2H41A

Solution structure of the second type iii domain of human fibronectin: minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
95
structure length
95
Chain Sequence
b'GPLGSHLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin
publication title Interdomain association in fibronectin: insight into cryptic sites and fibrillogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 12
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h41A00
1KJ2H 1LP9B 2VDOL 3NPSC 1XGUB 1D5ZA 2VDML 1E4WH 1IEAA 5CUSH 4JHBA 3LN4B 5HHOD 4WU7A 2AK4A 3CLEL 3MRFB 4P5KA 1T6VN 3QSKB 1FBIL 1T1WA 2IANB 3KS0J 4H5SA 2J1KA 2VLLB 1UXWB 1JCKA 2MKLC 4CVXB 4X9GA 1NFIB 4MB5A 2AK4E 3VD7A 4I3SH 5LGJA 1QYGH 2VXTH 3QQ4B 4L8CB 2BJMH 3P4MB 5TPWH 4A6YH 1BQUA 5I73B 4NKMB 1AC6A 1ORSA 4GS7C 1LK2B 1G0YR 4AENB 3UBXI 1EZVX 1QNZH 2Y36H 5JZ7C 4HPYL 4WI4A 1H0DB 3ARYA 3HNVL 2ARJB 4P46D 1RHHA 4RISL 3OJMB 1YEIH 4FG6D 4YHML 2NMSA 4BFIA 1LE5B 4UT9H 3ZE1F 4W4NA 4WW2C 5E9DE 4RGOL 4DGVH 4JO1H 2NTSP 5H35B 5DYOB 4F37F 3MGAA 4O58H 1YC8A 1JHKL 1NUDA 2D7TH 3O81A 2CIKB 2YD4A 3KPLB 4LHUA 3T0EA 5HXMA 4X5WA 1CDBA 4RGNC 3SGDH 2IADA 4O2EA 3RTQC 3FAWA 3GB7A 3U9PL 5TQ2H 1JK8B 4M1DL 4APQA 1DVFC 3MRCA 5BS0D 1RJCA 1QEWB 2LAGB 3QIUD 5GGRA 5L8LB 4WUUD 3SJVB 4U4BA 3ME0A 1L4IA 4FNLH 3U82B 3FHAA 3O6FB 2IJ0C 1GAFL 5C0CA 4LVOB 3J8F7 2VKWA 4DVBA 5IW6B 1VENA 4QGYA 3PWJB 1F4WL 1F8TL 4GRLA 2YN5A 2OBGA 5ESQA 3GSXA 2VLJA 3DUUA 1HHJB 5DJXA 1FSKC 5C0CE 5D93B 3MJ9L 2I24N 1WBZB 3KYAA 2P7TB 4FTVB 1CGWA 3EOYG 5HHVL 1CLOH 4XC1L 1U58A 3E2HC 4FFWD 3CMOL 2BCKA 4PJBF 1ZA3B 1J0IA 4BSVA 4ZTOL 1I8MA 1U8LB 1QLFB 4BQ9A 2RAMA 1YY9C 4PR5A 1X5ZA 4D9QD 3FL7A 1MCQA 5DJ6A 2X4RA 1CG9A 4K2UL 2OMBA 5BRZD 4JY5L 1DN0A 2A6JB 4KU1A 1CDUA 2Q7YA 1X5AA 1E6JL 1PG7W 5I1DA 2DD8H 2NY1D 4N0UB 5AAMA 1IT9H 3MMEA 1EHLH 1PYWA 1CDHA 2YD1A 3VWKD 1TTUA 3GMMA 4ODUA 4PB9L 3BEWA 1WBXB 4KRLB 4P3DA 4B50A 5GS0L 4EXKA 5FB8B 5E0QA 1L6ZA 3RDTD 1K4CB 4R97B 2ZUSA 3BMWA 3T0EC 5DD5L 2HTKC 4HWBH 3OKNA 4PJ7E 3BDBA 5D5MA 3QQ9D 2E27H 5F9WB 3OV6A 5LCVH 3MCKB 3ARFA 1A4KA 1I85A 3K2UH 1ZHLA 3KPRD 3QIBD 1DP0A 4APQC 1J7VR 5IVXE 4PV9A 5C0GA 3Q2CA 3H3PH 2VXVL 3NGBB 1IJ9A 1HHGB 2EYSA 3RWHA 3IRZA 5C0RH 4TSCH 3D48R 3N1GC 5CBAB 1JRHL 4J4PD 1NMCC 1IKFH 1GC1L 3BPOC 3IDIB 1M71B 5I18H 1NEUA 3VI3E 2HG5B 2W0LA 4GRLC 1MHPH 3D2UB 4UOW0 5B39B 1TMCB 2CQVA 3CDFA 3VFUB 2CO6B 2JJUA 3SDAC 3PWLB 4DKAA 5FK9B 3I50L 4GKOA 1UH4A 3BP5A 2DDQL 1UCTA 4G8FB 1PJ9A 2FECI 4H8WH 3KDMA 3TJHC 3BXNA 2UVFA 1ZK9A 5DRNA 1U6AL 5IG7B 3O2DL 4KQ4H 3A6OA 2DM7A 1BM3L 4QRTB 3DETD 3IU4H 3GSUB 3BP6B 3CSYB 5HVHC 2HKFL 4XB7A 1FIGH 1SHMA 4NKOB 4HG4J 5HVWA 1OGAE 3CVHH 2VR4A 2FX9H 5E4EB 3ROLB 3TO4B 1RZ7H 3JVGA 1KTDB 1OGTA 4I77L 4UDTB 3U0TA 4CADB 3LSOA 2JF1A 1EFXA 4OB5H 1NKRA 3CH1B 4GOSA 5H2BA 4XVJH 5JOEA 5I76A 4XTRC 1JGEB 4L4TA 3BEVB 1WZ1L 1N7ML 4YPGB 4OF5A 3T2OA 3GBLA 1MUJB 2D9QB 2F58H 3HC0A 3HHRB 1IBGL 1Z9OA 4ODHH 4A2LA 5DJ8A 5C0JB 3ARFC 1I85C 3X3FL 2C3WA 1ODAA 3UXFA 2Z0BA 4ERSH 4N1CA 5DXWA 3VMNA 4PRPA 1TZGL 2XIDA 1JZ5A 3L3IA 3UTOA 3TESA 1QFPA 4DN3L 3E0GA 3BZEA 5J11B 4KJPC 2PNDA 3C6LA 1CFVL 5HI5D 2XN9B 3DBXA 3MOBL 5LKNA 3P9LB 4B7IA 1AXSA 5ANMB 4LPVA 3BWAA 1BF8A 4YXKH 4WFHE 1HKFA 2R56L 5D1XB 4PS4L 5T1LB 2PO6B 5A16A 1KIRA 1GSMA 2F8XC 1JNLL 1U8MB 4X7EC 3U9UA 1IC5H 4KGLA 4MHHI 1OD7A 2DYPD 4KK8C 1TZIA 3TN0B 1AY1L 1ZVSA 3I6KA 4TUKL 2YZ8A 1FGVH 4U05A 5BXFA 3FN9A 2CMRL 3S4SG 1AE6H 3SDXA 2Z93B 4P3CH 5IB3B 3ZKXC 5DO2D 3ARBB 4L29B 4XNQB 4X6BA 2J4WL 1KIQB 1CDIA 3OAZH 4KKCC 1EEYB 3BKCH 1JF1B 4LDOB 1HSBA 5MEND 3U7WH 4OGXH 5AG9A 3SDXE 3JVGC 1ORQB 5F93C 3W9EB 2AQ1A 4ZO6A 3ZYIA 5JR1L 1CU4H 4UOW1 2CKBH 4R26L 1JNNH 3FOMA 1FL3A 5HYFA 4M61A 2DI8A 1KC5H 3WFDL 4YDKH 2WIIA 4S1DD 1KBGH 4Q2ZA 2BOBA 3O4LA 4U1KA 1NH6A 1AI1H 2OXHA 1R5WA 1FCGA 1YYLL 1OB1A 4HFWB 2PW1B 3NFPB 2W0KA 3MACH 3VXPB 4LLWB 4GKSB 1NC2B 4NDMB 4TVPE 1AGEB 1CD0A 1CIUA 3K80A 3VU2A 3HCVA 3N9GL 3UTZA 1C1EH 15C8L 1XGQB 3IT8D 1CR9H 2EE9A 3WS6A 3MV7A 3O45A 4XBGA 2HH0H 1T22B 4P9HH 1KPRA 3C6LC 3CC5B 2KZ1B 5C8JB 1S5HA 2B5IB 4Z5RA 3S37X 3VRJB 4LOUC 1XR9A 4HUUA 2PUQT 1AD9A 3C8HA 3LPGA 3CCHB 3O2VL 3P0YH 1K8IB 4H25B 4FFZH 4N0YH 5EG6C 1YDPB 3PWPB 4MNQB 5F7DB 1LO0H 3BWUC 4KKAC 5FCSH 4XI5D 4XNUL 1YPZA 1B0WA 4GMTL 4P2RA 1OT1A 5D70H 2D2OA 3RWEA 4IMKA 1HKLH 4AG4L 4GAYA 4LVEA 2P8MA 1JUFB 2WNGA 5EUOE 1BD2B 5ACZB 4C56A 2NY5C 3MV9D 3VFWA 5DT1L 4QYOA 3RJQB 2FJHA 3C5ZB 1NCAL 3O4OC 5DJ2A 5FKAB 1NCDH 5J6HA 3LZFL 1N59A 4WHYG 1YPZF 4DGIL 2ITCB 3VXOB 2X4SA 2H32B 2I27N 3RVTD 4HGKC 4CU6A 4HQQH 4OV6F 1B2WL 4XPTL 32C2B 4NWUH 3OKLA 1AIFA 1RFDL 4GW5B 4G6JL 1EJOL 4O2CA 3TIEB 4AEHL 2CIIB 4N5EC 1XEDA 1NFDF 5KVMC 3BW9A 1LDPH 1HXMB 1QBMH 3SGKA 5F3BB 2IH1B 4KXZH 4KK6C 3MCLH 5JIIA 1FG2B 1U3HB 4MCZA 1TJIH 4QKXB 4Y4FA 3ZL4L 3VI4E 4KK9D 5LGHL 4HF5H 3AS3A 43CAA 3SKOB 2ED8A 5CSZB 3WS6C 3U6RB 4KJQD 1YY8B 4PJAE 1BVKB 1K5NB 4A2MA 3QDAA 1U95A 1JI2A 3GIVA 3G6DH 4R4BA 5IVZB 5KVDL 4JZNB 1OAKL 2XFXA 4YXHL 4YHIA 4JFYB 4G8GB 4GXVL 1MJ7L 1MCSA 4CNIA 4NBXB 3HLAA 1LO4L 4XNXH 2W65A 4R9HA 1P84K 5FM5O 5IVOA 1MCPL 3BGFB 1DQDL 4HV8B 