database with same CATH superfamily
1A4BA 1IAIM 5IWLC 1A4AA 1Z9LA 1SBBA 2W95A 5ISZD 1WFIA 1XH2A 2BVYA 3WJMA 1A4JB 2Z31C 1D9KB 1IE4A 2J1ZA 2W1NA 4LPUA 3ZX1A 4CC4A 2QQNH 1I8UA 2JKIS 1YMHA 3BIBX 1CXEA 3N1MC 5I30H 4BHUA 2HPOA 3P0YL 1VJSA 1EFXA 2OL3L 3KPMA 3QFGA 4NENA 4UB0H 4RMQA 4U1SB 2IH3A 3N42F 2GIYA 3T3PB 1NUNB 4F58L 3S3JA 3LRMA 4MA7L 5C1MB 3O8XB 4G8EB 1CFVL 1CR9L 2FX8L 2R0LH 3SPCA 4EEEA 2DEWX 2MKWA 2VIRB 5IEHB 3GSVB 4WCYL 3PF2A 4XPGL 5D6CA 3VGHA 3V4PH 3WY2A 1AGFA 4NKIH 2X28A 3CDGA 3VQLA 4LCVA 1T89A 2W9LA 3HC4L 4G42A 4P57B 3EYSH 3T3PF 4O00A 3UDWC 3K71A 4ZPTA 1KEGL 3EFFB 3IK2A 3TV3L 4KXCA 5ICYA 5GGSB 4IMKA 4QRSB 2DRUA 3BVNB 4LSTH 4FLQA 3GXUB 2IANE 4G3YL 1B0RB 1WG3A 5FDWB 3A21A 3ARGA 3H9SA 2ZZUT 4L8SB 4I18A 4I4WA 4O2CB 4Z7NB 1OM3H 1AS8A 3KYAA 2WXKA 3FS9A 1IKFL 1BYOA 5DVLA 3RFZC 2R83A 4FG0A 5AAMA 4OJDH 3CN3A 4L23A 5BJTA 5T33L 2HFTA 1UWGH 5KBPA 3LNDA 4WI2A 2O5YL 5GQBA 5CEXA 5FW6A 1HK6A 4MKTA 4EI6A 4IRZL 2KDGA 5HI4C 4BJLA 1G9NC 4MNQD 5GSVA 3SCMC 4XP5L 4K3EH 4GAYA 4Z7QB 4FI6A 1E67A 2WKLA 3BQUB 3NJIA 1P7KA 2VXTH 3NCEB 4LQFL 1S5HA 3QW9A 1J87A 4JZNA 4QRAA 4ZXBB 1XH3B 3VXOB 4CN4A 1I8AA 4HZAA 1D5IH 2F1AA 2WKGA 3D48R 4HP5A 1W72L 1B3IA 2X4PA 1OTTD 2Q0ZX 4NPYA 4MGXA 3GK8H 1KN2H 2J6WA 1XF3B 5KZCD 4APQC 3QWNA 1KCUH 1EGJH 2JQZA 2Y2YA 5FA3A 3C5ZC 3L3OA 1P84J 1RUMH 3Q8BA 2X4RB 2WXRA 3NABL 4JPIB 5JMOC 1LDPH 4QWWC 1WA2X 3O8XD 2W0FA 5AOIA 1NBCA 2ED8A 2VC2B 1J5IA 1GGTA 4G9FB 1I1AC 1RUPH 1L0YA 5A16A 4E9VA 4XTRD 1RD6A 3L08A 4C56B 1RK0B 5MENE 3K74B 3BUTA 4JN2A 2UZIH 4KJQC 2FIKA 2P7TA 2L7QA 1F58H 1KTLA 2KZ1B 3AABA 2VNCA 2L04A 1LDPL 1A3ZA 1HWGB 1OE1A 5LNGA 4NWTL 4TNWK 4YBQC 5HJGA 1MVFA 5BO1L 3PXJA 3WFDH 5EUOA 1L9SA 4I18B 3QXAA 1FL5B 5J8OA 1LO5B 2LOEA 5B1BB 1IGFL 4WUUB 3GZPA 4G7YH 1QFPA 1GGBL 1HXMB 3VGBA 4HCIA 2C1OB 1MAJA 2CHWA 2LABA 2AEIT 5L2KE 1SJEA 5E8NB 4YHKL 3Q05A 4KO6A 2F53A 3BWAB 3ZTJG 5EU4B 4AYFA 5HGBB 5G5DA 4CBPA 1QFHA 1MELA 3QXUA 1GMIA 3U79A 4IKIA 4OCYH 2H0PA 4X4MA 3QNYA 4OCLC 4YSSA 1DUZA 5J6HA 2H8PB 4ODTL 1OVZA 1VHPA 1P7BA 2BY2A 4O5LH 3BEWB 2V3FA 1PZ5B 3ERXA 1S3KH 2OJEA 1IIIA 4KDTC 4C83A 1XH3A 3WIIH 5E9NA 2NYYD 4FFWD 4J27A 4I3GA 4PGBA 3U1SH 3BVTA 4I7ZC 5I73C 3GD1C 4XAWH 4U1IA 4FXGB 1DBKH 4EDWL 4O02A 2ENQA 2R39A 1CF1A 4JY4A 5D1XE 5IR1A 3OB0H 5CGYD 4FQLL 5JR1L 1FZJB 8CGTA 5L0QB 3U7YH 4JY6B 1TTAA 2IAMA 2G5BA 4H0GA 1KYOJ 2WWOA 1BVOA 4OW6A 1IO4C 2BHZA 4FQIL 1OAYL 2PXYD 5TDNA 5I1LB 1YPZA 2VXVL 3L4ZA 3QDGD 3HNVL 5IW6A 2CQVA 1WT5A 5KOVC 3VRJA 5HHQA 2GBAA 3OQRA 4OZHE 1QLFB 1JWSB 1NAKH 2GSMB 2NXZD 3MPCA 2YSSB 4KH9A 3SQRA 4FXKC 3WNOA 5DO2D 2NYZA 3N0AA 2AAVA 3U46A 3VXUE 4Z78B 4X6EB 1ZV5A 5E2TH 5JMRA 2D0HA 1KJMB 4ZNCD 3UTSE 3F8UB 5DRZA 4TQIA 4D8PB 4IBWA 1JP5A 5KANG 3R8BB 4L1SA 2VE6B 3OV6A 4ZSOB 5C0EB 4PWEA 4CGTA 3DX3A 1QI3A 4NXSA 2VLJE 5KVEE 3QEUA 4DGVL 4FP8L 4AITA 4Z3HA 4M4RA 3Q8EA 4LSDA 1KJ2B 4RNRA 4Z0BL 3B2VL 5J57B 3LB6C 3PDOB 4ZTOH 1XFPA 1EVUA 3CN4A 3QIUD 3SEPA 1A9BA 4HK0B 2DMBA 4UQ2A 1IKNA 3JQOB 2DOCA 5CILL 5GGSY 2DQCH 4L4TE 1FV1A 5C0DA 2VMCA 3B2UD 1URZA 5DRXB 4E5XG 5FXCH 1X5MA 3CPLA 4PJBF 2DW5A 3PABA 3MV8A 2ADIA 4FFYA 4U4IA 4Y5YA 4WWPA 1UT2A 1XL4A 3S5ZA 4BRJA 3W1ZA 2OMXA 2H1PH 4OGXH 1DQJA 2HLAB 3QAZB 3ZIMA 3K4DA 3QHFH 1UOLA 4N2CA 3S35X 2D0FA 3D18B 3HBZA 5HGAB 1AZRA 1AE6H 2YPLB 5AYUH 3E8UL 5IB1B 4YX2L 1MREH 2WGXA 2HFEA 3RVVC 3DURA 4XP9L 1THAA 1YEKH 2K7QA 3ARTA 4JHAL 3BN9C 4P48A 4P99A 5D7LA 5GGUB 3ZE2E 3G5YA 5ACZB 4DH2A 4A6YA 4HUUA 4QTFA 2ADGA 3TESA 3C5SA 2OCFD 3P4OA 4AVIA 1TTBA 4OB5H 1BAFL 3HZ3A 1AS6A 5DHXB 3QR1A 3V10A 3V0JA 3CMOL 4HK3J 4W9EC 2HWZL 3OJMB 4XNXH 3OGCB 3V6OC 4CJ0A 4CVWA 2FEDC 4TXVB 1LO3L 1IC4H 2APWA 2XCMC 5BV7B 1MCPH 4AV5A 1OP4A 4YZFE 1W0WA 3O8XC 1G5AA 1CXHA 4PS4L 5DJ0B 3NG5A 3KWTA 1Q1JH 1DLHA 4PBDA 1XGRB 2AV7A 4RGOL 1NEUA 1HHJA 1UB5A 3M1CA 4MFHA 3S5LA 1P4BL 4W9JC 1MG2C 1U42A 1YEJH 3LKRB 3QJQB 2Q2LA 1ZLSH 3D2TA 3UAFA 4XNUH 4TLUA 1VEOA 5CSZA 5C07A 3ZGIA 2WLIA 1E6JL 1F4AA 4FTVD 1MCPL 1QYGL 4ODVL 3AQYA 5ERWA 3W57A 3LHPH 5KW9L 5JPNA 1JV2B 2B59A 4XRCB 1R3KA 1YYMH 2X7LB 1JRHI 3QZMA 2X1QA 3KPQB 4EN3B 3LQZA 1YCSA 4ZFFB 3GPSA 1BZ9B 1YEJL 5FHBH 4AE0A 1X7SA 3EZ8A 4OT1L 1BJMA 1SDDB 4XCCH 4ZUSB 1VZHA 4X5XA 3DHPA 2WLLB 4HUCA 4X8XA 5LUMA 2X4TB 3IBEA 3FONB 3H56A 4MWFB 3B1TA 1QVOA 4X0NA 5F21B 4AYMC 1OLLA 4P9HH 3KWWB 5FKAB 5JQ6H 2ZNXA 2E8ZA 5GGRA 3RX5A 3IDYB 2W0LA 1AY1H 3GJEB 3B56A 2VH5H 3IDIA 2E3VA 4TN9A 2A9CA 5E9DB 5IHWA 3II1A 5KYWA 4NN6C 1NLDL 3S96A 4TQEH 4JFDA 4JUTA 4JDVB 3WIFB 4RFNB 2AXGA 2Y7LA 4R7NA 5IJDC 3LZNA 5FUOH 1U93A 1NC2A 1TQCB 4PJXF 1E5CA 2DLEA 4LBEB 4JM2D 4OJCA 2XWZA 2UZXA 4LCUB 1KG0A 1I8LA 1N3NB 2Y0SA 1Q9WB 4B9GA 2OR7A 2PYFB 3US1A 4YDLC 5EU6E 4P46C 1E4WL 2YFNA 4Q2ZB 3HB3C 3PWLB 1Q9LB 4NO0B 2BNQA 1CLYH 2XV6B 4EI5D 4X6DE 1OWWA 5F3BA 5TTRA 2E6PA 1QTSA 4XC1H 1VFOA 3EH2A 3HMWH 4MMYB 4E41A 3H42H 3EDJA 1G87A 2EYSB 3LKQA 1YNTA 4AGMA 2B1HH 3SPGA 3TASA 2ICWJ 5F0MB 5DFVC 1OF2B 5IBUB 2JQAA 2FJUB 2OL3A 2JV6A 3T0BA 3DC0A 4L3EB 2FIKB 1EPFA 1VEMA 4MKMA 3QJFA 4MSWA 4PJAA 4EXPX 