2H41A

Solution structure of the second type iii domain of human fibronectin: minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
95
structure length
95
Chain Sequence
GPLGSHLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin
publication title Interdomain association in fibronectin: insight into cryptic sites and fibrillogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 12
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h41A00
5D93B 3S3SA 1E4XI 1QZ1A 5KJRL 1N5YH 4HJ0C 2XQYG 1XIWD 5IMOB 1LNUA 1AO7D 3FB5B 3OKLA 1RJYB 4FZEL 4NWUH 5BW7A 4OIBA 1JF1A 4HLJA 3JTTA 5DLML 2IBGA 5DJZA 5FK9B 2EXYD 1BX2B 2EDDA 5I73B 2R0ZL 3VA6A 5I1LA 4C55A 2Y07H 3FN0H 1CFVL 2EDTA 5EULV 4EXPX 5JUEH 1NLBH 2C7UB 4FRWA 1G6RA 3EOAA 1I7UA 4PB0H 5LCVL 4MDIA 3KLHC 1IGYA 4NO2A 2VITB 1U91A 4HUVB 2AABL 5AZ2L 1WV7T 4JFDA 2NY7L 3O2DA 4LHQB 1R3JB 4LNVA 2WINB 2B1HH 3EJYD 5C09E 3KYKL 1ACZA 2AVGA 3WO3B 4WVRA 1BZ7B 1R5IA 2ZOKB 3P4NB 2CJUH 2WK2A 1HHJB 4NQEE 4NQSA 5BV7H 3F7RA 3FT2B 3P0YH 1IM9B 4NNXA 4ZDHB 4TVPD 3MXWH 3UBXA 2BNQA 1R3KB 3K1KC 5EU4B 2YZ1A 3UYPA 1QACA 3B9KA 3U0WH 5GS0H 2XN9A 5JORA 1IL1B 2OJZH 2E9WA 1IAKB 4F9PC 5JOFA 3B2UD 3RWGB 3KR3H 4S1DC 4X6FB 4Y5VA 4F7MA 3UTTB 1JHKL 4MZ2A 1XIWB 3V4PH 1N59B 3IS1X 1S7QB 4W4OA 1FN4B 5FYJH 1AO7B 1KF9B 3H7LA 3C6LA 4L4TD 3IRPX 1QQDB 2B1AH 2UZIL 2CIKA 3SDAA 5T1DL 3WHE0 5C0JA 3IJYB 3B43A 1DQQA 4KHXH 4MZ3A 4E42B 1FL3B 2AK1H 5IB2A 2QSQA 4DN3H 5IB1B 2QL1A 4L1DA 2X09A 3H6JA 4R2GC 1TPXB 1A7RH 2AI0L 3N9GL 2J2ZA 5ERWB 2DYPD 3V6OC 4POUB 1UXWB 5BVJB 2APVA 2EXWD 5HDOA 4NN5C 1WBYA 1U92B 3PHOA 3TZVA 1MQKL 4NPYB 3C6SB 1R24B 3IYLW 4JM2A 3STZA 1C16B 4N9GB 1LE5B 4O51B 2EDNA 4YBQC 4P4KA 5IVXE 1NGWA 2WP3T 1CFSB 4KAQL 4HIEA 3S88H 5BS0E 3PGDB 3PQYD 5JW4Q 1UWXK 4K71B 4NRXB 3ULVE 3RBSA 3AAZA 3ARSA 1MH5B 3OZ9L 4RRPG 4K8RL 3TM6A 3BN9C 4M48H 4HG4J 5I18L 1JTOA 1CFTB 4JQXC 4NNPH 2A77H 3KPNA 4JZJA 5T1KA 1CXIA 1NAML 4YK4C 1D5MA 4OT1H 3O3AB 1FLRL 4K7PH 5AUMA 5EB9A 1MJ8H 3L5JA 4L3EA 4PRHB 4HDIA 4YHZL 5J8OA 1MCPL 1A6UH 4UIMB 4PJHE 1MCJA 4LOUD 5ICXB 2H2SC 4F3FB 4HWBH 4L4TB 5A3ID 5J9PB 1VFBA 4F8QA 5I1AA 5HPMA 4OZIF 3UBXI 4NHUB 4BFGA 4WHTA 5B38B 4YDJB 4N0CC 2ZUVA 4D0DB 5ETUB 3VFOA 3WE6B 5F7EL 3P9LA 3TIEB 3EDDA 12E8H 5ADPH 1P7QD 1FYTE 4HS8L 1CIDA 2XACC 4UINH 3QHZL 2P5ED 4MB4A 1NPUA 4AG4H 3QUZD 5I1HH 1HH9A 2BVTA 1BQLH 3HCVB 5CP7A 3CZFB 5MHSE 4PTUA 1WIUA 5C9KA 4KJWD 3TBSB 3MRMA 1OSZB 2E8YA 4G7VL 5IMMA 5KG9A 4Z7QE 3T4YB 2O5ZH 4JQIL 2VXTL 3PQYB 2GTZB 3FRPG 5JLZA 3RNQA 3Q5TA 5LBSH 4LARH 2OJEA 1GZQA 3QULB 1N26A 1N6VA 1QR1A 4MNGA 4Z6AT 1K3IA 4HK0B 3OR7B 5BW7C 3BAEL 4NRZB 4U6XB 3VGEA 1C08A 3BW9A 1RPQA 3LH2H 4TNVF 5DUBB 1HQRB 4Y4HD 3ECBB 3T04D 2AJUL 5EU5A 4IM8A 2B0SL 4JAMA 3WLWD 2X1XR 4YC2B 4D8PA 1ND0B 2IPKB 1G7IA 3KAAA 5BRZE 4OZGF 3BPNC 5CHNA 4YDLC 4X7DC 5CJ8A 5ESAB 1FO0A 2MHAB 3GSNH 4AIOA 3NTCL 4YXHH 2YPVL 3X11A 2BNRD 5T1LB 1EGJH 2P4AB 1MWAB 1WAAF 1P7QB 1S7RA 4KKBD 4N0YH 1GRWA 1JVKA 3RZWA 1IC7L 2YD5A 1QLRB 1KJ3H 4HH9B 1LP9A 4FFVC 4DKEL 2GJJA 4YEFA 5IFHL 4QXUL 4LKXA 5EIVA 1KCLA 2P5EB 4YIQB 3CFEA 2X05A 1QD0A 2FBJL 4XNQA 5DXWA 4L4VB 4ZSOA 4N9OB 4MJ2A 2VUOA 2BDNL 2DLTA 3B9KC 2X4UB 3LVEA 4NUGL 4QY8B 1C8PA 3E6FB 5HHXL 4JKKA 2W65B 1BD2A 1E28B 1YN7B 4XXDA 4DZ8B 3DXAE 3HZYA 2UWEA 4Y5VC 3QZWB 4BH7B 4U1HB 3C5SA 1WIOA 3SKMB 3T65B 4HGMA 4KHTH 3MV11 3EOYG 4EN3D 5L6YL 1AI1H 3MRHB 3F5WB 3VXME 4IRZL 1MFDH 4W4OC 5CZVL 3C6LC 2BSRB 4PRDA 3WFDL 1CFBA 5IMLB 1BFVL 4KDVA 3T8XA 3GUTA 1H3PL 1IC4H 3KHOA 5GZND 4G3YH 4Y4HB 3SDAC 4ELKA 3K46A 3HUJF 3L7FA 4RMVA 5I1EL 3FONA 4DVRL 5KVEL 4Z9KB 3AS1A 1MCBA 3C09C 2X4RA 4O2FA 4WFHE 3HKFA 2JCCA 4U3HA 3LPWA 3OSKA 2EDEA 3NFNB 4G6JH 2Q7NA 5JPNA 4F7TB 3T4AB 2J5LB 4LPTA 4P2QB 4QRTB 2YEZA 3BWUC 4UUJB 4DOHE 1MCOH 2E3VA 2A0LC 3EFFB 3ULSA 4OCMC 5T3ZH 4XP6L 1MJ7H 2HT4D 2NY0D 1RUAL 3TZVC 4GW1A 4JM2C 5EFIB 4N0FA 5D72L 1RK0B 4LLDA 4I0CC 3AXLA 4D9QE 4PD4J 4P4KC 5I75C 2BX5A 1BQUA 3WIHH 3GKWL 1RZGB 3O9WD 4HK3J 4PFEA 1X4YA 2P42B 3HNVL 3O41A 3CDGB 1YDPB 4K8RD 1B0WA 5AAWA 5EBGA 1REIA 4ZS6C 3QXWA 4XPTH 2Q86B 3RAJL 1JF6A 2HFEB 4O58L 5DO2D 4XVSL 1KLUA 4XCEA 1DP0A 1YNKH 5CS7A 4YBLC 2V6HA 4JZJC 2IC2A 4BQBA 3IB4A 4JM4L 5F1SA 1NSNL 5HYJE 3K4ZA 4CJ0A 1LO4L 4Y5YB 5HDQL 1ZT4A 3DBXB 4OCWL 3HLAB 3T09A 2YMXL 2J8UF 3VD5A 4S1QL 4HIHB 3T0EE 5F88A 4OCSL 3WNMA 1FV1B 4XNMB 1R3IL 4HUUB 1RIVH 4ENED 4JR9L 3W0WE 4G42A 3SKNA 3RX8A 3T0DA 1BBJA 1KTKE 4JPKH 3NZ8B 3WS6A 3F7VB 3UZEA 3S37H 3EDFA 3PWNA 1QVOB 3BXNA 1H8NA 1MPAL 2VH5L 3G6DL 4RMTA 3QH3A 2PCPA 4PGDB 4H1LG 2V7HA 5L2JA 5CLTA 2NZIA 5L0QB 3HI5L 3V2AR 2NY0B 3W39A 3ZHLA 1F4WH 4N5EC 4HMEA 4PJAB 4K23L 1KXVC 4XX1G 4LSSH 1Q9OB 5GISH 5CEYA 3QP3A 4F9LA 3O9WB 5IKCB 2HLAA 1ZLWK 1HDMA 4Z95L 4KFZC 2QQQA 5TF0A 2AEPL 4X6EB 2F19H 4MJ6B 4J1UB 1QTYT 5I1JL 3NACH 3MPCA 5ID0B 3I75B 2J6EH 4X7EC 3G08B 2Z4QB 5E9DD 1G9EA 1ONQB 4HX1B 3GMMB 1D9KD 3D18B 5HHPB 2P1YA 4XPHL 3C8KB 2IPTL 1NMBL 2XG4A 3B5HA 3SE8L 1UXSB 5TE7L 4MQSB 4Q2ZA 3U9PL 3WL9B 2DDQH 1YPZE 4PG9B 1GIGL 1SVZA 2PR4L 5CUSL 4DUVA 1F00I 5CSBA 2RB8A 2A9MH 3PHQA 5CJQH 4MA7H 4HKBA 5F1NA 4AIXA 