2H41A

Solution structure of the second type iii domain of human fibronectin: minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
95
structure length
95
Chain Sequence
GPLGSHLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, structural protein
molecule keywords Fibronectin
publication title Interdomain association in fibronectin: insight into cryptic sites and fibrillogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h41A00
4LVOC 3MA9L 2PW1A 4OD2A 1MWAA 3QUZA 5BS0D 1J0YA 4JFED 3FCTB 2R56H 5K33A 2XPGA 2E3VA 3QEQB 1LK3H 1H3WM 4D3CL 2EZ0C 3ARBD 4P2OA 1NCDL 1A3RH 3HNTL 3GHEH 4AEHH 5I1IH 4ZAKD 1HHHB 5I1GH 4K3GA 5I76B 1HEZB 2BVOB 1OB1A 3TBTA 3ABZA 3FMGL 1CFVH 3TN0D 4ETQB 1MHCA 4JO1H 3L3IA 4UV4H 1OSPH 4Y4HB 4G6AC 2APBA 4RMUA 5E8NA 5GJSH 4U6YA 2DYPB 5HD8C 1QHPA 2YXFA 4GMTL 4XB8A 1E28B 1VEPA 5I1CL 3SBWA 2M1KA 4F3FA 4HX1B 1Q0XH 4OKDA 3GEWB 5DRWB 1P4LB 3LAFA 3NABH 3F6LA 4JPKL 1E0OB 3GRWH 3DX8B 3QWQB 4UZGA 2YUXA 1WGOA 2BZDA 4JFDD 5L0QB 1NAKH 3CNKA 2DTML 1DSFH 5I8EA 4X5WB 2UYLA 3KYNA 2QHLA 1EFXA 3N1GC 5DZOA 3OF6D 3OHXA 2P42B 4JLRA 3GMQA 3H42L 1RHHB 4NQEA 4P4KB 3CVIH 1SEQL 4X7SL 3VE0B 4JHBA 2ZUQC 1M7IA 3AREB 4M8QA 2G5BB 4S1RH 4N8VB 4A6YA 4Q97A 5C0BD 1V7ML 3V79C 1FO0B 3QPXH 4HKZA 1RUAH 4L8DA 2P5WA 1CG9A 3DETC 3KPRD 2HLAA 3KLAA 4NM4H 1UH2A 3HNSH 2D03L 3ZDYF 3QI9A 3BRDA 3UC0H 2ZUXA 4OLWL 1CLZH 1YYLL 4UT7H 1FNLA 1QP1A 3VFWA 3TPKA 4WUUE 4R4FH 3G5ZA 5CSZB 3D2UA 5LJYH 5T5FH 1BZ7B 4LLUB 3WMSA 3PG2A 4UNUA 3QNZB 4NZTH 2ITCA 4KI5D 4OIIL 1RK1A 4PG9A 4NN6C 4ZFZB 1VEMA 4QRSB 4MQ7A 5FF6A 4RZCB 1QZ1A 5DRXB 1MAMH 1GZPB 2R56L 5FYLD 1BIIA 3GM0A 1LK3L 3SE8L 3FB7B 4LDLB 1A3RL 1FNFA 1EGJH 3GHEL 1GOHA 5I1GL 1D5BA 3MV11 4P59H 5E5UB 1CFVL 1FVEB 4JO1L 3UTTA 5BW7C 1OSPL 1P9MA 4RGND 4ZQKB 1G7HA 3GJEB 1LWRA 2X4SB 2FB4H 5GJSL 3GSQB 4Z0XB 4UDUB 4LHUG 2H6PA 5DMKA 3SGDH 4KTYA 4OIAA 1T1YA 1Q0XL 1MJUH 2ZSWB 5GGRA 1DUYB 2R2CA 2ZWLT 4XC3H 2BHUA 2VXSL 3ZDZE 2B2XL 2P4AB 3P9MA 5KSVA 4KGJA 1VENA 4D0DB 3NABL 1FBIH 2DQFB 5DJAA 3P77A 3GRWL 3EW3B 5DQJB 1OAZH 1BZ9B 5DA0B 4QHKI 3GGWA 2R0LH 1NAKL 2XA3A 3VDCA 1U8HB 2BVQB 1CD9B 1HDMB 5LAXA 3D69A 3CSBA 3RDTB 2VDMH 4XNXH 4MDJB 1I1AC 4RISH 3CZJA 4PBVC 1HXYB 1BF8A 2P8PA 3FKUS 4X5LA 3KR3L 1PG7H 1ADQH 5CUSL 4PRID 4YFLF 3PXHA 1J88A 2ZUVA 2VNCA 4KJWC 3RQ3A 4NDMB 3RVUC 2XA8H 2F53B 3VXSA 1G7IA 2VAJA 2GHWB 4X6CB 2VC2H 4RDQG 4S1RL 4NQCD 2V2XB 3D85A 4L4VD 1Q9KB 2VZTA 3IFOB 3HG1B 1CL7I 4PR5A 2GSGA 3QPXL 1RUAL 1TIUA 5M95B 4CL7A 1GC1C 3HCVA 2FH8A 4JGUA 4NM4L 4KK9C 4M1GH 4TRPH 1VCAA 5DURD 4NWUH 1BBDH 5D1QC 3UC0L 1OTTD 3BPLB 4HKJA 1UGNA 1CLZL 3QWOB 4UT7L 3ULUE 1KPVB 4R4FL 12E8H 2VQUA 3QUYC 1MLBB 4RFOH 5T5FL 1PW3A 3SDXB 1KBGH 2WBWB 5TE7H 3VXOA 5BRZB 4HUWB 4NZTL 3NIDF 3LEYH 5AAWA 4PRHA 2D3VA 1ND0A 3MROA 2LU4A 4L3CB 4GBXB 4ZUSA 4MAUH 1S9KC 1TQBC 3OWEA 5C0FB 5CAYB 4WI4A 1MAML 4KQ4H 4L8CB 3ZSSA 1K8DB 2JIXB 5ENWA 1BOGB 4GRLB 5FA4A 5ITFA 1IEAB 2Q86A 3RL1A 3GB7B 1EGJL 5IGXH 3L6FB 2HG5A 4ZSOB 4P59L 1JF5A 3MUGB 2YBRB 3QFJA 1JWMA 1YEIH 3QULA 4YH6A 2FB4L 1EBPA 2W0FB 4N0FB 2JF1A 2HJFA 1D5XA 1BP3B 1RZGA 4N9GB 7FABH 4ELKB 5EBWA 5DFVD 3TIDA 3W0WB 1MJUL 3LQZA 4NKIH 4JHWH 4XC3L 4GQ9H 3A0OA 5IJVA 4OAWB 3S4SA 4Z7VE 2QTEA 2QL1A 1FBIL 4R2GC 5EU6D 5IQ9A 3RX5A 1OPGH 2VZ1A 3DX6B 5FKPB 2XWJB 4D8PB 1T1ZA 4TTGA 1OAZL 4JPVL 3MCLH 4IS6A 1IC4H 5EC1B 3MO1B 3QDJB 5TDOA 4BH7A 4X0KB 5IFJA 4EOWL 1AP2B 1CFQA 5IVXA 1E4KC 1MCEA 3ZE1E 2VDML 4XNXL 4XBPA 5DFTA 2C3VB 4RISL 4M1CC 1CZ8H 3V6FB 2DD8H 1PG7L 1ADQL 3KLDA 3HFML 4FRWA 1BIHA 1T04B 3O2DA 5IW6A 1FHGA 3VWJA 2XA8L 5DGQA 4I0CC 1D5MA 1GGUA 2VC2L 1E4XH 2I07A 1HKLH 3MBEB 3UJIH 5D2LA 1KJ2H 1MCJA 4LK4A 4J8RA 5DVMA 5HYJA 4N8VG 4R4BA 5HHOB 3TJHD 4M1GL 2EIZB 3BOVA 4TRPL 1IKNC 2C3GA 4NWUL 1XF4A 1BBDL 3MRKA 3EYFB 4G6KH 4ODXA 4X9IA 1N0XH 1IMHC 2I9LB 1A9BA 2VDPH 3FB6A 4YEFA 12E8L 4UBDD 2HN7B 4L1DA 4WEBH 4RFOL 4J3XA 4BZ2H 2Y1VA 3L3HB 4NQXB 5TE7L 1JTPA 3RZCD 2DQHH 2WIIA 3QIBA 2ICES 3LEYL 2ILLA 4WWKD 5DZNA 5FHBL 3HZKB 3NZ8B 4MAUL 5GS1B 1LEIB 1U8OB 2DI8A 4KQ4L 5HI3D 3D3VA 4LSVH 3SDCB 2JJWA 4UQ3B 3QXDB 3MJ9H 4MNHA 5HHXH 4ZTPH 4FQQA 5IGXL 1XF3A 5A40E 3TIEB 4K7PX 5C86A 1P69B 3D39D 3D6GA 2P44B 4I3RH 5F7WC 3MLVH 5KTEH 4K23H 1YEIL 4LCWA 3D18B 1S9YA 5IEHA 1JRHH 5I6XC 4PGZA 2GUOA 2BNQB 1CFNB 4NNXA 7FABL 2FJHA 1CVSC 1S7VA 3QJFA 4NKIL 1U3ZA 4JHWL 4GQ9L 2R2HA 4JZNA 4J3TA 1M4KA 4HKXB 1J05B 4EI6A 3WIHA 2H26A 1OPGL 1CD1A 3QFDA 4K55A 4WU7A 2P1YA 5DEZA 3MCLL 1IC4L 1MRFH 2EO1A 3O4LA 3RWIB 4TVSa 5EPMA 4JZJC 4NQEE 1CZ8L 3K7UA 2VE6A 1KT2B 2EC9T 4ZFOA 1B3JA 2DD8L 4G6MH 3F12B 3V8CA 4HSQA 1FL3B 2R0WH 3PV7A 4HIJA 1ZHKA 1YEDA 2CDGB 2WV3A 3DXAD 3BRFA 4LLQA 2P5WE 3NN8B 2PYFA 3TA3A 3V6ZB 1E4XL 1KTLA 1HKLL 4UUJA 3UJIL 2IQAB 3WEXA 1CE6A 1KJ2L 4EN3A 1KULA 1LO0H 2X4TB 3BEWA 4DKEH 3TGXA 3OL2A 4OLVH 4G6KL 3A6BH 3R0NA 1DBAH 4O4YH 4KKAC 1DQML 1N0XL 4P99A 1QBAA 1OF2A 2NTFB 4FQXD 4RMQA 3SDDD 5DT1H 3EYSL 4X80H 5B8CC 4P5TD 4WEBL 5AG8A 4X6BB 4X83A 4BZ2L 2CXKA 4IOIB 1EHAA 5TDPA 1HIMH 2DQHL 3T65A 2QSVA 3NFNA 4BZ1H 3IDGB 5ICXA 1CLOH 3HZMB 3BPCA 1U8JB 5D5MF 1CT8A 1UH4A 2IAMA 4F9LA 