5FXCH

Crystal structure of glycopeptide 22 in complex with scfv-sm3
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
224
Chain Sequence
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSIVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords SCFV-SM3
publication title Design of Alpha-S-Glycopeptides Derived from Muc1 with a Flexible and Solvent Exposed Sugar Moiety
pubmed doi rcsb
source organism Mus musculus
total genus 54
structure length 224
sequence length 243
ec nomenclature
pdb deposition date 2016-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fxcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fxcH01
2HKHL 1LEIB 3EW3B 2DWEA 4M61A 3K1DA 2EKJA 3CVHB 3VWKB 4HPOH 4Z18A 3WN5A 5T1KB 1BD2B 1FJ1A 3WD5L 5HPMA 4LSUL 3L5WA 5GSVA 2IH3B 3ZKMC 1AKJA 3DARA 4FQJH 1C12A 4Y5VB 1XAUA 2FX9L 4HD9A 1KLUB 2ZUQC 4JN1L 4N0FB 3BP7B 2VXSH 1A3LL 5HHXL 3GO1L 4HEPG 2PR4L 1UC6A 4K7FB 3DI2B 5F3HB 2OSLA 3DUUB 4JY6A 5C0AB 2FGWL 3NA9H 1T1YA 3OKOA 2EZ0C 3KYKL 4R4BB 4WRLA 1QSZA 5DD1L 3KJ4B 3PL6D 4UAOB 4FFZL 2ZNXA 3OWEA 1OGTB 1BAFL 5HHNA 3MRDB 1X5ZA 5E7BA 1VESA 3W11C 1FZJB 3GSVB 1GZPA 1XIWB 5BS0D 3KPMB 4GRLD 3BUTA 1AI1L 5IHLB 1D6EA 4U1GB 3L7FA 3L7EB 4OM0H 4Y8AA 1FZOB 2NY0D 4RGMC 1KB5A 1IGJB 4X0KA 4D9LH 2ERJB 4ODSH 5J1SC 2PYEE 3HLAB 1CDBA 5GHWH 1M7DB 3BEVB 5FGCB 4P4KC 3GSNL 1JCKA 5DK2A 3WXVH 2Z91B 1JGEA 4GMSL 4NGHL 4Z7VF 5E4EB 2WWMC 3NGBC 4UTBH 3EDFA 3H42L 1JNNL 2M1KA 2X41A 1PSKH 3ZHDA 4R0LC 1YN7B 4WI5A 3VFSB 4WY7L 2XOTA 1A3QA 4JRWA 4U1IA 4JGMA 3MBXH 1F45A 1R3JA 1QLEL 4X6DF 5IKCA 3O6FD 1S78D 2XACC 3CXDH 3TZVC 4C55A 5HYQA 2IPTH 2D0GA 3Q6GH 3D6GA 1R3HA 4YDLC 1NMAH 3IAPA 5DRXA 2YKLL 5I15H 1IEHA 1CN4A 3DV6A 4LVNC 4O58L 3DMMB 4PRIE 3KHQA 4UQ2B 4B41A 1S9VB 9CGTA 1U8QB 4UB0H 1GRWA 4ZXBD 1CD9B 4PGDB 5I1EL 1Q0XL 1J1PH 1Q94A 4PJGF 3MR9B 3PGDA 3NN8B 