3GLEA

Crystal structure of the major pilin from streptococcus pyogenes n168a mutant
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
283
structure length
283
Chain Sequence
TVVNGAKLTVTKNLDLVNSNALIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAEFDFSEVTFEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGSKVPIQFKASLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQTEASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKNIAGNSTEQETSTDKDMTITFTNKKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pilin
publication title Intramolecular isopeptide bonds give thermodynamic and proteolytic stability to the major pilin protein of Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Structural protein
total genus 70
structure length 283
sequence length 283
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 3gleA02
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gleA01
2XICA 1D2PA 3GLEA 3B2MA 2X9ZA 2XIDA 2Y1VA 2XTLA 3KLQA 3RPKA 1D2OA 2X9WA 2X9YA 4BUGA 3GLDA 2X9XA
chains in the Genus database with same CATH superfamily
3BT2H 3ZT6A 3TP4A 1SXAA 3ATAA 4YHNA 3GLEA 2DYPA 5ESQB 4A68A 4GH7B 3ILQD 1ONQA 3FQ4A 3MRDB 3V0VB 2H6UA 3O3DA 5E2UH 1OW0A 3DX0A 3A4DA 2HVBA 5E1AA 2PP9A 2MQ0A 3MRIB 2FEEL 2IQ9H 2YBRA 1GYCA 5T1KB 3I6SA 5IESH 1BJ8A 4ACTA 3VFGL 1S3KH 2B4CC 1EAPA 4PSRA 3BO8B 1HNYA 2FJUB 4G42A 1HXMB 1OVZA 1RIVL 2Z1KA 1QO3A 4GSDL 3D25A 5D1QA 3IJHB 2Z31C 1TENA 5IK3A 4JN1L 4IDJL 5CBEB 2W80C 2XVKA 3NN8A 1U93A 4P4RB 3ZJAA 4UQBA 2F74B 5HGHA 3ESPA 1UCBL 2ZOLB 4MJ6A 1KYAA 4WSGA 1T5WB 3CVHL 4F9LC 3L5XL 1GGCH 2B2XL 1V27A 2VL4A 4P3CL 3ECBA 4JGJA 3WIFA 3FB8A 5JIHA 4X0NA 3UMTA 5HJDA 4QRPB 3ZMNA 4QHKI 3OD3A 1BFTA 2QPDB 3RGVB 4JKMA 1BLNA 1SFDA 1X5HA 5F6IB 5D9SA 1E9QA 4GO6B 3WJMB 2JB6B 3IFLL 3QVAA 4ZMWA 1TVDA 4LAQH 5AZ2L 5CO1A 1B0GB 2CIIA 4M8QA 3PJSB 4WSKA 3OKDA 2G3MA 2WXRA 1KIRA 1XR8B 3BVNB 3T6VA 4D94A 1MHEA 4JKPH 5T8IA 3GS7A 3V4LA 5CZXD 1QFWI 1UACH 5IV2B 3SOBL 1R33A 4YLQT 4MJ4A 3MXWL 4TTDC 4ZX3A 4QUOA 4P46B 4I5BA 3ARXA 4OLUL 1QTYT 1GSMA 1KY7A 4XGZB 5DSCB 4FS0A 3X1BA 4G6ML 3U2IA 1F58H 3RGVC 3NN8B 4FA8A 1ADQH 5F6IC 4PG2A 1MFVA 2YD4A 1CXHA 1MCJA 2Y2TA 1TFPA 4C83A 3QGVA 4JFHD 4KXDA 3WO3B 4KKBD 5AOMA 3S9DB 2AC0A 3ECBB 3DJSA 4IS6B 5EC2A 2P5WD 1AKJD 1BZQK 3RPBA 4PRDB 3UTSE 4UMGA 1BLNB 1LO4L 2RGSA 2WLHA 1QZ1A 4L4JA 1JNHB 1DZBA 1VZIA 1TZHA 1X3DA 2C34A 4GMTL 5DC0A 4GUOA 3AQYA 4OAWB 2I25N 2N56A 2RJMA 5JYLA 2K9UA 1NMBL 2ZIDA 5CJXC 1LNUB 4U1SB 2DKUA 2BOLA 4KVNL 2JV6A 2HG5A 1UD4A 3BKMH 3TS8A 4ZI8A 5IQ7H 1IKOP 1XSOA 4XZUA 5B1AB 5DURD 5AQ0A 3ZRFC 4HXAH 4W4NA 3KPSE 3RVXC 4RGNE 3D8MA 2UZPA 2F5AH 4N1HB 5CR8A 4D9LL 3KNBB 4J6RH 4C83B 4KNSA 1IGCL 2GHZA 5AOZA 1FFPB 2HUEA 3DHJA 1K2DA 1UFGA 4PB9L 3VSQA 2YAFA 3IXAB 1U3ZA 2ITCB 3H9SD 1FFTB 3BSHA 2J1ZA 1E5CA 3QNYA 5F1NA 2H6PA 2JJSC 1DTUA 4JFZH 1Q9LB 4NHUA 4M7LL 5GGRB 1YRKA 3BGMB 5C0AE 1TZHB 1DQTA 1NGPL 4PJIB 5DQ9A 4QF1B 1MW0A 4HS6B 5GRVL 5KBKA 3VXNA 2B5IB 3STLA 1VHPA 4WW1B 3MRCA 4YLBA 5I1EL 2AAAA 4XP1L 5C0EB 1JJUA 4QPEA 4DETA 1NLBH 4BM7A 1NIEA 4W9JC 3JTSA 12E8H 1KN2H 1TQSA 5K39A 4DN4L 3WD5L 4AMKL 4NWTH 4AIEA 4DK3A 4YHYB 2XN1A 3ILQC 2Q8AL 3IDYB 3MOBH 5IW3A 5GJSL 4M43H 3MJ9A 1HZKA 4GO8A 2M2DA 2R0KL 1OM9A 1B4LA 3SBWC 2B1HH 3RL2A 5EA0H 4HS3A 4OCMC 1C5CH 4QCIA 3HG2A 1JPFA 1CL7H 1XGUB 2B5IC 4AZ8A 4LSUL 1W9XA 3KH3A 5FW7A 1A65A 3S34H 4HG4J 3LKQB 3DUSB 3F7RA 3DJ9A 3CJJA 1A6WH 1K8DA 3QJFA 1CU4H 4KQ4H 2P52A 3IDYC 2K8QA 3PXHA 3FONB 5C08E 2YK1L 3MOAH 3SGEI 1MHPH 4J4PC 2BIOA 1ZT4B 4BCZA 1HILA 4XRCB 3WIHL 4JHUA 1BA9A 2F58H 3SDXE 1UWGL 4H4NA 4NBYB 2WINB 5GISL 4OCYL 1MFUA 4JDVB 1UUNA 2WNGA 4OCXH 4JANB 3AUVA 3DVIA 2VLJE 5E23A 3FQUB 2XWJA 3ZKSD 1HQRB 4R8WH 4P5TD 3HZ3A 4LBEA 2P5WB 3VXRA 3WE6A 1AKJB 1P4LB 2VGLM 4HKXA 2K4AA 2VE6A 3H9SA 5CZXC 1D5MB 2AEQH 4K23L 3AROA 4KTDL 3RL2B 4HS3B 4CMHB 4PJ5D 2VSCA 4JO3L 2DLIA 3HBQA 4OZIE 5E99L 2IJ0C 4L4TE 4OZHE 4XXDA 3VXME 1UWEH 1WFIA 3NK3A 4UQAA 5CJOH 5F0PB 3TLRA 4XVTL 1EJFA 3Q9QA 3TBWB 3ZKQD 5A16A 1DFBL 1CE1L 2GVYA 5HJ3B 3VSUA 4DCQA 1I8MB 1ACZA 4NKIL 3QJFB 3REWA 1BD2E 1IEBB 3WEOA 2IALA 3VMNA 4KKBC 2OZNA 4BZ2H 3FQXB 2W65A 2Y7QA 4BZ1L 4UT7L 5DURB 3L2MA 5SWQA 3L3KB 5TFSL 4GXFA 3RX8A 1YNLH 5MEOA 1YEFH 3PIQB 1F4XH 3DDGA 2VTFA 3UAEA 3ARBA 4JO4L 1Q9WA 3ILPB 4O9HH 1DVZA 2YXVA 2D03L 4YE4L 3OXSB 1P84J 5AEAA 3JXAA 2SEBB 3I9AA 4I8DA 4C57C 2XWJB 3P54A 2CGRL 2UXGA 4MNGB 4KKLC 5L9DH 5I6KA 1YG9A 3WE6B 2FBOJ 3DHPA 3RB7A 3LS4H 1MCSA 3H9SB 5L88H 2UWEA 4H8WC 1DBAL 3N2JA 1H6EA 4KZDH 5B22A 2X70A 3AM8C 3PXJA 4N5ED 3PAZA 1A9EB 2XWDA 5JYMA 1JWSA 3IU3A 3O2DL 1J8RA 2OCCB 4YJZL 1THCA 1IAIM 1OOWA 3QDJD 3H2QA 2NQCA 5CIPA 4PJHB 1TETL 2Z1PA 4MSWB 4NQVB 4A6YH 1FN4B 1I1CA 5I5JA 4OZ4B 4ZO6A 1A5FH 2VLME 2LABA 5F6HJ 5F3BB 5BOZG 1QFWH 3LH2H 4KH2A 1F90L 4N8CH 5DT1L 2XN9D 3D3VD 5SWQB 3UDWC 4CKQA 2H32B 3ZTJH 1GJWA 1HCZA 2L8AA 2VLKE 2FIKB 5KN5A 1LE5A 1IV8A 4IGBD 2X7LB 3QUKA 2DY2A 1HIML 5I18L 1BF2A 1Q9WB 1NOLA 2X5PA 2EIEA 3SDXF 1CK0H 1DZ0A 1VEOA 2LLNA 3E2HC 4A55A 4MLSA 5DR5L 3NQIA 3IK2A 2A38A 4WRLA 4QOKE 4G5ZL 1DQLL 4KV5E 2P8MB 4O2CB 4M9PA 3IWVA 1WAAA 3QR1A 5D5MA 1F86A 1IIKA 4EIZC 