3GSOA 3QSKB 3VD9A 2XT1B 4JE4B 2YRLA 4LSVL 5SWQA 4PG2A 1UQSB 4Q7DA 3C6LC 1G0DA 2V5TA 3MJ9L 5C0EA 5HHXL 3HNVH 4ZTPL 3HS0A 4TVPE 3CLFL 1CYGA 4LLDA 4I3RL 3OKLB 4QO1A 4ZODA 4RGMC 5KTEL 4K23L 1MI5D 4U49A 1JRHL 2AJZB 4C58B 2DQUH 2X40A 3MUJA 2AJYH 2NY1D 2VR4A 2JELH 1U58A 1QSFD 3BQUB 3RU8H 4KK6C 3KG5A 1KCKA 2FECL 1EV2E 3ARDD 5F9AC 5FGCE 2M26A 5LQBH 5CD3A 3DRTA 4KZEH 3CX5J 2GEEA 1KPUA 4LQFH 3ILQD 3TYGH 4XMPL 5F3HA 4E5XA 4OCRH 4LMQE 1CFBA 3BXNB 4MLSA 4QCIA 3OKYA 2NXYB 3FT3B 2JJTA 1KCVH 2DOCA 4OZHA 4D0BB 1JPGB 4NC0B 4M7LH 2XWTA 1FO0H 3JWOC 1TTFA 1S7WB 2W60A 4Z7OF 4HIEB 1QO3A 3S97C 5K9OA 3ZMRA 5IM7A 1J8KA 1LO5A 2HWZH 3NH7H 4EI5C 4XWOD 3VXSE 3QISA 4G6ML 3REWB 3FONB 1JMXA 3REVA 2R0WL 1BD2D 5DJCA 4Z5RA 3JBG7 5CEZD 5L0QC 1KFAH 3MRMA 4PLOB 3EGSA 1NDGB 1X5HA 2NR6D 5JOPD 1VDGA 5F89A 3B5HA 1K8IA 1JZ7A 4FS0A 1LO0L 4DKEL 4UDTA 4K3EH 5SX5H 2DIBA 3T0WA 4P4KC 4OLVL 2VDOH 3A6BL 4O4YL 1DBAL 3ZLQC 2FHBA 1NMAH 3CFEB 5MEQA 2WZPD 3X14A 5HGHA 2B5IB 3AREC 1R5WA 3P0GB 1JBJA 3LSOB 5IR1A 4X80L 3CK0H 1VFAB 2COQA 3B3IA 3IS0X 4IOSD 5IMKB 4JM2A 2VTFA 4J6RL 4QRTA 3MJGX 1TZHA 2P48B 1HIML 5KSBF 5DQ9A 2QKIA 4TSAH 3UTQB 4BZ1L 3LEXB 1XGRA 1CLOL 2B4CC 2FGWH 3SHSA 4OBSA 3CFBB 1DFBH 1NFIB 3NCYS 3P4LA 4D0CB 5C6WH 4NRYB 3RVWD 4OZIF 1CN4A 4PJGA 3IF1A 4HAFA 3HNVL 4JCLA 2HT2C 4QHKJ 1DBBH 5DEFA 3QQ9D 2FL5B 2A73A 4KV5F 1KXVC 3UYPA 2B1HH 4AEEA 3ZYOA 1YMHA 2WUCH 1I3GH 3VH8A 2DQUL 4PP1C 3ARFB 1EEZB 2AJYL 1S78C 1GPOH 3RU8L 3E1F1 3MTRA 4QKXB 1ZMYA 4PJ7A 5LQBL 3VA2C 4KZEL 2I25N 5FECB 2VJXA 1CICA 1X7QA 1F6AB 4LQFL 2UWEA 3DURB 3TYGL 1IAOB 3VG9B 2YD7A 2DWDB 1WWCA 5IVXE 1NFDE 3GNML 4KDTC 4WFED 3VA6A 1KCVL 4JFOA 4NBXB 1DEEB 5D1ZB 1MFDH 3GSRB 4LIQH 3QWRD 4M7LL 1CFSB 5C0JB 2FSEA 2GTWA 2EIBA 4R8WL 3UMTA 1JWSA 5DD5H 4M61A 3HE7D 4RAUA 3LKOB 3V5DB 2YRPA 2HWZL 3NH7L 5KN5A 2OM5A 3IJSB 2DBLH 3TBYB 4HZLA 4HJJH 4HQQH 1I1YA 2YUVA 1CTOA 2ICEB 4I4WB 1KELH 1MOEA 5D2LE 1D9KA 2EICA 1IAKA 1I7UB 1II4E 1K2DA 3D1MC 1KFAL 2P24B 5HYJE 5EU7C 1JPSH 5DD1H 2DS4A 4Y4FD 3RDTC 3QNYA 2V9TA 5HSFA 4P3WA 4GW5A 1JNJA 2FATH 1ZANH 5DQDH 4PRIA 5C0DB 2EDDA 5EO1B 4DQOH 2UZXB 4K3EL 3STLA 1N6VA 5DMYA 5FYJH 2VDOL 4WHYG 1AHWA 4LPCA 1ZV5A 1NMAL 2EYRB 1QFPA 4ELMF 1PDKA 5L7XH 2VR5A 3CK0L 1OW0C 3VMNA 4U0QB 3AS1A 4ACPA 2OR8A 4TSAL 3V8OA 4ZNCD 1NMBH 2VKWA 5K93A 1OP9A 4PGBB 2E9IA 4HFWA 1H0DA 2LQRA 3BPLC 2XTJB 3OG6B 1DFBL 2FRGP 2ZP0T 5GGTH 32C2A 3BH8B 1ACYH 3TPUA 1U8NB 4CN6A 1ROWA 3MSPA 3WUWB 4LCWE 5H37G 1A7BA 1RSFA 4P23A 2HVKB 3IRPX 5FO8A 1DBBL 4LDOB 4QGTA 2P8LB 1PQZB 4FQJH 2B1HL 4GBXC 2IWGA 2WUCL 1I3GL 4HK3N 4OM0H 4JFYB 5KW9H 4P4RB 1GPOL 2H2SD 4WO4A 4AENB 2VLJD 4GRLC 2ADIB 4LARH 5C6TH 2W0KA 1XIWA 2A77H 3BIKA 3W39B 4G8IB 1AO7D 3GMLB 3Q6FB 3I84A 5DZLA 5CWSA 5GGSB 3PXJA 3L7FB 1NBYB 2VZUA 2NY4B 4TYUA 1K5NA 5F8QC 3L5WB 4LIQL 1SHMA 3EO1A 4ZS6D 1Z5LB 4XHJC 1NDMA 2FBOJ 4NNPH 4JFXA 5SWSD 5DD5L 1IZJA 4MNGA 2DLEA 1JNHB 4QHMA 2E8YA 2VABA 4M9OA 4BFGA 4LEOB 5ERWA 2YEZA 2DBLL 3AFLA 4APQC 2PW1B 4OD2B 1MWAB 3QUZB 4HJJL 3VGEA 5JZ7D 2BK8A 5HI5C 1KELL 2XPGB 1XGYH 4MB5A 2Z31C 2DKMA 2HRPH 4P2OB 4X6DF 4H20H 1JPSL 5DD1L 3BDXA 2GYSA 1EO8H 4F37K 1OB1B 4W6YB 3TBTB 5IF0B 3WD5H 1EAJA 3ARPA 2FATL 1ZANL 4Y0GA 5DQDL 1MHCB 3L3IB 2GTZA 3QCUH 4DQOL 4WI5A 4KJQD 3LN9A 2EKSA 5E8NB 3GSNB 4U6YB 2Y36H 2FIKA 4Y2OA 5L7XL 2HJKA 5F1NA 1G7MA 4F3FB 4MS8C 5KSAA 3MBEC 1DQJA 3U82B 1KYOJ 2IBGA 4NO0D 3K8KA 4MJID 4KRPB 1YY8A 2YA0A 4NQSA 2JB5H 2YC1A 1NMBL 2H9GA 4XPGH 5SX5K 3CUPA 4E41D 1B2WH 1UYWH 3VFGH 1ACYL 5CZXC 5I8EB 4U6XA 4J4PC 3ES6A 2Z92A 2X1PA 2UYLB 3KYNB 4NC2B 1EFXB 4I0PD 3ZL4H 1A1NA 3VXNA 3UJTH 3OHXB 4JLRB 2X9WA 3GMQB 1WITA 4NQEB 5GS1C 1TJIH 2EDXA 5E24E 4XXCA 4NFCA 5FEBA 1M7IB 5KW9L 4M8QB 5BVPH 3SDCC 4TTDC 4A6YB 2DLIA 4PJBF 1LVEA 1KEMH 1RZFH 4HKZB 4LARL 4L8DB 2P5WB 2A77L 2HLAB 3KLAB 3UZQA 1F42A 4U7SA 5B21A 4OZHE 3QI9B 1YECH 3MZTA 2CXGA 2JLLA 3VFWB 4DZBA 2D7OA 3EOBA 2VLKA 4HCRA 1KCRH 3G5ZB 3D2UB 1JK8A 4JFFD 3BP7A 1T7WA 2DBJA 4PJFF 5HDOA 3LB6C 4NNPL 5TPWH 5FM5M 5H2BA 1PYWA 4LRIC 2ITCB 2PW2A 4PRNA 1RK1B 4PG9B 5E99L 1I9IH 4MQ7B 5EA0H 5FF6B 3TH2T 1NLBH 4GT7A 3CX2A 3SGEI 3WIFA 1BIIB 1X4YA 1XGYL 2CK0L 1K4CA 3HE6A 4H20L 5EOTA 3C8KA 1EO8L 1D5BB 2EXWC 3WD5L 3EKCA 3ESVF 4LSPH 3UTTB 1G7HB 1GYAA 3QCUL 1SY6H 2BVPA 4Y5YA 4P3DA 3DXAA 2W9EH 2CRIA 2V9RA 3GK8H 1R3HA 2Y36L 3PWJA 4QHLA 5H37H 3BZDA 4LKCA 5GPRA 2H6PB 5DMKB 1IQDA 4NCC1 1NCCH 1VHPA 1T1YB 5GGRB 4XP5H 3P9MB 5KSVB 5EO0A 5FGCB 4GG6E 4HK0A 2JB5L 5DJAB 5DJ2A 3P77B 5IB3A 1JMZA 3EJZC 4PJGE 5IT2H 3IS1X 2DDQH 1GCFA 3GGWB 4WI7A 2EZ0D 2FO1A 1UYWL 1LP9A 4P5TA 3VFGL 4WEUD 2JJSA 5LAXB 3D69B 3QR2A 3O8XA 2CKBA 3HI6H 3QDMA 4JQXA 4NZRH 4HC1A 5MERA 3UJTL 1T6VN 3WUWG 2P8PB 4G6AD 4Z95H 1PG7X 3GM8A 1TJIL 3NCBB 4GKNA 2VDKL 3EOTH 5HD8D 3VXSB 1G7IB 1DN2A 1DCLA 4OBRA 5BVPL 1ZEAH 2C26A 4G8EA 5BO1H 3D85B 5DD3H 4PR5B 2GSGB 1KEML 3HCVB 1OLLA 4DKAA 4NQVA 3PWPA 3KPPA 1MHEA 4ENED 4LASH 1YECL 4HKJB 1FIEA 1FCCA 2AK1H 2GAZA 4OFPA 2K9UA 3L7EA 1AD9A 1AGDA 3BQUC 1KCRL 4DOHB 2HVJA 3ALXA 1B4JH 5DJZA 1TTGA 3RIFK 3VXOB 3R0MA 4OLYH 4LF3A 4PRPD 5AD0A 5HVWA 4PRHB 1ND0B 3MROB 