4FTVA 5H37G 3MLTB 3D85A 2Z8WC 2Z92A 3SCMD 1I1AD 1JHTB 5F1OB 5J12B 2X4PB 1A9EB 2GJ6A 4J4PA 3BISA 4NM4L 2QQKL 5GRVL 1G6RA 2HA1A 3UPRA 1F11B 4R6UA 1RULL 4OZGF 2ITCA 2NY1D 4PLNC 1YA5A 1SYSB 1NEUA 1AY1H 5J89A 2O5ZL 3QZWB 4GT7A 4ZO6A 1GZQA 2Q8AL 1AXSB 3V0WL 2Q86A 5F7UA 4XP9H 4GKZB 3LD8B 2GCYB 2X09A 4RNRA 3EYQC 1MCLA 2FH6A 4DN3L 3S36X 1A14H 3HI1A 5I30H 3QDHA 1F4XL 4XC1L 5LKNA 3WFZA 1WBYA 4UT7L 1N59A 3P40A 2DLHA 2AP2A 2E9JA 5IQ7L 3D0LA 2F19H 1N64H 5F72S 3RDTA 2IFFH 1EHLL 4HS6A 4X8JA 3MACL 4QTIH 1MCJA 4ZUTB 3FN0H 5JPMA 4YUEL 2LFGA 4C83A 4XPGL 4OAWB 4R90H 1WBXB 3DVGB 4MAUL 2ESVA 4JQIL 4NWTH 5EG6C 1RMFL 5CZKA 4OCWH 3ZKMD 3GHBH 2X4QB 3PDDA 4PJCE 2MCG1 4FQHA 3FB7A 4P2RE 3VXUB 4G3YL 1JIBA 1A7QH 4S10A 2BY1A 2LAGB 1NUFA 2WBJD 4JO1H 3WO4B 3LN4A 2VC2H 3BGAA 1KTDB 2P5WE 2WINB 1JI2A 4XC3L 4GQ9L 4JHWL 2V2XA 1JMZA 2DTSA 3UBXG 4LKXB 3QPXH 2EZ0D 1EERB 1UB5B 2ADIB 4XP6L 4GUPA 4YHOH 4OD3H 4ZS6C 1FNFA 1N4XH 2BVPA 4KJPC 2DQIL 4Z7QF 2E7HA 1HSBA 2DOCA 5GGTL 4HKZA 5DT1H 3ZO0A 3KXFD 2R0WL 1RZJL 1DL7H 1A6VL 1M7IA 1BOGA 1UACH 5JO5A 3S37L 3IFNH 4ALAH 3A0OA 3VA2C 4IJ3B 2MKLC 1H3VA 4Z7UB 1XR8B 1P7QD 3OKKA 1K4CA 2AW2A 1H8SA 3V0VA 3LKPA 2Y5TB 1TZGL 3L9RA 3IFPB 3MCLL 2FCBA 2YSSA 5ANMB 4P4KD 4ELMA 1BIIA 1FZMA 5JA8B 1AGBA 2CD0A 2WWMD 4PJ9A 3MRKB 4I5BB 1ND0B 4XXCA 4WEBH 3SPVB 4DTGH 3O6MH 1EVTC 1FP5A 1N7ML 1BZ7B 4YHLL 4RMTA 1PVHA 2H32B 4XCNB 3TZVD 2ITDB 1LNUB 4N0RA 3CPLA 4OM1L 3T0EB 2F8VA 1IGTA 3WE6A 5HI4C 4N68A 3L3HA 3OXSB 3OL2A 2BVEA 1MUJB 5H2BB 5FA3A 2VOTA 2FBJL 4FQIL 4ODHL 2LAAA 4WW2C 1YEGL 3V9FA 3ZDYE 1YY8B 1UADC 3TJEH 3QXAA 4D8PA 4MQ7A 4MJ6A 4L5FL 3HNSH 2BHYA 2NX5A 1N0XH 1QZ1A 4OZ4A 4P99A 3QNZB 3VXPA 3O2WH 4LAQL 2G75B 4WWKB 5C9JA 3OKDB 4WUKH 5CBEA 1QKZH 1NGPH 1ZLWH 2DI7A 3PWNA 4HCRH 1T20B 3OXRA 3P0YL 4ZOCA 1G6VK 3H7BA 4E41B 5EZOH 3UMTA 2SEBB 2V6HA 3GSUB 2HFGH 4MYWB 4QRUB 