1LO0H 4GSXA 4XPTL 1LQSR 1A4CA 1BM7A 4OZIF 1JWSB 5FUOL 4OZHF 3SQOH 2YPKB 2QVIA 3GMPB 5F1IB 2BMKA 4XVJH 2H1PH 3C5JB 3HI6L 4NN5B 3BJ91 5IQNA 3ROLB 1AGFB 1I31A 1RZQA 1S5HA 4O51A 2XI9A 1T1ZA 1DEEB 5BQDA 3KLDA 1EGJA 4DVBA 2Q7NA 3DOHA 5GJTH 2B4CL 3V0IA 3W9DA 1AD9A 3QZWB 4R90L 3C8DA 4MYPA 1PVHA 4RX4A 4P5TB 4LSVL 4N9GB 1MF2L 1Z3GH 5I8OL 5CCHE 2LR4A 1G7LB 3HLAA 3T3ME 4PJ5B 1HHKA 2FTAA 4L1DA 4NZUL 1T2QH 4KJWD 1M1XA 2OL3L 4MQXD 3M7OA 1HTYA 3QP3A 1WIPA 2A6DA 2DZEA 1UB6B 7PAZA 1ZY9A 2BRRH 4F2FA 5LN4A 4HBCH 3D09A 2FQFA 3M1CA 3BE1L 1EAQA 1IL1A 3RKPA 5LXGL 4WFED 1A8JH 3L3OA 3HZYB 3L4CA 2CQVA 2X4QA 3PGCB 4ZW5A 2P24A 4AM0Q 2B0SH 4UANA 1QPPA 2FX7L 2I9TA 4X8GA 3T8MA 1C7TA 2WJ7A 1VPOL 1YUHA 4NUJA 4H2CA 2Q86A 2NXZC 3IETB 4L8BB 3BPOB 1X9RA 1RU9L 2IFFH 5CEYA 1CIDA 3X14B 4X5RA 2X9ZA 4OLEA 4XMKL 2XNAA 3GMNA 1Y07A 3LPFA 5JA9A 2WW8A 1MDTA 4DP4X 1ZV9A 3K6OA 1BW8A 3UABA 2HMID 5EZIH 3LEYL 1M1XB 1WBZA 4YLCA 1A1NA 2A6DB 5ESVA 3BFWA 2ZCLL 2GJ6E 2PPEA 3QDJB 3ZO0A 3GKWH 3CHSA 3CVIL 4KV5F 1E6OL 5SWSE 3FT3B 5B1JC 1R46A 1T4KB 3PABB 3QQ3A 3FB5B 5AZEL 2ESVA 1UURA 2M1KA 2YWYA 4OKDA 3H56A 4XNXH 4YNYA 4JG0H 4ZX5A 1FHGA 2WM0A 2XN9B 3D3VB 3P30L 2B1OA 1I9RH 1EIBA 5DU7A 4Q2ZB 1C12B 4XR8C 1K3IA 3SGEH 4IGBB 2CUHA 5HTSA 1AR1C 2AQNA 5CU5A 5JIIA 4OSUH 4NUJB 2Q86B 4UT6H 3WHXA 4PGCA 1PG7L 3WKNA 1AFVH 3VFPB 4Y5VC 2JJVA 3RFRA 5EU6E 3ZTDC 2ZKHL 1YEIL 3UROR 4A63A 2WIIA 4N2FA 2WKOF 4OZFH 3MCLL 5ACMA 4NZDA 3MNZA 2XYBA 2UUDK 3PWNB 1ES0B 3T3MF 2FLRT 4PCSA 3V7AE 4ORGB 2K8MA 3GNMH 3NZHL 4ZUUB 1S78D 3ISRA 1NJ9A 1BSIA 1D5RA 4M62H 3V9FA 4JPVL 3ZSSA 4FQ1H 2FYYA 2JF1A 3AAZA 3V4PH 1A7PH 2L04A 1CZ8L 4N0UE 4XNMB 1K5NB 3QUXA 2C1PB 4U6HA 5EUOE 3RAJH 1XB6A 1YPZE 4LLUA 5DO2C 4FP8L 4PWHA 2WAQA 1HSAA 1XDTT 2WQSA 3DOIA 4PY8I 3K1DA 1UB5A 4BE5A 3V0AC 2Z35B 5EU3B 3GBLA 4JHZA 5DI8A 4WWKD 1UUSA 5C09E 3IFNL 3UACA 4FQIH 3U9UA 2WIIB 5GGUB 4UOW0 1JD7A 4E0RB 1PX8A 1W2KT 3I75B 2M83A 3AC0A 1CDYA 4QHUB 1TJIL 4A7GF 2XT1B 5C0GA 3QDME 1FZJA 5JTWA 4PBWD 3HAEA 4G72B 3G6AA 5SX4H 3EH4B 1E67A 2IDCA 5JW3H 2WN3A 2ZP0T 3Q8EA 1UD5A 4UAHA 2E7LC 2K3TA 4XP6L 4EDXA 4HUUB 5DRZA 1LO5B 3H55A 4ZYKB 3RUGB 2R56H 4J3BA 4XWOD 1AXSB 1I8LC 1V7ML 4W93A 1ROWA 5D2LA 1WZKA 3FSOA 2ADFL 3QRLA 4HFUH 1ZHNA 2EEAA 1A1MB 4KRPD 6FABH 1WVZA 3SDAD 3VXPA 1KYOK 3ASNB 4P2QE 1XB3A 2GIMA 1T7ZA 1U41A 3WY1A 5EEZA 1WISA 5C0CA 2Y0SA 2UV3A 35C8H 4WCYH 1NCOA 2PW1A 4JFVA 3LXBA 2YIHA 4X7CC 4XAKE 2JE8A 4OLWH 1AP2B 1U8IB 4LRIC 1EFXD 4DK6A 4UINH 4Z7VA 2V5RA 4GG8A 5TDNA 3C09C 4P2RE 1U8CB 2XDHA 1NCBL 1JNJA 1ZK9A 1OZUA 4M6OH 1RJLB 4A7TA 4G6FD 2I07A 3NIFB 4UDUA 2CDFB 4EUPB 4BGLA 3MUHL 3CSBA 1RQ5A 3CUPA 2EDMA 2J12B 1A6VL 5DJ2A 1FYTA 3HNVH 3P69A 1NL0H 2WQ8A 5AAWC 1S9VB 2FSDA 4M7JL 4KGLA 2BNRD 2A6KB 1NBVH 3CMGA 2EE3A 3JBG7 5EUOF 2V2TB 3IAPA 4NO5B 2NNCA 5I71B 3KZ8A 1YPZF 5F7UA 1OAYL 4HU8A 1A6AB 1RULL 2Q8BH 3HZMB 1AYOA 2AK1L 1I1AC 1XVSA 2JMRA 2YC1A 1AY1H 1MEXH 2P5EE 5D1XD 3S4SG 4KUZL 4ZMXA 2VDMB 4RMBA 4F9PC 1NANH 1ASQA 2EDQA 2IG2H 2VISA 2YAMA 4ZSOB 1TLMA 4EI5A 1Z66A 3T09A 4DT2A 4WU7B 4JZJB 1JXKA 4FCHA 2V2XA 4H8WL 3V5HB 4S1QL 2F1AA 3HB3D 5DUJA 4JHVA 4ZUTA 32C2B 3TYGL 5I71C 3FMGL 4GW5B 1I8IB 1XH2A 3DX6A 5DJ2B 5J5EA 4J3OF 4LPYA 4MVBC 1BIHA 4UTBL 2PTVA 4PGZA 4YUEH 1SVZA 1TVHA 2J43A 1ZLDA 2WLJA 4RRPG 1KELH 4CDGC 3HG1E 2VABA 3BXNB 3IFPA 4HKJB 1RUPH 4WWKB 2KZBA 2XZAH 1S78C 3CAFA 4KI5E 1I75A 3B7SA 3GM8A 1JG9A 5ANME 1IBGL 3UYOD 4JZJC 4M4RB 2QHRL 1L7IH 4IYKA 3NA4A 5EEYA 3QNXB 1V55B 3MGOB 4ZXBC 3RWDA 4Z8FL 1QR1A 1RLWA 4XCNB 2J88H 4CNIA 3PQYA 3MLRL 3HS0A 1G5GA 2DYSB 3QRBA 2IBZX 2BXYA 4GUPB 4C8XA 2JLPA 5I8CA 1MCHA 3DVGB 3WXWH 4X99B 4LKXB 2DWTA 4LLAA 4PHZA 1VADA 2E8ZA 3BN3B 3LHPL 4KKCC 4JQVC 3TBTA 4WWKC 5EHFA 3ORJA 2WQUA 1BFVH 5AKTA 4C4UA 4IU3A 2J6EL 2FWOB 4QRUB 3DTXA 4OCWL 1MPAL 5F88B 2HJLB 1JOIA 5E5RB 1JPEA 4Z7WA 1HQ4B 1MSPA 1TVHB 5E9DD 4KRPB 4BWUA 4ENED 3SDAB 1W8EA 4YSRA 4HJJH 3IGAA 3ML9A 1N5YH 3GUTA 4WI6A 3VFSA 5D1XA 1KB9K 1Q9OB 1R24A 4IOSA 3SPGA 4LSTH 1KPUA 3NIDB 5LB1A 3WDHA 1EFXB 4GS7B 3O2WL 1AHWA 2WAHA 2WCGA 3VU2A 2V7NA 2FAUA 1A6UH 1E4WH 3TYFB 4CNIB 4L3EA 2AITA 3G7TA 1IAOB 4XWOC 4G6FB 1SEBA 5B21A 1MCNA 4PLNC 4EDWH 4CADA 5I1CL 2HVKB 1XR9A 2XX0A 5JMOC 2J8UB 4UAOB 4KRPC 5IW1A 3SDAC 2E3VA 1DJGA 5TDOB 5CLTA 3N40P 3ATBA 2CBPA 2BNRB 4H1LG 5GPRA 2L0DA 5L4IA 5I6LA 1M9WA 3DTXB 2WYIA 3VWJA 1YN6A 5MERA 1AI1L 5JOEA 4X8XA 3DVNB 5E8PA 2R0LH 4Z7WB 1IM9D 1SOKA 1TU2A 2DTMH 4LHJB 1LE9A 2NUTB 1QQDB 4AW4A 4F24A 2KC0A 2ED8A 5D1XB 4TM9A 1R24B 1D9KD 3NG5A 5HD8D 3BGAA 2HG0A 4ODXA 1GH7A 3GIZL 1AHWB 5HYSB 1H15A 2O5NA 4MMXA 2A9NL 2EABA 5EBMB 2B1AH 1T1YB 1G7PA 3HG3A 3B2DC 1QSFA 3HB3B 5I15H 2EDBA 3N1MC 2VQ1A 4PMFA 3VFNA 1K3ZA 5GZND 2EJ1A 2BJMH 1JZ4A 2DKSA 5E4AA 2BZCA 4G6KL 4A2GA 1Q8MA 5JHDE 1DJXA 4QT5A 3LN9A 3C6EA 3QG7H 4OM1L 3ZL4L 3GJFA 2CA3A 3QUZD 2BSBA 1MIML 1OQXA 3FCGA 3BKCL 2ZAHA 4IW4C 3T3PE 1PTZA 3FUJA 4TOYL 2H0JA 1BEYL 3RVTD 2XKNA 3I2CL 2VAAB 5FOJA 5JIMA 4GLRI 3HB3C 4LSQL 4NSKB 4TNFA 4XODA 2Q2EB 3MV7D 3S36X 3FU8A 3QUHA 1ILUA 3HMWH 1M56B 1M71A 1O7SA 3EFDH 4H8PA 1Q94B 3O3BA 1NCAL 3K6SB 1KPRB 5H94A 2F8IA 4I9WD 4JBSA 4B9GA 2EDWA 3S96B 2FHFA 5MEPA 2GEEA 5JR1L 