4M1CD 3U4BL 1WZLA 4GKOA 4FMFA 2VLLA 5C0GB 1UACH 3BDXA 1GGCH 4NQEB 3VFNA 2AEQH 3UROR 5DHYA 4JJ5B 1MAML 1CD1B 1WBZA 3QUXA 1A6VH 3MV9E 2ZSVA 5JNYA 4DGVL 3CLEL 1J0IA 4RBPK 4RFEA 3T0AA 2CSPA 2XXCB 2WIMA 3T3ME 4LHUA 2V2WB 1S5IL 4P46B 1P69B 5IR1B 5INDB 4LSPL 5DJ8B 4KI5E 3QWOB 1AR1D 4KTDL 3P4OB 5JMRA 2P7TB 1B90A 3VH8G 4QRRD 3LKPB 2P47B 1D5XA 4UQ2A 1U6AL 3E8UL 2Y72A 4FXKB 5E9DB 3GSNA 2AK4A 3SGEH 5F9OL 4OUUA 4FZ8L 1CLOH 1UCBL 2PTTA 1RUPL 3HR5B 1EGJA 5J13C 5I8CB 2MPAL 3HNTL 4JB9H 1QLFA 4GMSH 5BV7C 2HYMA 5DJYB 4GAFB 3VRJB 1GSMA 1FNFA 4PIRF 5E6IA 3RIFF 3IETB 1KB9J 4J3XA 5GS0C 3FO9B 1ZMYA 2GITA 3DTXA 3EYQC 1LK3H 2R39A 2X2YA 4B53A 1AD9A 4JEGB 3ZE0E 2I26N 5D5ME 3MNWB 4RFNB 1CGXA 3P4MA 4I48B 4CNIB 1H15B 1JHLL 3FMGH 4H88H 1DDHA 4GG6A 1J1OH 3VRLF 1MHEA 1T66D 3D85A 3GMLA 4ALAL 5J56B 4P5TB 1KC5H 4S1RL 3M07A 4WFEE 3DECA 4HKZB 4HGKC 3FOMB 1HEZB 4ZXBA 1CL7L 4KK6C 4IOFD 2LTQB 4J3VA 2F8VA 5E6ZA 1NBQA 3S4SA 3N0PB 3PV6A 1HHGB 1KV3A 4QRRB 5IK3A 2BMKA 3KJ4C 3FJTA 3K80A 3OXSA 1KJMB 4X83A 4F7EB 1JGDB 4I3SL 4IOIA 1FSKB 5DHVA 2V2TB 1FZKA 4D9LL 3D9AL 3UMTA 3TO4A 2FD6L 3WS6C 1I3UA 4OZ4B 3D0LA 2GW5A 3O45A 3TYGH 1VENA 2YUZA 2DQFB 3WIHA 3FB7A 3O6LH 3QDJA 3B9DA 1WSST 4I0PB 2FR4A 3EOTL 3PWLB 3RUGA 3VFTB 4G6MH 4RX4D 1EVUA 3MODL 3OQ3B 2XNAA 4XGZB 1OB1B 4BQCA 3QB7C 3V79C 3X14A 3O0RL 3A6CH 1PX3A 1BVZA 4F9LC 2YZ8A 4TSBH 3RJDA 3GHEH 3UCRA 4TRPL 1ZWIB 5C0CA 5D70L 5DA0B 2FX7H 5EPMA 1SEQL 2YS4A 4BKLA 1V3KA 1KIRA 4I18A 2BFVH 2G9HB 2W1NA 1X44A 4PRBA 1FVEA 3EGSA 3VFUB 1KIPA 1MWAH 2EE6A 2NX5A 1CGSL 4NO0A 1IGCL 4UT6L 5FO7A 3VI4F 2VABB 1EFQA 5C0AE 4PB9L 4Z78A 5GGRY 1EEUA 4MA1C 1Z9SA 5IMOA 3VI3F 4R96B 4RWYL 1TVHA 1ZA3B 4LDLB 1RJYA 4P5MB 3FZUC 4HV8A 4FHBD 4PGJA 1NGXA 4OF0A 1I9JL 3DX7A 3L95B 4ZNEE 3NGBC 5FK9A 5I1IL 1BX2A 3PP4H 2B20A 1JK8A 1MI5A 4O9HH 1S7UB 4R7NA 4WGWB 4LDOB 2V5SA 3HTLX 5E5MB 2F5BL 3EDJA 2DLIA 3TESA 3H42H 2YR3A 2QV2A 4G8GE 1BJ1J 5IBUG 3O2VL 4HUVA 3HZMB 1NJ9B 4QTIL 1AC0A 1GZPA 3ZE2E 4GMTL 3EJZD 4Q9BA 5CEZD 3QUXC 5KSVA 2NTFB 1EMTL 2J6EA 3ROOB 2YPLA 4TSAH 3MLZL 5DGRA 3P40A 3Q3GB 4BZ2H 1NCCH 4R26H 4XVJL 1I1AD 1HIMH 5FF6A 2FL5B 2DLEA 4WU7B 3SKOA 2PW2B 3DXAB 5EOCH 3DUHA 2CXKA 1JWUB 3ZSTA 1R3KA 2MCG1 1NEZG 2HJLB 2A6KA 4JDTH 5E70A 5C1MB 5ANME 1OAKH 4NP4H 1AY1H 4DW2L 4LPXA 4WI8A 3ZKNC 1AD0A 4YDKH 4X6CB 1IAKA 3ARRA 3NA9H 4Y5XA 1B4JL 3RWGA 4X6FA 5GSRB 3U1SL 4ELME 3UTTA 4KTYA 1N59A 1JZ7A 1S7QA 5MENA 2LAAA 1XF3A 1T1YB 4ZUVB 1PG7L 3ARPA 4UZGA 1QQDA 2CO7B 1Y0LB 4Q9QL 3OGOE 4XNZB 2DM2A 1U8LB 4PJBF 4KRNA 5DVNA 5I15L 5E6IC 4XI5D 1FL3A 1QO3A 3TWCH 2X44D 4OIAA 5IB1A 1MLCB 3IFNL 4TULH 1QYGH 4JFZL 3FQUB 5H8DA 1LO3H 2FEEI 1WGOA 3QNXB 4NQVB 3TEUA 1U92A 1QFWM 3MUY1 3BH8B 2Z91B 5D96C 4NPYA 1NDGB 1R24A 3IFLL 2VQUA 3DYOA 3VXSA 4PJGF 1M7DB 4N9GA 1J0KA 4YXKL 4O51A 3SKUD 3KHQA 3ELAT 1CFSA 1T03L 1QSEE 2ZJSH 2E6QA 4ZXBC 2RGSA 4I3RH 3SDDB 2AXGB 1BWMA 3CLFL 5E1AA 3T0EB 1MUJA 4D94A 3ARBD 3MSPA 4JRWA 1CFTA 5C7XL 5I9QC 2ARJB 1RZ8B 4HUMB 4L9LA 1KEGH 3W0WB 5KOVC 1A6WL 4PRHA 4OLYH 4AYFA 4QO1A 1C12A 3NZHH 4TTDC 3TO4C 4KK5C 5ICXA 4F3FA 3KPLB 2P44B 1GOHA 3UPRB 5C86A 1DBJL 4XBGB 2BVOA 1ORSB 4F37K 4PY7A 3L5IA 4PYGA 5EOQH 5IHBA 2YHGA 4XVUC 1LGVA 4LSUH 4NHUA 4PRIE 5B38A 3D6GA 4D0DA 5EU6A 5ETUA 3WE6A 4KU1A 1NC4D 5LQBH 4PJ7A 3TIEA 2X4OB 5H35B 5JPMB 1ZAGA 4NKOB 1JNLH 1IQDB 2VDMH 4HIXL 5DD1L 1FNSL 2HFGH 4NGHL 4KV5E 5F9DC 4UDTB 1WZ1H 5HGGS 5E8DL 1J0HA 3WNLA 3E1F1 3IFOB 1CI5A 1N5AB 2JLLA 4LSQL 1FZOB 4JO1H 4MVBD 1U3HD 4J3OC 3HCVA 3CZFA 1EO5A 1RZFL 3RGVB 3TBSA 3UTZB 4XCFH 4AEIL 1MCDA 3T4YA 5D2LE 2W0KA 2X89A 3OXRA 4RGNC 2VXQL 4P3DB 3W11D 2GTZA 4H0HB 5TE6L 1NDMB 3QDMD 2CKBB 4I1NB 2I9TA 2KQNA 4XP5L 3EYOB 3MOAH 4KKAC 4N1CA 4HK0A 1KIQB 4KVNL 5IROA 4NRZA 2EO1A 1JGUL 1Q1JH 5DUBA 3BPCB 3GB7B 4NDMB 5IFJB 3MLVL 5I73C 4ZO8A 5DT1L 3U46A 4JO3H 3SGEI 4XHQA 5C70A 1T0NB 4W68A 1ND0A 1E4KA 4MX7B 1NMCB 2LU4A 2IPKA 1ORQB 4JPIB 3BZFA 1MF2H 3VWJD 3UAJC 2FIKA 3VDCA 4XBEL 1SJXA 2A73B 3P0VL 3QJHB 4XNYH 4HF5L 2HTKD 2ZUUA 5T1LA 2JJUA 1FFOA 4WFFD 1LO0H 1MWAA 1H0DB 1ZHBB 4OI7A 4OZHE 1EJOH 1QLRA 3PJSB 3CX2A 4FQIL 3RRQA 4IRSD 4R4BB 2ZUQC 1DEDA 4YIQA 1ZHKB 1U3HB 5TQ2L 4L4VA 3BP7A 2X4UA 1CE6A 4OM1L 1XFPA 4F7CB 2W65A 4D9RE 1E28A 1YN7A 2E8ZA 5HVWA 4DZ8A 1G9NC 2NNAB 3VXPA 2E7CA 1RUQL 4OGXL 3BGMA 4U1JB 3MRHA 3F5WA 2GEEA 3FQNA 1EHNA 5A2JH 4JY6A 2NW2B 4JVPA 1IC1A 4JPWH 2DLFL 5FECA 5IMLA 1F97A 1GHFH 2V7NB 4M93B 4MAUL 2EXYC 2ADGB 4YQXH 15C8L 3CXHK 4L3AA 3I02A 4Y0GA 1IILE 1W8NA 5H94B 4N8CH 3T4AA 4P2QA 4QRTA 1TPXC 1DQDL 4FQXB 5E00A 4UUJA 3EFFA 5D5MB 2DI9A 3L3HB 3W9DA 4NN6C 2HH0L 5HGHB 4X99B 3QIUA 1JZ6A 4JPVH 5FM4A 5MEPB 4GAYB 3QIBD 5EFIA 1RK0A 4XC1L 2APWA 2JIXD 4YHKH 3MLRL 5F9AC 4IRSB 4KUZL 1IAOA 4YFLF 3Q0HA 3BJ91 2EC8A 3CMOH 1AKJD 2OL3B 3CDGA 5J11B 4K71C 3MRNB 1MRCL 3CXDL 4FP8H 4WHCA 1HCVA 4J8RB 2HRPL 3MREB 1DQMH 2VDOL 2HFEA 1YEFH 3GSOB 3BP5B 1BBDL 4HJJH 1K6QH 5FDWB 3ZKMC 1IC5L 4R9HA 1KFAH 1A7BA 3GSRB 1KJ2L 1YMME 4GRWF 4PJDF 1AR2A 3DBXA 3KPRA 3LB6C 5AD0B 4UB0L 5I1KH 4XCYB 3THML 4PJ8B 4M6MH 2ZPKL 5DQDH 5GJTH 4OFKA 2VZSA 4HUUA 2ZG1A 4OCRL 4R7DA 1OGAA 2ADIB 