4U3CA 1PMYA 5GSVB 2PLTA 4D0CB 3MO1B 3K72A 5E99L 2A6DB 5ICXB 1P5UA 4MJ2A 1E4XI 4KQ3L 3TCLB 4FDWA 3RP1A 4UTBH 2JSFA 1MRFH 1KBWA 1AHWC 4Q74A 2EYTA 3MRRB 1CLYL 4I13B 4BCZA 1HL8A 3L4WA 1IEHA 3MFFB 3DX6A 1HSBB 1A7QL 2NY3C 1E9QA 1KV3A 1JF6A 2JXMB 3NTCH 2WCPA 1S9VA 1W72A 4PRHD 5D93B 2RB8A 3ETBJ 3OLEA 1HHGA 1I8KA 3QIWD 4KJWC 1DVTA 4N9GA 3MNVB 2YXVA 3QYNA 2IBGA 2ZF8A 4NSKB 4JO3L 1F4WL 1R4XA 1U6AL 2CCWA 4EF3A 1D7DA 3P4MA 1UOWA 4NZFA 1MI5B 3JWOL 4F2ME 5HI3C 3QZWA 2ITDB 4XI5C 2YQ3A 3ZJAA 4HQQH 4DW2L 1O7DE 3P9MB 4MBOA 2UYLB 5FW8A 5IR1B 1VADB 2G3XA 1CLOL 3IKCA 4Q2ZA 4BFFA 5EHFA 5HYJA 2UZYB 5GGVL 4NQED 4G6JL 1QHPA 5DJXB 4Y5VB 3BIKB 5F96L 2NZIA 1L9TA 2OP4L 4CSPA 3FRUA 3KEDA 5MENB 3NSFA 6FABL 1H3TA 2GSIB 1F3DJ 1A1MA 4GMTH 4OGAC 2ZYHA 3UTZA 5JHLA 4PVBA 1W0VB 3SKOA 1LXMA 2P44B 3AB0C 1PKOA 2G5UA 4CW1B 1JD7A 1TYEB 3MCLL 2WJ5A 1SY6H 3C2AL 4N0YH 3MA7A 5CKGA 2GY5A 4NN6B 5D2LE 5FKPB 3ZMNA 3O3UN 4DERA 1IC7L 1ETA1 1LQBC 2XZZA 4GMTL 4D94A 1BVLB 1DVFC 3GSUA 3MBXL 4WU5B 3SDDA 3D12B 1WIPA 3T8XA 1C08A 3PV6A 3WEOA 4MTMA 1RFDH 4OY9A 4WI3A 4UOZA 1FNEB 1X5KA 4OF8A 3AUVA 5EZJA 5L0QC 3GF8A 2Y06H 3A6OA 1C16A 1OARH 4NQUA 5I26A 1F6AA 3RWFB 5I0WA 1ETB1 4YHNA 1JSYA 1UXSA 4YQXL 2XWEA 1W0YT 1UA3A 2CXGA 1IU1A 4RDQF 1IM9A 4F5CA 2Z93B 3NFNA 3EJJX 3SDXB 1G6RA 2OX5A 4NRYA 3CPLB 2XY1A 4JM4H 3WXVL 3W5NA 2Y2TA 2E7DA 3I9IA 3LD8C 1FZJA 4YLBA 4IGBC 2GJZA 3U4EB 1MW0A 1LVEA 3DRQA 3NPSB 1MWAA 4B41A 3Q48A 2QPEB 5F1OB 2VITA 3CX5J 4YZFF 4OZ4A 3QZWB 4KMTL 4H26B 1XH1A 3FBQA 2ZUSA 3SJVA 2NNAB 4N6QA 3VXSA 5C09E 5BZDB 3FOMA 4O2EB 4OI8A 5K39B 3LQMA 1EAPB 3H9ZA 5F9WC 4AEHL 5JIIA 1UXWB 2E47A 3HB3D 5CJQL 4Z78A 5F6HI 3AVEA 1J0HA 4WSJA 1NSNH 1J8HE 1GTFA 2AKRA 1P69B 3BLPX 1KB5L 4PH8A 3B9KC 3OGCA 3HNSL 1HQ4A 1JVOA 3PWJA 4B7IA 1KTDA 1AQ8A 4H13C 2JB5L 5FWRA 4NWUH 1WFMA 2RALA 2NY5H 4BXVA 4Z7VE 3AROA 3M86A 1QFWL 5HVGB 1LJMA 3QRLA 4OV6F 2AS5M 4OGZA 3IF1A 2IJ0C 4QRQB 1INEL 1S78C 2R1YA 4CN6A 3PHAA 1NBYA 2BXYA 5T1MB 1A3RL 4X7FC 3EAKA 1HILB 3FHAA 4OT1H 3FAXA 5BZXA 4NYLB 2OTUB 2ZXBA 3PL6A 3M46A 4PJXE 1J10A 4F8NA 2CBQA 1XF4B 3P40A 3EOBB 3OKNB 2F7RA 1N5AB 1GYWA 1WAPA 3N40F 5KSBA 1C16B 1MHHA 5IB5A 5AVXB 2LT9A 4JM2F 4KU1A 5EBGA 4MAYA 3SO5A 1CURA 3ZRSA 1IFRA 4WNSA 4LVNC 4PJIB 4FXLA 1A6PA 3FDWA 3H2QA 4YIQB 2VAAB 4ZNEE 4OCMC 1XEDA 3FHQA 2ZWYA 4P2AA 5M7QA 2EDHA 1FFQA 3A47A 2JCCE 2FUQA 3QJHA 3BD4A 2ZAIA 2JB5H 3HC3H 3KXFE 4TQEL 4KRLB 5I15H 3KAAA 3DI2B 4WFED 3LCYA 1WHOA 1E5BA 3RZCA 2XV2A 5T1JA 5B39B 4YGAB 1UZ6E 4QLRA 3D4ZA 4PJXB 4KXZI 4BQ8A 2F53B 3BWAA 2VDNL 4ZW5A 4ZK8A 1EAPA 2VDKL 4QWWD 3UP1A 4WWKB 1F2QA 3QZPA 4P5TC 4RWHA 3P73B 3CGTA 1AXTL 1UA6L 4B9IA 2G30A 4EAEA 1ZKAA 1FNSH 1EXUB 1J1PL 1L6PA 1E8XA 1X5HA 2F5BL 4PVLA 4A2GA 1NBZB 1PVHA 4GAGL 4MD4B 2XKNA 1XGQA 2AERT 2YWYA 3HZYA 5K9KA 1J0YA 3QULB 1N6VA 4AT6B 3P3SA 2IMNA 1KGJA 3QYCA 5BXFA 1HOCA 1UKSA 3E2HB 5GS2H 1WVZA 3W37A 1SYVA 4PRID 4FQ1L 5LCVA 2GSGA 5DD3L 5AW6B 5JYLA 1S9YB 4M8RA 5CZRA 4ZMZA 4H2AA 4L5FE 5IJCC 2NOYA 1I31A 5HHXL 1FAIH 4CJ1A 5FYJH 2ZT9C 1LE5B 4I2XE 1ODAA 3TIDA 3TEYA 2IH8A 5F9OL 2PWEA 3IGUA 3DVFA 2Y5EA 2BMKB 1H5BB 2UZIL 3SE8L 3MJ9L 1M2VB 1BV8A 1JNLH 1NCCL 4J23A 4MXVF 5DSCA 4PJHA 3VH8A 3GSVA 5D6CB 4J1UA 4MAYB 1IC7H 4ORZC 4HOZA 4N8CH 4XVTL 1FVCA 5FCSH 3LEYH 5E7FA 4TRPH 1FZOA 3WN6A 3RFZA 2HT4D 3QG6B 3S35H 3IPFA 1S7TA 4E9XA 4ZMYA 3GHBH 2H6OA 3GRWL 3RWJA 5JQHC 2BSSB 3Q6FA 5KSAA 3FW6A 1A4CA 4JG1H 5DJYB 5E6UB 4WLCA 1R3HB 2ZWSA 3E38A 3HG1A 2CM5A 3IDYC 2FWUA 4D8OA 5EU5B 4A63A 4K5MA 5GRYA 4KUZH 4M6AA 1SF5A 3DVIA 4E2OA 5E8PB 1XBRA 4I2XB 4YSDA 4GXVH 1A3LH 5CS7A 1JDAA 5C2UB 3UBGA 2J8UA 5I18H 2CIKA 3DMMD 4QRPA 2WWNA 2B9BA 1T0PB 5GGTL 1VSCA 1YNTB 1ZHBB 1JDDA 1DVFB 1E3FA 3ZKSD 3BPCB 4YC2B 2V9RA 5E0FA 4LARH 4M4PA 2BOLA 4D3CL 5DD1L 2DMCA 2KPNA 1X6LA 1V3JA 5DZPA 1QFWH 4RMBA 5EC1B 4EBQH 4KHXL 4J3OC 4P06A 2VSKB 5KVDE 4PREB 2X1XR 4AC2A 4Q9RL 1CGTA 3PWUA 2ZOKB 4NO2B 5FYKL 3D0VA 5KOMC 3V0AC 3WNKA 3HPJB 3RGVA 1OGTB 1PZBA 4IOIA 6CGTA 3H2WA 1PD1A 2DDQL 3GRGA 3K6FA 4MS6A 3BVWA 2VLLB 2Z34A 3TM6A 5FOJA 1BG9A 3WTVA 1AIZA 4F7PB 4F58H 4XMPH 2KZWA 4J6IA 4NKMA 4ZMQA 3VXPB 1GKOA 4G8GA 2L8AA 2ZSVA 3BLKA 4AKQA 5E9AA 3QEQD 4K2UH 4GQZA 2W80C 5CLWA 2JIXA 4WU5A 1XR9B 3MNWA 4L1TA 3SKJH 1BSIA 3MRMB 3O2DA 3WSQH 5K5YA 2DLIA 2IMMA 1JHLH 1KIQA 2NX5A 3FCTB 4AXWB 1S5IL 1YNLH 3FQNA 2R4RL 4HH9A 5CR1A 4FQLH 1OK8A 3QG6A 2ENPA 3SGKC 1UH4A 3ZYOA 3MCYA 3A67H 3OX8A 4EQ3A 1EZVY 1PZ2A 5EC2A 4A7UA 3ZE2F 3F04A 1FF5A 5EA0L 2X44D 2E86A 4KFZC 4MQ7B 3CVIL 3PUCA 5E23A 3BP7B 4N0YL 3EBHA 2FYYB 3FO1B 1ZLWH 4NAJA 1SQMA 3LS4L 3APFA 2Q3AA 2EH7H 2GJZB 2NZ9C 3OPZL 1P6WA 2VLRE 4FCHA 4G8FB 3RY5A 4F1SA 2YBRA 4YHML 5L6YL 4XMLL 2ZOWA 1IAII 4JFEA 1BJ1H 3S2AA 2DEXX 3D34A 4A38A 4XBGA 5C9JB 5KBLA 4JG0H 3UG3A 3SGEI 3Q2LA 5BZDA 2AV7B 1P7QA 1QSZA 4BEIA 4FERA 5I19H 4WTQA 4XP6L 3FPXA 3HE7C 2XN9D 1YHPA 3RNKB 3T08A 2FL5B 5GRUH 5BV7H 1OSPL 2EICA 1ZXQA 1F42A 4BHUI 5C0GB 3FUFA 5INDB 5KYWB 2O61A 4F57L 5I1IH 5HHOA 2BSTA 4NO5A 4TNVF 3EGSB 3SBQA 1TJMA 4OIIL 1AD0B 1FNHA 5D2LB 