3V5KB 4L23A 1IE5A 1G7PB 2GC7C 2OR8A 3O11B 3X12B 2OJZL 3H0TA 4Z5RA 2VQ1B 4FFZH 4OF3A 4YDVB 5E8DL 5FFOA 5IB1B 1H3PH 3H7LA 3VFVA 1YMHA 3T4AB 1AIFA 4IRSC 5KEZA 1LK2B 4QT5B 5E9DB 1Q72H 2C1OB 5AVYB 2NY7L 3INUL 1JF1B 5L6YL 2XVGA 2W81C 4UQ9A 3MYJA 3OSKA 4XAWL 3ASOB 4X5WB 3D50A 4MHHG 3B2UD 3L7EB 5JNYA 2X0VA 3IE9A 5DTFA 3VQ1C 1AHKA 3ERXA 3H85A 3C60C 1KXTB 1PIGA 1KC5H 2EDLA 1R1CA 2ZXCA 4JHWH 5FYJU 1R34A 4KROC 4AE0A 4O02B 2B9BA 2ZONA 4JFFE 4PRHD 1FZOB 4ADGA 3O3BB 4GQ9H 1YYMH 4G8FB 1TVBB 2VZSA 5H94B 4YPGA 3T4AC 1G1KA 1GZQB 3HC4L 3QJXA 1GKEA 2ERJB 3HJEA 4ENEC 4LQ1A 3WTXA 4TRPH 3D4CA 3A3YB 4PCYA 2DOCA 3BEVB 5C9JB 3L5JA 4JR9L 4OJAA 3E3QE 2HT4D 3UPCA 1NFDE 3TCTA 1ZDQA 3CDZA 3MNWB 1XF3A 5B3JE 2QQNH 4XC1L 1BVOA 3O8XD 1IM9B 3MXVL 1ZTXH 2OMNA 4O5LH 4OCRL 2WGXA 3BZEB 4I13B 1KBPA 2ZOKB 4ODVH 4JGNA 1JF5A 1CR9H 5BRZA 4GEJA 4TTGA 1FZMB 1XD0A 2BH0A 3CVHA 3L3IA 1D9KB 4KRMB 2HZHA 4U1IB 1JTOA 3Q6FA 4WK2B 3N41B 3T3PF 3O2VH 2B3IA 2J71A 4X4XA 4HWZB 3Q8BA 4NNPL 4HPOH 1YMME 4K7PX 4RMVA 1P1VA 3KWVA 1DDTA 3A6BH 2D9QB 5FA4A 5IUSA 4LSRL 1CLVA 2E27H 4DP0X 4LKCA 4JPWL 4X9BA 4MCZB 4YPGB 4J3OH 2R15A 8CGTA 3A6CL 2CLRB 5F3HB 3JWOC 4NQCD 4OQ1A 3DX7B 3FPXA 1FFNA 4OM0H 5ID1B 3QUZB 4NUGL 3F58L 4JN2B 1RZ8A 1TXKA 3I9PA 3VX0A 3VB9A 5ID0B 1Q90A 1F13A 2XZQH 2X4UA 4GW1A 5EO0B 2DQTL 4W9HC 4XBMA 3WLBB 1TYRA 3MV7B 3QIWA 3ME0B 4FNLL 1FL3A 3EJJX 3KYKH 5GZNC 1KACB 1G9NC 3ABZA 2ICEA 2FH6A 4TUOB 4UOJA 1FAIH 1IFHH 4DO6A 4F7MA 4ZFGH 3MJ6A 5IVZB 1RK1A 2H2PC 5IMOA 2ZX8A 4DEPC 4PYGA 4Q7DA 3B1UA 3QUZC 2BRQA 5FA4B 3S5ZA 1EBAA 1DCLA 2IDTA 2JIXD 5DRNB 3X13B 3AS2A 3RVTC 1NPJA 2F9BT 1AQHA 5CLWA 1JRHL 4HDIA 4G70B 3RVWD 4Z7UA 4C58B 1SJHB 5D1ZI 1HNFA 1O75A 5D2NA 1D7BA 4R4FL 2O61B 4FX5A 4LVEA 3FUEA 1E30A 2IF7A 1NFDF 4OUUA 1RSFA 3VGBA 3ZE0E 3GSVA 4ZDHB 5B3JF 5DEGB 4MHHI 4HETA 1AZVA 2IOMA 4KHTL 4MAUL 4MNHB 3ULVE 3QUMB 5H2BB 4QRRA 1SYSA 4FNSA 1FL3B 1CICC 3WFHB 1S8DB 1AO7E 2DKMA 4L8CB 3R0NA 3HTLX 4PRHB 2PYEE 3QNZB 4JM2F 2NY2C 4RGOH 1RK1B 1KIQA 1NCWL 1SQ2N 3AZUA 4OJFL 3TBYB 5HYIA 2EC9U 3H8NA 1VSCA 4WU5A 4F1SA 2J21A 3DNKA 4LASH 1S9WB 1P9MA 3LD8B 1J1PH 3L4YA 4NQCA 3UTZB 1WS8A 3B2UC 4YHZL 4HEPG 2H8PA 3LVTA 3AGVA 3U0TA 4FFTA 1ZRUA 4J3XA 4GFXA 4WGKA 5I1LA 5IHZB 5DFWH 1E65A 3O8XB 4MS8C 3KYMA 1R3IH 2GSIA 2YEZB 3WE1A 2XA8H 5A2KH 5D2NB 5GGSY 2F61A 4B6ZA 3KYOA 1A9BA 3ROOA 3BVDB 2H5UA 4TSBH 4X4KA 5HI3C 2I85A 5LAXA 3V4VH 4UQ2B 2FO4A 3TZVD 1AZZC 4JO1L 4BDVB 3LD8C 3GSOB 3FO0H 4OGAD 3V0EA 5DMKB 5CJBA 5D70L 5BZDA 1OP3H 2XOTA 3U0WH 3ZK0A 2HT4C 2QTVA 3C75A 1HEZA 5EEUA 1IC7H 4FJ6A 3HMXL 3MR9A 1I7TB 3Q2CA 1H0DA 1SJEB 4OQTA 4PIRF 3O8XC 1KIQB 4RFOL 1ZA3B 5AVWB 1WGVA 1NCDH 3UTTA 1U2CA 3BCFA 4NQCB 2JCCB 3SPCA 3WFEH 4JFEE 2V5YA 2VITA 2FATH 3MLTB 1N67A 2AAVA 2AJ3B 4FF9A 5HYJD 2H9GA 4C4KT 1DBKH 4YHIA 2FSEB 5E6UB 4KI1A 3H42L 2X0UA 1T5XB 1ROCA 2VO8A 1ZAGA 2ZKXA 3BVXA 3IEAA 4XMLL 3FUHA 1YEHH 3WELA 5IBUB 3KYOB 1A9BB 3MRHB 5I74B 4A37A 2DH3A 1K6QL 4Y5YA 3CSYB 3QIBA 3CQPA 5IG7B 2X1WL 1GXEA 5HDBE 3ULVF 3O45B 4X7TA 1SYVA 3MR9B 3LNEA 3N44B 5K9JL 2JIXB 3RKDD 3QCUH 5K69A 1T22A 3K0WA 4JHBA 4N6QA 2BSCA 3IJEB 4X6DA 1WEJH 3WUWA 4BD4A 1JVLA 2QHLA 3GB7B 3RZWA 2X41A 4NCC1 4WEBL 5AVVB 4HPHA 1N26A 3L13A 5EO9B 4YDKL 5DJDA 1PY9A 1IQDB 4PWKA 1SMAA 1RZKC 4BZ1A 3Q48A 4CW1B 5IZ7A 1ZVYA 2ADYA 2FT8A 1ZANH 3BP6A 4X6FA 4YR6A 5E08H 2ZYHA 3OLEA 5JW4R 2GTZA 2VN3A 2HFEB 3HG5A 1R3JA 4LMQE 4NT6A 1IQWL 2OMZA 2QSCL 4HUVA 1MFCH 4I2XB 4OGQC 4OLZL 4Y1AA 2K45A 3EDKA 1B3IA 4UM8B 4Y5YB 2ZOTA 3RVWC 5IEHB 4UILH 2X4PA 3D39A 1GS6X 1W0WA 2EO1A 5E2WL 4OJDH 2HKFH 2I27N 4I7ZC 4P2OD 4R4NC 1I3GL 1UEYA 1ZLSH 3FHAA 3NCFB 3QXVA 4X5XB 1RVFH 5F9OL 4TNVK 3E9TA 2EEXA 1UM5L 2IQAB 3RWGB 3PFQA 4R96B 2IAAC 4RZCB 5DEJA 3PWUA 4G7SB 3BWZA 3VB8A 2NDFA 4AENA 3QORD 3LIZL 5DDHB 3M88A 1KWKA 2F7RA 5BPPA 1E7UA 3SSGA 2WQXA 3TZVB 1UA6L 4NPJA 4OGXH 2LFEA 5GGTL 4O2FB 3FT2A 3CVCA 5DMGD 2J1WA 1ZGLP 3HE6D 5DYOA 1FIGH 4NQEA 3CZFA 1BZ7A 4GBXD 4P5MB 1U8LB 1R3LA 1DE4A 1JPTH 3VDCA 5D1QE 1TKWA 5K5YA 4Z0XB 1MFNA 4JFQA 4BFNA 5T5NF 2QSTA 5IVXB 2GCYA 1UM6L 5HDBF 5H37G 3D4YA 1NH6A 2E47A 4I3RH 2WC7A 4Z0BH 5FECB 5DHVH 5CP3H 5HYJB 1CMOA 1J18A 1CD0A 3PWUB 4ONGH 4KO7A 4OGAC 1OB0A 3CQFA 4JO5A 3D08A 5C86A 2Z7YA 1FGVL 2YD2A 4QHPA 1RIUL 2ZCKL 4X7EC 4P05A 2NTFB 2A2QT 1KPVB 2PWEA 1RZFL 2YAEA 3KLKA 1P4UA 2KZ1B 2GBAA 3TIEB 2UVFA 2B8OT 4F93B 2BHFA 2BNQD 3VFUB 1CLYH 4QR7A 3F7KA 2IO5A 3UZQA 1BJMA 4LCWA 3TVMA 2VDLB 5TE4L 4O02L 4ZMQA 5GXBB 1BZ7B 1JE6A 1O5DT 1XX9C 2Y1AA 3RPKA 5I17A 5LG6A 2XQ0A 3QRGH 3F6JA 1DE4B 3BIAX 3ESUF 1E3ZA 4X8JA 3IJSA 2MPVA 1AZRA 1OGTA 1MN4A 4OF8A 5KBPA 2EYSB 2WKGA 2ZYIA 4IMLA 4NXSA 3IDIB 3N04A 5F89B 3DA0A 1FFQA 1OSPL 1YEEH 4ODUB 4D8PA 4LHUG 3WL9B 1DBML 5HHQB 4JRXD 4GINA 3OC8A 4UF7C 3QO1A 3CBKB 2XX1A 3JWOL 1TTGA 1N10A 2ICWI 3OB0H 5DFVC 3ZQ9A 4YS4A 1IAMA 1FDLL 3RKDC 3TL5A 1JZIA 3V0WH 2NYYD 3HFFA 3QCVH 2YGNA 4GKLA 3DROA 3LKSB 3KWWA 3I6KB 4FTVA 2FBJL 4IEFA 5GZOD 4P2OB 3L9RB 4LGPB 4Y89A 3MGTB 1JS4A 4H25A 4OLVL 1VGEL 2A6JA 3VD3A 3EKCA 1G9NL 3UIZA 3IRPX 4BXSV 5JPNB 3OKNA 5AB2A 2ENPA 1HCFX 3A4AA 3PV7A 5DJCA 4UYPA 3U2JA 1EHAA 2XWCA 5INCA 3EYFA 3R0MA 4I3SL 3FC8A 3VFRB 1E4KA 