4YX2L 4LRNL 2F74B 3PP3H 2EZ0C 4MS8C 1QBMH 3S34H 1IQWL 1FGNH 4PTTB 2DQDL 5C08D 4ONFH 4Y2OA 1QHOA 3RFZC 3WNKA 5EO0B 3NZ8A 1MIMH 1FAIH 4X0KB 2EDQA 3L5HA 4M62H 1CICD 1F45A 4HXBH 4AY0A 4TUOB 2XWBA 4Z7VB 3VXUE 1E6JL 1I3GH 5I76A 3DGGA 1RAMA 5D6DA 3MLWL 5GHWH 3FO0H 1OT1A 2EXWC 2H3NA 3BKCL 3FQRB 3OPZH 1RFDL 3FOLB 3VXTB 1X5FA 4RMQA 3S3PA 3QIBB 1J11A 4RQQA 4O02L 2GI7A 3MGTB 3O3BA 3GSQB 2H2PD 3LEXA 5C6TL 4WI7A 2NYYC 3QXDB 1CZ8H 3Q5OA 2VC2H 3MRBB 2Y5EA 4OFYD 1BAFL 3B4NA 4JDVA 4KY1H 2OR9L 1HXYB 2Q6WB 1GCFA 5F1KC 3CU7A 1KTDB 4JKLA 3L3GB 4MJ6A 1JJUA 4MA8L 2CLVA 1DLHB 3IXAB 4TQEH 3I75A 4OQ1A 2IEPA 3DX6A 3MBXH 3V6ZA 1S7SA 4R97B 3D2UD 5IROC 3SDXF 1K4CB 4P2YA 4HX1A 3GMMA 2VXSH 2W9DH 3D18A 3K0WA 4ZG1A 3BD5A 4OLEA 4HFUH 5ESVB 5JXEA 2X5PA 4YC2C 3U82B 4JREB 1UXSA 5JDSA 5JOPE 3WL9A 4G8GB 2NY5L 1E4KC 1CDBA 4Z5RB 1VGEL 1TXKA 1UZ6E 2F54E 3U6RA 3QUMB 5C08B 3SGKA 2JCCF 1A7PL 2VIRB 4DKFH 5T1MB 5HY9B 4ZO9A 3GM0A 4N0UE 1KB5L 5TGBA 1CICB 5F9JA 5C0GA 4H8WC 1EDQA 4NQEA 3DVIA 3MRRB 5IUSA 2VXUL 3P77B 5ALBL 4NKDA 4U3XA 2NY3B 3X13B 4PV8A 1YEJH 4U1NB 2J3SA 1UWEH 3GMPB 1IGFH 1MQ8A 5I8OH 2XKUA 3DHJA 2V2WA 5EUOE 4P46A 1P7HL 5ITFA 4MQ7A 3V5DA 1WZMA 4XCCH 3VGAC 3ARZA 1H3TA 2FB4L 4U7SA 2VXVL 3P4OA 1T80A 2P7TA 4NHCH 4U1LB 2DQJH 2CD0A 3FL7A 3GRWH 5DVLA 4Z7UB 1QNZH 5HYSG 3LEVL 3WDIA 2UY7A 2GQHA 3D2UB 4FXKA 4L8DA 1UA6L 1WFNA 3AB0B 2AJZB 4LU5H 2K1MA 2IMNA 5I8CA 1SM3H 1ZHNA 2BSTB 4JZOB 4XH2A 3V7MA 2VUYA 1MEXH 2D4FA 2X1WL 2EDKA 3QRGL 3RVXC 2RHEA 2ADJB 5GIRB 1TTFA 3DNKA 4X98B 5DJAB 3QIUC 4QNPF 1U42A 3FO9A 1KPUB 1IE5A 3OTTA 3CK0L 4M6OL 3QEHA 4ERSH 2A74A 4I9WE 2D7TH 1A3LL 4ONOA 3W2DH 5FGSA 5IVXA 1YEKH 2AXFA 2WQRA 5BS0A 1XGPB 2Z92A 5DZOA 1F3JB 5SWSD 1PJ9A 3DI3B 4P5TA 1C5DB 1X6LA 4GAGL 2VDRH 3QYCA 3FOMA 1HEZA 4ODSH 1ZGLA 1KELL 2HJFA 3V0VA 1U8OA 3AROA 4OJFH 4XNUL 4PJHA 1OAXL 2P49B 1A1OB 1HHGA 35C8H 4OF8A 3UTOA 1F58L 3TH3T 4ZFOL 5C0DB 2GAZB 3S9DB 4GUPA 1S9VA 2FDBP 4OSUL 2DQEH 4LLAA 4YO0B 2WBJD 1JGDA 1QFUL 3QI9D 4F7EA 3KPOB 3HC3L 1J8KA 3BIBX 1GC1C 2DM4A 2V2TA 1FG9C 1X9QA 2IAMB 2DQCH 5IHUH 2Z31B 2Y7QA 4HS6A 5JIKA 4ORZC 2C1PB 4AMKH 2OZ4L 3IGAA 1TQCB 4UQ3B 3V5HB 2QTEA 4JG0L 4X5XB 3CFBB 1TJGH 1ZK9A 2DQFA 1FYTA 3EFDH 1JMXA 1Q94B 5F44A 3F62A 4Y8AA 2F53D 1JNNH 5D6DC 1S7XA 4I0PA 3P2TA 1E4WL 3PWLA 4PRPD 5TFSH 3U7YL 2ARJQ 4RWHA 2YA0A 1L6ZA 4Z8FH 1FZMB 3BKYL 2IBBA 4ODVL 3OHXB 2G2RA 3OKEB 2VSDA 1A3RL 3G6JB 4NRYA 4XGZA 1WUNT 3OJDB 3D25B 4AQOA 5KAQG 32C2A 3MV8D 4YHMH 4A6YH 2H41A 1TCRB 4YPGB 5D2LB 4DUXA 4M7KH 3D39E 3P9MA 5DD3H 5C8JB 5FV1L 3TIDB 1ZOXA 2OXGA 1A6ZB 4R8WL 6FABL 5IVOA 5FHBH 4R3SB 2EIZB 4XPFH 2G9HA 5D7LD 5DO2C 4X9HA 5F89B 1ACYL 5F97E 5H37G 2CDGB 4XMPH 3MO1B 4NJAH 4G8FB 1EHLL 5EORL 1U8HA 5EZLB 1IJ9A 2M26A 4KKNA 5FYLL 3MRJB 5DEFA 5DD0H 1KCUH 3RU8L 3TCLB 5HGDA 1LE9A 3O3DB 3DYMA 3VRIB 1Y18B 1YECH 1ZA3A 5JXEC 1I3VA 4GAJL 3KVQA 4XHJC 4P5MA 1NANH 3QI9B 3JVGA 3R1GL 3MBED 2R8SL 2R2HB 3FCTB 1UKSA 2ERJB 3SGKC 5BRZA 2EE2A 3TYFB 3CVHL 3KYAA 4XP9H 3L1OL 4JFXB 5E5MA 1TIUA 3EYSH 4L8CA 4BH8B 1MFCH 3NCEB 2W0LA 3MLUL 3HZMA 4R0LA 5JZ7D 1NJ9A 2DKMA 3CC5B 3DHMA 4HPYH 4EDXA 3F58H 2FNBA 1I8MB 4BA8A 4LSVH 5JQ6H 4PJEB 1AXSB 2E27L 2JJTA 2OTUB 3MV8B 3Q3GA 1J8HE 2D7OA 3V5KA 1TTGA 4GT7A 2KQMA 4ODHL 2FL5A 3GHBH 2BHZA 2PW2A 3DXAA 4P46C 3HE6A 1JZ2A 1IAIM 1Q72L 4XT1C 1U8QA 5DUPH 2WM0A 3VGFA 3VXMA 2HJLA 4M9OA 1NGYB 4PV9A 5LGHH 4IOSD 4PJCF 1RZ7H 5D7LB 2NW3B 4N5UA 5TDOA 2VDNH 5F96L 3JWOL 1ZVSA 2D03L 5EBMA 2PETA 1ADQH 5MEOA 3U79A 3WJJA 3FFDA 5FV2A 3TBWB 5F9WB 2OL3H 4YHNA 4PD4K 4WWID 1NCTA 2B4CH 5GGTL 4ZUVA 3WFBL 3GJFK 4HBCH 4OBRA 5E2WH 4IJ3B 2ENYA 3DIFA 4JGUA 5F7HA 1L7TL 5FXCH 5LAXB 5TQ0H 1DL7H 4CADB 4QGTA 4JFHE 4RAUB 3M8OL 4ZFGH 1E4JA 5BVPH 5ENWB 3AMKA 1MLCA 5CIPB 1RD6A 4M1DL 4X80L 3VGBA 1XAUA 1OAUH 4X9BA 5DJDB 3BDYL 2XQYK 3H3PL 2GJZB 3QNXA 5GSVB 2ZOLA 4NQVA 3ULVC 4JN1L 3BH8A 2Z91A 1L0QA 3GRWA 5D7IB 1N4XH 1NDGA 1T2XA 2F8OA 4WCYH 1DN0A 3GSWA 4P5TC 3DURA 4ODXB 3CH8A 2VDQL 1BQHA 4EXKA 4YWGH 1RVFH 2ILLA 2PYED 3JV6B 1HOCA 1UH4A 4LLYA 5L7XL 2J4WH 3INUH 5HYJA 3IF1A 4QOKE 2LTQC 3SDDA 2EICA 3I6LE 2C1OB 3DMMB 3T0EA 2F5AH 3WSQH 1T4KA 5EZIL 1UB5B 4JJHA 2ARJA 4V1DE 1JPTH 2RBLA 3QHFH 2VAAB 3W0WA 1D5IH 2EDLA 3BEVA 4LVHC 4F33B 4KVCH 1FSKC 1YNLL 3IFPB 1HSAB 4JO2L 4KTEL 3I6KB 3KPLA 2DRUA 2HKFH 3UPRA 1D5ZB 1U0QA 1ORSA 1CD9B 4FQJH 5F1IB 4YR6A 3VXUB 2DWDB 2NLJA 2P5WD 3LKRB 3LZFH 1DBKH 4I0PC 4AL8L 1IEBA 1RSFA 4M7ZB 2X4OA 4KKCC 4NKOA 1KCRL 1FORH 5I1GL 3MV01 2Z9TA 4G9FE 3S97C 5DTFA 3O4LE 4UDTA 3O4OC 4PJ5D 4RAVA 4TUKH 2DQUH 5IT2H 3GI8H 4LCYA 4H5SA 4U7MA 1MAKA 3CJJA 2OP4L 1M1SA 4JGJA 3TBTB 5GS1A 3SE3A 4WGVB 4JFFE 4DFIA 3RGVA 5IB3B 4LLWA 1RHFA 4LASH 4WY7H 1DUYA 4PGBB 3AGVA 2PYEB 3FQXB 5I74B 4NQDE 3X3FH 4B7IA 4P3DA 5FYLD 4JY4B 1NDMA 3SQOH 5CGYC 1VDGA 3HPJA 4M7LH 4FABH 2K3TA 4R90L 4LF3A 1KIQA 4NZRH 3U7WH 4RFOH 1YPZA 2PO6D 2H6PA 2ZG2A 3JVGC 2F54B 3MJ9L 3EO1B 5CZKA 2NQCA 3BPCA 3GB7A 4NDMA 5IFJA 1PKQE 1OTSC 3ILQD 5TDNB 1MLBB 2GIYA 1S9YB 4JKPL 4HPOH 4A6YA 2VAJA 1T0NA 2EYRA 3P11H 4G8IB 4Z7NE 4MX7A 4MD5B 4JPIA 3FFCB 1RULH 2HT2C 5DK0A 2JB6B 4R0LC 