4XE5B 3HZKA 3ZKMD 5I1GL 1ITCA 1Y6MR 2BERA 4NFBA 2WNGA 3S3CB 1FVDB 2FBJL 3SKNB 4Z18A 4CVZB 1DFBL 1E30A 1BOYA 1KT2B 3KL3A 4S1RL 5KSUA 4MCYA 1BZOA 4H8QA 1G7JB 2QVKA 4IU2B 3FFCA 3IFNL 1DCLA 2IBZY 3AT0A 4F57H 4JY6A 4NKMB 1NIEA 3LS4H 4U1GB 3TZVD 4LCCA 3L9BA 4GBXC 1U8OA 5JHDA 1QFWI 3MYJA 4XB3A 3LX9A 5I0VA 1GZQA 1SBSH 5I74C 3UABA 5C0FB 3CDYA 1YEFL 3AT8A 2P8PB 4P2RE 4FFTA 2OTWA 1A65A 1T5WA 3GXFA 1GGUA 1MAML 3QCUH 4ZTPL 3REWB 4E42B 5EIIA 3B7SA 4HZ1A 4XHJC 2FBRA 4DKAA 2C7UA 1XB8A 4TMPA 3KHQA 4Y5XA 5I15L 2HWZH 3PWPB 2MFNA 3LNHA 2A3TA 2A99A 2ZWNA 2X6BA 3T6XA 4Y1AE 3ZE0E 3HC2A 3R1GL 2JFCA 2V8LA 4FMKA 1DBML 1PW3A 1U8JA 3QIBD 1O6SA 1BMGA 2HT3C 3IMRA 2EACA 4KY1L 4JB9H 2VO5A 2GAZA 1RP9A 3ZPDA 3V6ZB 3D50A 3NZHL 2BNUA 1X9LA 4TYUA 3RU8L 4Z7UF 4S1RH 4MYPA 1Q9LA 5JIKA 4PCYA 1OL0A 4HFWA 4Y1TA 4GAJL 3UYOD 4ZPVB 3UJJH 4LP8A 4DEWA 2WY3B 3U1PA 3OC8A 3WDJA 3LJ3A 4MDJB 4E41B 3MRDA 1M4KA 3FFOA 3UYRH 4QRUB 2CR0A 4WO4D 3ATFA 1OGSA 1UM5L 2M2DA 2FD6L 4K8RD 3U1SL 4ZODA 2LVEA 1K6QL 1RZJH 4NP4L 4KTGA 5HHPB 1U3JA 3Q43A 3DX8B 1N0XL 2R27A 4A67A 3GMQA 4M7ZB 1R3LA 2IQ9H 1TR7A 2WQVA 4PJFF 3AREB 2NT1A 2X89D 1TG8A 1MHCB 3CCHB 4JANA 3N06B 3B9VA 4ODSL 1UCBH 3NSCA 1XGTA 1ZLUH 1CO1A 4C4BA 4K7PY 1CT8B 1BEYH 4AUYA 3VVVA 4GQ9H 3PQYA 1U8MB 2CIIB 2XIIA 4CU8A 4BZ2A 5HDOA 3CHQA 4ZS6D 2NR6D 5JOPE 1UWXH 2X42A 1CVSC 1ILUA 1EEZB 2PP9A 4OCWL 2Z8RA 2BSRA 3GBLA 4U05A 2VUKA 3OM3B 4PGZA 5JLZA 4X9YA 4U6HA 4ONOA 3BHBB 3GBDA 1SF3A 3S34H 3IFPB 4XP4H 4NUJB 5C0BE 4XOBA 3FT2B 5E5MA 2P8LB 4IBZA 4Q9CA 4OV5B 5KEZA 4N68A 2WLIB 3MRQA 4WK0B 3S36X 1I85A 2COVD 1ZWIB 1JS4A 4KXDA 4HUMB 4A2FA 2H45A 3QG7L 5DTFB 1N26A 3RWEB 3D4CA 1ZOXA 4KH2A 5KSAB 5MERA 1ASQA 5L9DL 4U3SB 1QBBA 3P9MA 2C7FA 4N85A 2FB4L 1T1WB 2GJJA 4FQHA 3BW9A 4DTGL 5HI5D 3QHZL 4PRAA 1MDAA 2ZP8A 2EE6A 1U0QA 2OAAA 4IBSA 2Y7QB 1QOKA 4HKBA 4OM1H 3QEHA 5JXEC 1WFJA 1RVFH 3DBSA 2WUBH 2F5AH 3BD5A 2C3HA 4YDJB 1UWYA 3O6FD 5ANMB 2EP6A 2VITB 3WS3B 3EKCA 3TBSB 5IMMB 3MUJA 4QXUL 4MCNA 3S7GA 1FIGH 2SEBB 1QSVA 1OQOA 2AXJA 1PZCA 2FSDA 1S7VA 1FFNB 4JFQA 3M7FB 2OYLA 3R8QA 2QDVA 1AYOA 2BHYA 1CB4A 5E6ZA 1J0ZA 4OGXL 4BQ6A 3TYGH 2NQCA 1GHFL 5IF0A 5CBAA 4OIIH 1NFDA 3OKEB 4N2DA 1CDBA 1F6AB 2ZNWA 3STZA 1OD7A 4FZEH 5EF2A 4M1GH 5LGKA 1M7IA 3MA9L 3HUJA 3N1PC 4ZX5A 4H8UA 4IBVA 1YJDL 3D85B 1BZ9A 3HNTL 1BA9A 3IPEA 3KE0A 1F3DH 3LZQA 2BVEA 4XMWA 3Q2WA 1DQLL 1MNUL 3NCBB 2HRPL 3FT2A 3OKDA 3O3DA 4HS6B 4QTHB 4BGDA 4J3OH 2O1AA 2WOBA 1LNUB 3MRJB 1U3HC 4R0LB 4GSDH 2P45B 1JTPA 4OLZH 2JJTA 2X3CA 3QUKB 2G3MA 3EFDL 5DUPH 1I7UB 4YXHH 5LQBL 1H3UA 4XP1H 5C09D 3L5IA 2IFFH 1I9RL 1ZV2A 1JMXA 4YE0A 2ZJSL 1Y7VA 1QHOA 4FABH 3BW9B 4I0KA 4KKLC 3ARDC 4PW4A 3TF7C 3AT9A 3P3TA 3QXTA 1SN0A 4GLRH 3BKJL 1DL7L 2Y7QA 3ZDXF 4AQ1C 1C9SA 3ISWA 3QFJD 3QT2A 4R3SB 4ACPA 4L37B 1JI2A 1JPSH 4YO0B 5JHLL 2NY5L 3NIDB 1HCYA 1ZEAH 4X8JA 2BW4A 1CXKA 4Y19D 4JDZA 4K15A 1S78D 1PY4A 2EDEA 3FNKA 4R5TA 1DQVA 4K3GA 5BZZA 4MA1B 1EFXB 1FYTE 4NENB 5A1AA 2P24B 4WWKD 1IC0A 1FL3A 1SFHA 2MNWA 1UD8A 3HG3A 1KTRL 1M1SA 3O45A 3HLAA 2F7QA 3WS6A 2ITDA 1SZNA 1MXDA 3X1EA 1S7QB 2FQGA 3NA9L 4BZ1H 4HAGA 1KB5B 3FO9A 4EN3C 1U58B 4LASL 2ENSA 1E6OH 2W9EL 1IX2A 1R47A 2ARWA 1CZ8H 3NIGF 2V4LA 4FI7A 4YGVB 2HFFB 3VGAB 1Y1DA 4PJ5D 1CFBA 2BOCB 3ZE0F 5CILH 2I07A 1SOKA 1B4TA 4QMEA 1ASOA 2OW6A 4WNQB 3VFOB 2CE6A 3GFUA 2R29A 3F84A 4WO0A 4EKXA 2BY0A 2ED6A 3EO0A 3C6LB 15C8L 3PDGA 4TVSa 2ZAHA 4WEMB 3ZE0B 2CPCA 2YAPA 1IGML 1YPZE 1I7UA 2G9KA 3N85H 1YYML 3HZMA 2ITFA 2FWOB 2HJFB 2H2SD 2VSDA 1J5CA 4UQ3B 3UL4A 4AK1A 1GS7A 2A74C 2G2RB 1S7UB 2OPCA 2EO7A 2FX9L 5CGTA 4OLYH 4JPWH 1WEJH 4M5YH 2A0LD 2DQDH 3FT4B 4I8DA 1QBLL 2Q86A 5E4AA 4Q97A 3RFZB 3P4MB 2BM3A 3MBEC 3ABZA 2ZKYA 4PUBL 5AKTA 5D1ZA 5J11C 2A9NH 3UTSB 2GJPA 2QV4A 3ABMB 2GYSA 2ZX8A 1K3IA 3AG3B 2FEEL 3RI5F 3VRIA 1TJIL 4S1SH 5IQNA 3RL1B 2Y3NA 3D05A 4PGDA 4JPQA 1W9XA 4FQ1H 3QCUL 4O2FA 3MRIB 4FCAA 1KC5H 4CRPA 4LCIL 4NNYA 4RFOH 1E4KA 1D6VL 4JDEB 4ZAKA 3NCFB 5IY5B 1BBDL 3WEAA 1FUNA 2BLFA 1MWAL 3ABLB 4OZHF 4A2MA 2XPYA 1XGPA 2EDLA 1UKQA 1U41A 1W0VA 1YQVH 4K71B 3SKOB 4XMTA 4M1GL 4FL4B 2TSAA 4HK3N 3BT0A 1R24B 5AW1B 2IIJA 3BT2L 3LB6D 5B8CA 1HYSD 4KZDH 1BIIB 2IPUG 3PGFH 4XZUB 5SWQA 5I6NA 3QHFL 4MLSA 3MGOB 1ICTA 4ICWA 3KBEA 5IW3A 3GXPA 3RIKA 5DVOA 2FECI 3UJJL 3C6EA 3MRCB 1SXCA 5FWQA 3X3GL 2LLGA 4QHMA 2OJ1A 2N59A 4FLRA 2B4CC 4TVPE 4UTBA 3LN4A 1IQWH 4GP8B 4RSYA 3LEVH 2B39A 3C09C 1T4KA 3VXQB 2GAZB 4EMZA 3HG2A 5DT1H 3LRSB 3MN8A 3G5XB 2X70A 1TQSA 3SPVA 4NEHB 3C5ZA 1XB3A 3OHMB 5CN3A 1I1CA 2VXQA 5CIPB 1U33A 3MLYL 2A77H 2YAFA 4Y4FD 2FSEA 5E8EB 4W4NA 4XPFL 2NSQA 2YXMA 1AQDA 2OLDA 5C2BL 4PB0L 4HGWB 1BLNB 4OF6A 1MFAL 3ME0A 4ZTPH 1RUPL 1EHKB 3C60A 4IKJA 4B9FA 2HX7A 1ZY9A 1UQSA 1YY8A 1BYNA 3OMNB 3O6FC 1K4CB 4Y4HD 3PY9A 4H8HA 2ZYRA 2V5MA 2W0KA 4CL7A 4ZFGL 5PCYA 1QRNA 4ZUVB 2XPGA 3RPIB 4XNDA 1NCAH 1HE8A 3GBNH 2BCKB 3FJTA 1HXYA 4JKPH 5LNDA 3HAEH 4JK0D 1RHFA 1JTOA 1ML0A 3QCVH 3VSVA 3KMDA 3H42L 1ND0A 1W2KT 4KMQA 3QZNA 5DJDA 4P5TA 3VFNA 3NBNA 2DDQH 2YRBA 3B2MA 5F3FA 3X1BA 