3VXSE 2DQUL 4PJCB 2V2TA 4IMKC 1W72H 3V0AC 5AG8A 3VWJD 2G75A 3VMOA 2GSIA 5IQ7H 3H42L 3PUCA 3RZCA 5D7JD 3ZKMD 2XZAL 4HXBH 1ZHNA 2DL2A 2I26N 3PIQB 2EDYA 2PXYA 4HIIB 2O5YH 1J5OH 4Q9CA 5CILL 4OUUA 3QEQB 1J1PL 1CD1B 2YA1A 5JPNA 4KQ3H 1DANT 1A1NA 1MJ8H 4XPGL 1B0GB 2AXGA 2W38A 5FV1L 5GZNC 5ALCL 4LL9A 4OGAD 4OTXH 2EDRA 1QFWI 3LRGA 4JFDA 5C09E 4DCQB 3BIKB 5KSBB 3UO1H 3SDDA 2NXZC 5C6TL 3IDYC 1ROWA 3SGKC 2H9GA 3IJHA 2R29L 4M03A 5LQBL 1OWRM 4JFDE 4WNQA 3ZT6A 5E4IA 4Y4FC 5MHSE 4I0CC 3FRPG 1HH9B 4FMFA 5DUMH 4G9FA 3UTTB 4DKFH 1YMMA 4PIRF 5ICZB 1T89A 5FA3B 5AUMA 1YEFL 1OTSD 1VFBA 3GI8H 4KRPC 3MLZH 1TVHA 1SYVB 1QUNA 3WIHH 5FO7B 4PLJD 5MP6H 1LNUB 1JGDB 4G9FE 4Y2DB 1YMME 4YBQD 2L4OA 4NJAH 3H9ZA 1U8QA 4RBPK 1EHNA 4WI7A 3RVUC 2DQHH 4PYHA 5FM5M 3MLPA 1X5LA 3WLBB 3NOIA 5C6WH 1NL0H 3MRHA 5HGHB 4YGAB 1FZJB 5KG9A 4ZUTB 2NY0C 1T21B 4R0LB 4GG6E 1FL5B 1JN6B 3VH8B 2VLKB 3BSZL 5L2KD 1PQZA 2MQ0A 1QSFE 1SY6H 4QXTB 3KGRA 3QUML 1M05B 1ONQA 1AR1D 3QXAB 5IF0B 2I60H 5EULV 1JZ8A 1BBDH 3RZCC 3QXTA 2FL5A 3UTPD 1T03H 1Q9OA 2EDWA 1BX2B 2JJSA 1DQQB 5JW5B 2PXYC 5EOCJ 1RURH 3FB8B 1KJ3H 4RZCA 2F54D 5IFJA 1MIML 1XZ0A 3MRBB 1N5AA 3EOTH 1UACL 5EPMA 1UM6H 5HYIA 1FZMA 2D4DA 3QUXB 1RMFH 4PTUB 3HNSH 1NEZA 1KYOJ 1TNMA 4HUXB 4O4YH 3GMLB 5D9SA 5HPMB 2XZCL 4GG8B 4ZOBA 1NJ9B 4JKKA 1TETH 4NNXA 2V9TA 3F7YB 2Z9TA 2VITA 2N7BA 1FCCA 1R5IB 4X83A 3SDDC 3ULUL 1HK6A 5IW1B 2FSEB 5DFVD 5HI3C 4ZTPL 1T6WA 2DJUA 5CKGA 3E8UH 2P5WD 4YUEL 4U1NB 1P6AB 1KPUB 5ELIA 3MRIA 5E6YA 2HMID 1T89C 3KJ4C 3QHZH 4XMLH 4JG0L 3F62A 5DGRA 2NY4D 2BNQE 1VEMA 2H32H 4MA1B 4V2CB 3MXWL 4YDVA 1P7QA 1P7HL 5B8CA 5BV7C 4U2ZA 4ZOEA 3L3OA 3NCCB 4NSKB 5I1IH 1F97A 1HOCB 1DE4A 4FZ8H 4PUBH 1BBJB 3SOBH 1MRDL 4Y19E 3VFNA 2RB8A 3WD5L 4OJFL 2OJEB 4ISVA 3HI1B 4JRXA 3DX6A 3CLFH 3TFKD 2WWKT 3S36X 4P0DA 1RZ8B 3ES6A 2D03L 4YC2C 3QI9A 2FGZA 3QHTC 4YE4L 2JJSC 5IMMA 5CJQL 2VXSH 3BH8A 3QXDA 2BXZA 1IQWH 1D9KB 2QHRL 2YC1B 4KROC 4U0RC 5D8JH 3F7QA 1ZANL 1RUAH 4MNGA 1JHTA 2BDNL 1YNTA 3O6KH 3VCLA 1K3ZA 1T7WA 1F6FB 1JNHA 4ORZC 4XCYB 1R3KA 1G0XA 3FFCE 4NKDA 3T65B 4K8RC 4PFEA 5C0IA 2A83A 3L7EB 3P77B 1QLRA 4MNGE 3FZUD 3ARED 1KGCD 4PJEB 2X4PA 1R3LA 3RU8L 2ORBL 1OAQL 1VFMA 2QR0B 1ZLUH 4XP1L 2ZCKL 1BFOA 4ELKB 1PG7X 4U1LA 4UV4H 3MJ7B 3FO1B 4TRPL 3KXFA 1IE5A 1K8DA 2IPTH 1F4XL 3IU3A 3SE9L 3NTCH 1H9VA 2XTJD 2ZCLL 3CX5K 1RZKL 2QQNH 3KLHD 2VIRA 3QEUA 4NT6B 4ZAKA 4CMHB 1CS6A 3JTSA 4XPBH 2AK1H 3RWGA 3MV8A 4RDQG 4KY1H 1PVHA 5C08B 2IBZX 4G8EA 4PJGB 5KN5A 5IFAL 4PJHA 3QUZA 4L8BA 5MI0C 2R2EA 4NUGL 2B0SH 3KG5A 1TNNA 4O00A 1I3RB 1YQVL 2AJZA 5B8CC 3OWEA 2GTZA 2Q20A 2ADIB 1G7JB 3MV8E 1JMXA 4AM0B 2NXYD 2LVEA 3TC9A 4I48B 1DLFH 4M6NH 2ZG2A 1EDQA 1MAMH 1MIEH 2E5EA 1LE9B 4EI5D 2EO1A 4ETQA 3CFBB 5GRUL 1UG9A 3HAEA 2IQ9L 3VD9A 1AQDA 2WWKO 3WEXB 4QOKD 1WFUA 4PJHF 2SEBA 1NMAH 3QDGB 4AIZA 3T4YB 1AP2B 1A1OA 3DX9B 5FUOL 2EKSA 3LN5A 1NGWA 3F7VB 3QI9C 2R0KH 1OL0A 3B2UD 4X6CB 3RGVD 4RMTA 2ESVE 4GSDL 3KPQA 2Z31A 5SWZD 3U0WL 1J87A 4UI2A 2WWMD 3VGEA 3QDJB 4NO0D 3EAKA 4I2XA 4OM1L 5CMAA 2V5YA 4KHTH 5E5MA 4V1DA 1FO0L 1YJDH 5IFHH 4NN6B 3OKKA 1OM3H 2F5AH 4EEEA 1J8KA 1QRKA 4Z7NF 4BQCA 1MREL 2WIMA 2EIZB 4L4VD 1B9ZA 1EEZB 4MMZC 1SBSL 1A7QH 3RRQA 4P5TB 3UAJD 2AS5M 1MWAA 4AL8L 1HIML 3TVMA 1N0LA 2AJXL 2PTUA 3V0WL 3I3DA 3WN5A 1T0NA 1HYSD 1NFDB 2A9ML 4ZO8A 3AXLA 4PJDF 2R4SH 3GK8H 4U6VH 4WTWA 3A67H 2XWBA 3D69B 3P9MA 5M7QA 3ZT7A 3QUZC 5KS9A 1FAKT 1HEZA 2DTMH 4NBZB 2JB6B 4MD4B 4IRSD 2EIDA 5C7XL 1FPTL 5E1AA 3MQIA 3HG1B 4NZUH 2X7LA 1YC7A 4K94L 3VXRA 1A9EA 1OPGH 4JRYA 5KS9E 3BJ91 1WUNT 1F6AA 4FFVD 5TDNA 3RNKB 3VG0L 5FA4B 1AD0A 5EB9A 2QSQA 1UZ6E 2FYYB 3HZKB 5A1AA 5K59E 4OCYH 5DFWH 5AWNL 5JQHC 4HIJB 3VXRE 1MVUB 3HC4H 3OAYK 4DW2H 3MRMA 1CGVA 2P5ED 3RUGB 4FABH 3UMTA 1JZ7A 4I0KA 3V79C 1HI6A 1MCNA 1KFAL 2VOTA 3F12B 1ZS8B 3NACL 4EIGB 2FRGP 3G04A 4LMQE 1ZMYA 2Z31C 3MNVA 4RGMC 5EU6E 5J1TC 4X4ME 5IIEB 3I6LE 3X3GL 3OKMA 4KI5D 4QRQA 3RL1A 3SDCD 4JKPH 3ILPA 4HJ0D 1CICA 3UC0H 3VGAB 3B2VH 1GGYA 1PDKA 4RQQA 3ZYJA 2C3XA 4YDJA 1UB5B 2BOCB 3QCTH 4G43B 3B9AA 3CU7A 1AGDB 1I3GL 1VGEH 3GHBH 3U4AA 1WK0A 5D7IF 3QZWA 1RIHH 4KJYB 1I4FA 4ORGB 1Q0YL 4QRSB 1NGZA 1Y18B 5GRVL 3EO1A 3TVMC 2NW3B 3MLXL 1BZ9B 5I6XC 1BLNA 1LD9B 3RX7A 4NM8H 5FO9A 3WN5C 1Q1JH 1T2JA 2DI7A 3DMMB 5F1NA 3H8NA 4EDWL 2VH5H 2DLFH 4ZUVA 3TH2T 1LO5B 2GSGB 5TJWK 1PD6A 2BVUA 4OSUL 4JKLA 4Y4HB 3DSNA 1UWGH 3B5HA 4OCNC 1KELL 1GVIA 5JDJA 3WO4B 3DI2B 1IL1A 4ZUSB 3RWFB 3KPNB 3IFLL 4IIQB 5DMKA 1SM3L 4M4RA 3BP4B 2JJTA 2VQUA 2NY5H 2W9EL 4NHCL 5I74B 2Y72A 3LDBC 4YWGH 5C0FA 5ICYB 5SX5K 5HDOA 4ONGL 1A5FL 4ESKA 1G7LA 3ZO0A 5DMJB 1YZZA 1X4XA 1P4IH 4N8VG 2AJUL 5GGTL 5DTFB 2IC2A 1F90H 3VFMB 4U1SB 4GUPA 4E9LA 4JGMA 1A7NL 4ZO9A 5I8OL 2AP2A 1WLHA 2VR5A 2XOTA 4PB0H 4I0PD 4JM4H 3QG7H 2Y6SD 2PKDA 1CICC 2V5SA 5ERWA 5EIQA 5C0EB 3FCTB 4JFZH 3SKNA 4M7LL 5DHYA 5GGUA 4RIRA 4JY4B 1BWMA 3P73A 1RPQA 3ESVF 4HEME 4JB9L 4MD0B 4UTBH 1W0WA 2FO1A 1MCDA 1G9NL 1J8HA 2YD6A 2JCCE 3IDNA 3B5TA 2ICEA 4XXDB 1PEZA 1MNUL 1QPPA 1W0VA 4LHQB 5IBLD 1VFAA 2QV2A 4HHAA 4L8SA 3RPIB 1XF1A 4LU5H 2VDNL 2CH8A 3HTLX 2NZ9D 1S7QA 