3KPNA 4ZUSB 5TFSL 1I9IL 5EA0L 1NLBL 1X5KA 4U1NA 1MIEL 1TCMA 5E5MA 2NXYC 1UWXH 5GIRA 4ESKA 3VFNB 5ENWB 3AY4C 2X44D 1G9NC 5FA4B 5ITFB 2Q86B 3RL1B 1JNLL 3VGDA 1A3LH 5JOEA 3DETD 2HG5B 5DLMH 4LSPL 3QFJB 1JWMB 4XPAH 4WRLA 1U91A 1SY6L 2W9EL 3GK8L 2XYCA 1E27A 3QEGH 2HJFB 4YFDB 4DVBA 1J86A 1D5XB 1RZGB 4MXQC 1NCCL 1IM9D 5EBWB 1OSZA 3TIDB 2DJUA 2GCYA 3VGGA 3LQZB 4ZO7A 3WIIH 4XP5L 4M7ZB 3DX7A 4Q0XH 2CKNA 5IJVB 3W5NA 2BSRA 4K9EC 3S4SB 2NYYC 5CINH 5IQ9B 2CGRH 2IPTH 2FYYA 2PKDA 5IT2L 4LKXA 4XWGH 1T1ZB 2DDQL 4U3HA 4IS6B 3FAWA 5TDOB 5INDA 4BH7B 5IFJB 2IGFH 2B5IC 4PJEA 1CFQB 5IVXB 2ATPA 1AKJA 4XBPB 2LABA 1DN0A 3P0VL 2GY7B 1DL7H 3PGDA 3HI6L 2OL3A 3KWWA 4NZRL 3WFCH 4Z95L 3MRBA 3PF2A 3X12A 1CIUA 1A2YA 3FFDA 3MFGB 3KVQA 4X4XA 3EOTL 5CP3H 3OGOE 5IW6B 3VXQA 4XAWH 2ICWI 3VWJB 2G5RA 1WIPA 1D5MB 4TUJA 2I07B 3FQXA 1ZEAL 4I3GA 5BO1L 3MV7A 5D2LB 1ZXQA 4WI6A 4JRWA 4J8RB 5T3ZE 5HYJB 1NC2A 2C3HA 1EDQA 4R4BB 4JZOA 5I1AA 3SCMD 1SJXA 1EBAA 1XF4B 4MZ2A 2X89A 4LASL 2AK1L 4ODXB 4YHPA 5B3JF 3ARFC 1A9BB 2XFXA 1I1AD 2CRMA 4IIQA 1B4JL 4YDKH 1HHGA 2WIIB 4KAQH 4OLYL 3QIBB 5TDNA 2R29H 2R2BA 3VG9C 1XCTA 1MEXH 3L3OA 4KJWD 1QLRA 2NLJA 3R1GH 3RVUD 3MRFA 3D3VB 1G1CA 3FOLA 3SOBH 1K6QH 1KGCE 3ARUA 2QEJA 4PRAA 1EAPA 2QSQA 5TQ2H 1A8JH 4YZFE 1T7YA 4LHQB 4MNHB 4YLQT 5IWLA 1A3LL 4FQQB 1XF3B 2Z4QA 3NFPA 5LVEA 4KK9D 3ULUC 1ZVHA 4WDIA 4K94H 5DLML 5C9JA 4LCWB 1S9YB 5ID0A 3CVHH 2BNRE 5IEHB 3P30H 5HI4D 3QEGL 4M02A 2GUOB 3QUYD 2Y07H 1QLFA 1KB5A 1SEBA 4NNXB 2FJHB 3C5JA 4EUPA 1S7VB 3QJFB 1BQLH 4HGWB 3H9SD 3WIIL 1PSKH 5MI0B 5IW1A 4Q0XL 2R2HB 4JZNB 3DYMA 3ZKXB 3UROR 4F2MA 3IYLW 1DZBA 4EI6B 1FZOA 2H26B 5CINL 1CD1B 3QFDB 2CGRL 2IPTL 1TTUA 4WU7B 4XWGL 3BAEH 3CH1A 1N6UA 3UAJC 1INDH 3W11C 3O4LB 5ALBL 2IGFL 3E2HB 4U7MA 5BOPA 2AXJA 1X9QA 2C9AA 3B83A 3T0EA 2N7BA 5EPMB 2HT3D 5D7LD 1DL7L 5I75B 2Q7NA 4RDQF 2VE6B 4K94C 3WFCL 4ZFOB 2VH5H 5C2BH 5E8OB 4HIJB 4X6FA 2V17H 1ZHKB 1ZHLA 1YEDB 2CO7B 2L0DA 2XTJC 4XAWL 4LLQB 5J89A 3TA3B 2PYFB 4UV7H 4NJAH 1KTLB 5E2VL 2C1OA 4JY4A 4UUJB 2DMBA 3T09A 1ZGLM 3WEXB 1CE6B 4EN3B 3BHBA 4PJ5A 1IFHL 3QRFM 2A9MH 4R2GD 4K71B 3BEWB 4ZUTA 1GIGH 3FT4B 4OF7A 2VLKE 2AEWA 1MWAH 2XN9E 5B38A 1OF2B 5KS9F 3L3DA 4S1DD 1ZVYA 4FXLA 2F8OA 4MA7H 4V1DD 1AO7A 1MFCL 1MCHA 5TDPB 1XZ0A 4YHOH 4YDKL 1OGAD 3T65B 2R29L 3NFNB 4WFFE 5ICXB 3BPCB 1FVDA 5IB5A 1MEXL 1T20A 2D9QB 1CT8B 3SE3A 2IAMB 3I6LD 3R1GL 1JHLH 3GSOB 4UT6H 2NY4C 4OFVA 4YAQA 5SWQB 5L6YH 3SOBL 1K6QL 3PHSA 1T80A 1X5AA 1KN4H 3H7LA 5TQ2L 5FOBA 4MMXC 5DI8A 2XQYG 4LP5A 5C0EB 3HS0B 4KJYA 5MEND 3T1FA 3QA3A 4ZPTA 4LLDB 4K94L 1C08A 1CL7H 3RVVC 3ULVH 4L1HA 5IBTH 5GS2H 3CVHL 4GFTB 3P30L 3QUZC 2LTQB 1GGYA 2R4SH 3UDWA 1OTUC 4U6VH 1U58B 1UWXK 4XVJH 4DW2H 5FM8A 2Y07L 1I8KA 5ADPH 2D7MA 3BKJH 5CD3B 2M8XA 2HLFC 3DRTB 1BQLL 1KPUB 4NQDD 4NYLA 4WGWB 1PSKL 3MCG1 4M5ZH 3K80A 4L9LA 5F3HB 4H8WH 1FZMA 4E5XB 1CBVH 2I9TA 2X41A 1LP9E 1HE7A 5ACLA 4L29A 4QCIB 2O26U 1FRGH 3BAEL 3UTPD 3S4SG 5HBBA 3UCRA 3FTGA 3QDME 4OZHB 1INDL 2EIDA 3RNQA 1QG3A 2XWTB 3KXFE 3LQAC 3SBWC 4A6YH 4XPBH 4MJIA 2W60B 4UQ2A 1QO3B 3ALWA 5IM7B 4CMHB 5K9OB 1S7RA 1LO5B 2K1MA 4KRPC 4P2RD 4NCDA 3ULVC 2VH5L 1SJEA 5C2BL 3G6JA 3REVB 1H8OA 4CJ0A 1X6NA 5DJCB 4GW4B 4Z5RB 2V17L 5C0CA 3WFBH 4F37F 1QFWI 1OD7A 4UV7L 1HILA 3MRMB 4NJAL 1EHNA 1U3JA 3EGSB 1XH3A 4NBZB 3PWPE 3TBWA 5F89B 3TEUA 1K8IB 1X44A 3KAAA 2EO9A 3BD3A 4H0IA 3FQUA 2VLRD 4YDIH 1BFVH 3DIFA 2A9ML 5F97E 3ESUF 4LHUD 1GIGL 2AJ3A 4UDTB 2ARJA 1MWAL 4GLRI 5GSVA 3IDMA 5I19H 5MEQB 1UCBH 3X14B 4EXPX 5HGHB 4NQUA 2VUYA 2A2QT 2QJDA 3NACH 5IR1B 3T04D 2IADA 4MA7L 2VB5A 1IL1A 3B3IB 3VD7A 43C9A 4JM2B 1N59A 2AXGA 4QRTB 4YHOL 1TZHB 3SKNA 3CFCH 5DQ9B 4RAVA 1T22A 2QKIB 1XGRB 4S10A 2MJWA 5KG9A 2RB8A 3QI9C 4YE4H 3T8XA 2H8PA 4KVCH 4U2YA 4UT6L 1IT9H 3GBNH 4JFFA 4D9RE 1KN4L 4PJGB 3IF1B 2BRRH 1RUQH 1YY9C 3HUJA 1ZLVH 4ZUVA 5D71H 3SJVA 1ONQA 5DEFB 2A73B 2UZYB 4MVBD 2IALA 1CL7L 4O51A 5D8JH 3ULVL 5IBTL 4IRJA 5C07D 1YMHB 3OKEA 4KKAD 1FLRH 4ZOEA 2VUOA 3EOYG 3VH8B 2LV4A 3TLRA 4U6VL 2MNUA 1ES0A 4XVJL 4DW2L 3EYOA 5ITBH 5ADPL 1G6RH 4PJ7B 3BKJL 3WBDA 2YPKB 1CICB 1X7QB 2UWEB 1F00I 4M5ZL 3BKYH 3ZE0F 1G7PA 4H8WL 1CBVL 2VXTH 2F54D 3F65A 4KKLC 1P9MC 1JI2A 1FRGL 1EX0A 3LRGA 4JFOB 1J0IA 3NAAH 4M6NH 4MYWB 1HI6A 2FSEB 4A6YL 2D2OA 2GTWB 4NQTA 4XPBL 1UA6H 1JWSB 4NWTH 4M61B 4RAUB 5KN5B 1IGTA 2XACC 4HMDA 4HZLB 1I1YB 4X6CF 5L2KA 1WZKA 1NSNH 2IPUG 1D9KB 1IAKB 4KK6D 3WFBL 1T0MA 1K2DB 4P2CG 5JW4Q 4E0RA 2NY3B 4YDJA 2XV6B 1L6ZA 4GRWB 3RBGA 5JORB 4WW2A 3QNYB 2H1PH 5ETUA 4CRPA 4GW5B 4HIHA 4YDIL 2AP2A 1BFVL 3O3EA 4PRIB 4Y4HD 4F7CA 3L9RA 2EDHA 3VGHA 3STLB 1JZ8A 3Q48A 5DD6A 2DYPD 1AHWB 2Z93A 5I19L 1UCBL 3CSGA 4U0RB 5IESH 3SDXF 3HPJA 1AIFA 3NACL 5CKAA 3MLZH 2MKWA 4HV8A 4PLKD 2H3NA 5DURB 5EUKA 3S3PA 4F8QA 1NGXA 1BLNA 2VITA 3H9HA 1ZLUH 4HFWB 1H0DB 4YE4L 3UJJH 4KVCL 5T1LA 4KUZH 1IT9L 2WM0A 1MF2H 2H32A 32C2B 2PN5A 3TPUB 2DQIH 3K4DA 5LCVL 1BF2A 2C5DC 2BRRL 5HHQA 1RUQL 3KPMA 4P23B 5HVHB 5D71L 5FO8B 2FLRT 1AE6H 4DK6A 4CVWA 5D8JL 4HWEH 4P4KD 3WHE0 4ZO8A 1FLRL 5INCA 3ARED 3NA4A 5HVGB 4EBQH 4CU8A 3IXTA 4WO4B 5ITBL 