4XOEA 1LYQA 1BD2B 5KJ4A 3T09A 1KCRL 1QNZH 4YZWA 5EZPA 1VA9A 1EO5A 4EI0A 1WBZB 3IDGA 4R4BB 3I6KB 4XCFH 1M6OB 1NOAA 3IGLA 4JFTA 2FHCA 1B4RA 5F6IC 5IB3A 3B7RL 5LGHH 3QEQE 1F4XL 2A77L 3G6AB 3V6FA 1H19A 1HJCA 2JF1A 3F7PC 1OP3K 1QWUA 4NC1E 5BQDA 3A4EA 4NUJA 2H32H 3RNKA 4PJ7A 5IV2A 2NUTB 4ALAC 1BHGA 2CSPA 2EO9A 5IB4A 1ZAGA 4AW7A 4TVUA 3HEIB 4RWYH 1JGEB 1BM7A 1NFAA 2BSTB 2O5NA 4TVPD 3OR7B 3GBML 4Y16A 2CHXA 3NSYA 4J3BA 3RTQB 1DBKL 1DSYA 5DU7A 1BWMA 1MLBB 3L3IB 3EBGA 4Z7NE 4E9TA 3BGMA 4QRSA 1RPQA 1PTZA 3H7BA 5CJQH 5JA8B 3TA3D 3LS5L 1PFOA 1S9YA 1CXFA 1IEAB 1TKWA 3QCVL 4DFIA 3L7FA 3KVDD 3CNKA 4BZ2L 2OXHB 4LDOB 2VM3A 3QORD 1MJUL 1KUMA 1XGYH 5DK0A 4YIQA 2C1PA 1UASA 4L29A 1KJVA 5JHDB 4OF5A 3NDZE 1RL1A 3C60B 3CHOA 2R2BA 4H1LH 4O02H 3KYOB 5T3XE 4DP1X 3EBIA 3IXAB 1NDMB 2OTWB 5F9AC 5AWNH 1UM4H 4IBQA 4MMXA 4PU2A 5F7HA 3IMWA 4HS3A 2XJKA 1U3HA 2PETA 4FYSA 1JAEA 4N9OB 4O51B 3V9EA 3MNVA 3DURB 3FQYA 4FS0A 3S2CA 4KK5C 5EZOH 3QIBB 3ZTDC 1JGDA 1AD9A 1E9PB 2W07B 3LRHA 3TJEL 4W4OC 3WLWD 5DHMC 4BFBD 1MFMA 3SQBA 3GM8A 1GZHA 5BS0A 2DAVA 3HE6A 4MNQE 4M5YL 1FYTD 3DYMA 1IGIH 3S8FB 1XTMA 4KNQA 1UJTA 3QYMA 3T77A 3CFBB 4DEUA 3FQ4A 4OLZL 5G4OA 2FT8A 5DFVD 5IBTH 4JZJA 4MD0A 1SN2A 5FUCE 4S1QL 1JGVH 3RAJH 1QFUH 1XQ4A 3S5LB 4I1RA 4DNLA 3HC0B 3V7MA 3H9SB 5KJRH 4JG9A 5DRNA 3IDMA 4NUGH 3O3DB 5TQ2H 4GQPH 5FCUH 4JRXA 2JKSA 2FVNA 1L9PA 5D7IF 1F02I 1YY9D 1A7OL 3K4ZA 4WK2B 1USZA 2QEJA 1B88A 3AREA 5EO9A 2AC0A 1F1AA 4DGIL 1D7FA 5GZND 2AMGA 4F2MB 2PTTA 2V2TA 4L8CB 1B4JH 1T1XB 4KK6D 4ANXA 4GI8A 3B4NA 2YXFA 1FN4B 2PUQT 3SSGA 2EUXA 3EO0B 2XZCH 2G75B 4WUUA 5L2KB 2FJSA 4ZOCA 1G84A 5T3XD 3L3OC 3Q2CA 5FHBL 1S7TB 3SOBL 1I8MA 1UZ8B 4M61B 5C97A 3KWUA 4KTDL 2F08A 3IMVA 4FFZA 4MXQD 4WQOA 4FZ8L 2DWXA 4JPWL 1PKQB 4TLKA 1VF5C 5EB9A 3GMRB 2ADJB 1AOHA 1MJ7H 3IDUA 5DC2A 3VFWA 5HDQL 5HVWA 4U1MA 3V4UH 3GKZA 2XJLA 1IKNC 4GG8B 2WXPA 1M7DA 4X7SH 3KLQA 3MGTB 3NH7L 4N24A 4LLWB 4WRLA 2NY6C 4N6RA 1HL4A 4MASA 4MHHI 5J89A 2D9CA 2E8YA 4WI0B 4X99A 3VFSB 4RMSA 4F9LC 5E08L 5EU7E 3TV3H 2EO1A 4XN9A 5DDHB 2G5RA 4U1IB 3BFWA 3HE6C 2PO6C 3D2UD 3WKQA 1TVBB 4FQHB 4UV4L 4AX3A 3ELQA 3KPPB 4G9FD 2WZAA 3VFMB 2X4QB 3SKMA 2FCBA 3HUJF 5DUPL 3D4YA 3PP4H 2YUXA 2J1WA 3OGOE 2BFVH 2WTRB 5IW1B 1UA6H 3CG8A 3FF7A 5AUMA 4JJOA 5GISH 1X3DA 3P0YH 3DOIA 2HZHA 2VW4A 4XPHH 1CFSB 4KK9D 3WJJC 4Z77B 3NP4A 2EIKB 3N0PB 5IUCA 1N5YL 3O6LL 2HSIA 2V3DA 3HFFA 4LU5H 4ONFH 1EXHA 1D5ZB 4G43A 5F89A 1IGTA 4QNPF 3VQ1C 1EAQA 4PJGA 4LDLB 4PJ9C 5DZAA 2AI0L 4IJ3B 4G6MH 3ZBMA 2Q6WA 1FGVH 1BXVA 2JELH 3SODB 5C3TA 4YHYC 4ZFZA 4WHTB 1J8HA 2ID5A 1MZYA 4OR1A 4DKEL 4WW2F 4PLNC 2D2CC 3QVAA 3BAEL 1HOEA 4IMLA 2UWEA 1TJGL 4G42B 2CJTA 3BPLC 3TZVB 2GW5A 4F93B 1A14L 3I02B 4FG6C 2CO2A 4ODTH 4FD0A 3D85A 5E56A 1OHQA 5JPNC 1BVNT 4BCYA 1IAKB 4Y4FB 5ADPL 5T1DH 1QI4A 2UX6A 3IDNA 4P4KC 3CN1A 3A4FA 4OM0L 4KK5D 2F5AL 4N8CL 1AMYA 4R0LA 4E5XB 3K6DA 1SVCP 4KOCA 3TT3H 3IU4L 5D71H 2OSLB 1A3RH 2J5LC 4MXWH 3H6JA 3MRHB 3ZO0A 2Y2WA 4Y2OA 3B3IB 4DEPB 3AS2A 1EHLH 2HJKA 4L9DA 1BD2E 1R34A 4B6ZA 1WISA 3Q2VA 1XIWB 1I1YB 2UZYA 1TFHA 1AC0A 3G08A 1YNTF 3MV11 3MQIA 5E51A 4RBPK 2RD0A 1MCWW 1YUKB 4ZXBC 4DWHA 1DN2A 3WFCH 2E9JA 2Q10A 4LHJB 1WBZA 3IDGB 5C2BH 5CNHA 4UILH 3DROA 4FXTA 3D87B 2AABH 1KJ2A 1OQXA 2JCCA 3O6KH 5F96H 2FO1A 1CYGA 1CDCA 2IAMD 3LH2H 3EF7A 1M56B 5J6GA 5FKPA 3LMJH 4WY7H 1F11A 4M48L 1WFUA 5IVXB 1FGNL 2E6QA 3OSVA 1WC7A 3E8UH 3WFHB 1UD4A 3PNWB 1QX1A 1J1OH 3CSBA 4OAWA 4KK6C 1QSFE 4BUHA 1R3LB 3VYNA 5IOKA 2VZSA 3KDMA 2FBOJ 4UM9D 5I17A 5I23A 3LQZB 1ZT1A 4OB5L 5JDJA 1CICC 3MUGB 4BE6A 5K9QG 4J4PD 3VH8B 1JF1A 1WPCA 1OK0A 2MCAA 1M53A 4M48H 1WUNT 1FLRH 2HFEB 3WO4C 3DIFA 4B60A 1JGLH 5GGRY 4Z76A 5HPMA 2YMXL 5DK0B 1RUKL 3VXME 3RDTD 4PR5A 3MLWL 4JFWA 4KKZA 1U8PA 2EDTA 4LVNB 4PLKC 1GRWA 1PZSA 2EKSA 4HF5H 3RG1C 2W92A 1G9MC 2UXVA 4HKJA 3KLAB 4PCKA 4NQDD 4QHUA 5C08A 3K1DA 3H53A 2XNAA 4P46A 3BRDA 3FU7A 3QWQB 4FHJA 4ANVA 1BFTA 3KYNB 1IGYA 5IVXE 3GM0A 25C8L 1MFEL 3ZL1A 3I6KA 2OR9H 2Q20A 3CU7A 1WBYB 3UBHA 1T89C 5KANI 5FV1L 1Q0YL 2G9HB 3DDGA 3SDAD 1F90L 5EMYA 1FVEA 4OU3A 3QUMB 5IMKA 1KYFA 4U1HA 5ALCL 4ZO9A 1Z7JA 4LCWE 3RIFF 1XH0A 5DZLA 5DC0A 2F8OA 3DBXB 2KT6A 1AR1B 1N59A 2XVLA 5FGBA 4HJJL 1QMUA 2HX9A 3EG9A 4WW1A 3VFVB 1A1NA 2VDLH 1M1XB 5I6KA 5LXVA 1KTDB 2X6UA 5GHWL 3PCYA 2ATKB 1T04B 2RHEA 2I9LB 3VW3H 1XGTB 2DM2A 4XO3A 4HKBB 2FQEA 5A2CA 4KWUA 5KUMA 4K3DH 4ZMPA 3IB4A 1HZKA 4IIQA 4ZOEA 1RXLA 4Z7UB 2GT9A 4UUJB 3ARGD 3V0VB 3GS4A 1ULVA 2CCVA 3BZDA 5I1AB 2GITB 4HHAA 1XF4A 2NXZC 4MCZB 5BRZA 3V0FA 5JLZB 4YK4C 2EYRB 3Q3GB 4HIIA 2P46B 1YO4A 3SE4C 4E9RA 4JFQB 5J0BA 2VIRA 3F01A 4WVRA 3FO0H 5JNYA 4FTVA 2P8LA 1CIDA 2A6JB 3DIFB 3N43B 4POYA 1ZSDB 1VACB 4AH2B 2AZAA 2P52A 5ADOL 2RMNA 1U3YA 3CH1B 1F86A 2TAAA 1HCFX 4PD4J 2J88H 1C7SA 2WLNA 3M07A 4JY5L 1O9WA 2GIXA 2Q2EB 1XBDA 3OX8B 1R1CA 3AWEA 1QO3A 2ZXWB 3CN0A 3DIVA 3MU3A 4HJSA 4ONGL 2EYTB 3MRRA 3RDTB 4CNIA 3UX9B 3L95B 2PYFA 2D3JA 3DX6B 3WFEL 5TK4A 5FDWA 5JOFB 3MVSA 3BZ4B 2IOOA 4NJ9H 5DF0A 5E8DL 4PG9A 1OAXL 