2BC4B 2GSMB 3VRIA 4P5SA 1BX2B 4S0TD 4OD2B 5IMMA 2NT1A 3QORB 1JHKL 1HH6B 2DWDA 2EP6A 5HDQH 4F8NA 3G6JA 5IMKA 4BWWA 4CSPA 1OWRM 4H0LC 2PXYD 2BCKA 4UIKH 4NC0B 3NAAH 1R4XA 2GK0A 3NCXA 3OGOE 4NRXB 1ND0A 3LS5H 5IQ9A 5JW5B 3QO1B 1EMTH 4PM1A 4Y4HD 1K9TA 2YGOA 1MCLA 3RGHA 1N70A 3MA7B 3Q8AA 4L8DB 3ARFD 5IW6A 3RNKA 3HE6B 1ZHBB 2DWXA 5GGSA 4GKZB 1X6NA 3PGFH 4GBXB 1RAMA 4QY8A 3U9WA 2WNXA 2VDQB 4J8QA 3AS0A 2Y72A 5E94B 4XX1G 3S97C 1HJCA 1G6RL 5JHLH 3QORC 5IFAL 3KPMA 2CKBB 3LXUX 1HEJC 2DQJL 4MJ5A 4RGMC 3JV0A 1T1XA 2I60L 3DMMD 4WWID 4JFHE 2N7BA 4DKTA 4KHXL 4MDIA 2WLYA 4Y4KC 1AE6L 1KIPB 3DV4A 1W16A 4YBQD 1BQRA 2AKRA 2HRPH 5DMGC 3STBA 3TEXA 3KDPB 2JJSA 3GSWB 5IMMB 1INQB 3IU4L 2DWDB 2VIRA 1M3JA 4WFFD 1OD7A 2WB1A 5I1GL 3EYUH 5B39G 1B0WA 1GJUA 1U92B 1AQ8A 3M7FB 2BNQB 4HC1L 1KT2A 4XOAA 5HGDB 1RFDL 3UO8B 3GSXA 2BVOA 1B2WL 3W0WD 3T2NH 2EKSB 1SXCA 4XE5B 1JHLL 4PJBB 1G9MH 5HPMA 3G5VB 1KCWA 3QBTB 5C0IA 3UCRA 5CXPA 3SBWA 3TESA 3HKZA 4QNPE 5J12C 3S36H 4WJ5A 3A21A 1W6WA 5F7WC 2ALWA 4NN7B 4BSWA 3FT1A 3CN3A 4BKLA 3MSPA 2F8OA 1KFAL 3B7TA 4G8AC 4WIQA 4JRXB 1MDAA 2AKRB 3L4WA 2XWBA 3GF8A 4LPXA 4Y4HA 3VXRE 5CWSB 3I85A 3H9SE 4EI6A 1CYGA 2F2HA 2G2RB 3EYSH 1BQHG 2APBA 3LCYA 4CU7A 2RAMA 2X6CA 3KGSA 4E42B 3UJIH 2YMXH 1NIFA 4XC3H 2BVOB 4ZAKA 1KIUA 2J1YA 4FYRA 4M4PA 4NN7C 1ORQA 4GAAA 3H3PH 3H54A 4W6XB 1BAFH 1JNLH 5DD5L 2OSWA 2R1XB 1CD1A 4OLXL 5TGBB 4AJ0A 3EHBC 5CJQH 5HSFA 1O6SA 5BS0D 4NM4H 2X3CA 4MD0A 3VU1A 5KVEL 4JHAL 5DQJA 4MGXA 1LK3H 1I7RB 2V9QA 3NJVA 3BKJL 5E5MA 5B38B 3S35L 4Y19D 1ZT1A 4F7CB 1N59A 1A4JB 2WLLB 4X5QA 5EC1B 1F3JB 5I1KL 4NWUH 2ZG3A 3CBRA 2PXYB 1XF4A 5IBTH 5GZOC 2APTA 2XWBB 3TNMA 4Y4HB 4O4YH 1R0AH 3AFLA 3ARFB 3PAVA 4HJ0D 3VI4B 1RZKL 4KJQC 3O3EA 5KUMA 3S3DB 2ATPB 3VM7A 1JGUL 1EX0A 3P0VH 1MWOA 4JDZA 1QHQA 3RZCC 2Z4QB 2VXSL 5EEXA 1NAMH 3HPLA 4HLJA 2IWGA 5FGBC 5KVDH 2QLYA 3US9A 3FAXA 4MJHA 4RWYL 4ELMA 2BOCB 2PXYC 2OQJB 3NT0A 3X11B 4CJ0A 3VFTA 1WUNT 2YD5A 3DMMB 5E24E 1R3HA 1XF2A 2R2CA 2NCMA 4FFYH 1RUQH 2YA0A 1T20B 2AJUH 2VXVH 3FRUB 3KBEA 2G75A 4YDNA 5E8NB 5FHAL 1O6SB 4HYTB 5JO5A 3ULUE 3KWTA 4OFYA 4QRTA 4K7PH 4POZD 3HW7A 5DQJB 4QNPF 4RMQA 2AERT 4Y1TA 3PJLA 5K9KB 4YEEA 4JFPA 2BWIA 1KN4L 4OY9A 4LVNC 3KS0H 4XNYL 3G6DL 3VNZA 1G6VK 3W39B 2ZF9A 1RZIA 2Z93B 5E6YA 1VA9A 3EH5B 2XRAL 2J8OA 3UAFA 1WAAE 3NFNB 5D5ME 3W0WB 4DHLA 5ICYB 2OTWB 4Y9GA 4JNXA 2BHUA 2DM3A 1JWUB 2UXFA 2EQDA 3DMMC 2YD8A 3QJRB 4YBLC 3DK2A 3NCYS 4Q9RL 1BBJB 4R5VA 4RCAA 4PB0L 1KGJA 4AUJA 2XJLA 4J3SA 3GRWL 4YBQC 1N3NA 2BSED 1QLFB 5LJYH 4HAFA 1IC4H 4XXWA 4AZUA 4JLRA 3P3YA 4FNTA 4ELMB 4DIXA 3X1GA 5JUEH 3PWLB 4ZQTA 2ZXQA 4Y19A 1F2QA 4KXZI 5IB5A 2FZ3B 2R0ZL 4WAFA 2NY4C 5EBLB 1AG6A 3FDWA 1PKQB 2CXKA 2IGLA 4DGYL 4ZZKA 2OX5A 1MRFH 2J5LC 4OCLC 1KJ2B 1EANA 2R0WL 3QJSB 3CNKA 5E56A 4HHAA 3QYMA 3TGXA 3ZLQC 2Y5TB 2IWFA 4BJLA 1OAQH 3WNLA 3FTGA 3UBXA 1OGSA 3PHOB 2IDUA 1R3KA 3DOSA 3FKUS 2VDNB 1HX0A 5F44A 5T3ZD 2X1OA 3FH7A 1OALA 4F2MB 3EZ8A 3F12A 1TMQA 5FYLE 4FN0A 1NLDL 3WBDA 3QA3A 3ZZQA 3QO0B 3OBAA 3VXUD 2XN9E 1V8HA 2V5SA 1ZSDA 5BS0B 3VH8B 1BQSA 2AQ3A 3IAQA 4JLRB 4D3CH 3RWJB 3NRFA 4UTAH 1YLBB 1JK9B 3M1BB 4Y19B 1S4IA 3ZDYB 3ZX1A 4PJ6A 2AJXH 4N6RB 1C1EL 1U8MA 5HHXH 4YFLI 3VTTA 3ULUF 3C9NA 4HX1B 1KB3A 5T5FH 4ZW6A 2KBGA 4HHAB 3SJVA 3ES6B 3VG0H 1SMDA 1SVCP 4FAAB 3U7AA 4ORZC 2ADJA 5F7DA 1HZHL 5HHNA 5FUCE 4PVBA 4LQFH 4XMTA 4TSCH 5I1AA 2CBTA 2VDLL 3EDJA 4LCCC 1X5LA 2ZX9A 1WAAF 3NFSH 2VT0A 1DN2A 3P40A 5D5MF 4K8RH 2VDPH 4KGJA 5G4NA 3TBVB 4W1TA 3F12B 5BQ7A 2YMTA 2ESVE 3L5WA 1OCWL 4LL4A 1JGDA 5FYKU 2WVSA 3PUUA 4F58H 5JDSA 5I30H 3DI3B 1GHFH 1F1DA 3PL6D 5EOTA 1HAUA 5JORA 5B1KA 2HT3D 4WW2B 2PCPB 1S5IH 4HJ0C 3EDEA 4DERA 4PRBA 3LKNA 4U1KB 3WTSA 1JNNL 1WAEA 2OYMA 1N5AA 2GSGB 3UTOA 3JUZA 3GS0A 3MLSL 4TQEH 5GS0D 2H3KA 3CZSA 1BLIA 4DF9A 1FFOA 2NLJA 3GMMB 1NGQL 3C5SB 4NZTH 5CM1A 2VSDA 1Z7JA 4AQ1A 1EAJA 1B6UA 3V0DA 1CE6A 5E2TL 4JRFA 3Q2VA 3ZE2B 3MRNB 4N3UA 1LEGA 4XPBL 3WO4B 1PCXA 4WFEE 3K8KA 3U46A 3TV3L 4WW2C 4A66A 4POZC 5I1AB 5J6HA 4PW3A 5JLZA 4ODHH 3II1A 5DS8B 1F4YL 4AL8C 4LCYA 2XU9A 2HFTA 3SKNA 4G7QB 3SKOB 4XO5A 1E4HA 1JGDB 3EBHA 1C8QA 5FYJL 5EB9A 2ZQKA 1GAFL 2AQ2A 5HI4D 1CLZL 1TF4A 4R3SA 3JWDH 3OJVC 2I5YL 4HIPA 3TA3A 4BKTC 3IPFA 1A7RL 1KJVB 1H3WM 3FYEB 4K94C 5EIIA 1JGVL 4IKKA 3WO4C 1GKOA 1GIGL 2HN7B 2YAHA 4HHWA 4XMVA 4P8QA 3AREA 3CVDA 1G9HA 1I8UA 1V05A 5LGHH 1I7UB 4D9RD 4B0MB 2QL1A 4NO3B 2FQDA 5CNHA 3B3IA 1YSOA 4PTTA 4FQLL 4UV4H 5TPWH 4Z3HA 5D55A 2QQQA 4AK1A 3F8UB 1GW0A 3L17A 5EEWA 2W8CA 2DRUA 4BHUI 1T0NB 1AR2A 1UXMA 4RH4A 5C6WH 4P3DA 1CI5A 3U46B 1CF8H 1E28A 3VXUB 1ZS8A 2XLLA 5JLZB 1KLUA 1NBYB 5F9JA 2WBXA 1UXSB 4YDLC 1RZJC 1HSBA 1LGVA 1KXQA 4LCYB 1MFEH 4M6NH 1R5VB 2NQDA 1L9OA 2PR9A 1Q1JH 3SKNB 3VRJA 4L4VA 1KLGB 3D4ZA 5F7HA 2ADIA 4JY4A 2PO6C 5GHWH 4BH8A 3OHXC 1DN0B 3SE4A 3L3HB 3RDTD 1BCIA 4NAQA 4UQIM 3HNTH 1N2RB 3WNMA 1A66A 4Z95H 4EF3A 1O9ZA 4NKDA 1HWWA 5F1KC 5C0BD 1FRGH 1H8LA 4OTXL 5DK0B 3DGGB 1ZIBA 3BZ4A 1CFNB 1OE2A 1U58A 3HC3H 4AJWA 2GJZA 3U9PH 2RBLA 3L3GA 3ENEA 2G3ZA 4YDIH 3SQBB 4LCUA 2E7LA 4DZBB 4FL4B 3NPSB 2UZIL 4E41A 2AXGA 4ZW8A 3GZPA 5HY9A 1H6TA 3QZPA 4Z7VE 1I85C 4PS7A 1CGSL 