4Q6IA 4OQTH 3HR5B 3O6ML 5DHVA 1Z0MA 3RIAF 2FEDC 5EU4A 5BVJB 5CJOL 2GTWB 5K9QG 2KKQA 1IM3B 1FVEA 3AMKA 3NCMA 5E5UB 1FVDB 4K3EH 3BE1H 2P8LA 3GGWA 2QQLH 4Z77B 5B21A 4HWZB 2EDHA 1FFPB 5IV2B 1F3JB 3LY6A 4P4KB 3DPBA 4LCIL 2JJTC 2Z35A 3SQBA 1FLTX 3GSRA 2VAAB 5AAWA 4KVCH 2NZIA 3PABB 4MD5B 4ONHB 3KPSE 2YKLH 1KJ2L 3W5MA 2DLEA 2PCPA 1CN4A 3LKOB 1YN7B 3O11A 1QA9B 4WFFD 5DDHA 1NCBH 1KULA 4TTDD 1HH6A 1OW0A 5JUEL 1JWMA 1BJ8A 4XBPB 3AB0B 4S1QH 3HZYB 3U46A 2Q8AH 5CSGA 4UAOB 1R24A 2LE9A 3EYSH 3UTQA 3CFDA 3VE0B 2FLRT 3ZDZF 4I3SL 1A6ZA 1QYGL 2VXTL 2BJML 4U6HA 4ZDHA 3D6GA 1X9QA 2NY3D 1M7IA 2APWA 3NABH 1S9XB 1Q0XL 3SPVB 4A6YL 5EBMA 3QNXA 1NCWH 3WLWC 1CZ8H 1YN6A 2V17L 1KB9K 4F15B 2WK2A 2V7NB 5I1HL 3C5SA 4L5FH 2UYLA 2PYFB 3PL6D 4OZGE 4OCXH 2FX7H 3BZ4A 3M17B 4L8SC 5FYLL 2J6EL 3MNWA 5D96B 3EGSA 4JFED 1SVCP 4DN4H 2EYRB 4Y5XB 2X41A 3HRZB 3T08A 4ENEC 4Q6IC 3S3JA 2CGRH 3DHJA 1KLGA 1A0QH 3L6FB 4UT9L 3JV6B 2DIJA 4NQCD 3OKDB 5JLZA 1YNKH 2R0WL 3VFTB 1A21A 3ECBB 1SJEB 4OFYA 3T8XA 1UM5L 2QQKL 4Y1AE 3T0VA 1CI5A 1HN1A 5IB4B 4BYHA 4GRWB 4XP4H 3QO1B 5EFIA 2X1QA 4TSBH 4XVTH 4JZOB 2H45A 1IILE 5EZLA 1DDHA 3MJ9A 5GHWH 3IAPA 4X4YA 1G7MA 3T4AB 4NCDA 3MJ6A 1E4XI 1RJLB 35C8H 2VERN 2FO4A 2YD2A 3MLUH 4LLVA 3SE4A 2NQCA 4LCCA 4WGVB 4FNLL 5AYUH 4ONOA 5HYJD 1T1YB 2A9NH 2DLIA 2CLRB 2X4UB 4DQOH 1OW0C 3DWTA 1FL6B 3V95A 2ADGB 4DK3A 1H8SA 1BVLA 3WXVH 4JQXA 4YJZL 1UZ8A 4L3ED 3MUGA 5KVEH 4I18B 3DO7B 4GKNA 1NSNL 1ZLVH 2Z92B 2VJXA 4JLRA 5H37G 5FCUH 3RWJA 1UXSA 2DM3A 4UMGA 5HHNB 1MCRA 3OJ2C 1CLOL 3EHBD 1QSVA 4JFOB 4OD2A 4EUPA 1D6EA 3ARTA 5EOTA 4JHWL 4DJMA 3ZSTA 5D7LD 3ARDB 2OR9H 2HJKA 2NX5B 5HDBF 1S7VB 4JG1H 1VADB 1X7QA 4Z7WB 2NYYC 1DEEA 5T1MB 2OSLA 2R1YA 2DD8L 4ZXBD 1IT9L 3RVVC 2XTLA 3PWNA 1XGPA 2XNAA 5GRJH 5FGCE 5C0BB 1RUQL 3IYLW 4QO1A 2LU4A 1HSAA 3HE6B 4ELMA 1QSEB 1ZLSH 1PAMA 3FKUS 4OD1H 1HHIA 4Q9RH 2N7AA 2GUOB 4UDUA 4HWBL 2LFGA 4FQJL 4YHZH 3TA3A 2E27L 4HIHB 3S36H 5LCVL 3X14A 5E7BA 3K2UL 2HVJB 1ZKAA 2W9DH 5FDWB 3D3VD 3W0WE 2XRAL 4XP9H 1ZA6A 1WFNA 2YBRB 4F2MA 3FO9B 3O3DA 1BIIB 2ICES 3SE4C 4JY6B 5IB1A 4LCCC 4P2OD 1UH3A 5C0RL 4TSCL 2KQMA 4R6UA 2WV3A 4ELMF 1XGYH 2A6DB 3AROA 3O2DA 4QHLB 3MUHL 3LRSB 2FZ3A 4CMMB 3L3GB 2LABA 4K8RH 1C5BH 4PG9B 1MAJA 2VDPL 3VXQB 4I13B 5TQ0L 4JQXC 1HHKB 1KCSH 4LRNH 2G60L 5JHLL 4G42A 1RUKH 2APXA 3BUTA 4JPVL 1NAMH 1TCMA 3KNBB 3D18B 1PG7H 3VXUD 1DQJB 3H9SD 4BZ2H 2R2BA 1I3UA 3HE7B 5F3HA 3MRQB 4H8WL 1HXYB 4LPTA 4KQ4L 5JZ7D 3VI3F 3IU4L 4HZLA 3O3EA 4EN3B 1FIGL 1FNSH 3E6FA 3OZ9L 3CVHL 4KV5F 2FX9L 1O7SA 1C8PA 1RZ7L 3DRQA 3QEHA 4TUJA 1AC0A 4RWYL 3R1GL 4YHNA 3B9KA 4RCAA 4OIIL 2UY6A 3D39B 2QADC 1WWAX 1DTUA 2EEDA 1F11B 4P23D 5DS8A 4OB5L 3O2WL 3M45A 5JDSA 4PD4K 4WHTA 4RAHA 3S34H 4ODBD 2VE6B 4RGND 3SCMD 2DQCL 3RWDB 2G9HA 3RTQD 1GC1C 4LLUA 5IHLB 3TIDA 5J56B 2OP4H 4MXWH 5E8PB 3TA3C 4FQHB 4HS8H 1DVFD 3RZWA 1CK0L 4FQLH 4MAUH 1N2RB 4MJIB 4R96A 4E41A 4N90E 1IC4L 1G7HB 2JK5B 4MA3A 1ZVHA 1T04A 4QF1B 3EFFA 4CVZB 1NC4B 5D2NB 1F13A 1A6TB 2DMCA 5TDPB 1DR9A 3I75B 2H3NA 4LKCB 5HHME 1SVZA 1I9JH 2NNAB 1MH5A 1GZPB 1KB5B 4N8VA 3CD4A 2GJ6B 4F57H 4LIQH 3ZTNH 2P45B 1JPTL 3QPXL 4HIXH 4M4PA 2XZQL 4PLKC 2V9QA 4HMEA 1IC5L 1QOKA 2X9XA 3KVQA 3CAFA 1A6AA 1NGXB 3EYVA 2AABH 4KHXH 2BNRB 3OB0K 4J12A 2VDRL 4M02A 5BJTB 5JHDB 1RY7B 4P3CL 1YY9D 3FB7A 6FABH 4FS0A 4JREC 4PJIF 4NGHH 3N1MC 1DBBH 3F5WA 3BKCL 2AJ3B 4LGSB 1EPFA 4OGXL 4F7EA 2NY6C 4CKVX 1CGTA 2IPKB 1C08A 1CL7I 1CU4L 4LP5A 2AJSH 2ITDB 3B9KC 1JNNL 3O6LL 3V6OA 5FAAA 1LQSR 2MPAH 4YDKL 4N8CL 5HHOA 1JGVL 1KBGL 4M7ZC 3TWCH 3HAEH 4LHUD 1AO7B 3T0ED 4S0SD 5JOFA 1AI1L 4LSTL 5I8CA 2A73B 3WE6A 1XR8B 3QRFM 2EC9U 1I9RH 3MACL 5HHOE 5DFTA 2QSTA 2EDLA 2O5XL 1X5JA 3ROOB 4APQD 3PWVB 4IS6B 1IGJB 3RWIB 4LRIA 2H2SC 5CWSA 1C1EL 4QRUA 1QFUH 5CZKA 5EU5A 5IB5A 3TYGH 1ZLWK 3TH3T 5C0CD 3TBYB 2Y7QA 4P9HL 4XHJC 5GRVK 3KPMB 1WJ3A 4D0BA 2COQA 5ADPH 4PJ5B 4TTGA 2DLTA 2VLJD 3EZ8A 2ZSVB 2IH3B 3EYOA 3VFOA 3EDFA 3C60A 3P0YL 4OAWB 3SDAD 5DQDL 3CPLB 4FFZL 2GJZA 4AIOA 3D0LA 3DVNA 1MI5A 2GY7B 2E9JA 1FLRL 1MWAH 3TJHD 3V8OA 3QXVA 5CBEB 1EO7A 2QLVB 1I7RA 1REIA 1KT2A 1HKLL 3S88H 2YSSA 4PRHD 2VNCA 3SQOH 3LEXA 1JGLL 1CLZH 3MUJA 4XXCA 3N50A 1FDLH 2X70B 1MFNA 4F58H 4L3AA 1DQTA 5K9OA 1D5ZB 3V6OC 4YR6B 1IEAB 3HPJA 4LSQL 4UNVA 2K7PA 4XTRD 3TCXA 4WU7B 1XGRB 2AK4B 3KYNB 5BS0E 1AGFB 5TFSH 3IDXH 4MZ3A 4WUUE 3ARGA 5GJSH 1DUYA 5EZJA 3QNZA 5BMFH 1Y6KR 1F3DH 4JDVA 2YEZB 3ARFD 5TE6H 4IRZH 4WJ5A 3WJJA 1PKQA 3CSPA 1ZOXA 1LDPL 4GBXA 1QBML 1B6DA 5L2JA 5LGJB 4HK0A 3JXAA 1FC1A 1I1YB 1W8NA 4LARL 4LRIC 3E2HB 4KJPD 4HF5L 3X13B 1ORSB 4LLYA 4OKDA 1NAKL 3NCJL 1PFCA 3QUKA 3L1OH 3U0PA 3QDMD 5HYEA 5DR5H 2C26A 3GIZH 4NO2A 5E2TL 5E9DB 2O26U 3GBMH 3G6DL 1CXIA 1MFDH 2C1OB 1T20A 4I8DA 3L5JA 3C60C 3L5WB 1KPVB 4KK8D 4NC1C 4X6DA 5I71B 3TM6A 1VHPA 2BSRB 5HHPA 4D9QE 1TTGA 2E7CA 3T3MF 3VWKA 4HBCL 5BRZE 4XNZB 1S78D 4PJAF 2VDQH 2VTFA 4X6DE 4WTZA 3S97C 1T7YA 5IQ7L 2A0LC 2BY2A 5I9QB 2IADB 1OCWL 2OTWB 3GB7B 2FHFA 4XXCC 5FHBH 1SEBA 3BAEH 1DCLA 1J5OL 3IDMB 1FN4A 3PXJA 2ZJSH 3BUYA 5TDOA 2P8PB 3WXWL 1I8LA 4KQ3L 5T5FH 1MJ8L 3KPRE 4L4TD 