5I73B 2YD2A 1G6RL 2EEAA 4DGIH 1KLUA 4TNVK 2DJ4A 1YJDH 1XIWB 2WW8A 1KCSH 3BIKB 1MH5A 3AUVA 3BKYL 4NUJA 1RIVH 2VXTL 1KNOA 1UADC 5CWSB 2CJUH 4M62L 4Z78A 2WAHA 4OKVA 3T0EE 5I8KH 3I50H 1ORQA 1UXSA 1K5NB 2NY7L 2YWYA 3X13A 4CADA 3NAAL 5CZVH 3RIFF 1IM9A 4M6NL 1VSCA 4PJDA 3EO1B 5FYKE 1NDMB 4DGYH 2CD0A 4V2BA 1UA6L 4JFXB 4AEIH 1AC0A 4NWTL 4M7ZC 4MNGB 1LNUA 4QHMB 4KXZI 5ERWB 2YEZB 4PP1D 1A5FH 1PKQA 1S78D 1Y0LA 1NSNL 4ETYA 1P1ZA 4PJ5E 3SDAA 4X4MA 1FAIH 1J18A 4OFYA 1G1YA 3NPZB 4OCYH 3AM8A 2H1PL 4MSWA 2B8OT 5KSUA 3K2MC 4CNIA 2GTZB 1EJ6A 2RGSA 1HWHB 5DRNA 3TZVA 2DQJH 3CC5A 2EKSB 2XNAA 3H3BC 4HEME 4QY8A 3B6SB 2FIKB 3VWJC 4N90D 2HJKB 1CXIA 3FAXA 1I8IB 5F1NB 1HH6A 1G7MB 3MLZL 3MXVH 5KSAB 1OD9A 1DQJB 3CFJB 4LCUA 2IANA 3SCMA 3ZKSD 5B3NA 1YY8B 3PIQA 1IC5L 2YC1B 5C70A 3UJJL 4RWYH 3CUPB 5I1LA 4KUZL 1HZHH 1MF2L 2X7LA 3V6OA 3GKWH 4MQSB 3FHAA 2DQIL 3O6LH 3VI3F 5J0BA 4U6XB 3RDTD 3ES6B 2Z92B 1Z0NA 1ZSDA 1IAIH 3MRJA 4XNZB 1A1NB 3VXNB 3QIBC 1TMCB 3FL7A 1PLGH 3WIHH 4HWEL 5HYQA 4MHHI 1JWUA 3KJ4B 1DANT 2F53D 4EBQL 5T3XE 3HG1D 3VH8G 4DGIL 3D9AH 1YJDL 3B43A 1ZLVK 1KCSL 4KMTH 1RIVL 5D7JA 4YNYA 3SQBA 2HFTA 2CJUL 5I66A 3F5WA 1A6WH 2DM3A 5DJ0A 5I8KL 3I50L 4DZBB 3EOBB 1KPRA 5BV7B 2VLKB 5CZVL 3JVGA 1JK8B 3BP7B 4KK8D 2R1XA 5J8OA 1VB9A 4DGYL 3QH3A 2IMNA 1UKTA 5IV2A 5BRZD 3RWGA 4AEIL 5H2BB 3G6JE 1PYWB 2DLGA 3MXWH 5MI0C 1VFMA 1R0AH 2PW2B 4PRNB 4WTWA 4PJXA 3ZKXC 5C0CE 4GBXD 1QSEA 4JAMA 4I1NB 5FYJD 2LFGA 2CO6B 2E9JA 2ZCKH 4X7EC 2YZ8A 2JIXD 3MV8A 4PJCE 4PYHA 4GRLD 3V0AC 1K4CB 2OK0H 2C7UA 1I3RA 1FAIL 3HE6B 5EOTB 3E2HC 2OXGA 1NJ9A 3C8KB 4OCYL 1RU9H 4XVUC 3S35H 5I75C 4FTVA 1PJ9A 5JMOC 5D9SB 2BY2A 2G75A 4LPYA 2OZ4L 5E6YA 2DQJL 2BVPB 4Y5YB 4P3DB 3DXAB 4HUXA 1NUNB 1CLCA 1R3HB 3HRPA 2P5EA 3PWJB 1YEFH 4QHLB 1QYGH 3IDYC 4LKCB 5I30H 1D3CA 3EJYC 3TA3C 4XHJD 1IQDB 1F3DJ 1CGTA 4OCMC 4HS8H 4CUCA 3RX7A 3MXVL 3W0WD 1YC8A 4YDVA 2N7AA 4EN3C 4RCAA 3MV01 3DLQR 4PBWD 4IOFC 4UOW1 5EO0B 5D4QA 4HHAA 1WWWX 4K71C 3PWNA 4HK0B 5DJ2B 5IB3B 1TZIA 4G6FB 5HI5D 4F7MA 3HUJE 2XQYK 1HZHL 1FNAA 3GKWL 1LP9B 4P5TB 3SJVE 4V1DA 1QSZA 1YN6A 1G0YR 4P5MA 3O8XB 5DF0A 2CKBB 3QDMB 2Y5EA 2VDLH 2DQTH 4OCSH 5MERB 1PEWA 1RJZA 4NNYA 1FV1A 2FEDC 4TQEH 1A64A 4YEEA 1PLGL 5DMJB 1ZLUK 1T6WA 3N0PB 2IAMC 2YMXL 2J2ZA 4GKNB 4F9LC 2X70A 4LVEA 2ZG1A 1SM3H 1UEYA 3HR6A 3TNMA 1CF8H 1R3JA 2APFA 2X9XA 3MBED 4G8EB 3F7VA 4PG2C 3MQIA 4JG0H 1MCNA 3D9AL 3S34H 1EMTH 3HA0A 4KMTL 5HHOD 5C7XH 4NQVB 3PWPB 3KPPB 4ZFOL 5JW4N 1MHEB 1W0YT 4NO3A 2RCSH 3I02A 4DN4H 1A6WL 4JPWL 2GAZB 2LTQC 4PTTA 5CZXD 5E7BA 1AD9B 3L7EB 4J4PD 1AGDB 1JGLH 4PD4J 3QDGA 4HS3A 2HVJB 5HDQH 2EYTA 3A67H 5DJZB 3V0WH 3VJ6A 1X4XA 1JTOA 3MXWL 4LF3B 5AD0B 1R0AL 5D72H 2YA2A 3SGDI 3PL6A 4U1NB 5ALCH 4XNYH 1PY9A 2E6JA 4L3EA 1NAMA 1MCQA 5E5MB 5GIRB 1FSKB 3SDCD 2JJTC 4NJ9H 4TTDD 2OK0L 4KK5C 4AQ1B 5F8RC 4JRYA 1QRKA 4D9QE 1JYWA 1NGWA 1RU9L 3S35L 4CMHC 4WENB 5EULV 1MCRA 1U91B 1AXSA 1RIUH 4HIIA 1MCDA 1J7VR 5DJXA 1E27B 4JKPH 1YEFL 4TNWK 2W65A 1QYGL 5IQ7H 2BNQD 4DVBB 5I30L 3NZHH 4RX4D 4PV9A 1UENA 4HS8L 3LB6D 4Z18A 1OSZB 5GHWH 2GCYB 2HT4C 5CP7A 3ARQA 3DX7B 1WCBA 3L3JA 2AXFA 2BSRB 3ZDZF 2XXMB 4N8PA 3W9DA 4WW1A 4EKXA 1LDSA 3A6CH 1HH9A 5DYOA 5FYLH 2FYYB 3IDJA 2D9CA 4HGKC 4LKXB 2AK4A 3MOQA 5LBSH 2ZPKH 5INDB 4KROB 3HR5A 3OAUH 4J3UA 4PJEB 2ATPB 1AKJB 1DN0B 2EXWD 3PGDB 4JM2C 2OL3B 2VDLL 3KWWB 2D0GA 2DQTL 4FQLH 4OCSL 2IPKA 5T5NF 2XKUA 3WFEL 3MRBB 4KDWA 4TQEL 3X12B 2I26N 1A2YB 3FFDB 3WNKA 4NO2A 4OZFA 4X4XB 3LQMA 3VXQB 4ZDHA 5KVEH 1BAFH 5FA3A 1SM3L 4YXKH 4TUJB 3KHQA 3FQXB 2AS5M 4F15B 4JG0L 3MV7B 1AXTH 2E6PA 5FFLA 4M7LT 1K3IA 3S34L 1NC2B 1EMTL 5DHVA 1SMOA 5C7XL 3K8LA 4JZOB 1ZK9A 4DFIA 5I1AB 3EJZD 4LVHB 3MLPA 3RWDA 4PJDE 2RCSL 3EDEA 4DN4L 3HLAA 2AAVA 4JB9L 4YHPB 3U46A 2BMKB 1LO4H 1T2XA 2DICA 1UB5A 2XFXB 2AKRA 5HHPA 4HFUH 3ULUF 1JGLL 3LIZH 4GRWH 2PYEA 4IIQB 3OR6A 5HDQL 3A67L 3V0WL 1HHGB 1CICC 5BS0E 5HYSA 1H8SA 5TDNB 2R2BB 2IPUK 4MNQA 1XCTB 3L3OB 1QLRB 2NLJB 4X4ME 2CRYA 3OQ3B 5ALCL 3UP1A 4XNYL 3MRFB 3IT8D 3QUMH 3SPVA 3UTSA 1YQ2A 5EUOF 1RZJH 3FOLB 1S7QA 4NJ9L 3T3MF 4PRAB 1EAPB 2GQHA 5KANG 3UTOA 1FNGA 3PV6A 1HXMA 3KYMA 2Z4QB 3BEVA 3NFPB 3MRQA 1NKRA 3IB4A 4WDIB 3QIWA 4K7FA 5ID1A 5C9JB 2RHEA 5ID0B 2VSDA 5I8OH 1EUUA 4JKPL 5IQ7L 3BQUD 4YHIA 4U05A 4S1QH 2IANE 4AIXA 3NZHL 1QLFB 4POZC 1KB5B 1SEBB 2NY3C 5EN2A 5GSRA 3NPSB 3C5JB 4EUPB 5GHWL 5IW1B 2ADJB 3P4OA 1F2XK 4TOYH 4F2MB 4XGZA 1E4XI 1B6UA 4Y8AA 3V6OE 1FZOB 3A6CL 3ARGA 5FYLL 2QQLH 3IAQA 2NXYD 2YUZA 5E2TH 1EEQA 3CH1B 1AHWC 1RZJC 2PCPA 5LBSL 4D94A 2ZPKL 4U0RC 3OAUL 3E8UH 3T0EB 1H3GA 3WNNA 4WUUD 3ZE1F 4FQLL 5IMOA 5KJRH 5J7CC 1WC7A 1UZ8A 4NKOA 5GRVL 3DSFH 3RI5K 5T3ZH 4X6FB 1W0VA 1ZHLB 1XFPA 1YYMH 5JQ6H 3B9VA 5KVEL 2W07A 1BAFL 2PTVA 4YXKL 4HUUA 5T33H 2DL2A 2C1OB 3VFRA 4JY4B 4M4RA 1AXTL 4CMMA 3RL2A 4WHDA 1LEGA 3BHBB 4PJ5B 4P23C 5HVHC 2J4WH 5D1XA 3IVKA 1P4BH 2NYYD 1KN2H 2V5SA 5T1DH 4ZUTB 3C5SA 4U2ZA 1P5VA 2CQVA 2LU3A 3T4AA 2BVEA 2DQGH 4GUPA 5B38B 2MQ3A 1LO4L 3L3DB 4WO4C 3S96A 1P7KB 3S6CA 4HFUL 4PJXE 5I73C 3LIZL 1TQCB 2B39A 1AO7B 1JPST 2Z91A 4LGPB 5E6IB 1XZ0B 3TVMA 1XIWC 