3QQ3B 4O2EA 2CH8A 3WFEL 4MAYD 4ODTH 1A7NL 3DRQB 1F8TL 5FEBA 5HVHC 2ED7A 1EEYB 3MV9A 1QOKA 2CMRH 2A73A 2FX8L 3QJHA 4Q9RH 1MHCA 1NUGA 2R0KH 2JJTC 1ZHBA 3HFMH 2N4IA 5K93A 2ICCA 4MJID 1LDPL 2ATPA 3Q1SH 4U3CA 5ID1B 1RIHH 3N85H 3HE6C 3IVKB 4G8EA 3WN5B 3WKNA 4J12A 1BVLB 3TA3D 1OP3H 5KSAA 1BZ9B 1ZHLA 3DX9B 4J3WA 2QHRL 4UNTA 5HYEA 3PL6D 3VWKD 1IT9H 2NNAA 3C2AH 4JFOA 4R4ND 3WJJC 5EOTB 3UYRH 2IPUG 4IS6B 1YY8B 1JV5B 1NMAL 4PUBL 4OF6A 4P23D 1BQHG 1FBIH 2NW2A 1JPST 4J2XA 1NGQH 4OGYL 5DK2B 4XNZC 3MXVL 4OIIH 5I8KL 2V7NA 1AXIB 4HFWB 1WTGT 2ADGA 2BK8A 3KWWB 3SOBL 2XQBH 4PS4L 1MFAL 5CLWA 4JFED 2I25N 1G7HB 1KTRL 4YE4L 3RVVD 3CUPB 3TV3H 4FA8A 1PLGH 5H94A 1E4XL 3G5XB 1YYLL 5HVFB 1TCMA 4FQXA 1YC7A 2NXYD 5A2FA 4OM0H 4E41E 5I1DB 4ORGA 4YZFE 3LV3B 5D5MA 3L3HA 2HTLD 4J6RH 4CMHC 4Z76A 3PGFL 3O11B 1EO8H 4X99A 1MHHB 3ARGD 3HMXH 5JHDD 1A9BA 4EJ1C 5MEPA 3B9EA 1KLFA 5BMFH 2YK1H 3DO3A 3EO0B 3LPGA 1X5KA 1NUNB 1ADQA 2NY2C 4XC3L 1TLKA 1U3JA 2G60H 5DJ2B 4YPJA 2ITCB 4MJIB 2F9BT 4I5BA 4FFWD 2OL3A 2CRMA 1IGMH 2YXMA 3OF6A 3SDDC 1MREL 3PWJA 5HHVH 4BFIA 3G6AB 3T0EC 4NNYA 4P4RB 1YEGH 4P9ML 3GSOA 3Q2CA 4WEBH 2ZG3A 3BP5A 4MMXC 5FDWA 5D1QD 4QXGH 3CSYA 3KXFD 5DEZA 1UEYA 3U30B 5GGVH 2VDPL 2D7QA 3PL6B 4GG8B 3VWKB 1EX0A 3LEYL 5AD0A 1GJIA 3RWEB 2EC9T 4PJXB 4PJ8A 3ZO0A 3VG9B 1K4DB 4JQVA 5HDBF 4DEPB 4U0RC 4PJIE 3CFKA 2ADIA 2UVFA 3ZKQD 2IALA 4HH8A 4J3UA 3UTPD 2H8PB 1TETH 5I19H 1U3YA 4YHPA 5CINH 4OAWB 5F7UA 4TNWF 2LABA 3MJ7B 1NANI 5EO0A 3GK8L 3JXAA 3RHWK 3NIFE 1V05A 3E3QE 2CK0H 3KPMA 1I85A 4LEXH 4Z7VA 2ZCHH 1UEMA 4OB5L 4OCXL 4UDUB 3FQRA 1LO5A 2JB5L 3RL1B 2BOCB 2FHCA 3FOLA 3ARGB 3FT4A 3VXTA 4MSWB 4OQTL 4Z7WB 3PABA 5GS1C 5F3BA 1F3RB 5F93C 3SE3C 3RGVC 4GRMB 4M02A 5I66A 4YBHA 1FL5A 4GRLA 2E7HA 5CSZA 1R3LB 3MGTA 2KUTA 4PLJC 3QXDA 4FQ2L 2QSTA 3QCVL 4KQ4L 5C0AA 2O5XL 4HJ0D 3MNVB 1WJ3A 1QRNE 2Q6WA 1HXYA 2AXJA 3MV7D 2BCKB 3L3GA 5BO1L 5C0NC 1DVFB 2I5YL 5AYUH 3ZYIA 3ZHDA 4QCIB 1B0GB 1AH1A 5JOEA 3SHSA 2P48B 2GSGB 4ZNEA 1KENL 3CVIL 1CFVH 2MOVA 4K7PY 1CS6A 3UTQA 1AGEA 5EN2B 1CE1L 4CAGA 1HK6A 3MOBL 4KMTL 1GGTA 5BJTB 2AABH 2DIJA 2E9JA 1HHKA 4NQCB 5AZ2H 3ZSSA 2NY7H 4G8GA 5E94B 1RURH 1JI1A 3KLHD 2ESVD 1G6RL 4HJGB 3RWFB 3QUMA 3AC0A 3KYKH 1UT9A 4GKNA 5T5NG 2VIRA 3BEWB 1FFNB 5KVFL 4J4PA 1MCEA 1D7FA 5D71H 3V6BR 2VR9A 2AJ3B 1N64H 2GCYA 5EZJB 2VN7A 1A1NB 1PGRB 3G5ZB 1J8HB 1F90L 3WNOA 4NKIH 3UO1L 1I7TB 5KW9L 3MRRA 2WUBL 1J10A 1BM3L 2CUIA 5L2KE 5IEKB 2ED8A 4X7SL 4PP1C 1U95A 2OSLB 3U4AA 3X13A 1T2QH 2V5MA 2EDWA 3L3JA 5KSAC 5CKGA 1BLNA 3WD5L 2GK0B 4QHUB 2BJML 3HG1E 3Q6GL 4JY5L 1AGDB 4S1DD 5ESQB 3HMWL 3RY6A 4ELMA 4RA0C 2DQGL 4C56D 3ZL4H 4O2CB 4QTHB 4U1LA 1K85A 1GPOL 5FUCE 4XPGH 2UZIH 2EDOA 3QUYB 1N2RB 3NH7L 3PWPE 5E8PA 2A2QT 1W72L 1CQYA 4U6VL 1LEKA 4HXAL 2CKNA 4JRXD 5FUZH 4M93C 3GJFB 1N7ML 3TLRA 1M71A 2PYFB 2QADB 2Q7YA 4GKSA 2AJZA 4CDGC 3OKNA 3N9GH 5GGQH 2BSTA 4MNHB 4JZOA 3KNBA 1C1EL 4K3EH 1P7KA 5A2KH 4XX1E 4FQXC 1LMKA 4YHLL 1ZANL 5GIRA 5SWZE 2Y36H 5DJAA 1YY9C 3MACL 3HZKB 1DBBL 3I84A 1LDSA 4GXUN 1U2CA 1JZ5A 5HI5C 1CLYH 5J0BA 1P6FA 4YBQD 1ZGLP 5D7KE 2DQIL 3QDGB 4ZS7H 2VZTA 3U83A 1QSEA 3KYNA 5ISZE 3OZ9H 3DUSB 3R4DA 4DK3A 1F3JA 1PX4A 4PJAF 5J11C 4EUPB 4X9GA 2VLJE 3BN9D 1NAMH 3LOWA 1C5DA 3JBG7 1FLRH 2O26U 4V1DB 4YGVB 1JFQL 4Z0XB 3VFPB 3WHXB 4YHZH 3MJGX 1VFUA 5AG8A 5CGTA 5D1ZA 3MJ8A 1T5WB 5DMIH 1OCWH 4PJ8C 1RJLB 5I16B 2H2SD 1FVCA 5C0DA 3NCFB 3OL2A 4YO0A 3TJEL 1TVDA 3BI9X 5F7EH 4C4KO 3HMXA 4PRIA 3NFSH 5C0IB 2IAMA 3E6HA 4R4FL 1JWMB 2WBKA 2Z31A 3S36L 3VFMB 2Y06L 4HS8H 1IFHH 4NWTL 2C1PA 4G6KH 4LP4A 4UQ3A 3V5HA 3EOBA 3MRFB 3DUUB 3C5JB 4MHHI 4NFCA 4GS7B 4U05A 5B4MC 1I85C 3L7EB 3O3EA 3S5LB 1TTUA 3O4LB 4GH7B 4MD4A 3NCJL 4NM8L 5CSGA 5SWSE 3VDBA 5DJCB 4W70A 5C3TA 3RJQB 1N3NB 1RZKH 3K1DA 5EH1A 5EBWB 3OKEA 4PP2A 1BOYA 1U93B 3TH2T 3OJDA 3D25A 3OX8B 3MFGB 2VXTH 4OCYH 1RIUL 1TZGL 3TFKC 4YPGA 1FJ1B 5D2LA 4GRLC 4QRQB 3U36B 5E99H 1CDGA 4ZD3H 4YH6A 3TIDA 4UOW0 4N8VG 4KGJA 3Q48A 3GSVA 2RCSL 2QKIB 5F89A 4XPAL 2ZCKL 2DB8A 4YK4B 2EEBA 2FJFA 3O2WL 4RMRA 1EXUB 2CDGA 2B0SH 2QLVB 3DO7B 1DSFL 5FHAL 1QBAA 3I6GA 5IG7B 1PKQB 1EFXA 3QQ4A 2IADB 3NA4A 5JDJA 1Y18A 3R8QA 3BYYA 3PIQA 4KZDH 4PJFB 1FL6A 1IKNC 2XIDA 1CFQB 4JFDD 4M8VA 5K9OA 2BVQA 1BECA 1T1XB 1X6NA 2XZAL 3WFHB 4J4PC 3ET9F 4JFXA 5F7NC 5HHOB 1FO0L 2HT3D 3GIZL 5E0QA 4DKEH 5IFHH 1HH6B 3L3IA 1GH7A 2XTJE 4FFVD 3CC5A 2X9WA 1I8MA 3W81A 2BDNH 1N5YL 1KN2H 3KGRA 4OD1H 2BNQD 4EZMA 3AU1B 2Y9RT 5C0EB 1RMFH 1QSFE 2NY3C 3B9KD 5FKPB 5HHXH 2XN9D 2OTUA 4YNYB 3S3JA 3M1BB 1CQKA 1F4YH 3ULVF 2D0FA 3VFWB 4UTAH 2OR7A 4OZIE 5FA4A 4FQHB 5L6YH 4ZAKA 3RY6C 3ULUE 4IRZH 3TC9A 2ZSWA 4XWOC 2Y07L 5BXFB 1NLBL 1LNUB 4HS3A 1ZA6A 3C6LD 1N8ZB 1H3PH 3HC4H 3MCLH 5EU7E 2NW3A 4PB0L 1KIUA 4Q0XL 1JF1B 3JTTB 5KVEH 3SDAD 5DJZB 1U8IB 3AB0C 2VDLH 3QCTH 3AFLA 1JHTA 2B1HL 1EUUA 4LAQL 2CJUL 3DRTA 4AEHH 2P8PA 1I7UB 3TF7C 5BV7L 2A0LD 4JFDB 3P0YL 3IU4H 4KPHH 3WIIH 3BPNB 4CADA 4CGTA 4X7CC 4YDLB 3DVNB 5D72H 3TZVD 4DQOL 1R5IB 1FVDB 4JM2D 1UWGH 5GS0L 3FN9A 5CIPA 1OP9A 2OJZL 4P4KD 3HNVH 3BZ4B 2HKHH 5DJDA 4MQXC 1BHGA 2GJZA 4LSTL 1S7WA 2O61B 