2BMKB 5C0CB 1HNGA 3BPOB 4OTXL 2GAZB 4DVBB 4M6OH 4Z7OF 5AD0A 4QRRA 3ARGC 1I8KB 4GRLB 5E24E 1DQLH 3C8KA 4XVSH 4Z7VA 3UO1L 3WJJC 5L0QB 5EU7C 4GBXC 2J5LB 5IBUB 4PRPD 5F7UA 4OGYH 3P9WB 4QRPD 4Z7VE 5DUML 1LILA 3G5XA 3C6LD 3GSWA 3ZE0F 4DKFL 5DJZA 4LQ1A 5ADOH 4JR9L 3C08H 3GI8L 2CK0H 4LOUD 2HWZH 3ZDYF 3Q0HA 4N1HB 1F02I 3WIHL 3QUMA 4F7MA 1IGIH 1S7XB 4HKJB 1HINH 2VRAA 3P30H 4NJAL 4LBEB 2Q7YB 1U8OA 3G5ZA 2GEEA 4KKAD 1T1XA 3H7BA 3HPLB 2NY1C 3PWUB 1NBYA 5HJ3B 1OQOA 3MODH 4PJ7B 4X99B 3VWKC 3RL2B 3FQUA 2Q76B 1T5XA 4CN6A 1XAUA 3NFSL 4FQ1H 4G5ZH 4AK1A 1FH5H 2X4QA 4D0CB 1TITA 4FQXA 1GGTA 5IVXB 1SY6L 3O3AB 1BQHB 4PJ9A 4ZSOA 3A6BL 4LPXA 3QQ9C 1KJMA 2YMXH 4HS3B 3FHQA 1ZHLB 2Y06H 2VDOH 2ZCHH 1BGXL 3GMPA 2VDMH 2DWDA 1CFSA 1S5IL 2W60B 1HILA 1U8JA 3EOTL 4ZSOE 2EYSB 1NPUA 1UM6L 5KAQF 5I2IA 4GG6F 2VQ1B 1FBIH 3O4LD 1IEBA 3NIFF 4MJ2A 4BELD 2PR4L 4N5ED 1UADC 4O4YL 1JMZA 4KVNH 5D7KD 3N1FC 3AUVA 4WCYL 3LB6C 2VMFA 1QBAA 2AAVA 3ULUF 1WZKA 3ARPA 3GSOB 4UUJA 4AH2B 4ZD3H 3VGBA 2BVPB 1YYMH 5GQBA 5CP7B 3K81A 1OGAB 3MV7D 4V2BA 1C12A 3KDMB 2OLDA 4U1GC 1MLCA 3QH3B 3QB7C 1EK3A 4XMLL 2ZG1A 3QG6A 4HPYH 2O93L 3HNVH 4XP5H 3H9HA 4BSWA 3BRDA 4RBPH 2Z8RA 4JFQA 1OGTB 4OI8A 5I1IL 4B0MM 4OLUH 4RGOH 4IJ3C 2EE2A 1EFXB 3QISA 4PREA 3FO2A 5MENE 1CWVA 1XGTA 4K3DH 4P2RD 2A6KA 3MREA 5CEZH 3QR2A 1S7WA 5H2BB 2R2HA 4FOMA 5E2VH 5IEKB 4PY7A 4IOSD 2M8XA 4C56D 3BD3A 2P44B 3UTSA 4FQXC 4QCIA 4WWID 5DRWA 4M00A 3U9PH 1VFUA 4P49A 4PJ9C 3ZKNC 5DJ8B 3BH9A 4M1DH 1ACZA 5F96L 4LCWA 3ULUC 5MEOA 1BPVA 1IQWL 2ZUUA 4MDJA 3TBVA 5D8JL 5DEFB 4ZS7H 5CLTA 4Z7UA 2X4OA 4RMUA 3TNMA 1GGCH 1UWEL 1GAFH 5GZND 3O6KL 3BZEB 1OSPH 3DUHA 3C6LB 5JORB 3RBSA 4WEUD 5HI5C 2ARJQ 5INCA 5JA8B 4HGWA 3JZ7A 1F8TH 3KHOA 4N1EA 1AXSB 5HVFB 3G6JF 5FO8A 2J8UA 2CUHA 3BDXA 3TP4A 2B39A 3MYJA 3BJLA 4PP1D 5CIPA 4QHUA 4UV4L 3MRDA 4ODWA 3U7AA 4Z7UF 3VFVB 5HHVH 2IPTL 1TZIB 3CMOH 2OZ4L 3HN3A 1ZVSB 3NTCL 2B20A 4ZTOH 5BXFB 2N4IA 5HPOA 2QQNL 4E42A 4KRPD 3SDXB 4Y16A 2YD3A 3DURA 1OQXA 4PRAA 5KSAA 2AK1L 2J8UF 3GMRB 4KY1L 4X6BB 4K3GA 4L9DA 2H8PB 4MA7L 1L0QA 2YWYA 1HSBB 1JV5B 3QJHB 3HZMB 3O4OB 3NPZB 2OMNA 2AV1A 3O41B 2HLAA 3RVUD 1E6JH 5IOPB 5JW4M 3TO2A 4HS6A 3BQUA 1DLFL 4M6NL 1MIEL 1QG3A 2Q7NA 3MV9E 4Q97A 4G6AC 1AKJB 2BVQA 2YN3A 4JEGB 4M61B 2HFTA 4U3CA 6CGTA 2NY7L 1BFSA 4NNPH 1FO0A 3Q3GB 1P1ZB 1WV7T 5F1OB 4ZPTA 5DD5H 5DK2A 2OM5A 1TLKA 1NMAL 3HUJA 1R5WB 3RZCD 1DZBA 4MX7A 1OB1B 4K55A 3JTTA 1IM9A 1VEPA 4WWKB 4K71C 1U9KA 3I6GA 4CN1A 5ESVA 5DA0B 3DGGB 4OFVA 3HUJE 1MY7A 2HJFA 5CLWA 3MO1A 1BZ7A 3TBSB 3O45B 1RZKC 3H9YA 4JCLA 1GC1H 3L9RB 1YJDL 5IFHL 3MRGA 1KLUB 5CEXB 1S5HB 1OM3L 2F5AL 4JFDD 4RMRA 3IXTB 5BOZG 4NRZA 4MAYA 5E5RB 2WMPA 3SDDD 3P4LA 3QCUL 2A2QT 5HI3D 1I9EA 1WAAE 3T2QA 2I07A 5E8NA 1IGYA 5EUOB 4LPYA 4F8QA 2E6QA 1YMMD 4XI5C 1U6AH 4NCC2 1WIOA 3O2DH 1BM3H 3RWEB 4Y16C 4G6MH 2HTLD 4U6VL 5FM4A 2HKFH 2P8MB 5KSAC 3QHFH 3WDIA 3BI9X 3VWJA 1WCBA 3T0DA 1TQBB 3S5LA 3IF1A 3UYOD 4NJ9L 3PP4L 4HK3N 2L0DA 5D7JA 3MROA 4QYOB 5DQ9A 3P11H 5KSUA 1FZOA 4B53A 1UQSB 2O61B 4I77H 4WGWB 4TNWK 3FB5A 3CZFA 3X12B 3LKPA 2HFEA 3BQUC 4NZUL 2FJFB 3FFDA 1MQKL 1EIBA 1G7IA 1JYVA 3MLRL 4KPHH 2X4SB 2M1KA 1K6QL 4HC1H 4NKIL 2RCSH 1WZ1H 3RVTC 3T2NH 3TF7C 1AIFB 4OCYL 2DRUA 4O2CB 2RFXA 5J6GA 2R8SL 3B8SA 1P4BH 3ET9F 3Q6FB 5I15H 2NXZB 4FABL 8CGTA 5HHXH 1H3PL 5I0DA 4KROD 4C4KT 1FFNA 1GJIA 4PJAB 4OZIF 4Y4FB 4KAQH 2OX5A 5B3JE 4Z78A 4XWGL 2GT9B 2EDQA 2AERT 4NQVA 43CAB 5LBSH 1JP5A 1ZHBA 1Z6JT 4MSWA 4K8RD 4WO4B 4JKPL 3MLYL 2LTQC 3B2VL 1KCVL 1U95B 1VA9A 4IHOA 1D6VL 1EXUB 3VXTA 4MAYC 1IEHA 4JFXA 4R2GD 2R56H 4R4BB 3U36A 3QWQB 4PS4H 1L7TL 3D0VA 4O02L 2KUTA 5IK3B 3VXSB 4C55A 1NANI 1KTLB 1VGEL 4Q58C 4NZDA 4CNIB 4FQCH 1RIHL 2D3VA 4X98B 3D85B 4YO0B 1S7RA 1IFHL 3NFNA 4Y89A 3VMPA 2NY0B 2WQRA 4WDIA 4OZHA 5FUCE 5BQ7A 2V2TB 5IB2A 3S37L 2VH5L 3OXSA 2DLFL 2G75B 2GSIB 5DJYB 3VWJC 2Q86A 1UCBH 2ZUXA 5JPMA 1J9CT 1KIPB 1P2CA 5D7JC 1MQ8A 5JR1H 3ZKMC 3L3JA 3E3QE 2PXYB 4L3CB 1GOGA 4R26H 5GGTA 3OR7B 5L2KE 1UWGL 1CFNA 4J1UB 3WFDH 4XX1G 1I7UA 4Y88A 5F1IB 5IR1A 3GO1L 4OI9A 5DJDA 5C09B 3UTPE 3I2CH 4NQXB 5JPNB 5K9KB 1A1NB 3O8XC 4JRXD 4OZHF 5J1SC 5F7KC 2EIEA 2HVKB 4UNUA 5IMOA 2F54E 1YYLH 1BFVL 2RR3A 1Z5LA 5BZDB 1E4XL 5ID1A 4JFDB 4U1JB 3QI9D 4J3SA 4C4KO 4PJFA 3E6HA 2HRPL 5EBLA 5CJ8A 3LEVH 2H9GB 4RAVB 3N9GH 4QHNA 1XFPA 1DANU 15C8H 4LVNC 2A74A 1GRWA 2P5WA 2XI9A 1BOYA 4G9FB 3QCVH 4JM4L 3KJ4B 2PETA 3LKRA 4NPYA 1VFBB 3OPZL 4XVUC 1BIHA 5HYSG 3H0TB 1TVHB 3WNLA 2UWEE 1ERNA 4E0RB 1FNGA 3N85L 1RJYB 5ALBH 1FVCA 2P5WE 4PJFF 3O2VH 3RWCB 5GRXG 5GZOC 5BV7B 5KBNC 1WFTA 2Y5TB 1D5XA 5CEYA 4AT6B 4WHDA 5DQJA 4GKZB 2RIKA 1U8QB 4YBQC 4NZRH 4K3JH 3KXFD 4GG6B 1U8IA 3GM8A 1R6VA 4YDLC 4U6TA 4C83A 3OG6B 4XNUH 1QSFB 4YBLB 2D9CA 4N0CC 3L3HA 5KG9B 2FBOJ 2DICA 1BVZA 4OKVB 1HYRC 2FIKA 3E3QC 1G7QA 1T2QL 3AU1A 4LPUA 1ONQB 4OQTL 1TCRB 1A22B 3O9WA 4YC2B 1KJ2A 1Q9OB 1GOFA 3LZFH 5I75C 4WFGD 2WUCL 2JCCF 4Y5YB 4RZCB 5J12C 4BUGA 3X11A 4U0RB 1IGTA 4O51B 1N5AB 3BE1L 1J0HA 2QQLL 2IQAA 2EH7H 1MY5A 3BD4A 1RFDH 1PX4A 4JKWA 5IEHA 1EJOH 3OXRA 3ZE2F 2ZUTA 4S10A 1YEDB 1D5MA 5DK0A 