1Z32X 3J27A 4IDLA 4L8SC 4V2BA 1MJJA 2K0RA 3E80A 3N85H 1KTLA 2QQKL 4WF7A 1YNTA 3QFDA 3ZDZB 5IOPA 4KTEH 1PW3A 1U8KB 5H4YA 2EICA 3EUUA 1JZ6A 4U0RB 4OCSH 1FCGA 5GSRA 3T6XA 3PL6B 1RUKH 2YGQA 1IFGA 2UVEA 4K9EC 1FYTE 3PPEA 1HSBB 5CBAB 5GSVB 1W91A 4JJOA 3ATEA 3DJRA 2E7HA 3W5NA 3CQQA 2DQUH 1TJHH 5BO1H 2UY6B 5IKCB 2EINB 3BHBA 1OARH 2MPAH 4ODSH 2APSA 1WA2X 3JWNH 4X80L 4KXZH 4UWQB 3GPSA 3NPSC 4ZOBA 1NDGA 3KBPA 1XH3B 2MH4A 5KSAD 3WEXA 1UT1A 3N55A 4TKWA 4E9QA 4HUXA 1ADQA 3ZPDA 4L2YA 1U58B 4FXKC 1RJCA 2G9HB 4TNEA 4U0RC 3RWEB 1MVUB 3SKUD 3L3GB 4ANVA 3NEXA 3PL6C 4X6CB 1DANT 5DJXA 3UIYA 1QR4A 4HF5H 2YXFA 4LCUB 1O7VA 3WYRA 1TZOA 3GRBA 5M95B 2LLGA 3OKLA 4KVCL 4ZUVA 1XCTA 4S1RH 3B2VH 4G9DA 3ZE1E 1MHHA 4E9WA 4L05A 4MMZC 1X5AA 4WI8A 1BZ8A 4NQDD 3T65A 1U2YA 3GXIA 3OX8A 5FC9A 5TTRA 4HS8H 5GS0C 4YSSA 1J0ZA 1FORH 4G7VL 4Y2LA 2JJTA 3F01A 2KQNA 9PCYA 2GTWA 3NBNA 3FUIA 1YYLL 3MRPB 4G8IA 4P4KD 2EDFA 3I9GH 5CN3A 3S7GA 3CDGA 3CXHJ 4OLYL 4U31A 5KS9B 1NMAL 1DANU 3NUKA 2E74C 2MOGA 1LJMA 4AYFA 3TCLB 4HFWA 2OS7A 2D2OA 1QPXA 3NIDE 4WI0A 2R2BB 2X4TA 2WUCH 1A7QL 5I2IB 3MRMB 1E5BA 1W8NA 4W68A 1L3WA 5IFHL 1N4XL 2GITB 3PQYE 2Z92B 3P9MA 4D9QE 4W9DC 4AG4L 5E2VH 3NPZB 3O4OC 1QSEA 3BD3A 4OFIA 4PJCB 4Z7VF 3D85D 1PZ5B 1N0XL 4GIAA 1N8ZA 2EXYD 4MLIA 1MCKA 5MHSD 1L5GA 2VZ1A 4XNBA 3V2AR 4FXTA 1SEQH 3RDTB 3DO3A 2Z8VC 3UEZA 2AV1A 3EO9H 1YEGL 3FFCA 1MAJA 1RD6A 5C0BB 1CG9B 2EEDA 1XGRA 2O5ZH 3CLEH 1DBBL 4Z7WE 3RX7A 2IFGA 3QFJA 5KSAA 4PTUB 5F72S 1NINA 1BVZA 5DD3L 3TV8A 3P4MA 2J1XA 5D1XE 2HLEB 2LT9A 3OAYK 1J12A 3DETD 4CBPA 4DVRH 2DQEH 5IHUH 5ICZB 3EYQC 3FFOA 3CFDA 4JQVA 2OTUB 3OG6B 4AKOA 4A1RA 4R7XA 1A7OH 1A1OA 5T3XE 1Q0XL 2CO2A 5HP5A 2Y7OA 1RUAH 1HOCB 4L3EE 2QQLH 5ENWA 3VACA 3GHEH 2ZCHH 2GI7A 2YRBA 2DQGL 4WTQA 3RHWF 4EJ1C 1U95B 2D3VA 4WLCA 3BAKA 1W72L 2EVJA 2O5XH 1AGBB 3HN3A 1PZDA 5TK2A 1JZGA 4X7DC 1UZ8A 4NNYB 5CD3B 1SUJA 4P4KA 4N2OA 2EDKA 3QPKA 1TZ8A 2VLRA 2CO4A 5C2BH 4OW6A 4YSUA 4MMYA 2HPOA 3QJUB 5E4IA 2Z0BA 5I66B 4R7NB 1KJ2L 2ZNWA 5KSAB 5FYKD 3SDYL 3KLAA 3OLIA 2NY5H 1DQKA 1DVTA 1ZLUK 3MREB 1YNKH 1EO5A 1L0QA 4PJGA 4Z9KB 3C08L 3FTSA 3V6OA 1X6LA 1ACCA 5JQ6H 4I77H 4S1DD 3CFDB 3WJJA 5CU9A 4G2AA 3NIDF 4HGKC 4HLZG 3UTPE 3W11D 4PWGA 1QEWA 1XIWA 1HZLA 2K7PA 1QSFE 4AEEA 3IDMA 3L4UA 4ISVA 4LLVA 4NQDB 5ENWB 5FYLH 2B39A 2ICES 2WNKA 1DFXA 4M5YH 1OAXH 1CF1A 1KBBA 3KG5A 4MA7H 4R7LA 1LO3L 5K9OA 1J8SA 5E9DE 4HCIA 3SGDI 4P4KB 3T0ED 4WQOA 2AQ1A 4UNUA 3Q9PA 4ODWA 1PFOA 5IREA 3BPCA 1NAKL 4PRID 2YN3A 3PHQB 3L7FB 1ZVSA 1WBYA 4KOBA 4FZ8H 4QLRA 4W9EC 2TSAA 3EOTH 4Z7WF 1RZ7H 1MH5A 5AG9A 3S3JA 2F7IA 1DLHB 4M6ML 5J1AB 1FNSH 3HG0A 3NZ8B 3ET9F 4N90D 2A9ML 2BVYA 3BWSA 3C8KB 4LEEA 3MX0B 2R23B 4U1NA 5I75C 3CFJA 3VXSD 5DJ0A 4EIUA 5ACZA 3D85B 2HJKB 1QP1A 2R39A 4LLVB 1NUFA 1CVSC 5BZWB 1CTOA 3ALXA 2FE0A 5EBGA 2JKIS 5AZUA 1RMFH 1CC3A 4H20H 1ZE3C 2WJ5A 4N68A 1P4BH 5LXVA 4JY5H 1I1FB 1ZXKA 3HE7D 4A2EA 4RIRA 3MUGB 1GGYA 1X5YA 2DV6A 2HH0L 1G43A 3BPCB 3L5IA 4NKOB 3MJ7A 1YN7A 4JY6A 2ZXWB 4MAYD 3FHEA 4YHPA 5GRYA 2ADGB 3UYPA 3B9DA 4K94L 4BK5C 1YJDC 2ICCA 3KE0A 4B50A 4I48B 5E8OA 5ERWB 5EOQL 3L3JB 4IBYA 2H1XA 4IRSA 4WDIA 1JGLL 2V17H 2BY0A 5GGTA 2HCZX 4U1NB 1YEJH 4FQXD 1C16A 2WMPA 3AY4A 4F20A 3IYLW 1TQWA 2VXUH 1QW9A 4LOFA 4FZEH 3T0EA 1I3VA 4WGVB 1UQSB 5EF2A 2FRGP 4G8GA 1TLKA 2G9KA 4UM9A 5DGQA 2LVEA 3V10A 1H5BA 4G80A 3U36B 3O6FA 1RZJL 2C9SA 4MQ7A 3W2DL 3O0RL 1NEPA 2Y2YA 2AMGA 4Y2NA 4A6YB 3H3BC 4LPUA 4X50A 5BRZE 5HXMA 4AGOA 2CNZA 3AXLB 3KW8A 2FBRA 1JFQL 2P44B 3LKOA 1YN7B 2Y06H 1NBQA 4HMEA 3NESA 2DLEA 3P0YH 4JJ5A 5IB4A 3X1NA 4I9WE 1IAKB 4QHMA 2KUTA 5DFAA 4JFDA 4NJ9L 3CFIC 5FWQA 3U4EB 4M7KL 5FKPB 4HWBL 1U8HA 2RFXA 2WWNA 4AEIL 2H1LM 3BP5A 4LIQL 3UPRB 5E8OB 4LRNH 1W15A 1WG3A 4PJ9D 5IIEA 3UCQA 1LP9A 1T80A 1A2YB 3MLVH 4EOWL 5INDB 4RAUA 2OK0H 3HAEH 1W0VB 4HD9A 4NC1C 4AT6A 3ILEA 1M2OA 3SIKA 3T0EB 3TFBA 4GPVA 2R9HD 4LF3B 5DJ6A 2DL2A 4L1TA 5FV2A 3LEVH 1EEQA 2Q1EA 5C0DA 1JI1A 4LP5A 4S1DC 4U1GB 5L8LB 2IH3A 4PRIB 5I0XA 3W5MA 4K9EL 3JQOB 4HEMA 3VXOB 3W11C 2BP0B 2Q87A 3KJ6L 1KCBA 1AZBA 2GPZA 3J7HA 3PWJA 4JREB 1WUZA 1Q0YH 1AJ7H 2HLFC 4G11A 1PJWA 4U1MB 4LLDB 1KEMH 1S7TA 2ZJSL 1UXWA 5EZLB 3IDNB 3SGKC 4XCEB 8FABA 2PMZA 4E2OA 3KPSD 1ILSA 4S1SL 4OV6F 3QULB 3VXSB 4IJTA 4WTXA 4RGND 2I32A 3CFEB 1CYXA 1CXIA 1XXDC 1T21A 3F7PC 4TUKH 5DWUL 5IIEB 1QA9A 1B4RA 3LNFA 4RAUB 4C54A 3VD0A 4RA0C 3VA6A 1FE8H 4GKNB 3CDCA 2MIZA 4XNZB 2Q10A 4JREC 4Z7UE 4HK3J 1UXLA 3HE7B 5D2NE 2MMXA 4WY7H 4M61A 2VWEE 1S7WB 3SDCD 4JM4H 4Y88A 3AS1A 3QJQB 1LL1A 2IGFH 3MLUL 5GS0L 2IH3B 5C0AD 1FNGA 3ATFA 4JDTH 1QLEH 2UXTA 5CZRA 4MAYB 3MDJA 4HCRL 2DQCL 1T5KA 5AWNH 4BINA 1KB5L 2WBWB 3BEWA 3KWXA 4KRNA 1ZHKB 3WXVH 3Q7JA 1W8OA 2CM5A 1NQBA 2VRAA 2X6BA 4NZRH 4R26L 4XNQA 2YEQA 1BREA 4YXHL 4FQXB 4FFWD 1MQKH 2QTEA 3CSFA 5B3NA 2YLHA 3HE7C 3IFOB 3CZLA 3O3AA 4HXBH 2ZUWA 3FQNB 4NQCE 2FD6H 3P4LA 4OD1H 4EZJA 4LGRB 2C9UA 3WU1A 5DUBA 3BKYL 5G5DA 4F7PA 4APXB 2TAAA 1KEGL 2F19L 4AXWA 1G6RA 5CFHA 3T4YB 3MLZH 1VDGA 5HI5D 5IVOA 3WS6A 3ZZLA 3K2IA 3CC5B 1J1XH 4G1EA 4B27A 3FHQA 3FT0A 3A67H 3S37L 1CICA 3TPUA 1RIHH 3RIKA 1MLCB 4M61B 1LHZA 3CXFA 3WTVA 4AIXA 4Q4IA 1EAOA 