4WI8A 4DJMA 3OKNA 2FECI 4CAGA 5IB5B 1FVDB 3BISA 3WNPA 1T20B 4G43A 5JXEA 5MP6H 3QUML 5GRJH 4YAQB 1RZJL 2L4OA 1UB6A 5EG6C 5FOBB 5DI8B 4FTVE 1TNMA 5KZCB 4PP2A 4KJYB 3T1FB 1DUZA 3QA3B 1R3IH 3I3BA 1R6VA 2KQMA 2H41A 2P5EE 1C08B 4HG4J 4M3KB 4Y7MA 1UH3A 1H5BA 3BN9C 5DK0A 1UM6L 2X4UA 2WWKT 5I8OL 3VRJA 4S1QL 3DECA 3QXUA 5F9JA 1I8KB 2BY1A 3SE9H 4NYLB 3ULVF 2X1XR 4YHLH 4L9LB 5JXAL 1FZMB 4TOYL 1REIA 2NCMA 1QKZH 2I9TB 1D6VH 1BPVA 3KYKH 4L29B 4YK4B 2QQLL 3EZ8A 4LSRH 5E2TL 3GBMH 3FTGB 1Q9WA 3J7HA 2YUWA 5D1ZD 1HCVA 3RNQB 2B7DT 3DMMA 3E8UL 2D4FA 4Y2DB 3SY0A 3NIGE 4KJPC 3ULUD 4MJIB 1Z0MA 4UQ2B 5IVZA 5KJRL 1S7RB 3VFPA 4HUVA 5F1SA 1YNTA 1CLYH 1SJEB 5FCUL 3DSFL 3G6JB 3M8OH 2ESVE 4L4VE 4H1LH 5JQ6L 5C0CB 1YYML 4XP9H 1HILB 4HCRH 3GI9L 5T33L 1XH3B 3MX0A 1T0PB 3TBWB 1NBQA 4L5FH 3WO3B 1HXYA 1N5YH 3FQUB 2J4WL 4XNZC 1P4BL 3DIFB 1FL5A 5A2KH 2AJ3B 1ULVA 3TCXA 5GRVK 1X6LA 2ARJB 3DUUA 5GSVB 3KJ4C 2YWZA 3QDGE 3UAJD 4XXCC 3IDMB 5FHAH 1IEHA 1OGTA 4BQ9A 1OP5H 1AGEA 2IADB 1IL1B 43C9B 3LD8B 1N59B 4HEPG 4XVSL 3MOBH 3SKNB 4L3EE 4RAVB 1T22B 4BA8A 5KG9B 3T8XB 2H8PB 2XTJD 3E6HA 5GRJL 1IQWL 4JFFB 5BV7C 3HC0A 3DO7A 3HUJB 4TULH 1CDCA 4ZUVB 3PWVA 3TT1H 1H3TA 1R3IL 5SX4I 1FNEA 3SJVB 2YN3A 3T2OA 1PZ5A 4NBYB 1C7TA 3BYYA 5FXCH 2P49B 2IALB 4HWBH 5H8DA 1AFVH 4JFZH 4F33A 1FFQA 4O51B 2OLDA 5A3ID 4IRJB 3HTLX 3OKEB 4PGCB 1BJ8A 4KKNA 3QCTH 5JIIA 2Q76A 1ES0B 3EYOB 3MV9A 3HE6C 5DR5H 3WXWL 1L6XA 3SE9L 3N50A 2CKBH 2YBRA 3JUZA 1WBZA 4YHLL 2AK4E 1G7PB 5JR1H 3WFHA 4EUPG 1D6VL 2V7NA 1N0LA 4GQPH 2NY4D 1M7XA 3KYKL 5CJXA 3LKNA 4Y5YC 1DVFA 4LSRL 1KIRA 3GBML 1MY5A 4C83A 1K4DA 1QPXA 1HI6B 3MGAA 4U1IB 1IEBA 4OCLC 1NH6A 3UPAA 3FO9A 3RVVD 5ACZA 1YPZA 1IGTB 3BGFB 1JTTA 4OF6A 4PB0H 3HN3A 4K3DH 2DM7A 1CLYL 3QUZD 3DPBA 4B53A 4U1KA 1UKQA 5L2KB 1OTUD 3QP3A 3M8OL 4X0KA 3OXRA 1T0MB 4E0RB 4P2OD 4XP9L 4YDJB 3B9KA 4HCRL 4L4TE 4P5TC 1WISA 2HLFD 1BFOA 1OLZA 2XTLA 4HKBA 2JJSC 4L5FL 4OZGA 4KUCF 4JDZA 5EIIA 3MLWH 1N5YL 3O8XC 5ETUB 3U4AA 2AW2A 4JQXC 4HIHB 2ZSVA 3O3EB 4F7CB 3L9RB 1OT1A 1OP3K 2PXYA 2V5RA 1P6FA 4R90H 1Q0YH 2PYEE 5DD6B 3U0WL 2Z93B 5FHAL 1FL6A 3CJJA 4K2UH 3HPJB 4FQ2H 2R9HD 1AIFB 3KNBA 4U3XA 3UPCA 2I5YH 3GBLA 4MNQE 5B38G 2H3NB 3MOBL 5EUKB 2CLVA 3UTSE 1CGVA 1MIMH 1BLNB 1NGXB 2VITB 2VXVH 3QUXA 5GS2D 3DROA 3TNNB 1I9EA 3LN5A 3H9HB 4NOBA 5C09A 5T1LB 1WBYA 4N1CA 4I13B 1CDYA 2FD6H 2H32B 2C4FT 1RJYA 4ONOA 1SMAA 5DWUH 5HHQB 3KPMB 3BKMH 4TULL 3TT1L 2NPLX 2W9LA 1XR8A 3CIQA 4HWBL 1U8OA 1EUTA 1AFVL 4JFZL 4QGYA 4NQED 5INCB 4IJ3B 3QCTL 3WNMA 3IXTB 1FSKC 5EOCH 5IROA 4Q74A 1B90A 1CS6A 5EIVA 1B4RA 1KLUB 4QF1A 5DR5L 1ZKAA 2P5WD 2DKSA 2CKBL 1NEUA 2OL3H 1MH5B 4YXHL 3P73A 4NUJB 1QACA 4XWOC 3SE4A 3WJLA 1A6VH 1KNOB 5BXFA 4AY0A 5JR1L 1LILA 1KJVA 2QHRL 2W59A 4OKVB 1ORQB 1UXSB 2CRZA 3DVNA 3X13B 5IVXF 4CADB 3MRIA 3OAZH 1RUKH 1JZ3A 1IM9B 35C8H 3D2UD 4PJDB 1QNZH 1YY9D 2WMPA 4Y19A 4X7CC 3PUCA 3WXVH 3NIDE 4Q6IA 5EZIH 1LNUB 1RI8A 4PB0L 4K3DL 2JE8A 3G6AB 5GISH 3MLSL 2HJLA 1G84A 1Y0LB 4ONHA 5IHLB 3ET9F 1P1ZB 3SDAB 5D2LF 2FX7H 2OXHA 4RGOH 2YD5A 5ESQA 4KROC 2FHFA 1A4KA 3C5ZA 1RK0B 3MLWL 4OF5A 1AGFA 4MSWB 1A9EA 5KSUB 3UTTD 4KKLD 4CNIB 3QEUA 4LSTH 3PHQA 4JKMA 4TNWF 1IGML 4TVPD 5DRNB 4ZYKA 3TZVB 1DDHA 3FZUC 1OTSD 3CC5B 2N4IA 1CTNA 2XNAB 3KDMA 4QY8B 4R90L 1Q0YL 1MCCA 3C6SA 4K2UL 1PEZA 3BUTA 4FQ2L 1HH6B 4F15C 2Q8AL 5E9DA 4KY1H 3QG7H 2IANB 4LCUB 3SCMB 4G3YL 3W5MA 3LMJH 2ZOLA 5I71C 3PIQB 1MIML 2J8UF 2VXVL 3DARA 1N3NA 5F6IB 2CLRA 4LVHC 5CEZL 4X6EA 4EQ3A 5I1LB 5JIHA 2X7LB 5I2IA 4QXUH 1CXFA 2FD6L 3MA7A 4CVUA 5FUCE 4Z76A 1KB5H 1P7QA 5DWUL 4M6AA 2BVYA 1MFAH 1ZSDB 1U3HA 4EUPH 4IIQC 3MRJB 2A6KA 4YHYB 1MI5E 5FDWA 3BGAA 4IBLT 5I15H 5TJWK 1W8NA 3CDYA 4M4PA 3TC9A 4NO5A 1OAYL 5HYQB 4Y89A 2QSTA 2J6EA 1JWUB 5F93C 3VXSD 3WO4B 1MCFA 3D85D 4K7PL 5EOCL 3TCLA 2BNUA 2NMSA 5D6DA 4IMLA 5IWLC 1JF6A 2OL3L 5JQHC 4KUCD 3D5OF 3B5GA 1KC5H 1A6VL 4GH7B 5D7JB 1N8ZA 5I66B 5LGJA 1C12A 5DHYA 5DJ0B 1I8LA 1OCWH 1KPRB 5DXWA 4G8GA 3EDKA 4L8BA 1RUKL 35C8L 2ZZUT 1QNZL 2R1XB 3QH3B 3VXTA 4M03A 3NPSC 3WXVL 5IV2B 5F70A 3RWGB 4PY8J 4O2EA 4RMSA 4PJXB 3HZYA 4AIZA 4LFHG 4JAMB 1QSEB 1X5LA 4UNTA 1J1PH 2VL5A 1MAKA 1KOAA 5GISL 1IC7H 4QLRA 4X99A 5L8LB 4J3OC 3ECBA 4K3JH 1MNUH 3MV8B 4HMEA 2FX7L 2C7UB 1I3RB 4RGOL 1C16A 4RWHA 4WUUA 4HIEA 3T0EC 1NJ9B 5IBUB 3S35X 4RQQA 4FTVB 4LSTL 3K74B 2G75B 4HUXB 1JGVH 2P5EB 4LPVA 3OTTA 1B0RA 3OGCA 2EE9A 4YDVB 1NCBH 4KY1L 1PX3A 3QG7L 1EZVX 3LMJL 4HHAB 1IGIH 2DB8A 3VWKD 3PWNB 1T89A 3DVGA 1TZIB 5J4MA 1NCWH 5C92A 4RRPA 2E27H 4Z7QF 1BEYL 2SEBA 4F7MB 4XBGA 2UZIL 4QXUL 3DV6A 2MOVA 4V1DB 1KB5L 1YN6B 3GKZA 4P2QA 1MFAL 4P5MB 4NC1E 1TQCC 4FFYH 4BM7A 5F44A 5I0ZA 4I0KA 1RJZB 3JWDC 4NNYB 1FV1B 5HPOA 4ZFGH 4W4OC 1OARH 1N7MH 3MV9E 3UO1H 3SE3C 2LAAA 2APVA 3VWJD 4CU6A 2X70B 2NY2D 4CVXA 4DKFL 3TNMB 4ZS6C 1R3JB 1QD0A 1TPXB 1T1WA 3RVXC 1ZA6A 3MJ8A 1Q1JH 4X6DA 1RZKH 5EZJA 5HYJD 3VXPA 3IFLH 1FNSH 3K0WA 1KC5L 4Y4KD 3T0XA 4KHXH 4C55A 4NO3B 5JZ7C 4OZHF 1QOKA 5GRUH 3I02B 2AXHA 4HIXL 1NGQH 3QHFH 2AEQH 1OCWL 2F5AL 3MUZ1 4PTTB 4BUGA 1N6QH 3UDWC 4NSKA 1WIOA 1YPZE 3ILPA 4YGAB 3QDGB 2PO6A 