5T3XH 3AREA 5DI8B 4PGJA 4A6YA 1RUML 3AFLA 3H3BC 1RZIB 4BKLB 3TT3L 2I9TB 1G9NC 2BNQB 1KGCE 3VFRB 2F53A 3CFKA 2CSPA 4V1DD 4S1QL 1UJTA 3BZDA 2VZTA 3QAZC 4R90L 2Q8AL 4BM7A 2WBKA 1U8NA 1V7NL 4R4NC 2LU7A 2J6EA 5L7XH 5ITBH 4FQPA 5JO5B 1P5UA 5T1KA 2NY4C 1RK0A 2V2WA 1A9BA 1C5DB 1MHCA 2F53E 1MJJA 2XTJE 4R4FL 1FFQA 3Q5YA 4Y19B 1P7QB 5KVDH 3NABL 4X6FB 4GXVH 2KBGA 1NCWL 2NY2B 5I1JH 2AI0L 2VL5A 3TVMD 5J0BA 1J05A 43C9B 3DIFA 3VFNB 1DQDH 1MCEA 2CDFB 2DQUH 2HJLA 4ISVB 1F3DJ 5IMKB 3QWRD 4OCXL 4RMVA 3H42H 4S0TD 2Q6WB 4DN4L 4QNPE 5H94A 2XZAH 2MQ3A 1PY9A 2CGRL 5DSCA 3MNZB 1A0QL 3O9WC 1ZSDB 5CILH 4QOKE 3S4SB 1SJHA 1YNKL 5IMMB 4WI9A 3FFCB 5SWZA 3OF6D 4JRYD 4UZGA 1XIWA 2YPLA 4MNGB 4OZGF 5GGVL 1JHTB 25C8H 1HHHA 4XAWL 4XCCL 3VCLB 3WIFB 4TSBL 4X0KB 5SWZE 2A83B 2JELL 3Q6GL 4L4VA 4JJ5B 2C5DC 4OGZA 3AREC 4KKBD 5GHWL 1PZ5A 2Y4SA 3GSNB 1T3FA 2R29H 3MLUL 4XAKE 2YS4A 5LQBH 1TFHA 1S9VB 1K8DB 5I1AB 4L4VE 3IU3B 2XKNA 2A9NL 4DQOL 1TZHA 1CE6B 1RIVH 4JFFA 5DEGA 1NLDH 3WL9B 5DUBA 2VIRB 4ZAKB 1CICD 1TPXC 5GS2H 3VD3A 4UIKL 3K74B 3WXVL 5KANI 3MV8B 3CXHK 4PG2A 4MZ2A 3I02B 5E6IA 5KVEL 2H41A 2GCYA 5KN5B 3QUZB 5IUSA 4L8BB 1OSZB 2R2EB 3QDHA 2YHGA 4FA8A 1GZQA 2GTZB 1I7ZA 4PJXF 4KTEH 5MEQA 4X7TA 2JIXA 1U91A 1TDQA 5HY9B 1P7KB 2OR9L 4JG1L 5A2JH 4HWBA 3QNYB 2ESVB 4CGTA 3CFIC 3QUMH 2SEBB 2PTTB 2FEDD 3B6SA 5DVKA 1A1OB 5K9JL 2P5EA 3DX8A 3SO3C 4OFKA 1EX0A 4YK4C 5L6YH 3NIDF 3B2UC 4NWTH 4PGBA 3KPQB 5E00A 2Z31B 3LV3B 4PTTA 1XIWC 3TPUB 2P5EE 3OR6A 4DZ8A 1ZLSL 2HFFB 4OD1L 4X6EA 3LHPH 5I8EB 1M7DB 4HT1H 1OAXL 1GXEA 1EBAA 9CGTA 2XZCH 3OKKB 3S36L 3SHSA 1JZ4A 3BO8B 2E8ZA 1GIGH 1QPXA 1QRNA 3SY0A 4JHAH 4RMWA 1P84J 4KI5E 3ULUH 1HDMA 1R5VA 4GW4A 3L3DB 1XCTB 2N1KA 1R3IH 4EKXA 2YK1L 1LP9A 1FP5A 1XGYL 1XGUA 1H3GA 5I6XB 3PHSA 3UX9B 1ADQL 3HNTL 2X1XR 5HHQA 1FYHB 1C5BL 3AXLB 2XA8L 2WBWB 1JPGB 2XACC 3CVHA 3MRFA 1JJUA 5FKPA 5C2UB 1CYGA 4PG2C 1H8OA 1ACYH 2IANA 5D2LA 5E6IC 3HR6A 1KCSL 5LG1A 4YQXL 3UJIL 1J88A 2VLLA 5KS9B 1NAML 1QBBA 2G2RB 1PG7L 4CVXA 1DQMH 1NFIA 4BZ2L 1J8HD 3V0VB 1LP9F 5D2LE 3V7AG 2X7LB 3KJ6L 5FDYA 3P4MA 3VXRB 3WD5H 1A9EB 3ARQA 3EYQC 3MBED 1AD0B 1LK2A 4RMQA 1ZWIB 5ETUB 4ENED 4HLJA 2ED7A 2C3VB 1IZJA 3EYFB 5F6IC 1JHLL 1E28B 3ZYZA 3MRMB 5EU6B 3RX8A 4HUKB 5CJQH 5EC2B 3Q48A 1XH3A 1ES0B 5DMIL 3T1FB 3BFOA 1ZANH 5I66B 1LE5A 4XC3H 5DZOA 2BDNH 4ZPVB 4IRJB 2FX8H 2Y25A 1VGKB 1OD9A 3U1SL 3RL1B 5H35A 4KI5C 5C2BL 2VUYA 2B1HL 2KDGA 4HJ0C 4MXWL 3C2AH 4DFHA 1RZJL 2CIKA 3KPLA 5KZCB 2ORBH 2R0LH 4OF3A 4FQLL 4MAUL 2ZCKH 1J0ZA 4UIMB 2Z91B 2CLVA 1Z9MA 3C5JA 4TRPH 1F58L 3KLAA 4DAGH 2X9YA 3AS2A 1JK8A 1OHQA 4H8WC 1QEWA 2ZCLH 1RZKH 2A38A 4GLRI 4XX1E 5AZEH 3ZSSA 5FO9B 2E9BA 5KW9H 2VB5A 4EIZC 5C3TA 1I9JL 5IFAH 4LHUG 2DWEA 3VFGL 4LIQL 3ZTNL 5IW6A 3H6JA 3PWJA 4ZUVB 4XNMA 4N5UA 4YHOL 4RFNB 5D1QB 4GFTB 1IAII 1HHJA 4QTIH 1A7PL 1CDCA 5C07B 4KHXL 5CEZD 1WBZA 5EBGA 2P7TA 2P49B 2CJUH 4FTVA 5GRUH 4HPOL 2IQ9H 1G6RH 4N0FB 5FYJH 6FABL 4MDIB 1Z0NA 1G1YA 4POZD 5I73C 2NYYD 3IXAB 3G08B 4TNWF 5L9DH 1QLFA 4FQ2H 5FUOH 4AYFA 5DF0A 3RVVD 5DA4A 3IAGC 3REVB 2DTSA 4GSDH 1HWHB 3LD8B 2ERJB 3U0WH 1A3QA 2R1WA 3TWCL 3KYKH 5DWUH 4GUPB 4X4XB 3V6ZA 1Q94A 1FO0H 3IRPX 1B90A 2Y6SC 1WBXA 1I9RL 4WFFE 3DJ9A 4UB0H 1MREH 5ERWB 3SKNB 1SBSH 2JCCB 1I9IH 3NIGF 3P3YA 1LGVA 3PF2A 3IDJA 3MCKA 5CZVH 5E6ZA 1ZXQA 3LQZA 3TYGL 5I19L 2AJXH 5CZXC 3IDNB 3V0WH 1LVEA 2ICEB 1MHEB 3WHXA 5ADPL 4Z95L 3W39A 1HHGA 1VFAB 2IF7A 3TZVD 2F74A 3ETBF 4X7SL 4WENB 5I1EH 5CBAA 4LLMB 5F44A 5IHZA 2UVEA 2NZ9C 3IDIA 4JM2B 1UM4H 1V3KA 5DHVB 5IROA 3FJTA 5FV2A 2JB5H 2B8OT 1CQYA 2KZWA 3D2UA 5C7XH 1FPTH 3OB0H 1N3NB 1AXIB 1TJHH 4J3VA 4AQ1B 1XCQA 5B39A 1H8NA 1S7SB 1UKSA 3DV4B 4JFEE 5D93C 3VFUA 1QSZA 2DQGL 3PWLA 5FK9A 2P8LB 3GGWB 5JIKA 1NBZB 3VG0H 3KPSB 3S88L 2VWEC 4G8FA 4NQCE 4KC3B 1ZT7A 2Z35B 3EDDA 1CLZL 5IG7A 1XF4B 3VDBA 3ULVL 4JKMA 3NZHH 1FDLL 3BP6A 1ED3B 5JNYB 4G7YH 2QADD 3ILQC 3TO4A 3CX5J 3NACH 1B6UA 4OZ4B 2D7PA 1NUGA 5EWIL 3RP1A 5DDHB 4EVNB 2RBLA 5HYJA 2V7HB 4CADA 3IDGA 4P9HC 4CVUA 1JWMB 5TFSL 4N9GB 3IDXL 3OX8B 3CMGA 5GJSL 3U46B 3K8LA 3TA3D 2XYCA 5BMFL 3I9GH 3MX0A 1R24B 2ZUQB 3QWOB 5HYJE 3CFDB 3S8WA 3BEVA 1E0OB 1UENA 4LSDA 4YPGA 1BMGA 3LEYL 4R97C 2DIBA 4U6HB 4LSVH 1M7IB 5C71A 4OZGB 5F9WC 3QIWB 3QNXB 5C0JA 3BIBX 1YN6B 4L3EE 4UU9B 3MLXH 1CTNA 4JE4B 5CGTA 2IFFL 5DR5L 3GIZL 4LGPB 2IALA 4EDWH 4JO3H 2OK0H 1R0AH 2YXFA 3K4ZA 3EGSB 5LJYH 2H26B 4PLKD 5GXBB 2JJVA 3UP1A 1PY4A 5D7LE 2IBGA 3MRKB 4ZFOB 3BZFB 4Y1AB 1C5CL 3MZGB 4Z7QE 3PHOA 3FT4B 1ZT4B 4MXVF 2PO6A 4P2CG 2VDQL 2EDFA 5E08H 3MFFB 4E5XA 2BHYA 2NLJA 2W9EH 4NHCH 4XGZB 4PJ8B 2NY6D 2AEQL 2Z93A 5IB3A 5F8QC 3ARBA 3B9KD 4L29A 2DJSA 5EZLB 4ONGH 5FHBL 5IGXH 1DDHB 4PBWD 1KIQA 2FB4L 1A5FH 3THMH 1G7MB 5SX4I 1EEYA 4Z8FH 1JF1A 2VO5A 4YNYA 5DC4B 5GGTH 2ZJSL 5E4EC 3TO4C 1WBYB 1A6WH 1DBKL 1ORQA 5F6HJ 3W9EA 4P2OA 1D5IH 3L95A 1A7NH 2ZUWA 2ZPKL 3CUPB 1RZGB 3D3VE 4M6OL 1IC7L 1CIDA 3WIHA 4J7RA 1DQLL 2C7UA 3KYMA 1PX3A 5FYKU 2I25N 4M7LH 3MUGB 3T3PE 1NDGA 4GKNB 4AMKH 2H2SD 5J1AA 4E41D 3B83A 3EBAA 4HFWA 4JLRB 3WNNA 2PW1A 3RWJB 5EBWB 4TSAH 4OGYL 4DEPB 3VXUA 3VXPA 