3V4PA 3I6GA 2E6PA 1TQUA 2ICWJ 4FQXC 5C08D 1ZMYA 5K59E 2Z0UA 1FZKB 3K72B 4RESB 2FUTA 2P49B 1URIA 1RHHA 5DRXA 2MTAA 4DP5X 4OF0A 3WN5A 4XN4A 3E38A 2VM9A 1HINL 4PJ9B 1KDIA 3NZUA 4WK4B 4ZOCA 1JBJA 3GSRA 3BIBX 3CZKA 3LQAH 4DQOH 5CEZL 2HUHA 3FL7A 2VLJD 4HGMA 4HIJA 4I4WA 5DZOA 1ET7A 3UTTE 5BZXA 1MI5A 2CK2A 2NY6D 5DUBB 2WBJA 4OZFB 1ZIAA 3DUUA 3C12A 1FAKT 2PW2B 2QADD 4JX0A 2WZAA 5B7MA 5ETUA 5DF0A 4G1EB 4L4TD 5MEND 5I6OA 3VXMD 1U4FA 5KG9A 2CO6B 2CBOA 3PWPA 2G0LA 3QE5A 3IDXL 3F5WA 3TPUB 1XQ4A 5DJ8B 1TNMA 5LBSL 1BD2D 4PJ9C 3DSFH 1ZEAH 3KEDA 2Q76B 3AQZA 3C6LC 5AALA 3ZKMD 3P77A 1U6AH 2EUVA 5DA4A 1PIFA 3KPSB 3OGCB 4R6UA 4N1EA 1MCWM 4WUUA 5HVGB 4RGNB 1URZA 4Y9CA 2R9HC 1SFHA 5EF3A 25C8H 2QMJA 1RY7B 2X42A 4P48A 1CT8A 1WE5A 2DLFH 3U82B 5ADOH 1VENA 1YEKL 2EDDA 3GHBL 4AM0B 3GSRB 3NTCH 3ZMRA 1QI3A 3NACH 4CN1A 4X6DE 4ZPTA 3IDJB 4HIJB 3V79C 5CCGE 1J9QA 2WYHA 2IAMD 2ZPKL 3TWCL 2KQMA 3D30A 1RK0B 1LVEA 4LZKA 1ZVNA 3NJHA 3R4RA 4NKQB 1PG7X 2XTJE 3DXAA 5DJYB 1L0PA 3GSNL 3GQFA 1CPUA 3SDCB 4LOEA 3FTZA 3SPHA 5ILTH 5C0AB 2WO3B 3HS8A 4XP9L 4K3HA 3HNSL 1UH2A 5E8EB 1WRFA 5H35B 2QKSA 5ELIA 5FUZL 3GWJA 3MRRB 5KSBB 5E1GA 2WO4A 1FO0B 2XXCB 1JDCA 2VJ0A 6TAAA 1JHTB 2E0PA 2VLMD 4DPBX 4MCMA 4IK6A 3GMLA 2V9TA 1YCSA 2QR0B 4UQEA 2UZYB 1PEWA 3D48R 3W9EB 3TFKD 3ZDWA 1W0YT 1CFSA 4AI7A 3D39E 5K59F 5F96H 3K71A 2VLKD 3QRFM 1KULA 3SDCC 1KCSH 2OXGA 3C2AH 3BISA 4KJPD 4HLZH 4AK2A 3N44F 1SF5A 1UKSA 2VYRE 5CMAB 3GRGA 5MENA 3VYNA 1KTBA 4HJ1A 5F7EH 1AQDB 1MCPH 3QK0A 2ZICA 4QAMB 1UZ6E 1CXFA 1NIBA 2YD6A 3GJFH 3K4DA 4P2CG 3KEHA 5IR1B 2B14A 4AQEA 4NNXA 1QNZL 4FFWC 5C08B 2R29L 3CZJA 1OSZB 3G08A 4AQOA 5AD0A 5A2AA 2GY5A 5LCVH 1MHPL 1SN2A 1HDMA 3MBED 1ID2A 1FNHA 3U83A 5I6XB 5KYWA 3SDXB 1ZT7B 3GMLB 2Y36H 5AW3B 5GGVH 1A6PA 5JW4M 2CDEB 1U8OA 2I26N 3FO2B 1CFSB 2VLJB 1G5AA 3OKEB 1M05B 3JTBA 4PGEB 4HIXH 2NY6B 1YJDL 3D9AL 1NDTA 3KXFA 3NDYE 4RMWA 2QADB 2X2HA 4OZIB 2HT2D 1HWGB 2UXVA 4NDMB 4L4TB 5MENB 4TV3A 2EVFA 3VXMB 1BOYA 3JV6B 1N7ML 4OZGA 1IILE 1AANA 3HFML 4A7VA 5I6XC 2V8LA 3G5ZB 3UAAA 1EQWA 1IGFH 1BD2B 4K3EL 5F9AC 4N86A 1JF6A 1A3LL 1IGIH 2CRMA 1ZLWH 3QH3A 4MB1A 3G08B 4XPGL 1S7QB 5JPMB 5AOIA 5IMLA 3EADA 3RTQC 3MO1B 3M8OH 2NY6C 4LCWE 1G0XA 3MRFB 3V0GA 5HGBA 4D0BB 4YWGL 2QADC 1IEAA 4YZWA 1K8IB 2MKWA 3QCTL 4PJ7A 3LEXB 3GZQA 3LKPA 1E8ZA 4GOSA 3J2PA 2R69L 3R18A 4O58L 5AKSA 3FB6A 1KZQA 2IAMB 2ROXA 4YAQB 3VFGH 2XWTB 1NEZB 3MKKA 2MOQA 4W9ZA 3GXNA 5SX5H 5L2KA 3F7VA 1RIVH 1EZLA 2D7OA 3I3DA 4GSDH 1IC1A 2BVQA 4FYQA 5FYKL 2CO7B 5IJBC 4NM8L 1YUKB 4HIHB 4IDJH 4JN1H 4OZGB 5A40E 5C6TL 4Y2DD 5EMYA 2EEBA 2GJ6D 4IBWA 4I18C 3OAZH 4NPYB 4X2UA 1NCGA 5D7KD 1UENA 1LYQA 2QJDA 5I8KL 1CDBA 5D7JA 1UCBH 3E0GA 5E7FA 5BUPA 1V3LA 1UZ6F 2ZWSA 3CVHH 3L5XH 2B2XH 4JDEB 1T7WA 1OP4A 2E86A 4P3CH 3OWEA 1WIOA 1T1WA 1NM4A 2J8HA 2WXGA 5CSZA 1NDMA 2IAMC 1A47A 2Z64C 4FTVE 4N2EA 2WQVA 2P80A 2VLKB 4P59L 5E0FA 1A22B 1MRCL 5IEKA 5AB0A 4AVKA 1GGIL 1FJ1A 3IFLH 4HVBA 1LO2L 2JXMA 4L9LB 5AZ2H 2OW7A 3JYCA 3U30B 3T6WA 2Q7YA 1LWHA 2KPWA 2Q0ZX 1LMKA 5EU6D 3FB6B 5IJVB 2ZUSA 5JOFB 1QASA 4S2SA 3R1GL 2E75C 1BP3B 3SOBH 2MNUA 2QVFB 1N0LA 2ODHA 2YPLD 3G6JE 3MXWH 4GQRA 1T0PB 2BVQB 1FNEB 4OLUH 4K3GA 1MCDA 3JZ7A 4G6MH 2P42B 5GS1A 5JXAL 4NO2B 2XFGB 1AH1A 4JUTA 4BCYA 4XN1A 5JIQA 1M1SA 3MBEB 1TJMA 4L9LC 4PJAA 5FA3A 5L4MA 3LV3A 3U30C 1AKPA 3SBQA 2BVPA 4JFOB 3FULA 1D5BB 4Y4FD 4KX9A 5GS3A 1Z6JT 4U7MA 3TN0C 4XZ4A 3BGFC 2WSPA 4FQJL 1F11A 1LO4H 1OF2B 4DP7X 3LQZA 1ETZA 5I76B 4HD5A 4Y1SA 2NRDA 1FJ1B 3NFPA 2ZAGA 4FMFA 3OZ9L 4ABQA 1NBCA 4FI8A 3T3MB 1RJYB 4GMTH 1GRWA 4JQXC 3OKMA 4HSQA 1PPIA 3BN9C 5C09D 4HK0B 2Z8SA 4JG1L 1AGDA 1NMBH 3NEOA 3UZVB 5B8CB 2BFVL 2YARA 4LBAA 3MBEC 1QLRB 4KVNH 4GW4A 4WI3A 2G0KA 3APNA 2W07A 3U2SA 3MROB 1KOAA 2ZYRA 1X9UA 3L81A 1M6OA 4N8VB 5LBVA 3RL1B 3E1ZA 1ZWIB 1AD0B 1ITBB 4N8UA 2ZG1A 4FFZA 4IHOA 4RNRB 3Q3GB 3BAXA 2R4RH 4XB3A 1S7UA 1NC4A 4J3OD 4GRWE 4D9LH 5EBWB 9CGTA 2GAZB 5I23A 3EFOB 4GUQA 4X98B 2HFFA 1IGCH 3CXDL 4LLQB 5TH2B 1DVFD 1PLBA 2HT2C 3X3GH 1XF5B 2H41A 3LZNA 1ECYA 4Y4KA 4PB9H 1FHNA 4QYOA 1RP8A 4XNAA 2QGBA 3LNGA 1H19A 2VZ3A 3TH2T 1WICA 3K91A 4M7LH 3DECA 4H5SB 1PAZA 3NFPB 1NGPH 1J10A 3SKMB 3HPJA 3ZRSA 43C9B 4JGMA 2YPLA 4HG4K 4U6TA 4XP4L 3GI8L 4NQXB 4F57L 5I1EH 3MVSA 4XP1H 2HJFA 2CO1A 4HT1L 4WK0B 4Y2DB 2O4EA 4XAKD 1VGKA 2GJ6B 4DN4H 3HVNA 3CU7A 4NQQA 5EZOL 3WD5H 4AMKH 2W07B 4B9KC 2WZPA 3U2SB 2OP4L 1V3KA 5EORL 2Q8AH 3WG7B 4GNKB 4P2RD 3PNWB 1KXHA 3NCWA 4GO9A 1WBXB 2JTDA 3ECUA 3G6JF 3STZB 5GJSH 3FQWA 3LKRB 4L1LA 3ARDA 2Q6WA 1D6EA 5TDPB 1F02I 2R0KH 1S7UB 5GIRA 3VGHA 1XZ0B 3D52A 2HRGA 2DD8L 4KDVA 2EIJB 2CCVA 3ESNA 1G0YR 2WXJA 5I73B 2J5WA 3RVVC 4WO4A 4NQSA 4LSUH 4KMTH 1KCUL 1JV5B 4XVOA 2H2SD 2IV8A 4ZFOB 4D7BA 2WVVB 2CPUA 4M8UA 2LFGA 3IMVA 2VR3A 5EU6B 4FKHA 2KKQA 3D0VA 1MFAL 2I7OA 4NYLB 3EJTA 5EZJB 4YHML 5KYXA 4L5FE 1H6FA 3VCLB 3KD4A 1PD0A 1PDKB 2YPLB 4Q97A 4H0IA 2P5ED 2YK1H 1MWAB 5IFJA 2WSDA 3ZIYA 1LQBC 2XFXA 3WIHH 1FL6A 3U6RB 3H1ZA 1T89A 5DCCA 1ACXA 3JVGA 1UWGH 5DJZB 5GISH 3W0WE 4KITB 4OCYH 4WI2A 4WV1A 1UM4L 2BZDA 1UWXK 1DVFA 4QKXB 3WV0A 2MRYA 4FERA 2KZKA 4XH2A 2Q6WB 4WHTB 4Y4FB 1D6EB 4HUNB 2G5BA 3MLWL 