4NNXB 3RAJH 2XOTA 5EC1A 3V4PL 2BNQB 4ZS6D 4N90E 2Y23A 5DQJB 3WS3A 3B9KB 3PXHA 1OAZH 2XN9B 2QQLH 4JM4H 3RTQB 4ODXA 5JOFB 1BOGA 5DD5H 4OD3L 5T1KD 1LO4H 4OCWH 3T2NL 4OLUL 2YMXH 3GGWA 4NSKA 5H2BB 1YJDC 4Y5VB 3RWHA 1YMMA 4K94C 4DZBA 3CSBA 4L3ED 4OCSH 3WCYA 5D1ZC 4OZGE 1A9EA 3HE7A 2C1OA 1RJCA 3DMMA 3QEGH 1CIUA 5DS8A 3GIVA 4DN3L 5FB8B 1QBBA 2XZZA 1A7RL 3C60B 2WSKA 3U2SB 1SVCP 2CIKB 2IBZY 4F33A 3B3IA 2UUDK 3SDAB 1I9RH 2SEBA 5C0JB 3IFPA 1HSAA 4URTB 1A7OL 5JW4M 4YFDB 2IAMC 3I6KA 3MZGB 1WTLA 2VH5H 1A5FL 2Z31C 3G6DH 3GFUA 3TT1L 1OQXA 1FRGH 3VXUA 2DD8H 1QPPA 2DWDA 2H32B 3HI5H 5KSUA 2R2EA 3LKRA 3DSNA 3NABH 4OBSA 4I2XB 3T3PF 3LCYA 1WBYB 3PHOB 1NAMA 3B9VA 3F7YA 3TZVB 3QJFB 4FTVE 1V3JA 4JM2B 4H0IA 4M48L 4NNPL 5FYKL 4JHWH 4LGSB 3WFCH 1NGWB 4HIEB 1HYRC 4K7PL 4Z95H 3NVQA 1FPTH 1MJ8L 1MFEH 5L88L 5IEHB 2G5BA 2AEPH 3AAZB 3NCBB 3HUJE 4HIIA 5I1JH 3TBTA 1CGVA 5F7DA 3TBYA 1YQVH 1NBZA 3QZWG 2R2CA 3OGCA 1BJ8A 4YBLB 3OKOB 4JZJB 5T1KB 3QPQD 4PGBA 4NFBA 3FQXA 5A2IH 5AUMB 3HI1A 3T0XA 4JY4A 4L3EB 3RX5A 4HDIB 2YUWA 2IPTH 4WFGD 4X6CF 5JIPA 5TE7H 2VKWA 1MCWW 2GK2A 4L1HA 5CUSH 5D4QA 12E8L 1VFBB 5ADPL 2HLFD 2ED9A 2F54A 3QUKB 4WHTB 1J87A 3EO1A 3O6ML 3QG6A 1NAKH 3UTSE 4IRJB 3VFOB 1GGIL 5EIQA 4LPYA 2NZ9C 3P9LB 5TDNA 4AG4L 1MLBA 4GFTB 1BQLL 4N0UA 3C08L 2PTVA 4M6NL 2W9LA 4RDQF 3V52H 1I8IA 3MGOA 4D2NA 4MD5A 3FFCA 1ZT1A 3C87A 2O5ZL 5E03A 5IQ7H 1FNHA 4BQ8A 5L2KB 5GRUL 1EEYA 4LARL 8FABB 2DJ4A 1CBVH 3HG1B 4LSPH 3C9NA 3V0WL 1P4BH 1BD2D 3FO1A 5KN5A 2FGWL 4KTDH 5EUOA 5JLZB 3H9SE 4WTZG 1YZZA 1CGWA 4L8BB 4LHJB 1BVLA 1U8MB 3MX0A 1BZ9A 3ARTA 1GZQB 3E8UH 5KSBE 4AJ0A 1QR1B 1C7SA 3PWPB 4FZ8H 4EDWL 2ZKHH 1UCBH 1C08B 3BT2H 1RUPH 3BW9B 5IVZA 3VMNA 2AXHA 1GL4B 4H1LB 2EDBA 5EU5B 3HNTH 2I07A 4IS6A 1HE7A 3GSNL 4UT9L 5F9WC 1VA9A 1QSZA 1EH9A 1LD9B 3VW3H 4P2OA 1EGJL 4D8PB 4IJ3C 2AJVL 3X3GL 1KJ3L 1G7IB 1O7VA 3QAZB 5ILTL 1FO0B 2GJ6B 2F15A 3CU1A 5GS0D 1X5JA 4P9HC 4OZFG 3WUWG 4WI2A 5DD6A 2VL5B 3EYQD 4YHIB 1K8DA 1S7RB 3WNPA 1T22B 3OG6B 1J12A 4OCNC 4ZODA 4DAGL 1LP9B 4TSCL 3RWDA 5JZ7C 5ISZB 1WITA 1ETZB 5EO9A 2BNUB 3CFEB 3O11A 1MHHA 1BFOA 4JRYE 3FN3A 4KHTL 5FYJD 4S1RH 2DI7A 1F6AA 5CD5C 3SN6N 2I24N 1AI1L 3EDKA 1PBYA 2VLJB 3UJTH 1MFDL 1F3DH 4UBDC 3G9VA 3EO0A 4WWKB 1W0VB 2IQAB 4L3CB 5ICZB 1MY5A 1BD2B 4KK6D 1IC4L 2UWEB 5CFHA 4X4XA 4G3YL 3QWRA 3C5SB 5JXAL 2FJGA 4QWWC 3HE7C 3DMMC 3G6AA 4UNUA 3MRDB 2FBOJ 4P4RA 2VQ1B 4I3SH 3AY4A 3B5TA 3BH9B 4D9LH 3T8XB 4GG8A 4Q6YA 3D9AH 3MQIA 1MELA 1MCOL 1YEIL 2DLHA 4ELKB 4B7LA 1MJ7L 3RWEA 1I3RA 1ZS8B 3IDIA 5J3HC 4O2FB 2F58L 1D6VH 5DJXA 5BV7B 4EIZC 2YEZB 2H8PA 3MODH 3DV6A 3WIHL 5T3XE 3ULSB 4M9PA 2Y4SA 1NUDA 4OAWA 3MJ7A 1AE6H 4O4YL 5A1AA 3O0RH 3HRPA 4M4PA 3WFZA 4GW1B 3ZTJG 4XPTL 1QFPA 3U9UA 4N0FB 4LLDB 1L0YA 1YNKL 4NCC1 1JGVL 5D70H 4FFYH 1KGCE 2FWOB 4UDUA 3RL1A 1L9NA 2BOCA 3I9GH 3V0AC 4MXWH 3D39A 4MSWA 3DVFA 5L9DH 4Y1AE 3NMEA 2G5RA 3T3MF 1IGCH 2A9NL 4UT6H 1KLUB 4IMKA 4XCEB 4GRMA 1F2QA 1MSPA 3RDTB 5LG1A 1R3LA 5I74C 5F8RC 2LFGA 4EKXA 1MCKA 4ZQKB 1S78D 2WBWB 2AKRA 4JPKL 5C07B 5IB4B 3SGJA 1DVFA 4I3GA 1FIEA 2NXZB 1I9JH 3FZUD 3RQ3A 5EZOH 4G42B 4XZUA 1FZJA 4ZUTB 1LO2H 5F6HI 1B0GA 3A6BL 5E2VL 3VMPA 5I30L 1RZKC 4XAWL 1NGPL 3IJHA 3NIGF 1OM3H 1SYSB 5EN2A 3PWNB 4M7JH 4KK9C 1TZIA 3BXNB 3O2VH 1F4WL 5BJTA 3K8LA 4NQCA 4FG6D 3QH3B 4QTIH 3OKDA 5GRWA 2PCPB 4LSSL 5E94A 5GISL 2FO1A 4PRAB 5CAYB 1H8SA 2WLYA 3RWFA 2V7HB 5L2JB 3DGCR 3GBLA 3BEWA 1FFNA 3QUXD 3W39B 2XZQL 5DRZB 1YUHA 2WUCH 4XVJH 5E7FA 2F19L 2AJ3A 5EZJA 5D5MF 3NACL 2Z35A 1B4RA 3G5ZA 1J8HA 1NL0H 5CEYB 4Q9CA 1I7TA 4LHUD 4KXZH 3FAWA 4MXQC 2HLAB 5IEKA 2OSLA 1KOAA 2P24A 1V7ML 1B4JH 4AIZB 3ZKND 3J8F7 4MA3A 3V95A 3U1SH 2DDQL 5FGBA 2XA8L 5ESQA 5KS9E 2A9ML 2AK4D 4MA7L 3FKUS 1G9NL 3PDDA 3BPLC 2OXHA 4R6UA 1PG7H 4Q9QH 2ESVE 3QDAA 1Y6KR 5SX4H 3QUYA 1N2RA 4P2OC 1AIFB 4Q2ZB 1CXFA 4LVOC 1UACL 3D3VE 1GGCL 2Q20A 4K3JL 3NGBB 3GJFA 3WO4B 5E6ID 4M5ZH 3ILQC 3OJVC 5F1NB 1A6VL 3P0GB 3IFNH 3QIWA 1IGIH 5ABDE 3LMJL 3QQNA 4FQ1L 1JNHA 4NQXB 1XCTA 4LCUA 3V4UH 4XB8A 2H45A 3VFNB 5DHYB 3BP6B 3VI4E 4Z7VF 2ZSVB 4YXKH 2OCFD 1S9XA 3VI3E 1UJ3B 2DJSA 3D85D 1DUZB 1T03H 1EHAA 3PF2A 3HB3C 4RFEB 3QDGA 5MERB 2GY5A 3SDYL 4LHUB 4ZXBD 3CLFH 1P53A 3MRIA 1FP5A 3K7UA 5DWUL 1CCZA 4QOKA 5DVMA 1CLOL 1X4XA 2R15A 1G9ML 1F6FB 1PW3A 1WC7B 4TVPL 3RA7H 3TPKA 1Q9WB 1WEJH 2VRAA 4V1DA 1IZKA 3AY4C 1A6WH 4UQ2B 4Z0XA 3VFPA 3WHXA 4XPBH 5D7JA 5T3ZD 3ZDXF 5IBUB 4K3GA 2AK4B 4OUUB 3HNSH 1T5WA 1F11B 3OR6B 4NKMA 1DBJH 4TTDD 3TO4D 4LCIH 4KK5D 5E4EB 2DQHH 3VG9C 4OLWH 4DEPC 5I16A 1LK3L 3I3BA 1YEDB 3E2HB 5BQ7A 1FHGA 4XVUD 2OX5A 3MLSH 3QDJD 2WV3A 3G5VB 3PV7A 1GGYA 1OVZA 2PTUA 5E6IB 2Q87A 5DD1H 3FMGL 5MEQA 4H88L 5GRZA 4E0RA 4DK6A 4M6AA 4NGHH 1J1OL 2GITB 4FTVB 4WW2B 3MRFA 3DUUA 4NBYB 1IEAA 1KC5L 1AD9B 5E8DH 4G9FA 5C0BE 3ZE2F 3O4LA 2X1OA 3JV5A 3MLTB 1VSCA 5C9JA 2CUHA 5C0CD 2PXYA 1RZFH 1RUKL 5D96B 3T08A 1N3NA 4GG6B 5EBWA 4LLUB 3V6FB 1JZ4A 4AEIH 3RKDC 4JFFA 1FAKT 2IANE 2VXQH 4IMKC 4MCYA 4EBQH 5TE6H 2NX5D 4NO0D 4RGND 5I71B 1CXKA 4QRQA 4NQDA 4PJBE 4FFWC 1M4KA 3OAYH 3L5XL 2AGJH 3S4SB 3GM8A 5IK3B 5I9QB 2QKIA 