3FSOA 4X6CA 1D6VH 1NBVL 1Q0XH 2Z7ZA 1XL6A 1NDGB 4IRJA 4UV4H 4MZIA 1AP2B 5IMKB 1YPZB 1QYGH 3GO1H 4OLUL 4W4OA 5K33A 4NO3B 1JRHL 2EIJB 4F8LA 3NFPB 2ENYA 5F7BA 1UFGA 1LEGB 2IALA 2PYEB 4KY1H 1DBAL 4ZX4A 5KVFH 3WIHH 4OSUL 4ZW7A 1CMOA 4YOKA 2AMUA 5AZ2L 1N8ZA 3VG0L 5E1HB 1DE4B 3O4LA 1OXYA 4JM2A 3SKMB 1K8DB 1LK2A 3QZBA 4I3SH 3GO1L 4OLUH 3WY1A 3GXMA 4AVKA 1HHIA 1F6LL 4R3SA 3LXBA 3CQFA 1GGIL 1VDGA 3VGDA 4K73A 2XT1B 4N0RA 5IW1A 3VG9C 2GT9B 1SBSL 3FT0A 2KDYA 1FFPB 5CBAB 3NT0A 3HI6L 2AGJL 5L4MA 5KS9F 2FTAA 2GEEA 1JHKH 3QPKA 1AC6A 1A0QH 4IRSC 4YSTA 4EOWH 3EGXB 5DRXA 5CFHA 4V11A 2GIMA 4PJEF 1MCEA 1QSEB 4IOSA 4RMUA 3ZHKA 2EVIA 1OAZH 4N5ED 5C0ND 4FKKA 3TYGL 3L5JA 2D9QB 3P77A 2P8MB 1HCVA 5J06A 2NY0B 3CDZB 5IBTL 2IPTL 4W9CC 2YAEA 2NZ9D 3N50A 3QUKA 4W9GC 4Y16B 4HSAC 2RQEA 4JFZH 4EZKA 2YAOA 5FR3A 4X99B 5DVMA 2ZG1A 1D6EB 1FIGL 5HVHC 4MNQB 4XCCL 5JPMA 3BZEA 2BC4A 8FABB 3L13A 4A6YB 2Z92B 1WGOA 4LB8A 4LLVA 1ET7A 1H6FA 1DZBA 3QDMA 4JG0L 1BWWA 1NUDA 3PREA 4IGBB 2LR4A 3IXTB 3UTTA 2W65A 1KENH 4K3HA 3ZHLA 4Z6AT 3VI3F 3HJEA 4Z7WF 4YBQD 3LZLA 3SGKA 2OSLA 3TCTA 1A1MB 3MODH 1B0GA 3T0ED 1PLAA 2PR9A 2BINA 3OKMB 4ZT1A 2WSDA 3TO4B 1JV5B 2H0EA 4HWUA 3TF4A 3RWIA 2CLVA 2YRZA 5JW5A 2VLKA 3QDJA 5DGQA 1W8OA 3T3MB 5E6RB 4L9LC 3STBA 4DN3H 2C9RA 1LWRA 3AMLA 1LDSA 5T1LD 4KXZH 1JGEA 3ULUF 2H41A 5HXMA 3CX2A 3F12A 4UIMA 1U8HA 2ORBL 3ZZQA 3L5XL 1BG1A 3DIDA 3MJGX 3F2LA 1P1ZA 1C12B 1UFUA 3C6SB 5DRWA 5GGQL 1FLTX 3FXIC 2Y07H 3HCVB 2CK0L 4XO9A 4NAQA 3OWEA 1BQHG 3I02A 5DR5L 2AK4D 2WBJB 1ZDQA 2WBXA 2JJSC 3DJSA 4PM1A 1H0DA 2WWMD 2G60H 3P4NB 4FEIA 1MIMH 4BK4A 4LRIA 4R26H 1XR9A 3JUYA 2BS71 3NCJL 4RAVA 1B0IA 5HHQB 3D30A 3A23A 4WI6A 3J7HA 5MP6H 5J6SA 3GJEA 2X4OA 3ULVE 4X5RA 4KJQD 5H37G 3N6YA 1PLBA 2VDRH 3X13A 2Y7NA 4NJAL 1H9VA 4L4TD 5HPMB 2WB1A 3UC0L 2X53A 2QFPA 3WMPA 4KQ4L 4HOXA 4L8CA 3C9NB 4ES8A 2IWKA 1G9NH 2D7TH 3UTQB 3PFUA 5AVQB 3ARWA 1L3NA 4G7SB 4HUXA 1CFQA 3LMJL 4NBYB 4UMGA 2DQHL 2E27L 3CTTA 2Y6SD 3RZCB 4C83B 4JFEB 1NANH 1RZ7H 4HCGA 1B0GB 1MQKL 2WTOA 4AG4H 1QFUL 2GFBB 3BUQA 3DGGA 4NQSA 5MEPA 3BPNC 3MUY1 2VDLL 4JO5A 3ETSA 5TGBA 2CO3A 3F64A 5I6PA 4ACTA 4EZMA 5LCVL 3L17A 5I5JA 1N6QL 5CWSB 1D9KA 2CA4A 1TZGL 3DJ9A 3PE9A 1RULH 1UVQA 3HMXA 5HYIA 4PY8J 2YUVA 5EBWB 2Y06L 2UZPA 3TBSA 2P5EE 3KPMB 3EYQC 3OZLA 4P23B 2EILB 5DK3A 1DBAH 1QLFA 5IJKA 2YD5A 4JFHE 3ARYA 1KCSL 3EO1A 3MA9H 4N26A 2D3VA 4L3ED 1A7RH 1ET5A 4TSAH 5EOQH 4DGWC 1B4JL 4CVXB 1T1XA 1ND0B 3PAZA 3GMPB 4QY8B 5B3NA 4Y5VA 3UACA 3U36B 4Q4IA 5K59F 2F54D 3N40P 3MV01 4A39A 4GKNA 3RY6C 1V05A 1RIHL 1K5WA 3F7KA 4X2UA 4GG6A 4J8RB 3GC3A 5EPMA 1QUNA 2ZOOA 1EGJL 1SGKA 3WFBH 4CADB 3MA7B 4YDKH 4Y5VC 3LKRA 3TNNB 4YDLB 3H4FA 1UWEL 4L8SA 3DPDA 5L4JA 3FCBA 3EJTA 4QTHA 3B3BA 3PWPA 1GR7A 1PL3A 4NZDA 4E9LA 2OMBA 3BAWA 4LEEA 2VMFA 3V0GA 5CBEA 1I9EA 2WQAA 2NW3A 5E95B 3RTQA 4L4TB 3HNSH 5SX4I 4ELMB 4FQCH 2DKMA 2ZWLT 4FQXD 4KRPB 3N2JA 5F6HJ 3NJMA 3TA3B 3DARA 3ZDWA 2YPLD 3IDJB 3GXNA 4GI6A 1IBHA 4PLOB 2Q1EA 1F13A 1NFDE 4YC2C 1SEQL 3M8OL 2WZPA 1SJXA 3DTDA 4JCWA 5E4EC 2X2HA 5IT2L 5ITBH 2CKBL 3KDPB 4Y0GA 2DPKA 4Q0XL 4NRYB 3IN0A 5LLIC 1FI8C 3TFBA 3Q9PA 5BVPL 1NIAA 1JCKA 1G9HA 3O3BB 1UACL 3CLEH 4R90H 4CSZA 1BFSA 1I7RB 3L5XH 4CW1A 4P4KB 5ECGA 3RLSA 2V5RA 3UXFA 1M6UA 2VQUA 5DMGC 1BBJB 1OZTG 2DYSB 4P04A 1GGCH 2NY1C 3ALPA 1TPXB 2Q7NA 5A43C 3B3IA 3DJZA 3L2MA 3SD2A 1BCIA 3CZFB 5AVTB 5F7EH 4X4XB 1AS7A 3WI9A 2ZJSH 4IDLA 4FTVB 4HIHA 2PW2B 5T3ZL 4P5SA 5CSZB 5C07B 4JGNA 3UTOA 1T6BX 4PJIF 1YEGH 4KHTL 3S36H 4YHYB 1FFPA 1RFDL 1TTGA 1ZANL 4OJFL 5DHVH 3T1FA 4H4NA 4KDTA 4JZJB 5GRZA 2HG5A 3WD5H 1KXHA 1M3JA 2FO4A 3UCQA 4CKVX 4Y5YC 5I0DA 3K91A 3LY6A 1WS7A 2Z93A 1QQDB 4F1ZA 5C0CD 1QD0A 2BWIA 2DIEA 2WZ0A 5GIRA 2ZD0A 3EGDA 3IDMB 4A37A 4TL5A 3WNIA 3SN6N 3FCTA 1FGVL 1CBVL 1MWAB 5AYQA 3TTSA 4MQTB 3QS3A 4N0UE 4FQ2L 1J5OH 3VTAA 5GGRB 3HI5H 2Y1ZA 1NDMA 1EAOA 1Y07A 1KFAH 2F0CA 1DQQB 5KAQF 5E00A 3G5VB 2G2RA 4KZEH 3PFQA 1T3FB 1P5UB 3D4GA 1RZQA 5B3SB 1ZVSB 5C0AD 1TYRA 1OGAE 1B6UA 4G8IB 5GJSH 2VXUH 4KX9A 1UD2A 3JWNC 4GAAA 3W0WA 1RIUL 2X2IA 1MCKA 2YA0A 1DVSA 4ZO7A 4X9BA 2DH3A 4OM1L 3RVXC 1SJMA 3PIQA 5CHNB 4WU7B 5D2NA 3DMMA 3OXRA 5DO8A 1J9TA 1NFIA 3AG2B 4UBDD 4XOAA 4ZAKB 3QUMA 3FH5A 3NIDF 3UEQA 4TRPL 3CZKA 4HCRL 3M7OA 3V5KA 5IIEB 1OTUC 4FAAB 1I3UA 1Q9KB 2Y24A 3F5WB 2Y22A 3LEVL 1WA1X 3U46B 2VDOH 2PR4H 4PY8I 4X98B 4XI5D 2HG5B 5SV4A 1M7IB 3W5MA 4JFXB 2YPKB 4P4RA 3WENA 5GZOC 4RETB 3NZUA 4S0HA 2LE9A 4FNPA 5ISZE 3CZEA 4HIQA 4HPHA 4R83A 2F61A 2FYYA 3FO1A 1KLFB 3S97C 3QWRD 2CDGB 1SHSA 1JERA 4IKLA 3D39A 3UO8B 5FO7A 2E74C 2Y6SC 1J9CT 4PJGF 2VISB 1CFNB 2IBZX 1CFSA 5MEQB 5DVKA 1R0AL 1BQSA 4DGIH 3NEEA 5CM1A 1F4WH 2WLZA 1KBGL 2JIXD 5D7JB 3Q8CA 1DJZA 1U8IA 2WPGA 1H5BA 3LZFH 3HJ0A 3BGFB 1UOVA 3CFDB 5F9DC 3SE9L 5ELIA 1V3MA 2F8VA 3HG4A 5GS0C 3AXIA 2J43A 2Z0BA 3AITA 4XP9H 4CUCA 3K2IA 3CFCL 4WHTA 1OSYA 5D7KD 5I8KH 3CQPA 2H1XA 4N1HB 4XNMB 3B9AA 4XX1E 3GS7A 5HTSA 4L8BB 5IFHL 1SNRA 3VWJC 5I19L 3GWJA 1LWHA 4OKVA 4HFWB 3QUXB 4OLVL 1HDMA 4R7VA 1ZSHA 