5LWYH 3FQNA 3H9SA 4S1SH 1VKXB 2VC2H 1G9NH 4LLWA 4GKSA 1NC2A 4NDMA 2K9UA 5F88A 1WEJL 4XHJD 5HGAB 1D6EB 1ZHKA 1IGFL 4X8XA 5EOTB 4PRID 1WVZA 1MNUH 1F4YH 2HWZL 3IFPA 3VXUE 3H9SE 1SY6A 1EH9A 2VLRD 2BSSA 4ZS6D 4IBLT 1T22A 1A14H 5J11C 3CC5A 3O6MH 1PSKH 5FGCB 1AH1A 2OSLB 3VRJA 2R1YB 2E3VA 4JFHD 1LEGB 3AC0A 1S9YB 1UB6B 5HD8C 3MA9L 3CCHA 1N26A 1K8IA 4H25A 2GFBA 4P23A 1XGPB 3QULB 2BVTA 2XNAB 3PWPA 4MNQA 5F7DA 2PO6C 4PGZA 1EHXA 3DO3A 4G5ZL 2MKWA 2EDXA 4NO5B 3SCMA 4RAUB 3TN0C 3ARZA 3W0WB 2B4CL 4TOYL 1UVQB 5J4MA 3V4PH 4KUZL 1Z9LA 4BH8A 2YMXL 3X14B 2JE8A 1JUFA 1BFTA 1EERB 2Y06L 1D3CA 1INEH 3ARBC 1BD2A 2X6MA 4JDZB 4RGNE 3TYFA 1OTUC 2JJWA 2ZCHL 5H8DA 2VABB 2XG5A 1ZA6B 3C5ZA 2KL6A 3GSVA 5FKAA 5DMYA 4P2OC 4AEFA 5JUEH 5GSRB 3V7AE 4LGRB 2IG2H 4XCEA 2FZ3B 2OL3H 2ITCA 4M48H 3VXOA 4KVNL 2H32A 2OS7A 4Y8AA 1OF2A 3DYMA 1ZLVK 1T4KA 4ZD3L 5HGBA 2CIIA 1Q0XH 1JWUA 1YYML 2V17H 2H6PA 2GK2A 1H5BB 2NPLX 2IH1A 3MLWL 4UT6L 5F3HB 5EUKB 5I1HH 1FG2A 1U3HA 1TENA 2F9BT 4LMQI 4W6XB 3ZE1E 4JREB 4OZFH 3BPLB 4XWOC 3O3EB 4CBPA 4U6XB 5FYLH 2J6EH 3JWNC 7CGTA 5CSZA 4XP5L 3U6RA 3C60D 1RJZA 3QEHB 4KZEH 1BVKA 1UJ3B 4HKBB 5TF1H 4AY0A 1MI5D 4YHNB 1VDGA 2B5IC 3CGTA 1A7RL 4G3YH 5C9JB 4DUXA 2R0WH 4OLUL 7FABH 2VXQH 5IVZA 3TJEH 12E8H 4K3DL 1VESA 4P23C 5CEZL 4D94A 5JDSB 3AGVA 1UM5H 5E2VL 2QQKH 4QLRA 1Q9WB 2VXUL 3DX7B 2A0LD 1NGPL 2J8OA 3SCMC 3IKKA 4W81A 5T33H 1N6QL 5T3XD 5GGQL 5IKCA 4H20L 4HV8A 4P4RB 2DMBA 4EQ3A 2CKNA 4PJCA 3CDGB 1A4JA 3T0EE 4H1LH 4DK6A 1DLHB 1U2HA 1MLBB 3PQYD 3PV6B 3FO0H 2VSDA 4JO2L 4ZS7L 3PIQA 2OZ4A 2HN7B 1GGCL 3C5ZC 4FFYH 4HIIA 4MA3B 5HHMB 4FQIL 4NO3B 4PJBA 5GGSY 1M4KA 4F7PA 1OSPL 3V6FB 2IWGA 2E9WA 5F9AC 3ARGD 3FT3B 4YDIH 4QEGA 3HC3L 3WS3B 3DGCR 1CD1A 3W81A 2DQTL 2H3NB 4M62H 2P47B 1B0GA 4Z76A 4PJCF 4GBXD 4PJBE 1MH5B 1NSNH 1EAPA 4N8VB 1BQSA 2MJWA 3EFDH 3SDAA 3BKML 2E9IA 4MMXC 4PRNA 3CFEB 4LKXB 1UWXH 2FHBA 4Z6AT 2WBJB 1BQLL 3LS4L 4DCQA 2FJGB 2VLJE 4LLQB 3EYVB 4HGMA 4JHWH 4XCNA 4TVSa 4LSRH 1HNFA 1U3HC 5KSVA 1ZEAH 3ALWA 4YHKH 4PRHA 3UTTA 3MC0A 3F5WB 5DK3A 2Y07H 5FA3A 2F8OA 3K1DA 3RIFK 5EA0H 1SYVA 5FO7A 4OLYH 3F8UB 4YFEA 5KSBF 1LNUA 4PRHE 1JGDA 2YPVL 5DRZA 3QQNA 1RUQH 3IS0X 2ICWA 4NNPL 4JVPA 1H3UA 5HHOB 4JO4H 1P4LB 5SV3A 4PV8A 5FGBA 3UPRB 5D1ZD 1FZJA 2PF6A 4FQJH 5J06A 4ODTH 3WE6B 1AQKH 5BOPA 1VB9A 4ZUTA 3OHXA 1T21A 4R0LA 1FL5A 1YEJL 2VLKA 1C7TA 1KB9J 3IS1X 1I1FA 4U0QB 2XRAH 2VZSA 5HTSA 4H0HB 3QXAA 3LPWA 4PY8J 5D5ME 5IF0A 1A3RL 2EE6A 1N6VA 1BX2A 5JW5A 1AR2A 5IB5B 4RSVA 1HZHH 2A77L 2Y7QB 3D1MC 5GS2D 4QRRD 2YRZA 3QDMA 3OAUH 4M1GH 3SGEI 2AJVH 4CU8A 2Y23A 2VDPH 3QUXA 2AEPH 3LB6D 5TQ0H 3EYOB 3RHWK 4HUMB 3VFOB 4K9EL 4PTUA 4ZFFB 4P57A 4P46B 2G60H 4NP4H 5JHLH 4HUXA 4MQ7B 4MQXD 4JPVH 5HPMA 2GJZB 5FF6A 3QDME 4KZDL 4GG8A 1NJ9A 3D0LB 3F7YA 3G9VA 1TXKA 5LAXA 5JW4N 5E8OB 3QYCA 5IW1A 2FSEA 2BVOB 4G6ML 1TVDA 1U8PB 3QHFL 5JQ6H 3OZ9H 4U1NA 4U6YB 2CPCA 2VKXA 1NEZG 2C4XA 4ZQKB 4EOWH 3P11L 4RWYH 1CXHA 3R1GH 1FG9C 4OIIH 3U2SA 4PRBA 3S35X 1OTTC 1A8JH 5BS0B 1X6NA 3QIUB 4J3OC 4WUUB 5CGMA 3O2WH 4Y2DC 4R8WL 3HPJB 4KPHL 3RX5A 1CBVH 1Q9KB 4WTXA 4HC1L 3RI5K 2RCSL 5F21B 2DQCH 5C0AD 4KGJA 1BBJA 4FQXD 1YJDC 5FGBC 2EZ0C 3T2NL 5EORL 2A6IA 5EO0B 3ZYOA 1U93A 4PJ9D 3ZKND 1P4BL 2OJEA 2Q8BH 4WJ5B 5I15L 1CK0H 4L4TE 4GBXB 4R0LC 4M43L 3ULUD 5HHXL 2XQBL 3STBA 5L2JB 1Y0LB 1T1ZB 3DROB 5HSFA 4HD9A 1RZ8A 3WIIL 2EH8H 1IC4H 4KAQL 4QRPA 3I85A 4P3WA 2IEPA 4LLYB 3M8OH 5LBSL 1D9KA 2YC1A 3U0PB 3QEGL 4PRPE 2N56A 5E94A 4WV1B 3QFDB 4QRPE 3SBWA 3QUXC 1KCRL 4CDHA 3U4BH 2HLFD 5BRZB 1YQ2A 2YRLA 1JPTH 1T20B 3QPXH 3NZ8B 2QQQA 2XZQH 2X44D 2HFGH 2NY1B 4X6DB 4PJEA 4FQCL 3CXDL 1J1XH 4U3HA 3VXMD 2VDRH 3VWKB 1K2DA 4OBSA 3STLA 1S78C 1U3JA 1CFTB 1SQ2N 4KFZC 1O5DT 3RDTB 2W59A 2FWOB 1G0DA 2Q3AA 4WI2A 1UCBL 1DBML 4BA8A 2Q1EA 4NT6A 4X80H 4HBQA 2EO9A 2ILLA 2XWTA 5C08A 3KPRB 4PJEF 1SEBB 3QIBB 4G6AD 3GKWH 1FN4B 3O6LH 1OLLA 1S7TB 1OP3K 1I3RA 2WLYA 2MCPL 5B38G 4K07A 4N8CH 5TDOB 1JGVH 1EA9C 3I2CL 1QFWH 1G7JA 3AY4A 1N4XL 4I48A 4LSTH 4NN5B 1T80A 3UTSD 1N8ZB 2I9LB 3VD5A 2K7QA 1DEDA 4QHKJ 3C8KB 3C09C 3UCRA 3WEXA 2O5XH 3MR9A 4Z7VB 2IAMD 1R3JA 4PJGF 3O4LE 1NCTA 1M6OA 3O0RH 4LCWD 5GGRY 3LEVL 1T5WB 3LH2H 3T4YA 5D7KE 3FONB 1JZ2A 4NQDD 3QPQC 2DBLH 3F7VA 3G5XB 3GSWB 1DBAL 3QCVL 5DJZB 1U42A 5TF0A 1FQ9C 1D9KC 5ACLA 1G9EA 3HAEG 4KMLB 4OQTA 4F7MB 3MV7E 5ALBL 3SBWC 5DQDH 4X7CC 4TVPL 4PD4J 1L7IH 4NZRL 1J0KA 4K3JL 1JRHI 1FLRH 2EIZA 3EUUA 3OJDA 4W4OC 3TLRA 4X6CF 3I84A 3ZMRA 5FYJD 4P5TA 1E4KA 4Y16D 4HWUA 4QXWA 3FQUB 5KSAD 1MPAL 2X1PA 2LVCA 3PGCB 5E7FA 4I4WB 1DUZB 1YPZE 3KLDA 2APTA 1JGLH 2CRMA 3B9DA 5D4QA 5E8EA 4P2RE 1NFDA 1WZMA 4ZSOB 4KK5C 3F65A 1E27B 4OLXL 1EMTH 1MRCL 2HKHH 2WAHA 5EIIB 4CMHC 2ZNWA 2R0ZH 3KS0H 4HH8A 5DVMA 3BQUD 4YX2H 4ZUWB 4C56E 2I5YL 2PTVA 3GMPB 4JVWA 1HQRB 1OP9A 4LSQH 2CDEB 1HILB 3DVGB 1U8JB 3IKCB 2JB6A 4MD4A 4H0GA 5I2IB 5ISZD 1UKQA 2W0FB 3FTGB 1Y6NR 2EH7L 3HG1A 3AY4C 1A02N 1IEBB 4LSSL 4FXGB 1T7XA 2ADFH 4D3CH 5JIPA 4OLEA 5T3XL 3BPNB 3L7FB 1IM9D 1WC7B 1D7FA 2UUDK 2FYYA 4XHQA 4UUJB 1SYSA 2QL1A 4HIJA 4LARH 1MVUA 5JW4Q 3DSFL 2DYPB 4IMLA 1SJXA 3RUGA 