3SGJC 1JGUH 1JE6A 1DVFC 1WZKA 4BSVA 2HAZA 3O6LL 5IB5B 3MLVH 4HQQL 4L8SA 1EXUA 5DT1H 1FZKB 4G6ML 2IQ9H 3NOIA 4Z7UF 5I1CH 1PKQA 1MI5D 2APFA 2H9GA 3FRUB 4LGRB 4C4KT 1H3UA 1WFOA 1YQ2A 2P46B 4PJGE 2C3WA 2FJHB 4PGZA 4WU5B 3FB7B 2KDGA 3QDJB 1XGTB 3NBNA 4TSBL 3U4EA 3GHEL 4B41A 1NFIB 3CNKA 4MB5A 3RUGB 3P0VH 3UAJD 1J88A 4HF5H 2HMIC 3ARDA 3ME0A 1U8KA 2IFFL 4U1KB 2RJMA 2XNAB 4H1LH 4WHDA 4K7FB 1G7LA 5HHOA 2YPLD 4P2RE 4RRPA 4FQIH 3X14B 5LKNA 4XP4H 2ZCLH 2UZXB 1MWAL 4NQUA 5TQ2H 4H8WL 5SWQA 1DQJA 2ZUTA 1SYVB 2EEDA 5C0CB 3U0PB 2VDKL 3H9SB 3AU1A 5EPMB 4OM1H 3QFJE 1HYSC 3ZYJA 4I18B 4FNLH 5KSBB 5IP4A 2YKLH 2XYCA 3M1BA 1CLCA 1KIPB 1RUQH 3LS4L 4RGNB 5FGBC 3HRZB 1MIEL 4NZUL 5FO7B 4FQHA 1CL7I 1CFNA 1Q0YL 3UTTD 4Z78B 3PP4L 1YMHB 1BREA 1XGRB 1X5ZA 1CT8B 3QBTB 5BXFA 1TVHB 2DLFH 4AQ1B 5MEND 1BEYL 1VEPA 2WLZA 1N8ZA 3UP1A 3QUYC 4F57H 2E7BA 4HV8B 4D0BA 1NGXB 3T2OA 15C8H 1IRAY 1Z3GL 3DX7B 1SMAA 4BUGA 2FZ3A 1U8IA 2A83A 3B8YA 1JK8B 2QADC 1MI5B 3L9RB 2R1XB 4QHKI 4R7NB 1ULVA 4CN6A 3QIWC 4KQ3L 1DQDH 5K9JH 2A6DB 4TSAL 5CKAA 4PPTA 4F37F 4R26L 1DR9A 3LS5L 4CMMA 2HH0H 4E41A 1HQ4B 1KBGH 5E24E 1GZPB 2ZWLT 2Y25A 4OUOA 4S1SL 3DVNA 4UILH 5KSVB 4JRYB 3FRPA 1FVDA 1IARB 4W6WB 3VXSD 2YPLB 1OAKL 4KZEH 1AY1L 4YDKL 2BVEA 1ZVYA 3TPUB 3NA9L 3BZ4A 4HK3N 5FF6B 3VXRB 1MCRA 4JVUA 4X7TA 3SKOB 2ZUQB 4X8JB 3G6JF 2O61A 2VDOH 1KPVA 3RPIB 4DFHA 2XWJB 3U7AA 3STBA 1IC5H 5DQJA 3BYTA 2A6KB 1FFRA 5D2LF 4KWUA 3ZKMD 3RTQA 1KJ2H 1AD0B 3BX7C 3W5NA 4O5LH 4Y5XB 3GBMH 3ETBF 4UB0H 3THMH 5D7JC 5H2BA 5L8KB 1UM5H 5FDYA 4JKMA 4K3HA 4PRHD 5B39G 1F6LL 3LB6D 4LSRL 3ISWA 4OCRH 5GGSY 4YX2H 1NEUA 5MENB 1XF3B 3HZVB 4PJIA 3OKKA 5FB8A 1IQWH 1I1FA 4GBXB 3MA9H 5ICYB 5HHME 3C60A 1WCQA 3U2SA 2EZ0D 4MS8D 5J1AB 4KRLB 4Y8DC 4DN4L 2D7NA 1GC1L 3ARQA 5EU6D 1QO3B 2BRQA 1E6JH 2BY0A 4HZLA 2EE9A 4WI6A 1MVUB 4GS7C 1MOEA 3BKCH 4NCDA 1RFDH 2X4TB 3V4VH 2H32A 2IH3A 2ZJSL 4E9LA 4I3RL 4NN6B 4I2XA 4Y2DA 3H9YA 2PXYC 4WENB 4O02H 2DN7A 3QJFA 4H25A 4Y1AB 3VXSB 1AXTH 1X5HA 1DBAH 1EK3A 1J1XH 5C6TH 3F12A 3T0VA 3WMSA 1C5BH 4MCZA 1BAFH 2X89D 4Y4FB 1EHXA 2WNGA 4PJEF 5IEHA 5EUKB 2NYYD 2OR9H 3ORJA 2OK0L 1KPRA 2D7MA 1NCWL 5IESL 5LWYH 5E1AB 1QRNA 2IG2L 4KXZI 1IKFL 1MUJB 3OKOA 2DKUA 1V5JA 4L9LB 5DJ6B 4LSUL 5ITBH 4ZO6A 5F6HJ 2YD8A 1F4XL 3SJVE 1C12B 2AQ3A 4S0TD 5LQBL 4YDVA 3R8BB 3S37X 4DCQA 3ULUH 2NY5H 1JNLL 2VDML 2BVOB 4PY7B 3LN9A 4J3TA 3SO3B 3CGTA 1BIIA 3QUKA 5SX4I 1KB5H 4IRJA 5C71A 1OTUC 4JO4L 5EU6B 5SX5H 1CF8L 4JO1L 4PJ7B 3ARDC 3KPSE 3B2VL 5DQ9A 3RIAF 2LQRA 3IKCB 5T1LD 5IWLA 5ALBH 3HPLA 1TVBA 4MNQE 1J1PL 4PJDE 5L2KA 1DQLL 3ZDYF 4X8XA 1FQ9C 1JPGB 4MLSA 4L4VD 8FABA 2NY6D 2XKNA 5A43C 1I4FA 4LGPB 3MOAL 3ZMRA 1QFOA 4KJPC 3HG1A 4CDHA 2XFXA 5D9SA 1OY3B 5D7IF 1LEIB 3OXRB 3QPXH 2VXVH 5KS9B 3PP3K 4L8BA 1CXHA 1U8MA 2I9TB 3LEVH 4JO3L 3U48A 3ROLB 2DTSA 3PWPA 2Q1EA 3NIDE 3D3VB 2R2BA 4FN0A 4H1LA 2R4SH 3KS0H 3U46B 1NFDE 4J7RA 1K2DA 1UCTA 4XNYL 1LD9A 2ATKA 4U6HB 3K4DA 1KEMH 2COQA 4P2QD 5KTEL 3C5ZB 1EJOL 2UYLA 3RVXD 1A0QL 2C4FU 4HWEH 4YHYC 3BGFC 3BZFB 2RIKA 4M3KB 5IF0B 3TBVA 1EVTC 2FIKB 1I9EA 2WMPA 5SWZA 2GJ6A 2ADFL 3QIUD 3UX9B 1GGUA 4PBWD 1A3LH 1CR9H 2X7LA 3D87B 3OAZH 1W8OA 2VL5A 2HT3C 5D2NE 1FFOB 4YHIA 1T22A 3ES6A 2UUDH 3TVMB 4CL7A 4WO4A 3SDXE 1L7IL 5ISZA 1ETZA 4Y19E 2BNUA 2BY2A 1MNUL 4QRPE 1UM4L 4LCWE 2NY6B 1IAMA 3BP7B 3ULVL 2VLJA 3QCUL 4WWKA 2OLDA 4OLXL 3RTQC 4U1MB 1CE6B 1XGUA 1W0VA 2IBZX 2IQAA 4L3CA 1JF5A 1VFAB 5ICZA 3K81A 4XMKH 4OI8A 5I17A 4XNUH 1GHFL 3VXPB 2B39A 1RK1A 1OAXH 3VGAB 3KPRD 3JTSA 1ES0A 3BGMB 3SPVA 3RWIA 1F58H 3NFPA 4MYWB 3S6CA 4LKCA 3MRDA 3ZDZE 1FCCA 3FQNB 2VQ1A 1QFUH 4JY6B 5K33A 3HC3H 1OGAD 1GXEA 1KTLA 4N8CL 1A6TA 4JE4B 3BH9A 4WI9A 5FECB 3HN3A 3C60C 2DM3A 2PW1B 2VLKE 1KUMA 2E9IA 2EEAA 2OZ4H 1VACA 1ZS8A 1II4E 3I02B 4XMLL 1WISA 4F2MB 2VLME 1UZ6F 3HAEG 3E3QC 5T5FH 3NPSB 4UTBL 3KLAB 3BKMH 3U7YH 4YHKL 5IW6B 4WUUE 5E00B 3BKYH 4ODVH 3W9DB 4Y2DC 3CMOL 1JBJA 43C9B 3QIUB 1SY6H 1VADB 5ELIA 4FP8L 3H3KA 4N1HB 1KJ2A 5JW3L 9CGTA 3GMQA 2IANB 3VH8A 1KFAL 2VZ3A 4M43L 1X5XA 4HGWA 1IAOB 2IPUK 2FWOA 2ORBL 1D3CA 4F8TA 4Z0BH 1TJHL 2RAMA 4LQ1A 4R8WH 4F15B 2YN3A 6FABH 5E6YA 2B2XH 2R23A 4M6ML 4F7PB 1CK0L 5DQDL 3RWCA 1ACYH 3HA0A 3N06B 1ZGLM 4K9EL 1U8NA 2CDEB 2OBGA 5JO5B 4TUJB 2FLBT 3RDTA 5EORH 1WWCA 1QBML 3S34L 4NQTA 1FGNL 3GJEA 2M1KA 4N68A 3SCMA 3KPRB 1YNTB 4ZQKA 3VGGA 5C07A 1MIML 1FAIL 4GAJH 1K3ZA 2EH8H 4M62L 4R7DB 5IB4A 4BZ1L 1OGAB 3R1GH 4HXBL 5JXED 1ZKAA 4XHJD 2R8SH 2A6JA 1A6AB 1I3GL 1OHQA 3EO9L 4ZUTA 2DTMH 3BESR 2J7LA 3CVHH 1PG7W 3KPTA 3QA3A 5GHWL 3FO0L 3L1OH 5FYKE 4IRJC 2ZUYA 4GQPH 1GOFA 1K9TA 1SYSA 1PEZA 2H26A 4ODBD 1HCFX 3H7BB 2X4NA 1FFQA 2W92A 4P2RB 5IWLC 5HYQA 2XWBB 1C5CL 1TDQA 1X5IA 2VLRE 3LQMA 4PRAA 5I76B 3DGGB 4NQED 3MA7B 2H3NB 1HSBA 1QHPA 3L5WB 2VC2L 5DRZA 3QEQE 3WYRA 5J89A 1QSFA 1EV2E 2DBLL 3QFJB 4RQQB 3MBXL 1RZIA 4KI1A 5EBLB 2Q8AL 5F7FA 1Q72H 4OZIA 3O3BB 4P46D 1IM3B 3LEXB 1DLFL 1F3DJ 4HWBA 4DVBB 4JDVB 1OP5H 4HFUL 4ZO7A 3JWOH 1GOGA 2CLVB 2L0DA 3QXUA 4AIZA 1JYVA 3DX6B 3V6ZB 1S7SB 2IFGA 3QPQC 3UEZA 3WXVH 1QG3A 3IDUA 3W82A 4DKFL 3WFBH 2APTA 4U1SB 4M8QA 