4P23C 3VH8A 1FNGA 5GISL 1YNKL 5EA0L 2GT9A 1RZ7L 1WCBB 2DM4A 3EYQD 2FWOA 3MA7A 1YYLH 4PRNA 1REIA 3GBMH 3ZZ1A 1A6UH 2PYFB 3VGDA 5ICZA 2AI0L 3H9YA 4LHUD 3MV8E 1WWWX 3WBDA 2VKXA 3NACH 3TBSB 5J6GA 2DIBA 4NQDA 4P9MH 4RBPH 3GJFH 3S98A 2AV7A 2OS7A 2B4CL 1NMCC 3QUMA 3ARRA 1SJHA 3K4DA 4OLVL 3BDXA 1B90A 2VWEC 4PJEE 3WHE1 4LLDB 1ZXQA 2V2TB 3PWPE 5EU6A 2O61A 4PBVC 4QOKB 4GG6B 3DRQB 1CYGA 3O3EA 2FIRT 4DUWA 1ZAGA 3QXUA 3I9GL 1XGYH 2NMSA 4U6HB 1F8TH 3V95A 3W39A 5CP3H 3VW3L 5DURD 5CGMA 1MCQA 3IDGA 3EOBA 3U0TA 2GJZA 3C8DA 3AS0A 2ZJSH 3U7AA 3WUWA 4L3CB 1T5XB 4HDIB 5D5MB 2H26A 3RNKB 3T3PF 3HS0B 1SMAA 1Z5LA 5D93C 1WAAA 4IRSD 3LY6A 1KPRB 4HGWB 1RJYA 5AZ2L 2I9LA 1ZLUK 1DN0A 2DKUA 1ED3A 1SEBB 1TQBB 3BFOA 5IK3B 4MB5A 4GRWE 2YWZA 4U4BA 4FFWC 4WI9A 1J5OL 3FONB 2E7LC 2QSQA 4PJIA 4ZS6D 4NOFA 5HDBF 5ICYA 1YEEH 5L8LB 4EIZC 3U46B 3LEYH 3B5HA 1ZLSL 1EV2E 4F7PA 3C6LB 3QNYB 3TESA 3I6LE 1Q9LA 4S1RL 2IANB 2HLAA 2R69L 3KLAB 3T65A 4BSWB 1FBIH 3SDXA 5HYSA 2J8UB 1R5VB 4JFEE 3WNNA 3RWIB 2BNRD 3IETA 3SGDH 1UM6L 1HK6A 1R3KA 3FFDA 3QEGH 4LMQI 3PQYA 1QFWM 4ZNEA 4JFDE 1G7HB 4KKAC 5T5FL 5KSAB 4P46C 5ETUA 1AXTH 4UMGA 4F7CA 1JUFA 3F12A 3QUXC 1UWEH 5D71L 4FNLL 1VCAA 1A4KA 4BQCA 4PR5A 4L3EB 4X9GA 4CMMA 4V1DE 3KPQB 5I8OH 4FQPA 3QFJB 5JW4M 4YXLH 2YEZB 1L7TH 5DJ8A 4EDWL 4UT6H 1J8HD 5KVFL 4WIQA 1TCMA 3P2TA 3QZWG 5EFIA 4Y5YB 5IBTH 1PZ5B 2DLFL 2VSDA 4NWUH 4UDTA 4KAQH 3ARZA 1H0DB 5D9SB 4L8SA 3IDIB 3WFCL 3TM6A 1XGUA 1KOAA 4CKVX 5JMOC 2ZPKH 3QDJD 2I07A 1Z3GH 5FXCH 4FQCL 5JHLL 5ESVB 2EYRB 1OP3H 5HI4D 3VXSA 2PO6B 4LDOB 1XF5A 4A6YH 5D7IF 4P9HC 4RDQG 2P42B 3UTSE 5C0IA 1U8HB 3CU7A 4J3SA 4D9RD 3GKWL 5CSGA 1ZHNB 4RGOL 5KS9B 3T4YA 2Y7QA 4HFUL 3UO1L 3MRCA 3S88H 1MQKL 3CFEB 3PNWA 4AH2A 2A74B 1MCFA 1S9WA 2QADB 1QRND 3ZYJA 5AD0A 3JV4A 2R2BB 3I3DA 3MC0A 3P4MA 1CXIA 3UBXI 5B4MD 3ZT7A 4TVPL 4JN2B 1GPOH 3U9PH 3EHBC 