2Y36H 5A2LH 3DLQR 4HCFA 5DWUL 1MFBH 4OLXH 3KS0H 4U1JA 2GTZA 2X09A 2PCXA 4KV5E 4M5SA 1AG0A 4P9ML 4F7CA 3L1OH 5KBDA 3V5HA 4LOEA 5EEZA 2P24A 1BZEA 1OM3L 3TN0B 4I18C 2CO6B 4QIRA 3V0VA 3FRUB 4DKDC 2Y25A 3C5JB 3MLUL 4JPSA 1JPTL 5CJ8A 3K6SA 1AI1L 4PJFE 4MNGE 1W0WB 5FHAL 1YC7A 4HEME 5EIQA 4JFUA 1OTSC 4HHAB 3T8VA 3ZQWA 3NPZB 3G6JB 3BPCA 4DGYL 4QOKA 1AZZC 4C56A 1JPFA 4XVJL 5KVGH 1FZMA 5B39G 4YSEA 5I76A 2CJUH 2VERA 3TBWA 3QH3B 2QVTA 5L8KB 2JTYA 4PJGB 2EDOA 4Y4FC 3VRLF 1C5BL 4EQ2A 1UM6L 5G4MA 5EBLA 5M94B 2IANA 3FH7A 3L3KB 3V0IA 4EDWH 2NDGA 5IM7A 3KLHC 4RRPM 2Y36L 3TEWA 1FSKC 1WFOA 2FT6A 1S7WB 3MV9A 2NW2B 2UWEB 3BVDB 1MIEL 2WQWA 5IOPB 1OCCB 3B9EA 1N64H 3HMWL 4HFUH 2XWTA 2YLKA 4DVBB 1AZNA 2H47C 3IJHA 1IGJB 4LHUB 3ZKMC 4DZ8A 2DLFH 3MV7A 1EHNA 3DOSA 5TE6H 5FA4A 1PZ3A 4YFLI 1EJ6A 3FO0L 1R3IL 5GS0L 4M5ZL 2X9ZA 3SY6A 4JAMB 4KMTH 4WI9A 4BBWA 5IK3A 4LSUH 4WEBH 2WK2A 4EUPH 3OL2A 2VW7A 5ITBL 2CMRL 2W81C 3MJWA 4J3XA 4EZJA 1P4IH 3KPOB 4A2EA 3L3JA 3RIAF 3TX4A 1GOHA 2X9XA 4MNHB 3CDCA 4AQ8C 2GBUA 1JF1B 2A6IA 5JO5B 3QUXA 4QHLA 5DVPA 3U30C 1KXTA 4Y2OB 2Q8AL 4LPYA 5JPMB 3QUZD 2HJKB 2XWXA 4XCFL 2AQTA 2GTZB 3ZUCA 5BUPA 3RA7H 1PIGA 2B2XL 3L8QA 3O41B 2A9ML 4RISL 3L54A 2H4EA 3FU0A 5CLYA 3BWSA 2VGLM 2NY7L 1T7XA 1GVIA 4G1MA 3II2A 5ANMA 1HQ4B 1OT4A 3K2MC 4GLRI 3U6RB 3CX5K 1WAEA 4WHDA 4D9LH 1NCBH 5EEYA 3VI3B 4Z7WB 1AHWB 2YSSA 3K5RA 3EGXA 4JCMA 2AXHA 3OZ9L 5TQ0L 5LN8A 5SWZE 5ECJE 5IHUH 1CFMA 3Q7JA 5KSBE 1RULL 1MCIA 4K07A 1F8TL 4NQCD 2FX7L 1OAKL 1T2XA 4TV3A 1G7LA 1YQ2A 1E3XA 2EQDA 3FOLA 4OUOA 3CFQA 3D3VE 2JMRA 1FCCA 4GIOA 1MCWM 1WS8A 5C07D 4MJIA 5D71L 1J1XL 4GSXA 3AZUA 1TJIH 3DX0A 4PBVC 2XQBL 4Y8AA 1Q94A 4GT7A 1G1KA 3EOBA 2HTLC 1FO0B 3PDDA 4HV8B 2WQRA 5EZIL 4ZMLA 5KSAD 1QPKA 3WEXA 3C5ZB 3F05A 4AJWA 1SQ2N 1YMME 4UQ2B 3C12A 1OEZW 5KVFL 1VGKB 4GS7C 4ZAKC 2FATH 2E56A 5JIPA 2X1PA 5FGCB 3MC0A 1MW1A 3ZTEA 1H8SA 2DWEA 4LZKA 4S2SA 4L3FA 4YPJA 3W2DH 5GS0D 4YUEL 4ZFOL 5IQ9A 3QAQA 2HRGA 2ETWA 2VDNH 1QW9A 2UUDH 3QCTL 4F8TA 4JRYE 3LXUX 4KKNA 5I8OH 3RHWK 2LGNA 3VWJD 2ZXAA 2XIBA 4TM9A 4PV1C 3I75B 3VFWB 2F5BH 4FQJH 2Y7OA 4NB7A 5TF1L 1FVEB 3NIDE 3DK2A 3HI6H 3AS0A 4N6RB 2QFRA 5DJ6B 3C9NA 4X4XA 3T4AC 1HESA 1ZK5A 2VC2L 2K8QA 1GXEA 2HT3D 3FB5A 5B38B 1NC2D 2FH8A 2PW2A 4G6AC 4ZMTA 3B2VH 1C12A 5DRWB 3UADA 4KMLB 2MQCA 3HG1B 4ONHB 4XNAA 5GSRA 2A74B 2WLJA 5INCB 4Y7MA 1SN5A 4J28A 3RGVD 3HFML 1GY1A 3L3GA 3P9WB 1U92B 3LQAH 1FC2D 4DO4A 2DY2A 5F97E 5CF3A 2DQCL 4ZUUB 1DSFL 5KZCB 2OSYA 1BFOA 2NY5C 5I5MA 5M95B 1I1FA 4UYPA 3QQ3B 5DUJA 2O93L 1YC8A 4Y19E 2VAJA 3O6FA 1T7YA 3OKDB 4PB9L 1PLGH 1YMMD 1OCRB 2HVKB 3FQWB 5LGHL 1GGCL 5FM5M 5DJ8B 5I1EL 2CUMA 2G4GA 4XNBA 5EBWA 5ERWB 2OZNA 5FGSA 4ELMF 2D7PA 1GJWA 4X7SL 4YPGA 1NJ9A 1Y18A 1DSFH 2YFOA 3QJOA 1Q0YH 4R5XA 5HHNA 3VXMD 3VD9A 5G2NA 1MI5E 5HHME 3HG1E 4MB4A 4AYGA 2OTPA 4N0FB 1URIA 2BY1A 4HGKC 4HJUA 3KBFA 5JW3L 2EEAA 3EXLA 4XCEB 1OGTA 5JIDA 4FYRA 1QBML 4MRCA 3LPPA 1KXQE 2XZQL 4BUGA 4RX4D 1XXFC 1GZPB 2NR6C 3F00A 1J48A 3NN8B 2XXCB 4MB3A 1QEXA 4O58H 3GGWB 1S3KL 1ZPUA 4NLAA 5KYXA 5MEOA 4KVNL 4BD4A 4YN3A 3ZHFA 4HA1A 5KYYB 1TSHA 4JFSA 4ATTA 5E0QA 3BWUF 3MSPA 1S6NA 4OZFG 1T1ZA 2XN9A 4PJ7F 1EJOL 2I5YL 1SLWA 3ZT6A 5E4EB 3DUUB 5CFAA 3MLWH 3SQBB 2OULB 4JL1A 1U8CA 2OMZB 2MCG1 2FNWA 1KOAA 4YXKL 2WLYA 5FC9A 4A1RA 4Q6YA 2VXSH 1F6FB 2NYKA 3SBRA 1NKRA 1W91A 2NY2C 3CIAA 3AS3A 5AZEH 1TYJA 1LM8V 2VLRB 3N44B 4M5TA 4P0DA 4Y4KB 1A7PH 1EJOH 2I5YH 3VH8G 3QFJA 2EINB 1TETH 1CL7L 4XN4A 3FFCD 3T0EB 3C5JA 1FFOA 4X9IA 3JZYA 4LPTA 1R9FA 3LKQB 1XF1A 1G0XA 3H9YA 3T2NL 4KKAD 5CR8A 3OVUB 4HKZB 5F71A 3QDGB 4DETA 3TA4D 3BHBA 1CF8L 3B9DA 3DX2A 4XPTH 1TTCA 2VDRB 3NRFA 4H25A 1WWBX 3DXAB 4PJBA 3MKGA 3BD3A 1JHTA 4WHCA 4FKHA 3CJJA 3V0WL 4AYFB 5C0EA 1TU2A 1ODUA 4NQQA 4R4FH 1FSKB 4R96A 2OMYA 5E8OA 2GUOB 1EXGA 5C6TH 4CVZA 5FECB 5GGVH 5T1DL 4PJ5A 4M1DL 4N2IA 5C0CB 3KD4A 4GFXA 1Q38A 3DV4B 4K7FB 4RQQB 5EUKB 4L4VE 1P53A 4I77H 3CXHK 1R3JA 2CPUA 5F88A 1YEWA 2Z92A 1OO2A 4N2BA 4P05A 1JZJA 1XDTT 3O0RH 3P30H 4L3CB 1DDHA 5DLLA 4H88L 1CD0A 3MFGB 3ESUF 1A7OH 4GBXD 4P2QA 1IGYB 1AXIB 1VAHA 2BSEA 3N42B 4H0HB 2C7UB 3B8YA 5I1IL 4DP8X 2B4CH 1BIHA 1H3GA 1KCVL 5D7IA 1GCFA 4NPJA 3RL2B 1MJJA 3SYQA 1QA9A 4UDTA 1AE6L 4Z7AA 5AKVA 4M00A 3GXIA 3SJVD 5AVYB 4IU3A 1SMAA 2HN7B 4P59L 1QPXA 1EEYB 4MMXC 4AIZB 1UATA 1CI5A 3TWYA 2WB7A 3APMA 4AQOA 3MX0A 1ACCA 1K5NB 3ZKXC 4JRLA 5JOEA 2QQKH 1U2CA 3MTRA 4E41E 4DJMA 1OANA 3QULA 4JHWL 5SWZB 4M4RB 5F7AA 2CBMA 1ETZA 1AHWA 4M7JH 4ZMNA 4FRWA 3WTWA 4B5ZA 3MV9B 1QABA 4PG2A 2WAHA 3RU8H 3WAJA 2GVYA 4XWOC 4EDXB 3BAIA 4ZAKD 4LEXH 2Y9RT 5DA4A 5IB4B 1E4XL 1Q9OA 4UUJA 5GGTH 1H0DB 1BF2A 1EBAA 4UB0L 4ZQTA 4HYTB 1U2YA 2C8NA 3PGCA 5CP7A 1AMXA 1FIEA 3QARA 5GGVY 4Y2DD 4KKQA 4JLRA 4MRBA 5CEZH 1YDPA 2K6WA 4K8RH 1BYPA 2X7LA 4U7SA 3FB6B 4DP7X 5CSGA 3QHTC 1MWOA 4EI6B 3P3YA 5A6LA 1U58A 4YXHL 4P9MH 4L0ZA 2NLJB 1MEXL 3SDYH 4HU8A 4MA8L 4MNHA 3FMGH 4PB0H 5AG9A 4HJJH 2XPGB 2A6KA 3RPIA 4RFNC 4IEFA 3RVWC 5E6IC 4JG1L 4JFXA 2ZUXA 3ZZ1A 2Z3FA 3LSOB 4FLSA 