1I4FA 2BXYA 4HS3B 4MCYA 2EYTB 4S1SH 3VJ6B 2DAVA 4N0CD 3QIBD 2XZQH 1WK0A 4L9LC 5D5ME 5ADOH 1D5IH 1VPOH 3PL6B 4ALAH 1IC7L 5EZOL 4YK4C 5D1ZA 4JY5H 3D3VD 1NAMB 4L3EB 4OZGE 1MNUL 3S98A 1FGNH 3OAZK 1L7IH 4JRYB 3EO9H 1GVIA 3QAZB 3U30B 1NGWB 3BIAX 4ISVA 1XF5A 4LCWD 1OWRM 3F7YA 3DBXA 2YRZA 5BMFH 1AXSB 2O5YH 4HIIB 3KLHC 1JGVL 5DJXB 5DTFA 1O0VA 1QRNA 1FH5H 2W65B 5FYKU 4NKMA 1X5ZA 4IRSD 4JM2F 2V5YA 5IHUH 4PV9B 4R96A 2VWEE 1NCBL 5C09E 1Z6JT 5CP7B 3BD4A 4ODVH 1WCBB 4PJBA 3L3JB 2AXFB 4HH8A 4QRPA 5HGAA 3C08H 4F57H 1IGIL 2J88H 2VLLA 3W9DB 1HH9B 5DYOB 1NCWL 1DQLH 3IDJB 3D0VA 2E27L 2AK4B 5E7FA 4NHUA 4PJGF 1RZ8A 5ABDE 5C2UB 2XKSA 4JJ5A 1E6JH 3HR5B 4JN1H 2J5LB 4Z7OE 3U7WH 4K8RC 4DCQA 4XVUD 4XCNA 4FFYL 3LD8C 4JPIA 4PJFA 2IPKB 4XCCH 2BCKA 4ZFGL 4Z7VA 1OARL 1N7ML 4NO2B 4OZFB 3UO1L 4ZDHB 3EJYD 3TA3D 4PJ7F 5FA3B 1P4IH 2E7CA 2UWEF 4EN3D 1RZKL 4PRBA 4OD1H 1NFKA 3KHOA 3IFLL 4J23A 1FNSL 5FCSH 2I24N 5DHVB 2Q8BH 4W68A 4KHXL 3VFTA 3RWDB 4XCFH 4MJ6A 4IRJC 5GRUL 2G60H 5ISZA 3HLAB 1NL0H 4ZXBA 4Y19E 1NGQL 3QHFL 4Z8FL 3U46B 3OB8A 1N6QL 1UXWA 4B7IA 4JCMA 1UB5B 2AKRB 3O2VH 5HHPB 3VD4A 2EE2A 1EGJA 3QRGL 5FUZH 4HJGA 2PYEB 1D6EB 3OR6B 1NANH 4G7YH 4I77L 4S1SL 1V05A 2OSLA 3JV6A 5HYSB 2XZQL 2FEDD 1NBYA 3N1MC 5ADOL 1D5IL 2UVEA 4MNQB 5F7EL 3JV4A 2IAMD 1V7NL 3SPVB 4JY5L 3UTSB 3IAPA 4GRWF 2D0FA 2VRAA 4OZIE 1FGNL 3SO5A 1S7QB 4Z6AT 1AQKH 4H25A 1L7IL 1CDJA 3G9AB 1LE9A 3DX9A 3EO9L 4XP6H 3CMGA 1VGKA 1FNGB 3PDDA 1HXMB 3IU3A 3KYMB 3BEVB 3MRQB 4PV8A 5JIKA 5GZND 5FK9A 5E4EB 3QIWB 4K7FB 5ID1B 2FCBA 2ARJQ 3ZSTA 2HA1A 2DLTA 5BMFL 2O5YL 5IBUG 5F6HI 1KB9K 3U2SA 3U0TA 5E9DE 2VZSA 1FH5L 4YHIB 6FABH 3BE1H 1W72H 2H32H 3B9EA 3FFCE 5IHUL 4OUOA 1FLTX 4ZOCA 5EN2B 5GSRB 3U7YH 5IF0A 1SVCP 4WW2C 4UTAH 3RGVA 1M6OB 3FRPG 4ODVL 3P4OB 1FGVH 4F57L 1AH1A 3OJ2C 4XGZB 3C08L 2OTPA 5CGMA 1WAAF 2ITDA 2J88L 3GSNA 3IKCA 3ARGB 1F6LL 1DQLL 1WEJH 2CDFA 3D48R 3LH2L 4QNPE 5SV4A 4KK5D 2PCPB 1CFTA 4JN1L 4BQBA 1DBKH 4BKLA 3P4MA 3U7WL 3X3FL 4Z7UF 3GI8H 5IMOB 3WLBB 3ZT7A 4XCCL 2CPCA 4U1GB 4ENEC 4R7NA 1WC7B 3IDIA 1UZ8B 2BSTA 4LL9A 4NKOB 3MREB 3RKPA 3BMWA 2BP3A 4JY6A 4HS6A 5FV2A 3VU2A 5HDLA 1W0VB 1J12A 1P4IL 4GO6B 4HUUB 1P84K 2HT4D 3VFRB 2P8MA 4CMMB 3RL2B 1LEGB 1E4WH 1PVHA 4OD1L 1CD0A 5D1XB 3IVKB 2KL6A 1UM5H 2Q8BL 1I1RA 2NW3A 3INUL 1JCKA 4G8GE 3N06B 3C5SB 4JR9H 5M94B 5F9WB 4XCFL 1ZGLP 1Y6MR 3T4AB 2G60L 2IJ0C 1NL0L 4ELME 2WQ8A 4IJ3C 4GUPB 3AXLA 1A6AA 4EIZC 3S96B 3O2VL 3MR9A 2APXA 5FUZL 1WZ1H 4JM2D 2Z91B 4G7YL 3TVMB 2F5BH 4L9DA 1UEMA 3OKNB 2YD4A 1FZJA 4HMCA 4G43B 1RJLA 1EEYA 3VRLF 4XMLL 3LKRA 1FC2D 3N1FC 2W0PA 2ZOKA 3K4ZA 1UB6B 2PETA 2FH6A 1EH9A 4PP2B 1W0WA 1DUZB 2AQ3A 4WTZA 3ROOA 3IU4H 3BUYA 3VFUA 5CGYC 4M6OH 1H5BB 2ZCLH 2GJZA 5DK0B 2X4UB 3PABA 3VD5A 3L5XH 3AS2A 2YHGA 2QADB 6FABL 3VRJB 1W72L 1TXKA 4AEHL 5I1IL 1VFUA 3SDAC 1U8KA 5F9JB 3SN6N 2QR0A 3U7YL 3MNZA 1CICD 1RUMH 3B2UD 4GAGH 4U6TA 4UTAL 4UV4L 3AM8C 4Z7WA 4BZYA 1FGVL 2YD9A 4LEXH 3V7AE 3GJFH 3GMNA 1Q94A 3ZTNH 1R5VA 2X9YA 3TZVC 1WEJL 4P2QE 5HDBF 3SKMA 5KBNC 1Q9WB 3FRUA 5F96H 3WNLA 1DBKL 3DMMB 1GC1H 1ETZA 1KJ2A 3SY0B 4BYHA 3NCCB 5IVZB 3GI8L 4OCWH 3SCMC 3VFPB 4HUVB 3UBXA 1YNTB 3RA7H 4LCYA 1LO3H 5F6IC 5L8KB 1WUNT 1ZTXH 1D9KD 1DSFL 3V4PH 4X6DE 4POZD 2NY3D 4GKSA 1PGRB 1A6UH 3V6OC 2X05A 4OZFG 3O6FA 5GRWA 1LD9A 1E4WL 4AT6A 1D7FA 4YHYC 3EFFA 4GRMA 1T5XB 1UM5L 1FL5B 3CVIL 4U1JA 4YHNA 5EBMA 2CLZA 4JR9L 4X7FC 4BFIA 4OZ4A 3DUUB 5IP4A 3K81A 1OGTB 5HHME 3MGOA 3WO4C 1AGEB 3H8NA 5KVDH 3G5YA 3HAEG 3MBXH 4PRPE 3MJ9A 3W82A 1FG2B 3HNSL 1WZMA 3QBTB 1AI1H 1CDUA 2E9WA 5BVJA 5HI4C 5D7JC 5HYSG 3IJHA 5AYUH 3E6HB 3L3KA 4DZ8A 3BP5A 1A7RH 1X5XA 3JVGC 3HC0B 3DO7B 2BOBA 1G9EA 4FXKA 4P23D 4XP4H 4D2NA 3PWVB 1BVKA 3ARZA 1ZA3A 4C59B 1FNEB 1PZ5B 4I48A 2NX5E 3IU4L 4GKOA 1MQKH 4PJIA 4F33B 1QRNE 4U1LA 4M6OL 3H0TA 2R1YA 3VFNA 1H15A 3QT2A 3L5XL 1AY1H 3WNOA 2Q76B 3QXTA 1S9VA 4WO4D 1FE8H 4PJBE 3MV9B 4QRPE 3BKCH 3HMXA 3JV5A 1BOYA 2HT3C 3P9LA 3WFDH 1XIWD 1RUML 4GAGL 1WBZB 5C0AA 4HXBH 4LEXL 1IVLA 4F9PA 4OF3A 3WFHB 2V7NB 2YK1H 5T3ZD 3LKNB 1DVFB 4DGVH 3Q6GH 1KIRB 1LHZA 2AV1A 4X9HA 4C83B 5F96L 1K4DB 2EDLA 4PJFE 1GC1L 4ERSH 1IEBB 4PUBH 5EBLA 4OCWL 3C60B 3VWKA 3FO9B 3G5XA 1UWGH 2CH8A 5ACZB 1YPZB 3B2VH 4EVNA 3I85A 1RULH 3BN9D 3RA7L 1LO3L 2R0LL 2NXZD 4U1KB 1ZTXL 3OXRB 3V4PL 3TYFA 4LGRB 1NFDA 4S1DC 3B9KB 1A6UL 1GZQA 4P5KA 1K85A 1YEHH 1BFOB 4HKBB 4P48A 4OZGB 4JDZB 5EIIB 1KGCD 2ZSVB 5ISZE 3LS4H 4NGHH 1UC6A 4S11A 1AGCA 3IDNA 3FHQA 3MRDB 4UAOB 1KACB 2PXYB 4FZ8H 2EDNA 2EC9U 3KYOA 1JZ2A 2R8SH 4ZFFA 2E7LA 1FL6B 1T7XA 2BNRD 2K3TA 5KVDL 3MBXL 3KNBB 1TPXC 2D7TH 5KSAD 5C9KA 4KJPD 3MGTA 1F4HA 3O3DA 2A6IA 1ITBB 4Y5XA 1B0WA 4XMKH 1AI1L 4LMQI 4Y4KA 2CLVB 4EI5A 2Z8RA 3QUXB 3DROB 3LN5B 2XY2A 5C09B 3I3DA 1WBYB 4PS4H 5AYUL 5DC0A 2Y5TA 1A7RL 3DRQA 5GS3A 1KBGL 1RJYB 2Y23A 1F8TH 4XPFH 4N1HB 5E4IA 2B0SH 1MQKL 1XR8B 5H35A 1C5CH 2OI9B 3PL6C 3GMOA 3Q5YA 1AQDA 2Q6WA 1CGXA 1AY1L 5D93B 1FE8L 3PDOA 1X4ZA 4QF1B 3WFDL 3CGTA 3QAZC 4MJ4A 3U30C 2XRAH 1EHLH 3SQOH 3P73B 4HXBL 2X1WL 5BXFB 4DUWA 1H3XA 2YK1L 1KJVB 4DGVL 3Q6GL 5K9KA 4PJEF 3DVNB 4IRSA 