4U4BA 4QHKJ 3LQZB 1XR9A 2I60H 2VZVA 5JDSB 1AIFA 3VCLB 3ZTNH 4PJXF 2HLFC 5D7SH 2DQTH 4Z7OF 1RU9H 3U6RB 2BVYA 3CIQA 1DJSA 4F58H 1OAQL 3QAZC 4NUJB 5C09B 4M1DH 1YEJL 5TGBB 4NIKB 5F9JB 3H3PH 2YUVA 4NQXA 1IGFL 4CVZA 3BP6A 5BS0D 1A4KA 2Y6SC 4XCCL 3ULVD 1P4LB 5T3XH 2WWMC 4NKDB 4HWZB 4PJ9B 4PV8B 1UJ3A 2VDQH 4Y4KA 4X4YA 5CEZL 1JWSB 2GKIA 1DUZA 3GRWL 4P5TD 4WWKC 3T0WA 5DMGC 5KVDH 5IIEB 4ETQB 4CVUA 5MERA 4Z7WF 4YFEA 1J0ZA 1KCVL 3LRSA 5ITFB 2BVUA 3BKJH 4MQ7B 3V5DB 4OZGA 5C0RH 2BY3A 1S3KL 1WC7A 4LU5L 1T7XA 1V7NL 4HC1L 1Q9WA 1MEXL 1FGVH 2Q76B 4LPUA 5KZCD 2W07A 4JO2H 2CUMA 4KTEH 4HHAB 4L8DB 1F11A 3OR6A 1KLGB 1A8JH 2PUQT 2AV1B 1ZHNB 4NZTL 4U1IA 4APQA 4XH2B 1YEDA 1AFVH 1FYTD 1SJEA 5E1HB 3W2DL 2M8XA 3G5VA 4JVWA 4I0PD 3ARFB 4AK1A 5I1GH 3MROB 2BSSB 4KKCD 4FTVA 1DTUA 3VFGL 4WW2A 5MHSD 3QEHB 2A74B 3T1FA 1NEZA 4PJCE 3R0NA 4NC1E 2VDRL 4ZTPL 5IVXB 2OP4H 3MLTA 1G0YR 1JTTA 2AXFB 4ODSL 5BS0B 2Z92B 3P30L 1FE8H 1G7JB 3HUJA 4OJFL 4LLUA 4G80A 3V6FA 3M17B 3EYUL 4HBQA 4KUCF 43CAA 2DQEL 1AGBA 2VJXA 3EJJX 3RDTC 2OZ4A 1ZGLB 2HJFB 3V0VB 1U8OB 5CILH 3ILPA 3SCMC 3JWDH 1SHMA 2DQCL 4FQLL 5FOBB 5EC2B 5CGYD 1S8DA 3FQWB 4PJHB 4ZPTA 5DRXA 2CKBL 3BP4B 4AMKL 2R1WB 3PWVA 5HDLA 4ZOEA 1TJGL 3MJ9H 1MJJB 1S9VB 2NXZC 4GUPB 3EFDL 4W81A 2XWTB 5KZCB 1A7QH 5IB5A 3S35X 2YN5A 4LVHB 4GW4B 1SY6A 5TFSL 1X5GA 3GMOB 4WI5A 5GGVY 1H3XA 2IGFH 4K3DL 5BRZD 3UTSA 3VU2A 5FFLA 1OTSD 2Y7QB 4HS6B 3FRUA 4KDWA 3VFVB 3QDHA 4UV4L 2AEWA 3IGAB 2HVKA 5F6IB 2UY6A 1OTTC 2FJHA 4WU5A 1FYTB 4KJYA 3WFEH 4YHML 1XGTA 4A6YL 1F8TH 2HT2D 1S7XB 2NY4C 1NFIA 4M7KL 1HI6B 4LLQB 5DD3L 4U1KA 5CWSB 3ALWA 2G2RB 4S11A 5IJKA 4K7FA 4NRYB 2AJXL 4KRPB 5FHBL 3MMEA 32C2B 2P8LA 1LDPH 5CD3B 2EKSA 3O4OB 1H3VA 1JL8A 4JFQB 4P48A 2YOCA 2R0LL 3DXAD 1OGTA 1SYVA 3HE6D 3U0PA 2H1PL 2VZOA 3H9SA 3P9MB 3ULUC 5DD0L 2QHRH 1R6VA 1H3WM 2PKDA 3VXMD 1DE4B 1W0WB 4B0MM 5KSBA 2MCPH 3CVHA 3LRHA 4GQ9H 4D0CB 3S96B 3HRZA 1T83A 2CRZA 4P59L 4FXLA 4PUBH 3EZJB 1S78C 1U8HB 1YMHA 2OTPA 5DEFB 1XGRA 1CT8A 5HGDB 1LE9B 1NFDB 4OGYH 4WFHD 3EYSL 3MXVH 3VG0H 5I8KH 1BQSA 5GS2H 4TVSa 4RA3A 3L6FA 4Y16B 4U6YA 4DGYL 2DIBA 1JUFA 4HPYL 1NFKA 5BRZB 3F58L 3WO4C 4YE4H 5IM7A 3L9RA 2R1XA 4OV6F 1ZLUH 4GKZA 1FH5H 5JQ6L 1YYLH 3SDCB 3LQAL 4P3WA 1R0AL 2A6DA 4QT5A 5D2NB 2V9QA 3U0TA 1OD7A 4FG6C 1Y6MR 4L8CB 4D9QD 1T04A 1R5WB 4CUCA 4R0LB 3GHBL 3DSFH 5CCKL 1HQ4A 4EDXB 3QHTC 1QPXA 5HVHB 5HJ3A 3QQ9C 4ONHA 4LCCB 4QRPB 4JRYA 5TJWK 1I1YA 5D1XB 3LY6A 5DUPL 2RR3A 1UJ3C 4XC3H 4Y4KC 5ALCL 1RZ7L 1EUTA 4MWFA 2M2DA 3V5KB 2NY2D 3TPUA 3VXRA 1QFWL 1MREH 2XG5A 4X8JA 5EIIA 5HYJD 5EDXA 3HE6B 3BSZH 3CAFA 4P9MH 1AO7E 1WQVT 3SDDD 3RPIA 2XWJA 1YEHL 1U8QB 2OL3L 3T0ED 3TNMB 3VXMB 2R9HC 1OSPH 4PV9B 2VDPH 4JCMA 5CJOL 3W9EA 2QQNL 8CGTA 5TDOB 2QBWA 1BGXH 3W0WD 1ZVSB 5EBMB 1BFTA 1T2JA 5MEOB 2VLKB 3OAUH 3FFDB 3TNNA 5AZEL 4L29B 5E4EC 4YHNB 2OS7A 1MFBH 4ZFGL 1Z9OA 3HZVA 1X4ZA 4APQC 5C3LD 5ICYA 4GBXA 4XVTH 2Q8BH 4C54A 3E2HC 3DIFB 5FUOL 4U7KA 3MTRA 5J6HB 5J1AA 4DOHB 1IMHC 4XCNB 3H2WA 4PJFF 1VEOA 3MUJA 1N4XL 2YA2A 3H3BC 3LKNA 4Z7NF 5T33L 4OCXH 5A16A 4WW2C 1QKZL 1OP3K 1MVUA 4RCAA 5GGSB 4ZFZB 3UJIH 2X4TA 4TVPE 4YWGL 1RUMH 1RVFL 2J4WL 3INUL 4CMHB 2BRRH 2ZOLB 4TOYH 3MRLA 2YD4A 3OJ2C 1JP5A 3ABZA 1ERNA 2F5AL 3S7GA 4Y1AA 1DN0B 3GSWB 3WSQL 1Z5LB 4ACPA 3GDBA 1EEZB 3RGVD 3DURB 5M95B 3QHFL 2NY2B 1P5VA 1BQHB 2OMBA 3EKCA 4LLYB 1HOCB 4HKJA 2HJKB 4Y4FA 5FCSH 5HYJB 5I71C 1EO7A 3IF1B 5EUKA 4PLJD 3RX7A 4CKVX 1XCQB 2P45B 3JZ7A 3REVB 4L4TE 2WZPD 1BF2A 5BO1H 5IHLB 1I8KB 2LV4A 2FHFA 4HZAA 1T4KB 1RZJL 2HKFL 1L0XA 2LAGB 5C0ND 4LFHD 4UU9B 3CVIH 5DJ6A 1PFCA 3BEVB 3LZFL 1BPVA 1DBKL 1XF5B 2MKLC 1WT5A 3MOBH 4KMTH 1ITCA 5GS3A 4U0RB 3FB8A 4LAJH 3GI9H 1FORL 3BUYB 1G6RH 1B9ZA 4YR6B 3S35H 2NLJB 2V9TA 2VLRB 1ZSDA 3H0TB 5IT2L 4IDLA 1SBBA 5C2BH 3GI8L 4AEFA 1IEBB 3QUML 5GRXG 3MV9D 5IJKC 1F90H 3P4LA 1SMOA 4HKXB 4NO3B 1NBVH 3UO1H 3IKCA 4YZFF 3PQYE 2WUBH 2Y5TB 4IBLT 5DTFB 5J6GA 3QFDB 1JCKA 4RAVB 1CD0A 1T7YA 3X3FL 1T7ZA 4LCYB 4H5SB 2CR3A 3RY5A 3WD5H 4KI5D 3R06B 4PP1D 4QHNA 3SQOL 2GT9A 1JPGA 5GS1B 5HDBE 2EE3A 5KSAD 3Q6GH 4KKLC 3MJ9A 4JY5H 4LLWB 4FABL 4I18C 1XR8B 1DUYB 4RFOL 1MRFL 2DQGH 1NCBH 4G5ZL 1LEIA 1KSRA 4WI4A 5KS9A 4QKXB 3CZJA 5H37H 2XI9A 3VXQA 1W72H 3HPJB 4OLZL 4HPOL 1HNGA 3ROLA 4HXAH 4LF3B 5CBEB 1UH2A 3D3VA 1YPZB 2H6PB 3QG7L 1RULL 3FQTA 5INCA 4UT7L 4CBPA 2JELL 5J4MA 3Q6FA 4ODTL 4BQ6A 1AJ7L 3MRGA 3HHRB 1C1EH 4Q9RL 4U6HA 4A6YB 4YHLH 4CVWA 1ZANH 3HFML 3MCKA 2EYRB 4XBPB 2P5EE 3C5ZA 4FQXD 2E6PA 5DK0B 3B8SA 5IF0A 3Q1SL 4O2EB 2FRGP 3ZKSD 3LDBB 1YY9D 3OB8A 3MV9B 3JWOC 1MHCB 3RHWF 3KDMA 5HI5D 4A2MA 1J05B 3BZDA 3TVMA 25C8L 4WFED 5LGKA 5DVOA 4PGEA 3VXNB 3MNZA 2ATPB 3OMZA 4JM2F 4TN9A 4UOJA 3RKPA 1NC2A 3OF6D 4G8EB 3UYRL 1GYAA 3RNKB 2XRAL 3EYVB 4C58B 5KSAB 1T6VN 4KDTA 3WDHA 5E8EA 1CG9B 1ZHLB 2VISB 3CDFA 4X9IA 3BRFA 4RISL 2J88L 1PQZA 5IOPA 4U1MA 5ACLA 4ZUSA 1VFAA 4EI6B 2EYSB 4Y5XC 1I9IH 1S7VA 4N1EA 5KANI 1BJ1H 4OIIL 2KBGA 2V2XA 3ALPA 4JFOB 5JHLL 3RBGA 1YJDL 3BGAA 4K94L 1AQDB 2XQBL 4PJ8D 5DZNA 2AS5M 5IBLC 2RQ8A 4GBXC 3DPBA 3K2UH 2PW1A 4R4FH 4OM0L 1PSKL 4ZNCD 4J6RL 