5D2LF 4K94H 3TIEB 1ED3A 2CGYA 3FONA 4JJ5B 4LMQI 5F9OH 1Q72H 3L5WB 1FZOB 3QWOB 1KJVB 2H26A 3HN5A 4FNLH 3BAEH 4XOCA 1CE6B 5AOZA 4K3JH 2DICA 2A7BA 5IVZA 2FK9A 4Y1AB 4JFFA 2KC0A 2X4PB 3NCXA 3V79C 1W80A 3E3QC 3LIZH 3IDXL 2ADYA 2VWEE 3EO9L 3QXVA 4LCYA 1CICA 1LQSR 5D7SH 2GHWB 3MRFB 1XVSA 3LZRA 4N1EA 1RZKH 5D70H 2ZQKA 5D7IB 3S96B 4ES9A 2APTA 4ZX6A 1A7PL 5EU4A 3MRLA 3U0PA 5F1NB 3O3AA 1IBDA 5IV2B 1BOGB 3K0WA 4GAGH 4WGKA 4W9LC 3NFPA 4URKA 2YQBA 1ZHBA 4KDVA 3RFRA 5HYJE 3LKPA 3IWVA 3KJ4B 5FF6B 2HG0A 4PV8A 1SJVA 4PS3A 4YH6A 3CVCA 4F8OA 5DURB 3HS0A 4WI7A 2W60B 4K9EL 3Q1SL 1Q94B 2H1PL 3KGTA 2AK1H 1JL8A 1LP9A 1JZ5A 3EYVA 3DX4A 5AW5B 3FQ1A 3I6GA 1LO4L 2P43B 4AE1A 1A7NH 4U31A 1A64A 1XSOA 1RZ8B 3E6HB 3IF1B 3MCG1 2CDGA 4XHQA 2WQ8A 2EDXA 4HS8H 1AQMA 3GB7A 1WLHA 4A2HA 2OYKA 1YMMB 1YEDB 4MCMA 4NGHL 4BQ9A 2XZAH 5IQ7L 2QSTA 2OL3B 3DKHA 3VFRA 2R2BB 2BSRB 3D06A 3MLSL 4OF7A 5D93C 2TRHA 4Z7VF 1A7NL 5F7DB 4TLSA 1JPFB 3WFCL 1JZ2A 2NY7H 1O7SA 4H8PA 5EOCL 1I9JH 1PZ5A 4X4YB 4MB5A 3PV7A 3ZLQC 2H26B 2ICWA 2DJMA 3LPGA 5DT1L 3E2HC 3SPIA 3QJTB 2VN6A 1XX9C 1G7HB 4QHUB 5C08B 4NQEE 4MZ2A 2WNKA 3PDOA 3HI1B 3RGHA 4KV5F 4XN1A 3SPVB 3NCMA 3BSZL 2W9DH 2KZBA 1JXJA 3AC0A 5HJDA 1DVQA 2ZWZA 2WUCL 2WWKT 2G5BB 2CDFB 5HI4D 1HI6A 5T5NG 1OTTC 4FKEA 5HY9B 5IB2A 3P69A 3KH3A 4G7VL 1JZ7A 3H3BC 2ERJB 3E8VA 3GMNB 1AQHA 2FR4A 3WKNA 5FYJU 1BOGA 1YNKH 3WKMH 2Q76B 2VDQH 3PL6C 1E0OB 4JN1L 2AEWA 4PGEB 5EH1A 1M05A 4KHXH 1U3HD 2VDOB 4HIXH 1SEQH 2YARA 3JWOH 3M8OH 4FXKA 4P4KA 1RERA 1HH9A 2X1WL 2EXYD 2VABA 5C0JB 4O58L 1YJDC 4U6XA 1DVUA 1HL9A 4I88A 2G0LA 1MCNA 4Y4KD 4CBZA 1OB1A 4HHGA 3F7QA 1KEMH 2J6EL 4KUCF 3KLHD 4FLOA 1MN4A 1X5LA 3GRBA 1GYCA 5D9SB 4F3FA 1DTUA 5DEFB 1HU8A 1MIEH 1CL7I 3BO8A 5KS9E 2VW6A 1XCQB 4LSSL 1IGFH 1D7BA 1ORQA 3CMGA 3ZDYF 3OAYK 5I6MA 3HNVH 3LD8B 1GL4B 3RNQA 5SWSE 3DXAD 1RV6X 3PABB 4G7VH 3O9WB 2D31A 2MHAA 4NCC2 2Q7YB 4CGUB 4RAVB 5ID1B 3QUML 1SMOA 1T20B 4F8PA 1XXDC 4H7VA 4LVOC 5FYJE 1NUFA 5E2TL 1L9OA 2YK1H 1XHHA 3BGAA 2DMHA 3KPRA 4XBEL 1FPTL 1I7ZA 3C75A 4OZIE 5JW4M 3LV3B 4NRXB 2HT2C 4YL4A 3KXFA 1R3JB 4QGTA 1CE1H 3VFOA 4XPTL 3BZ4A 4WUUD 3UG5A 1BQHA 5DEZA 4QJ5B 1CLCA 3GSWA 3CFEB 1NOLA 4FFYH 1BZ7A 2LLLA 1WE5A 1Z3RA 3KPSE 1VERA 4OFDA 1EMTL 2ZCZA 5E1AA 4OZ4B 2BSDA 3CC5B 1YYCA 1F1DA 1U95B 1P5VB 4WDIB 3S0PA 1JK8B 3L9YA 2DQEL 1I7TA 1MZZA 2G3ZA 2IGFH 4N1CA 5I1DA 3BISA 5CCKL 1H6EA 1JXDA 3NPSC 3QO0B 2NTSP 1MLCA 2KLRA 3BP6B 4H25B 4M02A 1K8IB 4I0PC 2FECL 4OTXH 4NZ8A 5F89B 4DPBX 4YXKH 4JM2B 4XWGL 2F7IA 1MREL 4PREA 3CXDH 1CDUA 5TF0A 3KNBB 1HHIB 3DXAE 2YA1A 4R97B 5AVRB 2HTLD 3GSNL 2XN1A 2ZXCA 4YHKH 2DD8L 1RLWA 5B1CA 5AW8B 2CU9A 4ICXA 1JGIA 2V33A 3KPSB 4WWOA 3P3UA 3MGAA 3PQYB 5T3XL 2G4EA 3BDYH 2CJSA 3LNEA 3OLGA 1FC1A 4TUJA 3GSXB 5JIHA 4AVJA 4MMYA 4HCRH 3WHE1 4BFIB 3MLPA 3QIUC 1IAKA 4K23L 4Y4FA 3BH9A 1CF8H 5I6LA 5JORB 3WIHL 2BK8A 3QEQB 4PJHE 1FFTB 5FIEA 5GS3A 2QPUA 4BDVB 5JHDD 1NFKA 3SDXE 3E6FA 4FJZA 5LWYL 2F6AA 3CFJA 3IMUA 1JGUH 3QS2A 2Q87A 1EVTC 3CFNA 3V0WH 3VXMB 1O5PA 2M8XA 1S7RB 3AU1A 2VDMH 1PPIA 1U8IB 3BQUC 4X8GA 2XI9A 4PJIA 4H5SA 4M9PA 4R97C 2JJSA 3BFQG 3BSHA 3GT6A 4K23H 3U48A 2FGWL 5H8DA 4DTGH 5J3HD 1J8HD 1SY6L 1A47A 2Y1VA 4OLEA 5TE7L 4N0CD 2XVBA 1I1YA 3G08B 4OZGE 2VJ0A 1KLGB 1MJUH 3AQDA 1KIRB 2WO4A 3TOPA 4BXSV 3FU7B 5IZ7A 4GQRA 4Y88A 5C0AE 1KLUB 4YSRA 4ZMAT 2CDEA 2ZUVA 4B96A 3FAWA 4ZFOB 4PRHB 3VNZA 2WVTA 1BFOB 3FT9A 1AQDB 1XO8A 3P9LB 3RWIB 1N7MH 1U4EA 3B2DC 1W72B 1XV8A 1Q8MA 2PPCA 2XXFA 2AJYH 2OMXB 2VXQL 3DX7A 4C55A 4GUQA 3TN0A 1IKFH 2IDQA 3FQWA 1JYWA 1EXUA 3B5TA 3PWPE 1RKRA 2Z91B 3NJHA 4OLVH 1JNHA 1INDL 3LNGA 5CEZD 5DD6A 3GIVA 4DKFH 2GBVA 3TBCA 4PY7A 3WAKA 1YVLA 3QO1A 4MQXC 1ZGLA 1T04A 3LQAL 1ZHLB 4WW2B 4ABWA 4W81A 1LP9B 1Z9PA 1JD9A 2YLHA 3TVMA 4Y9FA 4IK6A 3FFCB 1P84K 1WWAX 2X4NA 5FM5O 1MDTA 3QISA 1FWXA 3K72B 3LSOA 4LLAA 4JKNA 3TIEA 2AFNA 2CUAA 3PQYD 5HGDB 3V8OA 3HZVA 3JVGA 4GAJH 5I16A 4AEHH 2GSIA 1WT5C 4XVSH 1BZQK 1HIML 2R1XA 3BH9B 3LPOA 3DI3B 1R5WB 4HISA 2ALWA 1CGSL 3EZJB 4JHVA 4Z7WA 3VI3A 4YSCA 5DR5H 3G6AA 1PKQA 2Z4QB 2EYRA 35C8H 3ULVL 1L5GB 4YHPB 32C2B 5GRXG 4LPXA 4PVMA 2J8UF 1JYVA 2CO4A 2IFFL 5DVNA 2DV6A 3PJSA 2V7NA 2V2XB 5E6IA 5BRQA 4JAMA 4X4YA 5C09B 1X44A 3RIAK 3BSZH 3IMBA 1D5XB 3MBXH 3S5LG 25C8H 4BIKA 4RSVA 4CC1A 2QJDA 2NNXA 2DWTA 3VU1A 2CKBH 2Z31D 4K7PX 4LF3A 5ID0A 1MY7A 3HOGA 4OGQC 3SDCB 1E4KC 4LCWB 4MD4A 4HC1H 1KGYE 5IROA 1MFDH 1WFTA 1CVRA 3D69B 3L48A 4AEIL 4PJDB 2CK2A 5C7ZA 3EJCA 4MAUL 4RIRA 3EYUL 4OKDA 1V3LA 5DJAA 4P46D 1NAMA 5I66B 4QXGH 4JPKH 4UT9H 1RZ8A 5TFSL 1OP5H 2FJFB 1CDJA 2ATAA 4UTCA 2YGPA 4DN4H 3IJSB 2VABB 5HHPA 3ZO9A 3I75A 2O6FA 2XXMB 4JRXD 4O51A 5DJ0A 3TBTB 3WNMA 5HDBB 2P80D 1PG7H 5CGMA 3KCWA 3SJVB 2EDNA 2X6MA 1H3VA 1Z9OA 2JCCF 3ARED 1N2RB 1XSJA 3QI9A 4UU9B 4EI5C 2BCMA 2AVGA 1BQKA 4ZRGA 2V5YA 4ENEC 3ASWA 3I84A 1ACZA 1G6RH 2QQLH 4JS7A 5D7SL 4GRWB 4NOFA 4QHKI 3I50H 4N2OA 4TSAL 4GKZA 3UC2A 2FZ3A 1EEZA 2Q8AH 3G7TA 4QRBA 3ZL2A 4IK7A 3QNZA 2ILLA 5AVZB 3T04D 4GPVA 3QQ3A 4WHYH 4PWHA 5E5MB 3AG1B 