3MRIB 1JE6A 2VLKD 2X4PA 4BSWA 4HGWA 3V4VH 4NZDA 4Y19B 2QQNH 4PUBL 4Q6IB 1BQSA 6CGTA 1UWGL 1MREH 3CFDA 1JPTH 1RULL 4G9FA 3GJFK 4BSJA 4QOKA 3HAEH 5I8CA 2HJLB 3C8HA 4ONHB 2O5XH 4O9HH 1WTGT 4WFFD 4OGAC 2YKLH 3OAYH 3F7QA 3HE6D 5ESQB 2HFEA 1YEHL 1A4KB 3C5ZB 1AGFB 1A9EB 3RRQA 2FZ3A 5A43C 3LS4L 5MEOA 3QEUB 5E8OA 2NNAA 3PHQB 3U4BH 3GUTA 1IJ9A 4ZYKB 1DDHB 4FZ8L 2B1AH 3KDMB 4URTB 1CI5A 3C6SB 3IRZA 3EAKA 1V5JA 5CEXA 4M1DH 2D7TL 3GIVA 5F6HJ 5E9DB 4S0TD 1AD0A 3FT4A 2VDNH 2ZOLB 4HWZA 3QXWA 4MVBC 4XMKL 5E95B 4X4YA 2IBZY 1NBZA 3EO0A 1N3NB 1I3VA 4G6FD 5EWIH 2CLRB 5EU4A 1IGFH 2VDPL 4PS4L 4X6EB 3HI1A 4HPOH 1RIHH 5I2IB 3MA7B 2DMCA 4Z76B 1P7QB 4M43H 1CGWA 1F8TL 1M7DA 3O8XD 4XPFL 1U3HB 3QDMD 2A6KB 5K59F 1Z9LA 5FDWB 2MTPA 3KXFD 4R4NC 5ICYA 2E6QA 1N26A 3Q1SH 1C5CL 4NO5B 1UWEH 5L2JA 3WDHA 4Z7WE 3JWOH 3EZJB 4QXTA 1OW0A 5EOQH 4X9FA 3TCLB 4GAYA 2BNUB 2D7NA 4IMLB 3MLVL 1Y18A 2XRAL 1EHLL 3SQOL 1KEGH 4N0UA 3PWPD 4NUGH 4BQCA 3VFOA 4R97B 4XNMA 1N8ZB 5B3JE 5LGJB 1C12B 5DHYB 4XBEH 4G8GB 4AYFA 4L8BB 1MCWW 4Y5VA 5SWZA 3L5HA 1FVCA 3E3QC 3V4VL 3VXTB 4P2RE 5GS0C 2QQNL 2VIRA 4PB9H 1JYNA 2EEBA 1DR9A 4Y4HC 3T2QA 1MREL 4O2EB 1AGBA 1FC1A 1JPTL 3HZYB 4AIZB 3VXME 4G42A 1PY4A 2VL5B 2A9NH 5F9DC 1MRFL 5SX4H 4X99B 3ECBB 2O5XL 4O9HL 3HC3H 3BWUC 3SKJH 1C16B 4PLKC 4WUUB 2Z8VC 1KIPA 5JLZA 2UV3A 4Y16A 4ODUA 4D9RD 2B4CH 4GXVH 2WP3T 1Z2KA 5HXMA 4QRRA 4RQQB 5C08E 3U4BL 1F4XH 4GW4A 4U1GC 4RMWA 4MJ5A 3V7MA 1IAII 1BM3H 2B1AL 3RUGA 2EH8H 2VQTA 4HXAH 4IEFB 3CLEH 4LOUD 1B0RB 3OGCB 3ROLA 3AMKA 2VDNL 5D1XC 2BJMH 4KH2A 1FN4B 4APQA 2GITA 1BREA 1J0KA 3DVGB 5EWIL 4GKZA 4G5ZH 1U6AH 3BW9A 5MHSE 3BVNA 1IGFL 5F9WC 3DO3A 2SEBB 2L7JA 4XBGB 5DT1L 2Z31A 1YN7A 4HPOL 1RIHL 1U0QA 4YPJA 5DO2D 4KROD 3DV6B 5CSGA 4PJIE 2D31A 1AKJD 4P2QB 1U8MA 2C1PA 1G7QA 1WT5A 2WQRA 4IRZH 3TVMC 3K8MA 4JKLA 3T0AA 3FZUD 3QZWA 3O3BA 2CUIA 1UWEL 4GG6A 5JXEC 3H6JA 4CVXB 5J12B 3GIZH 3N85H 5C0AE 3JWOL 1T1WB 1ZA6B 4AM0A 5EOQL 4CBPA 3MV7D 5GZOD 4JKKA 3MJ8B 4P46A 4X6DB 3CXHK 4G80A 1C5BH 2P7TA 5EZJB 1NC2D 3VXPB 1KEGL 2VKXA 2QV2A 3ZYJA 4NUGL 2X89D 1O5DT 2EC8A 2JELL 3LPWA 5HHVH 2MQ0A 4XBEL 4R26H 2QADC 4UMGA 4NSKB 5J11B 1R3KA 2X4QA 2YPKA 3ILPB 3EHBC 1T83A 2PO6B 3TM6A 1I4FB 1HOCA 4JFQA 4MCYB 4OCRL 5HHMB 4XXDA 4GG8A 3NCEB 3ZE2E 3FQWA 3G6JF 1SBBA 3QEQE 3V5KA 2BDNH 1EVTC 3CCHA 1FFNA 2A9NL 4YX2H 5KVFH 4AQOA 3ZHKA 1FO0L 3GMPA 3SKJL 3OKOA 8CGTA 3DMMC 4YDLB 2RBLA 4OSUH 2B4CL 4GXVL 4ISVB 1XF5B 3F7YB 3DBXB 1F4XL 1BM3L 4W81A 4JO3H 2AQ1A 2XG4A 3C09B 4LQ1A 5DTFB 1QRNB 2EH8L 4HXAL 3CLEL 5JORA 4NKMB 1AR1C 1CQKA 1I85A 4R96B 1WFUA 3OAYK 2B20A 5KVMC 1T4KA 3FB5A 3LY6A 4PJBB 5HGAB 4QRPB 1BBJA 2BJML 4WGVB 1PZUB 1GSMA 2VLLB 4ZNEA 3RZWA 4G5ZL 1U41A 1U6AL 3D0VB 4NHUB 1RZ8B 3MLXH 4JJ5B 1F3DH 3T0ED 4DCQB 3NVQA 4IRZL 4XCNB 1IM3A 4FN0A 4JPIB 4PJFB 5FYKD 5I9QB 2AJVH 2FGWL 4LSSH 1HYSC 2BCKB 3EFDH 2ZJSH 1BJ1J 4Z7VB 2CMRH 2DI7A 5F1KC 1XT5A 3N85L 4KK8C 3E6FA 3MJ7A 5F7KC 3D0LA 2AI0H 2YSSA 3KPQA 4PJ5D 1GAFH 5CGTA 4PRBB 4MAYA 3V2AR 4X8JA 4LDEB 3VFTB 4MJ6B 4NC1C 1B88A 4WWID 5ISZB 4ZXBB 1QLEH 5HHVL 1UXWB 1F6FB 1KJMA 4FFZH 4KVNH 2GW5A 4HJGB 3WFZA 4G9FE 1L9NA 3NOIA 5E6ID 2F9BT 4QOKE 3RY6A 5F7HA 2OSLB 3IJYA 3JV6B 3WSQH 4PJHF 1OQOA 1SY6A 2BDNL 3JV4B 15C8H 4LSQH 4YX2L 5KVFL 5CJXC 3H2WA 1MFDL 1DVFC 5C3TA 3RVXD 1KF9B 4GXUM 4PJ9A 4WW2F 8FABA 4H25B 4ORGA 1LE9B 3DX9B 5KZCD 1VGKB 1EXUB 3IU3B 4JO4H 4PV8B 4OSUL 5FK9B 2FX8H 3WHE1 3BDYH 1HHJA 4HQQL 3TWCH 1FJ1A 1K3ZA 4N90E 5FDYA 3GSWA 1BMGA 3U2SB 4JO3L 3FJTA 3U0TB 3M07A 1RPQA 4TSBH 4LLMA 1PFCA 4X8XA 3B9KC 3JTTA 4UIMA 1GXEA 4QT5A 1RVFH 3QXAA 1T1XA 3RGVB 2G2RA 3BP6A 5T3XD 3ZTJG 4FMKA 5JO5A 2X42A 3LS5H 4KI1A 2ITDB 4LPWA 4PGEA 3IKCB 3V6BR 2XOTA 1T3FA 3B6SA 5FYJL 1A7OH 4UAOC 2PXYC 2CDFB 4C56A 1DQQA 2BNRA 5AAMA 1I8IA 1U8IA 5CEYA 2XG5A 3MLXL 1CFTB 3RKDC 4J12A 4RRPG 4BKLB 3CFJA 2DQDH 4Y2DD 4HDIA 3LEVH 3P4MB 5BZWA 3B9AA 4XHQA 1RY7B 2CDEA 1CD8A 2F53E 2W92A 4P0DA 4LSSL 3QUXC 4R7NB 3EFDL 4LIQE 2BSTB 3IDIB 2ZJSL 5CJ8A 2VWEC 3KLHD 2CMRL 4BFBD 5GGTL 3QHZH 1XGQA 3QJHA 4JY6B 4HS6B 2VISA 5C0CD 3BD5A 3PGCA 1IBGH 4WI9A 4KTEH 1HQRA 4HPYH 4N0UE 3WN5A 1F3RB 5DDHB 2P8MB 5EORH 2AI0L 2Y9RT 3IETA 3S7GA 1GAFL 4FQJL 3N1QC 2ZCHH 2NW3B 2OP4H 3ZHDA 2ZNWA 3O45A 4OM0L 3KS0J 5SWZE 1CDHA 2OI9C 2GK2A 3P2TA 4PJDF 2A6DA 5CS7A 1UM4H 4M7JH 1ZT4A 3SDXE 3AXLB 5D93C 1A6AB 4TPRH 3ZKNC 5C6TL 4KKCD 4FFZL 4K8RD 2K7PA 1J87A 3MR9B 5IROC 3S36H 4JHAH 1IAMA 4LNVA 3CDFA 3ISWA 4V2CB 1V3LA 5IKCA 3LN4A 3WSQL 3VXRE 3CU1A 2NW2A 3VI4E 3SE4C 1FZJB 3WJLC 1RJLB 1EEYB 4LSQL 3LKRB 3S37H 3RJQB 4PGDA 2XN9A 2ZOKB 4Y1AA 4XNQA 4ZSOE 2CUMA 4QRRE 4A2LA 4LCIH 1W0WB 4WHYH 4JO4L 3SJVD 1PG7W 3BPNB 4Q6IC 2JCCA 1A1MA 3DSNA 5EFIA 3ROOB 2FX8L 3BUYB 3TT3H 3BDYL 3KLSA 3RUGE 3TWCL 2V2WA 3VFUB 4IRJD 4G9DA 2GJZB 2HRPL 3PABB 3RP1A 3W0WE 2F8VA 1KTKE 4TSBL 4R3SA 4CW1A 1U8KB 5AZ2H 1GL4B 2QR0B 4RIRA 3H3KA 3MNZB 1MRCH 3C5ZC 1RVFL 1JPFA 3RPIA 4Z7WB 5D9SA 1A14H 2YS4A 2Z9TA 3GMNB 3LS5L 2XZCH 3S9DB 1Q94B 3QDJE 3AS0A 2WBKA 1R5VB 2J6EH 1WQVT 5CP3A 3SKMB 4MXWH 3FRUB 4NZJA 1WFOA 2PTTA 2FJFA 1FPTH 4I5BB 4LFHD 3TO4A 2DQDL 1ETZB 1KJ2B 