2R0WL 1HKLL 2BNRE 1EO8L 3AREB 3HMXL 3RIAK 4NN7B 3B6SB 3ARWA 1A14L 4F2MA 4NM8H 5B4MD 3KLAA 5C0BA 5IW6A 1O0VA 2FECL 3KPPA 2NY1D 3BJLA 4HUKB 4ORGB 1UENA 4Z76B 43C9A 1MCWM 1UM6H 1IGML 3O8XB 5HHQB 5FYKU 1VADA 1A9BB 5HHVL 2A1WH 3WNNA 5HVGB 4WRLA 5A2LH 1VPOH 3IDMB 1RIUH 1TZGH 1YEGL 4CRPA 2IANA 5EU3B 4QXGL 2YWYA 5GGVL 3TFKD 5HYSA 1ZTXL 5IGXH 4GRLD 5KANG 4I5BB 3CFIC 4Y4FC 3BQUB 4CW1A 4LLVA 4NZJA 2LE9A 4PJBA 5C0AD 4ZFFA 3RVTC 2FIRT 3PWJB 4NC2B 4QYOA 2YWZA 2AERT 4F7PA 4XPAH 1YYMH 4TPRH 4BFIB 2W9EH 4NNYB 3ZKXB 5JA8B 1ITBB 3PHSA 3MOQA 3O2WH 2CDEA 1D6EB 3CSYB 1OW0A 4KC3B 5JO5A 1J18A 5F7WC 4L9LC 3BISA 4NT6B 2WIIB 4TUJA 1DSFH 5FHAH 2B5IB 1FLTX 4NCC2 5CINL 3GBNL 5K59E 1YNTA 1WT5C 4LQFH 3I3DA 4M3JA 5K9QG 3PDOA 5B3NA 3A0OA 1NLDL 1U2HA 5D6CB 3CFKB 1GVIA 3T2QA 2CK0L 4PJGA 3N1QC 3HC0B 4LEXL 2IALB 4BFBD 1A6AA 2MJWA 4G8GD 3SO3C 3MUGB 3KS0J 3MYJA 4YHPB 4JG1L 1ZE3C 1JIBA 4JANA 3OG4B 4LIQL 2AQ1A 1FIGL 1V8HA 4DKDC 2ARWA 4PJAE 1E6OH 4J4PD 4DJMA 3H7BA 1HZHL 1NQBA 2WWKO 3KG5A 4X4MA 3KPMB 4P2RA 4HLZG 1RJZA 4EVNA 4U6TA 2NY1B 1JGLH 4UV7L 3EHBC 3JWDC 3MA7A 1LO5B 2VO5A 3FT4B 3L5WA 1P5UA 5A40E 1OF2A 5BCAA 2NY3D 1INQA 3PABB 5F3BB 1LP9F 3QFJA 2FATH 2YPKA 2O5YH 3BIAX 1HINH 3N50A 3H8NA 5I66B 5AYUL 5EBLA 4EUPG 1FL5B 4EQ3A 4GRLB 4XAKD 3D5OF 5CSZB 5FM5O 2Z93A 1IM3A 5C0AB 1A1MA 5C0FA 5IHZB 4DVBA 4HCRH 4XWOD 4KROC 5HGBB 3WHE1 5M94B 3FHAA 4Q0XH 2UWEF 3RGHA 1JGEA 4EI5A 3IU3B 1RURL 3F65A 5E08L 1SJVA 3ZYZA 3OB0H 4LAQH 4RAHA 3GMNA 3UTQB 4MD0A 1AGEB 1H5BB 1T21B 3WKML 4D3CH 5D71L 1H9VA 4U1SA 1R3HA 3LQZA 1PEWA 1N64L 5HSFA 1HHKB 1HWGB 3OV6A 3V8CA 3A6OA 3VCLA 4NKIL 3ZE1F 3C5ZC 1G0XA 4OGAC 1LK2B 4DQOH 1SJHA 2AJSH 4GKNB 1DBML 1G7QB 3S5LG 4NUJA 5C09A 1WWWX 2L4OA 1T2QL 1U8PB 5CZXC 2GCYB 4N8VB 4P9HL 2ZNWA 4LSTH 2JKXA 3TVMC 1X5LA 1U58A 3LSOA 4FFZH 4MQXD 1QSED 1PKOA 1OT2A 1P4LA 1CU4L 3ZL4L 1W72A 1U95B 3RZCA 4GJTB 4HWZA 4PJ9A 3L3JB 2NY6C 1LEGA 4KDTC 4OD3H 1BLNB 1XMWA 1JWSA 4XPGL 3T2NH 5ANMB 4OLUH 5E9DE 5IVNA 5IIEA 3DETD 4ETQA 5KVGL 5FUZL 3IDXH 4ELMB 5D1ZD 4PGCA 4X5WB 1SEBB 3VFSB 3JWNC 1DANT 1JRHH 5GGQL 1WWBX 4AEEA 4K3EL 2Q76A 3O6KL 3S8WA 1T6WA 4FQCH 5E8PB 3O6FA 1A7OH 4U1GB 4WHYG 4ZUWA 4QRSB 1HILA 1LEKB 4HHAA 1A5FH 4PRID 1X5YA 5BZDB 1GGBH 3TT1H 4H20L 1KLGA 1M71B 2IAMD 3WUZA 2Y36L 4GKSB 2Q7YB 3QXAB 2Z31D 2AV1A 4LLMA 3OKNB 2NTSP 1RHHA 1PZ5B 1EPFA 5DDHB 1KYOJ 3KNBB 3MYZA 1CLYL 2D0HA 2X4QA 3NPSC 1AGFA 4RMSA 1P7KB 1LVEA 4ZS7L 1CTOA 4LSDA 3ARFA 3V8OA 3MROA 1UVQB 2BSSA 5FYKH 1FFPA 2DF3A 5DR5H 1FYHB 3WEXA 3I50L 5L88H 4NYLA 4DKAA 2DI8A 4HW6A 2L7UA 2VZUA 2EDJA 3BRGC 3OKMA 1QSEB 3KYNB 2B8OT 4S10A 4DTGL 4F15C 4QRRE 5DMIL 1P1ZB 1G7JA 1OCWL 3GEWB 1M6OA 5F8QC 1Z6JT 2YC1B 4WDIB 5CEXB 3VMOA 2R69H 3M17A 1XF2B 1CXEA 5E2TH 4IDJH 1A21A 3UC0H 1OW0C 3ULUF 2MFNA 4O00A 5CBAB 1XGYH 2YRZA 1KCSL 1BIHA 3MJ8B 3NFSL 5D1ZB 4KMLB 3SJVA 5FOBA 5EC2A 3FQWA 1EFXD 2P43B 1IFHL 2Q3AA 2CIIB 3BP4A 4G6KL 1FVCB 1HN1A 2R1WA 3LKOB 4MJ5B 3D69B 2DYPB 2R29L 4ZTOH 1MJJA 3O6MH 2XWTA 1GGIH 4GW4A 3EYFB 4PRIB 4CN1A 3FB6A 3L3KB 3GMOA 3Q5YA 3C08H 3E6HB 2NZ9D 4M6NH 5F21B 3VFVA 1RZKL 3KPSA 4UAOC 4AM0A 3EOBB 2D4DA 3H9HA 3O3EB 3LN5B 4OCYL 5B22A 4MD4B 4PRNA 2FCBA 5GRUH 4MNQA 5E99L 1HI6A 4PJDA 2CGRL 4LLQA 4ZD3L 5CWSA 4PP2B 3FHQA 4N0RA 3V0WH 3IDNA 3CH1A 4PYHA 5HI4C 2FGWH 5CD3A 3UBXG 2BVPA 4JFQA 4OKVB 1TJIL 3WV0A 4D9RD 1F4HA 2DAVA 1NH6A 4ZAKD 1N0XL 4P57A 1J5OH 1MHPH 5JMOC 3GSVB 3GO1H 1DE4A 1W0WA 4EDWH 4QHMA 4YLQT 3IAPA 4AENB 1VKXA 4KZDL 3JV4B 4MDJA 1IAIL 4D0CA 4EI5C 2FJFB 3S96A 4WJ5B 5GQBA 2V17H 1FCGA 2OTWB 4UT9H 1L6XA 3T3PE 3I6GB 1M7IB 1EFXB 3QQ4B 1WFUA 1NFDA 2AJVH 2KKQA 3X3GH 3VXOA 3PIQB 4U33A 1FDLL 1FL6B 4DGIL 4Y16A 1ZLVK 5ILTH 3QUZB 5DRNA 5K9OB 2BVQB 5HI3C 4NOBA 1O5DT 3QXTA 4PY8I 1KN2L 4OD1L 1RMFL 3SDCA 3TT3L 5D2NA 4JHAH 4DAGH 2D2OA 4TSCH 2QJDA 3L3IB 4OZHB 1F4YL 3MUZ1 4UTAL 1R5WA 3IXTA 2Z0BA 3SDXA 4HCRA 4WW2F 2XV6B 4Y19A 3PUCA 1CYGA 4LCCA 3JV0A 4QRPA 3RZCC 3TN0A 4HT1H 5D1XA 4X6CE 5CD5D 4PJ9C 4LCWA 4BQ9A 1MCFA 2CXGA 2CPCA 4UBDD 4V2BA 5IFAL 3HC4L 4YFLI 3MCLL 4MXVE 2ICWA 1PZUB 5JXAH 4GXVH 4GG6F 5FA4B 1BWWA 1YMMD 4ZAKB 3K2MC 1YN6B 4QWWD 2ZSWB 3X12A 3HE7D 2VDLL 3QCTL 3DMMD 3TNMA 5DYOA 3D48R 4HS3B 3LPFA 1ZA6B 4AEHL 1MCQA 2N1KA 1YEIH 4ZOCA 3KYMB 1VERA 3CDYA 3O6FC 3R0MA 1A22B 2OM5A 5DHVH 2VLKA 3IU4L 4KPHL 3WIIL 4Q6IB 2F58H 2JF1A 1DFBL 2BNRB 3P9WB 3SKJL 1JHTB 2PN5A 4L29A 1MVFA 5J3HD 4RIRB 1P9MA 1MAJA 3UPAA 3DRTB 1UWGL 5KBNC 2P8PB 4X9FA 2EH7L 2GFBA 3UJJH 3VXUD 5J6HA 5CEZE 2AJYH 2HKHL 4WUUA 4NM4L 4O4YH 3VJ6A 5HBBA 2KPNA 3F7PC 4XCNA 3ARFC 4LEOA 1U41A 1G7MA 2JK5A 4M03A 2ZUXA 3G5YA 4HIJA 1VFOA 4H26A 2Z8VC 4OTXL 2QSCL 1JGVH 3QNZB 1OAZL 2QQLL 3RUGF 5GGSA 5DD5L 4ZFZA 1FNLA 1BFSA 4L5FL 4EN3B 2GTWB 1S7WB 5EC1B 1Q0XH 2A6IA 2A9NH 2VNCA 3QEGL 3IDJA 3WS3B 5I8EA 1Z5LA 3ZT7A 1EEZA 5GJSH 2Z8RA 2QR0A 1BOGB 5DI8B 5FGCE 4AH2A 4ISVA 1HXMA 1QA9B 3GGWB 4NSKB 2HJKA 3RWHB 4DZBB 1YMMB 1I9RL 5FCUH 1XCQA 3REVA 5ACZB 1A9EB 4WUKH 3HE7B 2FX9H 4RMUA 5FGRA 5KSBF 5TPWH 1I8KA 1KN4L 5DS8B 1ZT7A 3GIVB 1FRGL 3WUWB 4OZFB 4LBEA 3A6BH 5E2VH 5JOPD 4UU9A 2DD8L 5I30H 4XAWH 1FG2A 4OLVL 1NGPH