3S37L 4S1QH 5LQBH 2CBTA 2DLTA 2XOTA 5IBLD 4LEOB 4UV7L 1QFOA 5HD8D 1OSZB 1YSOA 3FCSB 5BNXD 1P6AB 4MNQA 5J9PA 3MUUA 5HHNB 3RL2A 1W72H 3REVB 1KELL 1VFUA 5G5DB 3PWVA 4JFOB 5IB5B 2CLZB 3MDJA 3L6FB 4GW4B 1DUZB 1HKLL 5J6HB 5EA0H 5SX4H 5H2BB 2AKRB 2X38A 3IGAA 4CMMA 1AO7B 2EIZB 1U91B 1E50A 3MLUH 1NPNA 2XY2A 4QHKJ 1AGCA 1IZJA 1JN6B 4GRMB 3MNZB 2VKWA 1OTUD 3V4PB 4BA8A 1U92A 1UOKA 8PAZA 2J5WA 2HYMA 3L1FA 3R06A 4OGAD 2IAMB 3O2VH 4NZTH 3V0EA 2NXYB 4TQHA 2XN9B 3D9AL 4TTGA 4OQ1A 5BV7L 1PAMA 4P3WA 4WWKA 3ZYZA 3O3AB 3ZTJH 1XZ0A 4WKXA 2ZUQC 5GS1C 4NX0A 5DK2B 1SY6A 2C4XA 1MRDH 3PQYE 3A5VA 1UD6A 3BKMH 1CZ8L 5HVFB 5I17B 1B9ZA 2R0ZL 3O4LD 4YHLL 4Z7OE 4H88H 4K9EC 1MCFA 2VQTA 4OGYL 2BVPA 2ZG2A 3EJRA 1OAUL 1H6UA 2DTSA 4N0FA 3IT8D 3ZKNC 3D85D 2MWCA 2E5EA 1KCVH 1ADWA 2A6DA 2BNQE 2LU4A 5ICXA 4TTDC 3CQQA 3LRKA 1JPGB 4D9RE 4QXVA 1T03L 2X4OB 4XNZB 4E42A 3QC5X 5J7CC 4YE4L 5TE7H 1BXAA 4FMFA 3BGFC 3BLBA 3IYLW 4PLJD 4LSVL 2YD6A 1KPVB 4IM8A 5E5RB 2X0VA 3CVHA 3EHBB 3GUTA 2Z35B 4LSPH 5LBVA 1CUOA 3GSQA 1QSFB 2J20A 4DGYH 1YEIH 2Y3AA 3GBNL 5ICUA 1ZSDA 1DQJB 4XMPL 5FLUA 2MCMA 2B5IB 3NACL 2V17H 4R8WH 3UZEA 4GUPA 4N3UA 4HUNB 4PRHE 5ACMA 4TNWF 4QAWA 2DJSA 1LD9A 3IRZA 1I9RH 4XXCC 3ZR6A 4NKQB 2Y5TB 3AAZA 3OR6B 1NCBL 5I73B 5DO2C 1HX0A 2VLJB 3O9WC 4MDJA 2EDRA 1MFEH 3N5AA 1XF3A 3IDNB 4ODSH 5TDPB 5KS9B 4TPRL 2VDQB 1MF2H 2FX7H 1IEBB 3EH3B 3NMEA 3T0EA 4NGHH 2WBJD 4LIQL 1DVFD 3MCLH 1DJHA 5DD6B 1GZQB 1I3GL 3I9GL 4IOFD 2X12A 4POZD 4HWNA 3TO4C 3F6JA 2O6CA 3L4UA 4KZEL 5I8CB 1EV2E 3ZYIA 1ECYA 2NUTA 2R56L 1CL7H 1UUNA 2E9WA 4CU7A 4AZ8A 3ET9F 1E4HA 1IT9L 7FABH 1MCQA 5J5EA 4I1PA 2X4SA 4YFEA 3TJPA 2WYTA 2J21A 2V9QA 5D1QC 3FQUB 4YWGL 3QIUA 2NUPA 4TUOB 1NPJA 5BW7A 1KIRA 2Z4QA 3PYCA 5CCKH 2FE0A 1S9KC 2K6YA 2VISA 2F9BT 5GRWA 1O6VA 5MEQA 1BMZA 3TL5A 2ZCLH 5JW4R 2WKOA 1SEBB 1R46A 4JFHD 1WBXA 2R1YB 1S8DA 4LGPB 1TEYA 4ZTOL 5JUEH 3MBWA 1U3ZA 2NNFA 4WKZA 4Q6KA 1JF5A 1SXNA 3IU3A 3ZDYB 1HNGA 3SGEH 3UJTL 4ABUA 3QUZC 2JCWA 2XA8H 3SDAA 3MJ9H 4HD5A 1KCSH 3NCCB 3HVNA 5J13C 2I27N 3UZQA 3FN0H 1F8TH 3FQTB 5CD3B 1K4DA 4KVCL 5ACLA 1E7UA 1KF9B 1KBBA 3SO3B 5D7LD 3TFKC 1X5IA 4RH4A 4IKKA 4OF3A 4HS8L 5B7EA 5KVEH 4YDMA 4YFDB 2PCYA 1N4XH 3M1BA 3CZUB 4XXCA 4DPAX 4K3EL 3CBRA 3W11D 5F2FA 5I30L 3VI4E 1UM4L 3VD4A 1S5IH 1CD1B 4QY8A 4ENED 5I71B 3FN0L 3V4VH 2XNAB 3APDA 4P46B 3WSQL 3IRCA 4C4UA 2NRDA 2YBRB 2E7BA 4P5TD 3VD7A 2R0LL 1YMHB 1ES0B 4CC0A 1F3RB 1BLIA 2FWLB 2PCFA 4I87A 3D6GA 3GZKA 5F3BB 4XMXA 3QRFM 1K3ZA 4BQCA 2NY1B 5DZ9A 4XR8C 1V10A 3GNML 3HHSA 1KIPB 4C8XA 1MQ8A 1VFBA 3QP3A 32C2A 1OAUH 4MJ5A 2ZCHL 4JO2L 3TJHD 3R7RA 4PV9A 2M83A 1LMKA 2QSCH 4JHWH 3GMOA 3PGCB 3ZE2B 3CSTA 3NZ8A 1DEEA 1IILE 3UYRL 4UM9B 4TVPL 1A22B 3V9CA 4L3EA 3QPQC 1IQDA 2ATKA 1X9QA 5DYFA 4HU2A 3NJJA 3VXNA 4F24A 3S4SA 3UPRA 5L8LB 1K6QH 2F54A 3L9RB 3L7EA 4Y89A 4NN5C 1IRAY 4GO6B 2MRYA 1JWUA 4RZCA 5KYUB 5ALBL 3GSXA 3ZYJA 5FYLH 4J39A 3Q9QA 4PR5B 5E2VL 1BBDH 4FFVC 4LEOA 1BLNA 4M43H 5DJAB 3FUIA 4YVNA 1V5JA 2WO2B 3OKKB 1F90H 4JMXA 1WD9A 5FYJD 4IRJD 2YD2A 2W88A 5AEAA 3KPLB 2XWDA 4KKBD 2BS8A 1XGUB 5I1DB 5CINL 2B77A 1WAAA 1A7RL 5ESAB 3WG7B 5E08H 2WXLA 1E4XH 3E9TA 2QGEA 2HFGH 3FYIB 1SHXA 2O5ZL 4LNVA 1DO6A 3SPJA 3MGTA 1AJ7L 1AO7A 2CJ3A 3GSNA 1MI5A 3C5SB 3VFGH 3ZR5A 1BPLB 1U8JB 2AK4E 1U8CB 2OMZA 2H6UA 4WW2C 2WXIA 5T8IA 3SKNA 3QDAA 3RZCC 3K81A 5FF6A 2R59A 5E1IA 1G0YR 3V2AR 1PJWA 4BFEA 1ZT7A 4N5UA 4XAKE 3V6OA 4E41D 1CFTA 2XICA 3J07A 2O72A 2BIMA 3X11A 3T0XA 2DQ6A 1A9VA 1ZRUA 4UAOC 4Z9KB 2AJXL 3SE3A 4BFIA 1X9RA 5L88H 3WTTA 1NAML 1UC6A 1A7BA 3MYJB 5CLZA 3KYKH 5FYJL 1TZGH 4QO1A 1YEHH 4JKKA 4TTDD 5CWSA 4JGUA 3T0WA 2YD3A 5HP5A 4UMSA 5DLML 1NDTA 5A16B 1OSPH 4RRPA 5BUAA 1UVQB 5EWIH 2CLRB 2IWFA 1OW0A 3N9GL 4PJ8B 2AK1L 2DMGA 2B59B 4GRLD 4HJEA 3TV8A 2WUBL 1F4YL 3Q3GA 4GJTB 3FZUD 5IHZA 5DHYB 3GYRA 3D0VB 1HNFA 1O5DT 3L7FB 5D9SA 4F3FB 1G1CA 2HJLB 3L2NA 4ONFL 3TEXA 4PCSA 3CFMA 1DBJH 3QDMD 2FHBA 5D96B 2DWEB 1KFAL 2RTTA 4S2SB 5AD0B 3OG4B 3US0A 4XT1C 2SODB 5C0CA 3WBDA 2MQ0A 3G6DH 1T1YB 4LMQE 4V33A 1ADQL 3E1ZA 3HZMB 3O9WD 2LQRA 4PGCB 2J57A 4RFEA 5ABDE 1T21B 3QIWA 3IFPA 1WCBA 1IBZA 4YHPA 1TCMA 2G3NA 1NWOA 3AJ7A 3LOWA 4I9XA 3ARFB 5EFIB 3QAZC 3ASOB 4I2XA 4IS6A 4JJHA 4YDIL 3APNA 3N1QC 3ZKXB 3CU1A 2VWEC 2X3BA 3KR3H 4OCSH 2IXQB 3W82A 4GEJA 5FO8B 5T1LA 1KYDA 2K4WA 1MUJA 1WEJL 2OZ4H 1D6EA 3K2UH 5AW0B 4LRIC 2A83A 2VDKB 4V1DA 4WW2A 3T0DA 1F1GA 4OD1L 3SDCA 2GJ6B 3WUWG 1ZTXE 4ADJA 1XMEB 4PJ5E 2MNJB 5EU3B 2HFFA 1JZIA 3BIAX 4MJHA 3GTTA 1FRGH 5CZVH 3STLB 5HYQB 3FL7A 3VXUA 4JZOB 5BVPH 4N8VG 2PW1B 4P5RA 3DSFH 5JTWA 5I1LA 3RIFK 1BF8A 1AANA 1MCOH 3TYFA 4OUUB 3O6FB 2J72A 1J88A 2B1AH 1U8KB 3ESPA 3BUDA 4PI2A 1FBIH 4PAZA 4XGZB 1CI3M 1NCWH 5AQ0A 2JNZA 4ZW8A 5FGRA 1JNNH 1FORL 1ZVNA 1RZJC 4QRPE 3VD0A 4KJPD 2FD6H 4WI4A 1F2XK 5K1NA 3VRLE 1WIUA 2JELL 2V2XA 1Y0LA 1DSWA 2N0MA 4BSVB 3B7UX 2VDMB 2VE6A 4ZSOA 1Q4NX 3TNMA 3UFIA 3HBPA 1FFNA 5B1JC 3AG4B 3PHQA 4HKXA 2IDTA 4L4TA 3UAJC 2IDSA 3PPSA 1S7UA 2QSQA 4OCNC 4DCQA 3P1VA 4FQXB 5BQ7B 2BY3A 2MOVA