5EWIL 2QSVA 5GIRB 1YPZB 1B4TA 5TF0A 4K23H 4KTDH 3TNNB 4GRWF 4LE8A 1F4WL 1HXYA 4JO3H 1CTMA 3DO7B 2H26B 5E99H 1J11A 2GJPA 1FLTX 2LU5A 4ELME 3HG1D 3FRPB 4YHLL 4XVTH 4X4YA 1DFBH 4FQ2L 5C09B 1CE1H 4FNUA 4KI5D 3VSTA 1IBYA 1PKQE 4MJ2A 2R4SL 4NKIH 3D69B 2P8LA 3LNDA 3E9UA 4PUBL 3EF4A 4L37B 3MCG1 3ZT7A 3BH8A 4BZ1H 4UT7H 3Q6GL 1JGIA 4QRSA 3RZCA 4HJGA 2IBZY 5ECJE 5TFSH 1M7IB 1FQ9C 4PPTA 1NUDA 3MODL 1BG9A 4Y2OB 4WJKB 2ZG2A 1IGJB 4JO4H 3RWFA 2CDGB 1FO0L 5DK2A 3QDGD 1JWMB 2D03H 4DP9X 2ZWYA 4QXTB 4X8CA 4YE4H 4AGMA 3KCWA 3K2KA 3TIDB 4XVSL 1P5UB 5I0VA 1DVFB 2CGRH 4IRJD 3O6KH 4WKZB 1C7SA 1DBAH 2VH5L 4X0KB 5LN8A 4U1JB 1DDHB 1YEWA 5AVUB 5I1IL 3D0AA 4ZUSA 4Y19E 3UP6A 3CFNA 3GJEA 3ZDYE 4BH7B 1ZGLA 3O2DH 4MKTA 4GYBA 3CFMA 2GKIA 1TETH 2KS0A 4OLWL 1TOXA 2X1XR 3WS3A 4QYAA 4N22A 2FGWL 3QUGA 4PJXA 3S4SA 5LNDA 1UT9A 1EHXA 5DEFA 3CN1A 4UT9L 4P2RB 4BELD 1F90H 3G5YA 3K8LA 5DT1H 4AW7A 2FEDD 4KFMA 1JZJA 3APFA 5CGYD 3T77A 4MZ3A 1I3RA 5MI0C 2VZUA 3DSNA 3GMQA 1MY5A 1GGUA 1ETB1 1HIMH 1EJ6A 1PYWB 1Z3RA 3WFCL 3M6DA 5I18H 5I6MA 3ZR5A 3H9ZA 1BEXA 3F6IA 1EO7A 3VI3A 4RDQF 2CIKA 1UJ3B 5GRXG 3GKZA 4AV0A 5DR5H 1KYOJ 3AG3B 1DQLH 4RFEA 1XGQA 3KW7A 1L9MA 2B59A 4RRPA 4WTZG 1RPUA 5E00A 2MSPA 3V4VA 3EJZD 4NP4L 3MYZA 1KJMA 4XPTH 3UADA 5HYQA 1MEXL 2BWDA 4NX0A 3GJEB 4NOFA 1VACB 4ODBD 5DZAA 5FUOH 4ELMF 2OCJA 2P5EB 5JMRA 3SYCA 5HGAA 4F91B 1CURA 1H9VA 5KVFE 3HI6H 3KPOA 4G9FA 3QZWG 1M53A 3WS3B 3BPNB 4P2AA 2FDBP 5LGJB 1ESOA 3B4NA 3QDGA 2AW2A 1UJ3C 4JFTA 2EUZA 3UTQA 2B4CH 3CN0A 4H13C 3SJVE 3BSZL 15C8L 2DI7A 3EJPA 5EUKA 2W5PA 3ZE2E 5EN2B 3U4BL 1KTDA 1AG0A 5GS2H 4WNQB 3G04B 3GMQB 2DI9A 4LSVH 4ZRGA 3QQNA 5IHHA 1MF2H 5I8OH 2V2WB 2X3AA 5I26A 5F0JB 3VFMB 3FBQA 3VXTB 1HHHA 2R1YA 2YEVB 5HGGS 5JHDD 5KBDA 5KAQF 4CAGA 4NZUH 5IBLD 2OL3H 5FPIA 2FX9L 2P26A 2XN0A 3O0LA 3HG1B 3IDGA 3GXFA 1X7TA 4JMNA 2VKWA 1ZCRA 1FYHB 3DYPA 1FIEA 3BPNC 2GC4C 3Q2LA 3R19A 2DEYX 1CD9B 5ANMB 3IJ9A 5C0ND 1IGYB 3TBCA 3TJPA 4WZ9A 3V6ZB 3BE1H 1IKFL 5I8EA 5A3ID 5LXGH 2OMUB 3VQLA 1I9IL 5FO8A 3F7YB 4L3CA 3ZDYF 4BSVB 3VWKD 3KPOB 4DTGL 1UGKA 4LCCA 2FX7H 1ODUA 4AVJA 5JXED 3B7RL 2D0HA 5J6SA 1OB1A 1NKOA 1BWMA 3QDGB 1VPOH 1J05A 4DGUA 1DVXA 2XG4B 1RU9H 3FO9A 2Y07L 1AGEA 3HC0A 2BDNL 3BH9B 4ALAC 1JYVA 5EUKB 4QXVA 1KTDB 4JFYA 4IRJB 1FA4A 3QIUD 3BZFA 4AYEC 4XMKH 3I74A 4P23D 3GXDA 2AVGA 4U6YA 4E9XA 4H1LA 1G7HB 5DZNA 3FQRA 3LEYH 1KXVA 4TVPE 1QFWM 4LPCA 4F2EA 4ZFFA 3WSQL 3U4KA 1KSRA 4NCC2 1T83C 2X09A 2ZCLH 2NW2A 3DX8A 4ZO9A 3CVIH 2ZTBA 1E6OH 2YSSA 3X1FA 5C1MB 2N7AA 4ODTL 1M2VA 4HBQA 4UQDA 1Z9SB 4AJYV 5AZEH 1JPGA 1OANA 5EZPA 3CV5A 5I8EB 3OLGA 4F8PA 4ZFZB 3P30H 1I9EA 3EGXB 2DMBA 3KM1A 3AU1A 3Q2NA 1KV7A 2ISDA 2IPTL 3GMOA 5D7IB 1YEDB 5KBMA 4B3EA 2NYKA 4G5AA 4DW2L 3QAZB 1SLVA 3RGBA 5LWYL 2ED6A 1BYOA 3ZYZA 2D7QA 1OOAA 1I7ZA 1PG7H 4PJEA 2CR0A 3WIIL 2IXQA 4WWOA 3S48A 4JFYB 4O2EB 2ZKHH 3QJZA 4N4YB 3ZE2F 4AOFA 3BT0A 1YEIH 1KB9J 4I0PC 2NR6C 3MCLH 1WGOA 2OZ4L 1KXQE 4K5LA 3QWQB 4FC3E 1D5ZA 1R6VA 1S7XB 3OMNB 4L4VE 4N2IA 3QEHA 3EOYG 5KBNC 2D31B 3NZHH 2NW2B 4PJ8C 2X6UA 4EQ2A 4GT0A 1ZHLA 4JPVH 4UIMB 4JM2D 3QPXL 1U0QA 4YO0A 1T3FA 1FUNA 4PG9B 1OGAA 4MTMA 1Y6NR 1FCCA 4K7PY 1CZ8H 3WN6A 1DEDA 3RFZA 1YMMD 2ODIA 2WOBA 3PYCA 3LRMA 2OA9A 4FP8H 1E8YA 1QFUL 1KCRH 2W88A 3T71A 3KL3A 4LB8A 2G3XA 3EJZC 2VN6A 4JM0A 4X9IA 5ITBL 3CCHB 3MCKA 4GRWH 1OQOA 5DHVA 4E41E 2O26U 4YN3A 2D3LA 2XTSA 1Y0LA 2DQDL 3DGCR 5JHDB 3KPLA 1F8TL 1A7NL 1OPGL 4PJEB 3H6JA 1FVDB 3OHXA 2DDQL 3IFNH 1PZAA 3J8F7 2MCG1 2IXQB 4K71B 4MD4B 4D0CA 5LUMA 5D1ZA 3UZEC 1VFAA 2EYRB 1LDPL 5FV1L 2BX5A 3B9KD 4AGPA 4APQD 1REIA 1NGXB 4E5XB 4HWBA 3CX5J 4R0LB 4JKKA 4EXKA 5EPMA 5CLYA 3WGUB 1TJIH 3QEHB 4PU2A 4ABWA 1S7RB 5DRWB 4HJIA 2OMTA 4HMDA 3VWKB 1O7DC 2C7UA 4YO0B 2X89D 1SDDA 3SGJC 3IKCA 4HAKA 3ZQXA 5KZCD 4XP6H 5HYFA 5I1DB 1TJXA 1SY6L 4KWUA 3GIVB 3L1GA 1QYGL 3RIAK 5K1VA 4K71C 3LPGA 4KPHL 4LNRB 1V7MH 4JK0D 4XN9A 1NCCL 2A9DA 4NRYA 4ETYA 5A6MA 2QGCA 2ADFH 4NRZA 1GZPA 3QIUB 3WKML 5DHVB 4P23B 1RURL 4R0LC 2R8SL 2E4FA 2WV3A 3NSDA 2PYFA 4PJCE 1W6LA 1NICA 3D7PA 3V6FB 4ZFOL 4KNTA 4Y5XB 2DJ4A 2ENJA 3VWKC 4AX3A 3HBPA 5HYEA 5AFAA 1A0QL 3ZDZF 3OJDB 4EUPG 1OHQA 2F53A 2D0GA 1J8HD 1TT6A 1LEKB 1EO8L 1DBJL 3LDBB 4PLKD 4XMZA 3PP3K 1NCBH 1G4MA 5T1LA 2OKMA 3OAWA 5C0FA 4FXKA 3IDUA 3GMRA 5IJKA 1MWAL 1TZIB 1NGYB 4IM8A 2KDYA 3U1PA 5D6CB 2OMTB 2LVCA 1MLBB 4L2LA 1N6VA 1NKGA 1AO7D 4MX7A 1A6VH 4P06A 4JZOA 4ELDA 2NW3B 4XP5L 1FG2B 3KLHC 5C3IA 2AEWA 2IH8A 4AUUA 2JI2A 4M7JH 4MMZA 5E0QA 1DQJB 2Z91A 1L6ZA 4LVHC 4Y5XC 2GT9B 6PCYA 3QR0A 5FKAB 4UDTB 5IQLA 4PH8A 4N2NA 4YPJA 4NRYB 3RURA 1NFDB 1D2PA 1JUFB 1GZPB 1RULH 4XCYB 3LDBC 4RAVB 4F33A 1BHGA 4FG6D 3VD2A 1S7VA 2EDJA 2JNZA 2AK1H 1KB5A 4DFIA 2M8XA 4RSVA 4G71B 3UC0L 1QSEE 4GAYA 4O5LL 1OP5K 3D0LB 1DVQA 3FZUD 4KUZH 3OWRA 2XSKA 4KUCD 1U8JB 1TEFA 5HHVL 2FJFA 2VL5B 1YNTF 3ARGD 4WSJA 4FFVD 1PAMA 3P4OA 3GD1C 3KHQA 4YK4C 4DH2A 3P4NB 4JM2B 2DH2A 2XXMB 3CFCL 3B83A 4R7DA 3S98A 4H8WH 3ZXAC 3FFCE 3MV11 4HGWA 5DMIL 4S1QH 3FQ1A 5EFIB 3TEWA 1CXKA 1XL6A 3QFJE 4GAGL 1YMMB 3TYGH 2JKRM 3FMGH 5KOMC 1M7DA 3E3QC 3I3BA 1ZD6A 3B7YA 3DRQA 3K81A 4X4YB 3ZKXB 1FL5B 4JZOB 3ULSB 2RIKA 1Y18A 3NCJL 