2BHYA 2DQEH 2ADFH 3CFIC 3LEVL 1IKFH 5BZDA 1CXLA 2DRUA 4JO2H 3UBXB 5JW4M 1HINH 4XPGL 5KAQG 1JGUH 4PJAA 3OKKA 3MA9H 4LCYB 5L2KD 1B2WL 1HHKA 5IOPA 5JDSA 1FZKA 3VXMB 4GKSB 1IBGL 4KTEL 2BY3A 1NCDH 4OCNC 5EUOA 4HPYL 3O6FB 5EORL 3ZL4L 3R4DA 1LD9B 1U3HC 3KXFA 4AT6B 3EFFB 4GRMB 4D9QD 2ZCHL 4U1JB 2OP4L 5EBMB 4YHNB 2CLZB 5JA9A 4BFIB 3CSPA 4OZ4B 4L4JA 3M1BA 1G9NH 1UM4L 4M7JL 1S8DA 3MGOB 4M93B 1JJUA 3G5YB 1RZFL 1RQ5A 4PLJC 1IRAY 3S36L 1T2JA 2E7MA 4PJXF 1QQDA 4IMKA 5D6DC 3MACH 4IHOA 5T1KA 2WLYA 3CVHA 5BVJB 9CGTA 4R97C 5T1LD 2FLBT 3HKFA 3IJHB 3RJDA 3S37L 5ECJE 3L3KB 2WWKO 1I8LC 3VI3E 1RZIA 3JV0A 4DZ8B 1NQBA 3BP5B 2Q3AA 3P0YH 5C0RH 4YWGH 5TPWL 2BOBB 4LCIL 4FXKB 4K9EH 4Z77A 5FGRA 1BVKB 1YDPA 1ZA3B 4G8FA 4JDVA 1DE4B 5A2IH 3G9VA 4I48B 4PJIB 3TT3L 4EJ1C 3KPSA 4J1UA 4ZOAA 4U1LB 1KXQE 3H0TB 3EOAA 2R1YB 4MXVE 1H15B 1A6ZA 4UB0H 4XRCA 2OJZH 1S9VB 4XI5C 3TESA 2OTWA 3EIFA 1CIDA 3P9LB 1MRCL 4ZNEE 4PY7B 3QHTC 5ESVA 3T77A 3ZYIA 5C0AB 3VG0H 1A14L 1MCBA 1CXKA 1F90H 2XZCL 4QTHA 4LCCA 2HH0H 2J6EL 2GJ6A 2VLME 4UU9A 4OLWH 3U4EA 2AV1B 4R7DA 1VACA 1E4JA 3C6LB 4YC2B 1FPTL 5KANI 2ADFL 1IKFL 2GJJA 5EBLB 3VWKB 3G5XB 2KKQA 5CGYD 4MB3A 4EVNB 4JO2L 1HINL 1JGUL 1LGVA 5KOVC 1T89C 1A7NH 2Q20A 3PP3H 1LMKA 3TYFB 5C0GA 1NFDB 3SDAD 3SE8H 4LLYA 1GZQB 4P5KB 4OFYD 1KIQA 4GJTB 2OCFD 3PQYA 2X4NA 3FT2A 4OF8A 1AGCB 5JHDA 3TZVD 5IB2A 3MLUH 3IDNB 4NN5B 1FAKT 3KYOB 4XX1E 2NY2B 4ZFFB 1G9NL 5IMMA 1F4AA 1L0YA 3STBA 5DD3L 5J12C 4OM1H 5IHBA 4XCYA 1J8HA 3ULUH 5DS8A 1YUHA 3MGTB 2IAND 2A6IB 2VXSH 3O3DB 2B2XH 4Y5XB 4Y4KB 4EI5B 3MACL 3BI9X 2BMKA 1S7TA 4NCC2 5D2NA 5E1AA 2Y5TB 3O81A 3DRQB 3BGMA 5D7IA 3P0YL 5J11C 5C0RL 4YWGL 2I60H 5I17A 2PO6C 2OR9H 3ARWA 4K9EL 5IB4A 4OJFH 2G9HA 3KR3H 5H35B 2F8XC 5CUSH 4WTZG 3GMOB 1AQDB 2Q6WB 4UB0L 4CGTA 5D1ZC 3V9FA 2OJZL 2H45A 1ACZA 5DMGC 4FOMA 2BRQA 3BWAA 3PDOB 3QIUA 4YDLC 4M48H 1MCSA 3DVFA 3X3GH 1HQ4A 4XPAL 4C56E 1NCUA 3VG0L 3WV0A 2IH3A 2N1KA 1F90L 1KG0A 2VYRE 1GJIA 5D7JD 4JFHE 2HH0L 1A22B 1G7JA 3AS3A 5K9KB 3C09C 4CDHA 4IRSB 1FCGA 1F5WA 2X4PB 1SJHA 4BSWB 4KWUA 1MLCA 1I7TA 2D7QA 2ADJA 1RV6X 1QFOA 4NHCH 4J3VA 5EB9A 4O5LH 3BRGC 1SYSA 4ZUUA 3CFDB 1QSED 3H3PH 4G9FB 1NUDA 3OKMA 1EVUA 3QEHA 4QOKB 1A7NL 5I8CB 4UI2A 3MV8D 3UBXG 2WBJA 3VXUA 4JRXA 1TVBA 2YA1A 2ENSA 2HFEB 4U1MA 4LLWA 2XZAH 2YPVH 3ORJA 2FZ3B 3QO1A 4FTVD 5MEOB 4KZDH 5I9QC 2NNAB 3GUTB 3MLUL 4CDGC 3P4NA 4QHUA 2P5ED 5J56B 3DUHA 1LK2A 3K1DA 2UY7A 4OM1L 3MMEA 5CEXB 4ZMAT 3ULUL 1L0XA 4Y8DC 3GIVB 1AD0B 2MCPH 1MY7A 4HWZB 3LPFA 4X4YB 1NBZB 3EO0B 5A3IC 5EU3A 2FEEI 3MPCA 4Y1AE 4WNQA 5EU4B 7CGTA 2VZ3A 4AZ8A 1F3JB 3EJJX 1FYHB 3HI1B 4JPVH 1P7KA 4ZXBC 4ONFH 3ALPA 4EOWH 2JCCE 5E6IA 1G6RA 1M7DB 2I60L 4KAQL 2OR9L 3V52H 3O9WA 4OJFL 5ICYB 2J3SA 4YBQC 5HYEA 5L2JB 3HFMH 3GSNH 1IAIM 3PJSA 5E56A 3MLTA 2NY0B 2OTUA 2AEPH 3LQAH 4QXTB 1V3MA 2ESVD 3Q2CA 3RWEA 4GAYB 3FN3A 3AB0B 3C9NA 4M48L 3X3GL 1Y18B 5F1IA 1EO7A 1WBXA 3TV3H 4N0UB 5GGVH 1NBVH 4GMSH 3VFOB 4XNMB 1SQ2N 4P2OC 4Y5VB 3E0GA 5SWZB 3CPLA 1HCFX 2FO4A 4UOJA 3QDGD 1FVCB 1MHHA 4X9GA 4PJAE 4NHCL 5IEKA 2VIRB 4O5LL 43CAA 3RGVC 4BJLA 5CLTA 1AGBB 5FHBH 3H3PL 2HFGH 4G42B 3PL6D 4HG4K 3B8YA 5EUOE 2CIKA 1OAUH 4L3ED 1XF2A 1FQ9C 3VXRB 3T3ME 5DEGA 1UKSA 3BZFA 2R9HC 4Y2DA 3NTCH 4JRYD 3D25A 3NCFB 1D5ZA 1KIPB 5JLZB 4N5EC 4F7TA 4Y16B 2XZAL 2YPVL 4ODUB 1A7QH 4XAKE 4QRRB 4KZDL 5CJ5A 4MJ5B 1HK6A 3RWCA 3RUGB 3PP3K 4P3CH 3WE6A 2Y6SD 1I9JH 1A6TA 4PJCA 3ROLB 3TF7C 2WK2A 4XZUA 1P53A 3V4UH 2MCPL 5F7FA 2XTJE 4MGXA 3ZO0A 4JVWA 2DN7A 2VXUH 1TITA 4APQB 4FQHA 2GITB 4GKZB 3BW9B 5ICZA 3BVNB 1MCIA 2AK4D 1KLGA 5HGGS 4NPYB 4OGAD 2Z31B 1YN7B 5AUMA 2DQCH 4ONFL 3RWFA 1JUFA 4LU5H 1G6VK 2D31B 3KPSE 1U8MB 2C1PB 1G7QB 3T0BA 3FQTA 4O00A 4MA8H 1CE1H 2YZ1A 3V52L 5JOFA 3NA9H 1UVQA 4QHNA 4TVPH 3U0PA 1JHLL 3QZWB 4HULB 3O3BB 3GSNL 1FG9C 1QUNA 5CJOH 4GG6B 3GSXA 5C8JA 4N68A 5L6YL 3P3YA 2AEPL 1YNLH 3LQAL 4R9HA 4ZO9A 4AM0B 4C4KT 3AROA 4P46B 3RTQA 4G80B 2P7TB 4L4TD 2F19H 2GJ6E 3TV3L 1P6AB 3BPNC 3Q5OA 5DRZA 5GGVL 1NBVL 4GMSL 1LE5A 4PGCA 2LU7A 1INEH 2R4SL 2HTLD 1DQMH 2ZKHH 2BSED 1IGCH 1YMMA 3EYSH 1R3KB 2X4QB 4I9WE 4TUOA 2UVFA 5FV1L 3S8WA 2PYED 1HOCB 1TJGH 4FG6C 4JFQB 5KOMC 5ELIA 4XXDB 4R4ND 4GG8B 1URLA 1I7RA 3FQWB 5GJTH 1BHGA 4MNQD 3V5KB 2HFGL 2OZ4A 1ZGLA 1OTSC 1VERA 1WICA 3CCHB 1FFNB 4LNRA 3ZHLA 2J8UA 1OAUL 3UTSD 1YEKH 4XVTH 4X7DC 4JEGB 4U1IA 4PRDA 3PQYE 1NGZA 3NTCL 3GMPB 3QPQC 3OKOB 4I3SH 5JHDE 4XCEA 3CLFH 1A7QL 3QIWD 3W9EA 5DVLA 5CJBA 1J8HE 2HKHH 1NCNA 1FYTA 3L3GA 4P3CL 3MRPA 1OL0A 1KJ3H 5E8PA 1I9JL 5EU5A 5GS0D 1T4KB 3ULVE 3FB8A 2VZOA 1T5WA 3O6FC 3V4UL 3FB5B 4XMPH 5ANMA 3M17A 1BBJB 5D2NE 2VXUL 3BX7C 2JTDA 2IEPA 2MFNA 5JUEH 2AJSH 3ARGD 1EA9C 5JW4R 5D7IE 3ZT5A 3G5VA 4WFGE 4MQXD 4U31A 3L5JA 2DQCL 4LU5L 3QG6A 4M93C 1HHIB 3WLWC 5FGSA 1T21A 4HLZG 3HMXH 3CFCL 3VCLA 4MA8L 1IM3B 1CE1L 1QR4A 3TNNA 3WDJA 3NA9L 1BVLA 4TVPL 1U95A 1NCTA 3GBNL 1MJ7H 5CJOL 4BK5A 2VXQH 3X11A 4POUB 3QCVH 1A02N 3RWHA 4ZD3H 1YNLL 1SVZA 2E7BA 4DTGH 1OAKH 3E6FB 3MJ7B 3D0LB 4HF5H 2YSSB 3KPQB 4K7PY 4UILH 4G7VH 5F7UA 5D1XD 4MAYB 1JZ4A 1OM3H 2F19L 3JXAA 4X8JB 1RZ7H