4IEFB 1RHFA 4K23H 3MLTB 1NAKH 3NCJH 3F12A 1JWSA 1C12B 3BGMA 2CXKA 1MLCB 5M94B 3CFJA 3LN9A 5ITBL 5L7XL 4L1HA 2BSTA 2VN7A 1QFWM 4MAYD 5E2TH 5IIEA 1X5YA 4Q74A 2OTUA 3H9HB 5MENB 4JCMA 5CHNB 1YNLH 4NN6C 4LASL 1EHAA 5D7SL 1FAIL 1EFQA 3RIAK 5I1JL 3EYUH 3RUGF 5T1DH 2GJJA 2L7UA 1XT5A 1UB5A 1K4DB 3B43A 4HBCH 3PJSB 3FO2B 4Z0BH 4KUCF 2A6KB 1QKZH 1AGDA 1X5XA 3MREB 1EGJH 4P5TC 1E4KC 3AAZB 1S7WB 5EH1A 5SWSD 4PY7B 2FCBA 4KJYA 4ORGA 1BECA 4QRSA 1Y18A 1WWBX 1BZ9A 1OCWH 1LD9A 3Q5OA 2CLZA 4G6FD 1CF8H 1MFCH 5FOBB 3DMMA 2P42B 4K71B 4YFDB 1M1SA 4DOHE 2FR4A 1DJSA 1X6LA 5F6HI 5EOQH 3QO0B 1AHWA 5IM7B 1LO5A 4MJ6B 3O8XD 3WXWH 25C8L 3B9VA 3QZWG 2Y1VA 2YD7A 3DXAD 2HT2C 5INCB 1V05A 1KJVB 4ZUSA 1JF6A 5F9JB 4OUOA 1ZTXH 3ZHLA 4HZAA 4HUWA 3BESR 4IIQA 3PHQB 3BP4A 5GRZA 1WGOA 5CIPB 1X4YA 4PP1C 3JSSA 4I3GA 4WI3A 4C57C 4HFUH 4JR9H 1RIVL 5EO1B 4XVUD 5DTFA 1NLDL 4TUOA 4E42B 1PLGH 1IC1A 4UILL 2QBWA 3VFMA 1C16B 5IHBA 4U1SA 3TCLB 3FQRB 5GZOD 4K7FB 3V5KB 4NUJB 1IAIL 3MV9B 3ALPA 5CJ5A 1UEYA 3RA7L 1T7VA 2AV1B 5CP3H 2R4RH 3TV3L 2V5MA 4J2XA 3VGAC 5CKAA 4KTEL 3FCTA 4N0CD 1TJGH 4JY4A 4DUVA 3VRLF 4MD0A 4XPAL 4PGDA 3NFSH 2B1AH 4Y4KD 5K9QI 5FEBA 3NN8B 2DJ4A 1J0JA 3REWB 4AQOA 4XXDA 3HUJB 3A6BH 4P2YA 2ADJA 2EEBA 3JTTB 3JUZA 3RPIA 1P53A 3DMMC 3HMWL 2AXJA 5HDLA 5L6YL 1BGXH 4H88H 4NWTL 3UYRH 2EYTA 1S5IH 3FQWB 3UZQA 1KXVC 1AHWC 1FFRA 2HJFB 5BVJA 3LKQA 3MO1B 4X8JB 1IM3A 1ADQA 1CT8A 3DRTB 5BVPH 5DRXB 2PR4H 3LHPL 5GPRA 4EBQH 4HT1L 4M3KB 1FVDA 3MRGB 5T5NF 5CD5C 4YIQA 3WO4C 1KEGL 4Z77A 3DUSB 4HWZA 2MTPA 4NRZB 1GIGL 1FFPA 1A1MB 1KNOA 4WCYH 1F3JA 1MF2L 5DJAB 4IIQC 4P4KA 1NAMA 3ZDXF 4JHAL 1Q9LB 4LLDB 3U4EB 4CUCA 2XPGA 1MFEH 3VA2C 2VAAA 5I74C 2JLLA 1R3IL 3PABA 3IGAA 4MD5A 5DD1L 4ONHA 2I07B 5E8NB 2F15A 4DKEL 2BRRH 1CFQB 1T7ZA 3OGCA 3LKOA 1QA9A 4R4ND 4CDGC 3B5GA 1K9TA 3K4AA 4K3HA 4UQ3A 1HWGB 2HTLC 1EEQA 4PP2A 5I1CL 3VWJB 1ACYL 1H3WM 1WITA 1KCLA 4MCYB 1GYAA 5E56A 3BKJH 3N1QC 5D7JB 2BY0A 5KSUB 4OCSH 4XRCB 2APFA 1DQML 3CZJA 2DQDH 3VDAA 5HYQB 4PGEA 4ODVH 2WLZA 4L8DB 2E7MA 5TH2A 3EJZC 4F9PA 4M5ZH 1OOAA 3GMQB 3RIFF 2V7NA 2C1PB 2AXFA 3BP7B 3S9DB 1IKNA 4NYLA 2PYFA 2RFXB 3FQTB 3O9WD 4LCUA 2ATPA 3BOVA 2DQIH 4LQFL 4D9RD 4R3SB 1H3VA 5L8JB 4JRXE 3M17A 4OV5B 5F96H 3GI9L 1RSFA 1V8HA 2EYRA 2XY2A 3WKNA 4Y5XA 3HRZA 3LQAL 1I1AD 4F7CA 3L6FA 2AEWA 4XC3L 1UWEH 4Z78B 3OKDA 2X4NB 2FX8L 4RRPA 1Q72L 2YD5A 5DURD 4YZFF 3VFTA 4LPCA 1ZHBB 2GK0B 4MSWB 2EC8A 1SJEA 2FIRT 1NGQL 3C2AL 2PYED 3JWDL 5IB4A 1B3JA 2R0LL 3WMSA 3VXTB 3MJ8A 1FYTD 5B38A 4R2GC 3KYOB 4P4KC 3U36B 3D0VB 4JZOA 1KSRA 3QJFA 2C3HA 4QY8B 4BFGA 3UPAA 4KMTL 4DAGL 2OZ4H 2DS4A 1RZFH 2CRYA 2F53D 4QGTA 2EKJA 3T4AA 4WY7L 1LEKA 4HJGB 1RJLA 4RFOH 2DM4A 1NGYB 2YUWA 5AZEL 1B4RA 1ZT1B 4P2QD 3NFNB 3M1BA 3RHWF 4DVRL 5EU3B 3GUTB 1BJMA 5FYLD 3UEZA 5KW9L 3KXFE 4OT1L 4HMCA 1T1YA 3VGHA 4MA7H 5T1KD 2CLRA 2X4UA 4IM8A 5T3ZH 5IB2B 5L2KB 3OXSB 5A2LH 3O3BB 4GRWF 1FL6A 2Q86B 3MGOB 2ADGA 3AB0C 5JPMB 1FFOB 3LPFA 5D71L 3SE3A 5TE7H 5I75B 3L3JB 3LOWA 4UAOC 3LAFA 4U1HB 2CDGA 4RA0C 1WSST 4QTIL 4I18A 3DO7A 4PJHE 2XQYK 1Q8MA 2Z92A 3MYZA 2MQCA 2F54B 2NY7H 1TQCB 1I7UB 2CJUL 3MRPA 1G6RL 4JRWA 1XF2B 5FYJL 1QFHA 3GSNL 4ZFZB 4NZTH 4JFOA 4WFGE 4F9PC 3R06A 3WFEL 4F15C 1T0MA 5IMOB 5IW3A 3ARDA 5L9DL 1Z5LB 2B2XH 5ID1B 1RZJC 1IKNC 4FQ2L 1S7VA 3GRWL 2BK8A 1NBVL 4BK4A 1CE1L 3E6HB 2YUXA 3ARUA 5D96C 5T1MA 4KTDL 3RI5F 4Y5XC 1XIWD 2YPLD 3TNNB 2IGFH 2UWEB 4Z7NE 3KYKL 5DWUL 4ZUUB 1CXFA 3DTXA 2P5WB 4BZYA 3WNOA 4EUPG 2XKSA 1LO3H 4KKLD 4XAKD 1IAOA 5C0BA 4MJ4A 4PJDA 4UNTA 4P48A 4LF3B 2BP3A 4UB0L 1HCFX 2NY4B 1FNGB 3HE6A 1LMKA 1QSEA 1U92A 4I2XE 1I9IL 1FVCB 3QCUH 2GUOA 1YEKL 4V1DE 4MNHB 1D5XB 5CEYB 2VISA 4Z7WF 3EDJA 3WSQH 4HIHA 5DD0L 5DQJB 4PJDE 5CZVL 2HVJA 5FDWA 1ZV5A 3LKNB 4JFFD 3L3HB 1OVZA 1CXLA 3QA3A 3RKDD 2YBRA 2WINB 3FO9A 4WU5A 2Q3ZA 1BIIA 2F19L 4JY6A 3QWRA 4NFBA 1IAKA 5I1EL 3NA4A 5E6ID 1G7QB 2A6DA 4QHLA 4TULL 2R9HC 3MUY1 4NJ9H 3PP4H 3LRSA 4YHPB 5F97E 2W91A 1UM4L 4CMMA 3L3GA 2AW2A 4PG9A 1KJ2B 2JB5L 2BZDA 3SE3C 3VXQA 2AGJH 2JIXD 3WFCH 1TJHL 2ZG3A 4I18C 3X11B 1MQKH 1DN2A 1IGTB 3EYQD 3OF6A 2NR6C 3QFJD 3MLRH 2VZUA 3D18A 3PDOA 1K6QH 3KWWB 4NKIH 2IQAB 2AV7B 4J3TA 5L88L 3HE7A 3OXRB 2HAZA 3ULVF 4LHJB 2R8SH 4JRYE 3ARDC 1D5MB 5DK0B 3NZHL 3AREB 4EN3A 3EO9H 4MWFA 4G7YL 1H3PH 1MHHA 5C0NC 4A6YB 3STZB 3OBAA 4G80A 1ULVA 5D7IA 1UA6H 3VXNB 4XWGH 3D39A 2F53B 2XTJB 3K0WA 3MLYH 1TPXB 3I9GL 1U8NB 1INQB 5KVGL 1KCVH 5D7IE 3T04D 1QRND 2VE6A 1D6VH 4CW1B 5BZWA 2PW2B 3HRPA 2WM0A 3RWDA 3HE6C 1MHCB 2K3TA 1MJJB 4ALAH 1L7TH 3IETA 4O02H 4LSVL 4XPFL 5E8PA 4LCYB 4FQHA 3K7UA 2NXYB 2VL5B 3A0OA 1J05B 2BC4A 4XH2B 1N2RA 1IFHH 4MJIA 4EI5B 3DIFB 5A40E 1EVUA 2JK5A 1YUHA 4QF1A 3S37H 2OQJB 4QOKB 4CVZA 4JO3L 1NFKA 2IAND 3FQXB 2OK0L 1R0AL 1A6TA 3CSBA 3ULVC 5HI4D 5TDPA 3I75A 1LDSA 1F5WA 3FMGH 4F3FB 3SO3B 5DVNA 4YK4B 3SKJL 3VRIA 1SJHB 2GJ6A 3RGVB 4GW1B 3OG4B 1RUPL 5SWZB 3GO1H 4O9HL 1UT9A 1GGBL 5E08L 2R23A 4K7PY 4NO0B 4NRXB 3INUL 1JGUH 1HHHB 1NGXA 1KN4H 2MHAB 3HE7C 1BFVH 5BJTA 4EI6B 1E4XH 3W9DA 4RA3A 3BYTA 5IBTL 4QXGH 4GAJH 1BOGB 3B3IB 4MVBC 5IGXL 1U8KA 