4EAEA 3FN0L 5F9WB 3IMUA 4UTBH 2KLRA 1T2JA 1U8NB 2P3YA 4FEMA 5C6PB 1IKNC 1FBIL 2J7LA 1YHPA 2BSRA 4NEHB 4G1MA 2NUPB 5I0YA 4JZNA 2V4LA 4IJ3B 4FHJA 4JKNA 3PF2A 3L2NA 1UD2A 4UQ3B 4JPIA 1IBGH 4JM2C 2A4ZA 4IK7A 1DR9A 4OGZA 2QHRH 2VOTA 3B9KB 1U8QA 4APQB 5K93A 4Z8FH 3QUYA 2WXQA 2CHXA 2YXMA 1HVXA 3MLRH 1EEZB 4PJCF 2FJFB 3H7BA 4G43B 5F9WC 2VLRE 4ZMNA 4N3TA 4R7DB 4XB8A 4ZFGL 3LRHA 2FWSA 1X5MA 4FQHB 4HGWB 2VSMB 3LHPH 3QEQD 4PR5A 5KZCB 3KLSA 4AEFA 2VC2B 2EYTA 1OCCB 4IJ3C 1Q9KA 3SDDA 2GFBA 5F93C 2J6EH 2ZXAA 2H32H 4PJGE 3DRQB 4MWFB 4OCWH 5L2JA 1MPAH 1OGPA 3B9KC 3C5ZD 3V6OE 1HE7A 3AG2B 3O9WD 4KY1L 4APQC 5CEXA 1S7SA 2AJZB 1U33A 2HAZA 4GRLA 5D7LA 2OI9B 2CGZA 4IBTA 3ETBF 3FF7A 1SLUA 4ZX4A 1NCTA 2EIDA 4HEPA 4JJHA 4UNVA 3P73B 2OSLA 3SCMC 4HUCA 4R4BB 3QQ9D 5MHSE 1S46A 4F7EB 1MIEL 3WNPA 3OTTA 1J8HB 3EYVA 3O2WH 3FSVA 3ZE0B 3L54A 2XPGB 3UERA 1FVCB 1D5XA 5D93B 4QHLB 3FN3A 4WUKL 1UOWA 4PRNB 2VDRB 3V9EA 1VFBB 3QJTB 3CWGA 5I1CH 3FU5A 3IMWA 4F37K 4ZMYA 1AO7B 3CPLA 3QEGL 2AZAA 2OI9C 3QXAA 1CYWA 4OBSA 1IEHA 1JTPA 4LSDA 2GJJA 4DQAA 3Q8CA 1Q9KB 3N6YA 3PV6B 2GFBB 1K4CA 1J7VR 5KWYC 1INEL 3OMAB 4DEUA 3LPWA 1AI1H 1UH4A 2A77L 1S7SB 2XV2A 4PLKC 3OMZA 4JW3A 5D93C 4GFTB 3SE9L 3HRZA 3LRSA 3UAJD 3BQVA 4KK5D 3ULVC 1KGCE 5HYSG 1YQ2A 3W81A 3CFKA 3PJNA 1MHCA 1IAIL 4DGWC 4ALAL 3EOBA 5H8DA 3VFWA 3L9EA 1BOGA 3GT6A 3ARGB 1UYWL 4PGDB 5AUMA 2DYPD 3GIZH 4WHCA 5IROC 2A9NH 4AQAB 2DIAA 3QEQA 4RQQA 1ASPA 3FO0L 3IRCA 1NAMA 3N42B 4M5ZL 4ELKA 4URKA 1X5IA 1NCHA 5EH1A 3O81A 2MCPL 4G6KH 3C5ZA 4CVXA 1K72A 3R06A 3M17B 4LLYA 5BV7C 5KOVC 1SDYA 4FFYA 4OM1H 5D1QD 3EO0B 3FZUC 3PGDB 5FO9B 3ZL4H 2AABL 1JXGA 2P7TB 3OKOA 1MIMH 4KMLB 3II3A 3BKCH 1XSIA 2Y7MA 1SOQA 4FFVC 4PJGF 1U3HC 4ZBJA 3T1FA 1BEYH 5AYUL 3VE0B 3I2CH 2J44A 4FE9A 4JPSA 3QEUA 5ADPL 3OSVA 1MFDL 2BHYA 3FQTB 4LSQH 3HOGA 3QI9A 4WEMB 3ULAB 5DHYA 3T0EE 2ICWA 3O6ML 3QWRA 1NCAH 1WH0A 4G3YL 2UY7B 4G8GE 3CVBA 4FQQB 1XGTA 3DGDA 4W9LC 5JR1H 3AQDA 1DJWA 3QEQB 5DS2A 5BVJA 2LLLA 3AT8A 1NAMB 3CHRA 4DUVA 3N0PB 4UU9A 5E8DH 2AEPL 5HDBB 4IRZL 3GDCA 4ONFL 3F6LA 2WTRB 1HKLL 4FLHA 4B9YA 3C5ZB 1HHIB 1JK8B 3UO1L 3O9WB 4N90E 3W1ZA 4LLYB 3SD2A 3GSQB 2NY7H 3INUH 3GSUB 4U6XA 5L6YH 1UA3A 4JFDE 4XAWH 4X9YA 5CILL 4ZTOL 3NJIA 2XXFA 1JGEB 4HJEA 3H9HB 4RFNC 1P7QD 2AQPA 2H0FA 4I1RA 3FO1A 5KVMC 2QELA 4HIEA 5FLVA 2WWKO 2P5PA 2R83A 5GRJL 3BI9X 4MD5B 1ZKAA 3H2WA 2YAPA 3S35X 4DPRA 3OKKA 4PS3A 1G7IA 5CCJA 2ICWB 4OH2A 5DZ9A 1RK7A 3O9WC 4NO0D 4Z7IA 1CBJA 3HC4H 1CGYA 3EH3B 1XGTB 5FHBL 3MBWA 2R69A 2UYLB 1AZUA 1TTCA 1KV3A 1PX4A 2YLKA 1F5WA 1L4IA 4HEME 2VLLA 3ML8A 4LEOA 1VEPA 4JR9H 4KJYA 2DBJA 3JTTB 3UBFA 3PAUA 3SY0B 3I02B 4Z7OE 5HDWA 4Q6IA 4UTAA 2XQYK 4XC1H 3MXVH 3SE6A 5SV3A 3MRBB 4OCRH 1SHXA 3UBHA 2Q5BA 2BSSA 1JN6B 1I4FA 5H37A 3BP7A 4G8EA 4X9GA 1HESA 4YDMA 3FO1B 5T5FA 1AYRA 4B41A 1NGZA 1T0MB 3ZY7A 1R5WA 4ZMZA 2EE9A 4YHNB 2DYPB 2K7QA 4NNPH 4WO0A 4EXPX 1ONQB 4OGXL 3O3DB 2XVBA 2EXWD 4Y16D 5E1AB 4LSRH 4Z3IA 2YBRB 4PP1C 1MG3C 2E56A 4JPWH 4PV8A 3TBSA 3L4VA 3RWIA 3UAJC 1EAPB 4U1HA 4KK5C 1E8WA 2WXHA 4G42B 2VLLB 3FU3A 2A9CA 1QO3B 1XSJA 3D25B 4HAGA 4LEOB 5D1QB 2PTUA 4OI8A 4NUGH 2CRZA 1PFCA 4IOFD 3F58H 5IK3B 4XNDA 1P7QA 1KG0A 4YXKL 1U93B 2O5YL 1PS3A 3BESR 5KYYA 3RBSA 5HGHB 4GXUM 5AVQB 3U7WL 2PTTA 3D18A 4WI5A 3UFIA 4F92B 5JOPE 4MJ6B 2DQTH 1OW0C 2EC8A 3BP7B 4FNLH 3LRGA 5DZPA 3WIFB 3FB8B 4U0QB 3I84A 4OI9A 2G5RA 4LHUA 4NO0A 5D9SB 1E9QB 2Y7NA 2OJEA 3HEIB 5KJRL 4YIQA 5D1QC 4A39A 4P46C 1BIIA 1JYNA 2CIIB 4M8QB 4EUPH 3OKDB 3HZVA 3R8BB 2JELL 1KIRB 2E6QA 1MHEB 1I1YA 2JI1A 2VDPB 3DV6A 4E9RA 1FGNL 3QRGL 1JRHH 3TBSB 5DHMC 3DLQR 3NIGE 1UWFA 1B0RA 3T8XA 5DQDL 1PY4A 3LNHA 4I5BB 1GYUA 4R4FH 3MUUA 3V4UL 1UD6A 2VR9A 1P7QB 3LVEA 1ZJBA 2A73A 4Z7OF 4NKMA 4BQ9A 3WEAA 4MDJA 1T04A 2XA3A 4JQIL 1TCRA 2AJYL 1PQZA 4CMMA 4KHTH 2TRYA 4MAUH 1J5OL 4LL9A 2OM5A 2VUOA 4BEIA 2PCFA 4P57A 1B9KA 1XXFC 5EC2B 1IO4C 3VXRD 4Y16A 3HKFA 2L7EA 4YFDB 2YJQA 5E6RB 1WTLA 4NO0B 3GTTA 2RALA 1NCWH 4OJFH 3B8SA 4CL7A 1NZRA 5JHAA 3MLXL 1GTNA 1EBPA 2OFQA 2YXWA 3GGWA 1S9XA 2V5TA 3PWPE 3T2LA 4J2XA 3F3HA 1J1OL 5KSBE 5FCUL 4PG2C 4Z3TA 4HWUA 4YHZH 3QT2A 4ZS7L 3DV6B 3P2DA 2VN7A 2HG5B 3LOWA 3TJHD 3V8CA 2WYTA 4XZUB 2YAOA 1QABA 2VDKB 3FN9A 4GQZA 1BZ9A 4MZ2A 4WUUE 1DJZA 3BMVA 4GMSL 2FK9A 3ZTCC 3ARBD 3QC5X 2R1WA 4JO1H 2CHZA 4HK3N 4OF6A 5J6GA 1K2DB 5D70H 3SO5A 2PCFB 3DIDA 2MQGA 4N9OB 3QZBA 3KR3L 4Y16B 1QVOA 3HMXH 2GABA 5C71A 4H8QA 4AGNA 5B39A 2JJWA 2JSFA 3C6LA 3QNYB 3DXAE 5F1NB 4YHYC 2BERA 2H6PB 3ISWA 4HJUA 1OAKL 4NHUB 4M9OA 4OB5L 4RFOH 5EU5A 4NUQA 5DQ9B 3BW9A 3UGUA 3SY6A 2VC2L 2C9XA 3UTSA 3VXNB 4JVUA 3STLB 4AH2A 3MRCB 3MRKA 2AGJL 1CN4A 4M29A 2KMWA 3JTSB 1E9PA 2A99A 5K39B 5IBUG 3TPKA 1NMCB 2GUOA 1U3NA 2VDOL 2CD0A 2AV7A 1N9PA 3IMRA 3EJQA 2ZSVA 3NIGF 4RMUA 3TXAA 3H42H 1UCTA 3ULUD 1TQVA 5F70A 1C08A 2AEOA 3BZ5A 4FLQA 3N50A 2E46A 5DWPA 4HH8A 3WAJA 1K6QH 3VTMA 2EAEA 1CWVA 4QCIB 5J6GB 2FUQA 1JPFB 3RI5F 3CSPA 3AB0B 4AZ8B 5MENE 3ARRA 4HCGA 3DX1A 1TTBA 2VDRL 3IXTA 3SODB 4IOFC 3ULVL 5I1HL 1BQHA 3B2PA 1HYSD 5K9JH 4ZS6D 1R0AL 1HCVA 3MZGB 2YZ1A 1K8DB 3MRJA 5DZVA 4YVUA 3RYMA 4MB4A 4LLWA 1KCLA 4DPCX 4N2LA 1SF3A 5CF3A 4WEBH