4L4VB 3THML 2HRPH 4EN3C 4FN0A 4KKBC 2H1PH 4Z8FL 2AJ3A 1PZ5B 1A6WL 2FH8A 4NBYB 1B4JL 3WO3B 2EC9T 2IPKA 4NN7C 2RJMA 2MWCA 1D5IL 2ITDA 1LEIB 2XKNB 4JQVA 4FXKB 4RX4A 1EV2E 3FN0H 5IJVA 1PBYA 3OPZH 4KTYA 5DUBB 2UZIH 4U1MA 1F2XK 1T83A 3N85H 1AO7A 3LKSB 1ZGLP 2GCYB 4ONFL 4AMKL 2A73A 3CX2A 4TSAL 1GZQB 1VPOH 5LWYL 4S1SL 4IRSB 2VC2L 5CZXD 1AFVH 5MEQB 2MSPA 4HIEB 4MA8L 3PWVA 4IS6A 1IGJA 3LS5H 3SJVD 1F4YL 4RFEA 3MBEA 2P24A 3O6FD 2GITB 1T2QH 1T0PB 4MQSB 1J8HE 4YGVB 1A14L 1NUFA 4CVWA 4RNRB 4CN4A 2X4TA 1E4JA 1PSKL 4G6KH 5DEZA 5DD6B 1BHGA 2ZSVA 5J9PB 1JFQL 4HUVA 2P5EB 3DX8B 1JPST 3ARVA 2WUCH 4XPHH 4PGBB 3IFOB 5E00B 4FTVD 2GYSA 1A7OH 4ZFGL 3DLQR 4JN2B 3CDYA 4X6EB 3SDCB 2QKIB 5CBEA 4NM4H 3V4PL 2EDTA 1Z3GL 2ZWLT 3ILQD 3L5XL 3UJJH 5K93A 1INEL 2WSKA 1OLZA 1RUMH 3U7YH 1F3RB 3V5DB 2UV3A 1R5VB 3MGTA 5L8KB 3EJYC 4GW4B 3TT3H 3Q1SL 2MMXA 2X70A 3BKYL 4LNRB 3ZDZE 4WW2F 3IDUA 5DC9B 4Q9QL 1JYNA 2IG2L 4JQVC 4R90H 2OL3L 4YR6A 1V7NH 4M48L 3OKYA 5HHQB 4AEIL 1XGRA 3CVHB 1T83C 3KYNA 5FKPB 1CVSC 5F89B 1AGFA 4R4FH 5D2LB 1W8OA 5DJ0B 2FECL 3MRJA 2YEZA 5A3IC 2VDLL 1RULL 1G84A 2AI0H 5ICXA 1BEYH 4JANB 2DQJL 5HGDA 1I1YA 1FRGH 3DV6B 1JPFB 1V3JA 1JYXA 4GQPH 3X13A 3MBEC 1MFBL 1ZGLB 2B4CC 3ULSB 1D5BA 1I7TB 2WUBH 5CEZE 1NDMA 3VG9B 4KZEL 5TF1L 1SEQL 3TBWB 3D25B 5ID0B 3ZT5A 4G3YL 5IWLA 3D2UD 5FGRA 5E9DA 3S96B 4HCRA 2V2XB 7FABL 1XH3B 2C1OA 2VXQL 3TJEL 12E8L 3L5WA 1KPVA 5GGVH 2BSRA 2Z8VC 1QR1B 3MCG1 2YD9A 4XAWH 4XCCH 1X44A 3BVNA 2ZOLB 2V6HA 1F4HA 4I0PB 4WUKH 5T33L 4LEOA 1LO2H 2Z8WC 4IOFC 2JELH 3Q6GH 3HI5L 3HMXH 1JTPA 3TO4D 1A6VL 1EBPA 2BFVH 4H0IA 1NKOA 5EDXA 2CLVB 3C5JB 3FO0L 2OTWA 4F33B 4FFYL 5FECB 5JOPD 3KLAB 4ZFOL 3IDMA 1MCCA 4DZBB 4YDIL 1C7SA 5F7FA 4Q9BA 3TZVA 2P8PA 2BNUA 4UIKH 1S9WA 4M62L 3HI6H 4I5BA 4FQQB 2BMKA 3FB6A 3EFDL 2DWEB 2GAZA 3UPCA 5TGBB 4WTZG 4XNMB 2CKBB 1U3ZA 1I8KA 1S8DB 5HDBE 5FYJU 5FYKH 1F45A 1H3XA 4HLZH 4R7NA 4YHYB 1I8IB 4NQEA 5HYSB 1EJ6A 1ND0A 4LSRL 1DBJL 4U33A 4YBHA 5DJCB 1ZEAL 4BH7A 1CL7H 1G9MH 4YHKL 4JFPB 4POZC 2XN9D 2Y07L 4M8QB 4NQEE 2GQHA 2ATKA 1YEGL 5EA0L 1UGNA 5HD8D 5K9JH 3NAAH 5E2UL 4OLYL 1QQDA 1NCNA 5IWLC 5GSVB 3UDWA 1S7XA 2DM2A 4HKJA 4JZJB 5D1XD 5T1LD 2PO6D 2X09A 4HX1A 3HS0A 3GHEH 4LBEA 3H7LA 5B22A 2OI9B 4HKXB 4JO4L 5E8DH 4DTGL 2R1WB 3PWUA 3HPLA 5AEAA 1TVBA 5I71C 3F6IA 3TN0D 2F5BL 5HJ3A 3V6ZB 1Q94B 2WZPD 4EDXB 4PJ7A 1S7UB 4IDJL 1OAXH 4X99A 4ODTL 3T09A 1AQKL 3RL2A 2Q76A 4XNZC 4MB3A 3ARBD 4GAGH 1OTUD 4D0CA 4UBDC 4ELME 2Z4QA 2W07A 4ZYKB 5IVXA 2ZNXA 4HDIB 3O3AA 1FE8L 2NY3B 4XMKL 1BQHA 5I9QC 3IDJB 4HS3A 3GJFB 3LQZB 2YK1H 4HKZB 2X89A 1HZHL 3UZEA 4PBVC 1F42A 3V52L 1ADQH 3HNTH 4PJ7F 1KTKE 2W60A 3ARSA 3OAUL 4M1GL 3WHXB 3PL6B 4KRNA 5FOJA 3W39B 5GS3A 2AJVL 2XA8H 3U79A 2F74B 3WYRA 3RY6A 3TZVC 4JGJA 3MLSL 2AEPL 4QT5B 4PBXA 2VQ1A 5KAQG 5IHZB 4G8IB 4YQXH 4NP4L 4JFEB 4M93C 3UJIH 5IVXF 4HWNA 5MEPB 5D5MF 3BHBA 1S9KC 1DL7H 2E7LA 4LVHB 4OCWH 4NQCB 4ODSH 1NC2D 4KV5E 4UV7H 2JTDA 1XCQB 3GSOA 3KJ6H 5L0QC 4AH2A 3TBTB 2J5LC 4HC1A 1RK1A 4XWOD 3KPOB 2BVPA 4X5LA 3I3BA 5CP7A 3V6BR 1S3KH 1OGAA 5INDB 5JQ6L 4L9LB 4LFHD 4XBEL 4EOWL 1JHLH 2DL9A 1ZT7B 3QH3A 2XXMB 1RD6A 1YA5A 4HK3J 3W11D 4Q7DA 4XCFL 3DVIA 5DMIH 1U8HB 1AJ7H 3UDWC 3PWPD 4OIBA 4MNQD 1CBVL 2C4FU 5GGSB 1VFOA 3CXHJ 5HYJB 1O7VA 3IJSA 4G9DB 2EECA 5DLML 3IDGB 3U1SH 5C0DA 5C2BH 1T2XA 2B1HH 2OTPA 4WRLA 5IEKA 1RZJH 2Q8BL 4Q6YA 4K9EC 1A2YA 1X5HA 2YRPA 4L3EB 4LSPH 1BD2D 3GKZA 1BF2A 2ID5A 1JVKA 5E99L 3C5ZD 4PRDB 1F58H 2EH8L 3DARA 3ARRA 3SGDI 4KRMB 3M8OL 3AVEA 5DMGC 3MRRA 4PRIA 1MJUH 5D7LB 5IQ9A 4E41E 5DEFA 1W72B 4PJIA 3CFCH 2IALB 1X5KA 2VLRA 3RY6C 1JE6A 3MA7B 5JORA 4OF0A 3U4BL 3VFGH 1CGXA 4PRIE 4GRWH 3QQ3A 4YHOH 4NRYB 1B0RA 2EXWD 3L5IA 2HFGL 2XG4A 2OR7A 4ZXBB 1XF3B 4J8RB 4PJIE 2E7LC 1A7PH 3LMJL 2VLRE 1J1XL 5A2FA 3KR3H 3PHOB 5HDQH 1U3HD 3JWOC 4H26A 3BPCB 4HPOH 4QTHB 2R69H 2DKMA 5KVFH 3VFVA 4JFHE 4E5XB 4HMDA 4YEFA 2NLJB 3IB4A 2X05A 3PGDB 2R1XA 4X80L 4PLNC 1VACB 1GPOL 3GMRA 4BFEA 4CRPA 3RVWC 3NPSB 2H8PA 3U30C 4OLWH 4JQIH 3GKWL 1MSPA 3D3VB 4XNYH 4NHUB 4YNYB 1FJ1B 1JV5A 1GGIL 3QJHA 3HZMA 4HH9A 5A2IH 3O41A 3SKMA 1QVOA 4G8GD 2WANA 2UZYB 5IOPA 2D7QA 1QFWL 4P2OB 3L95B 1AGBA 1VSCA 3V6OE 1AKJA 2D7MA 5JXAL 3SDXF 5GRWA 3MLVL 2C7UB 3KYMB 5IESH 3Q3GA 1P1ZA 1NDGB 3O0RL 5J1AB 2DQFB 3LH2L 5JXEA 1FNLA 3VXUB 3FQNB 3H9SB 4GS7B 4WWKA 5I19H 2DBLL 2DN7A 5F88B 1JL8A 3QEQD 1ZHKB 1H15B 1PW3A 4YAQB 3DGGA 2DB8A 5DZNA 4Z95H 5IHUL 3G5VB 5T3ZD 3JV4A 4X7SH 3IFPB 3TBSA 8FABB 4MJ5B 5IMLA 2BSSB 2CK2A 4ZS6C 2ZZUT 1A64A 3EOAB 3L9RA 1KLUA 5CEXA 3EOBB 3B9EA 3BISA 1QACA 4M3JA 5FM8A 1L7IL 3IXTA 3NCYS 4WW2B 3CJJA 4WFED 1QLEH 3BRGC 2BERA 2P1YA 2ICWJ 4F7TB 2E6PA 3GJEA 4U1IB 2DQGH 2GFBB 4P23B 4YFLI 3MRLB 1ZGLM 4NC1E 1FZKA 4Y5VA 4LAQH 1MI5E 2DF3A 4RGNB 5EUOA 3SCMB 2E8YA 3OKOA 3TH4T 3UTTD 3RTQB 3GJFH 4BFBD 2YPKA 3PE9A 3P4NB 2OXGA 3ULVH 4BH8B 1EMTL 1OTTD 2HKHL 1DVFB 3O3UN 1MFAL 4DWHA 2R0ZL 3TYFB 4YX2L 1MCFA 1OP3H 3IJYA 4Y2DD 3PQYA 5T3XE 5EWIH 1UQSA 2O61A 3BDYH 3GMOA 3GSVB 4P5KB 5JA9A 3X12A 2EZ0D 5EUOF 1T1WB 2ZKHL 4H5SB 3V2AR 3KPTA 2FJFA 4XCEB 3PQYE 3ZTJH 2ADFL 4D3CL 4S2SA