2IJ0C 4LCCB 3SHSA 1WISA 4P5MB 1LGVA 1ZA6A 3BGMA 4J6RH 1R5IB 2UWEE 5JXAH 2NY4B 3RZCA 4P23D 3TN0C 5E08H 2YD6A 3DX6A 4HIIB 1DQML 3M07A 5D2NB 4EBQL 1IAKA 1UQSB 1QFWH 3KPPA 5KZCD 3AMLA 1KCLA 1WV7T 1UM5L 3WN5C 2WIIA 5E6IB 1OM3H 5B8CA 4TNWF 3VFOB 4MNQB 5AWNH 4NYLB 4LCWA 3CDYA 3W9EB 4O00A 3RU8H 5ALCH 4D3CH 2BFVH 3FOLA 1FO0B 2XG5A 5CUSL 7FABH 1PX3A 4X99A 4DGIH 1FVEA 4G8GB 3VFRA 5KVEH 4JO3L 1RQ5A 5CJXA 1KIQB 1JZ8A 1FORL 1WTLA 1Z0NA 3O3DA 4WU7B 4ZUSA 3STBA 2NW2A 3WDJA 4KJWC 4UIKL 3K8MA 5BV7C 5JMRA 3RY6A 3B9VA 3FRUB 3LOWA 3V5HB 3MLUL 1RJZB 3CD4A 4M7LH 3OGCB 4ZQKB 3NFSL 3KPLA 5HHMD 2F53D 1GGBH 4HZAA 2X1PA 2V9QA 4KHXH 1OQOA 3K7UA 4FFWD 3R8BB 1J87A 4OCLC 3VFGL 5K9KA 2XIDA 1TNNA 1KGCE 5DMGD 4I13B 1MJ8L 4PGEB 1RUKH 2R1YB 1P4LA 4TSAL 3SGEI 2O93L 3HE6A 1UT9A 3H3PL 5C9KA 1DSFL 1RK1A 3MNVB 3MLRL 3BDBA 4NQEA 3VFTB 1S7XB 1CQKA 3OAZH 4X7TB 1HHHA 1LO0H 1NBZA 5T3XD 1FSKC 5D2LB 2P7TA 2BSTA 4I48B 5CCKL 3KPSE 5IIEB 4XHJC 5CSZA 4BSVB 4MWFB 4P3DA 2K3TA 4P46D 3GMPB 4E5XA 5B39A 3DXAA 3UC0H 1RUMH 3RI5F 4WI4A 1PD6A 3QUXD 4AQOA 1T04B 5EO9A 4TUOB 1W0VA 4KFZC 4NRZA 4XNXL 3HAEH 5BZDB 4OFVA 4NKMB 4Z0BL 1NDGB 3GJEA 1EGJL 4YQXH 1I75A 2VDKL 1BBJB 3U1SH 3LH2L 1TNMA 3F7YA 4MLIA 3QB7C 1I3RB 4AMKL 3QEQB 5L88H 5IEKA 3L5IA 3OAUH 1EHXA 1K4DB 1C5CH 1OWWA 2CIKA 2HJFB 4PJXA 4WNQB 4BZ2L 4AIZB 1QSEA 3T2OA 1B4JH 4BZ1L 1IEAA 4OGXL 3M1BB 1HIML 5A2KH 2CLVB 4J8RA 5DUBB 4Y19B 5FK9A 2E9BA 4POZC 3WIIH 3LMJL 1GIGL 4F57H 1NH6A 1VPOL 4HMEA 4OFKA 5B3NA 3RTQB 1H5BB 1WIOA 3V5DB 3UAJC 2VZ1A 3CMOL 2HH0L 5HGHA 1T89A 5EWIH 2VITB 2I9TA 3BAEH 3TH3T 3TYFB 2WBKA 4YDVA 3HZKA 2BRRL 2CUHA 5KG9A 1FV1B 4CVWA 2VLRA 3JUYA 1KUMA 3EHBD 2J88L 2JJTC 1I4FA 5CBAB 4DZBB 4KRPB 3NZHH 3BT2L 3TN0D 3I85A 3UPCA 3B2UC 1NUGA 5D6CA 4JZJA 2VLKB 4GKSB 4WFHE 4CVUA 2RFXB 3L3DA 4XPAL 1I8LA 3HPJA 1JZ5A 2DKMA 5CEYB 4ODXB 4PJHB 4M7KH 1LHZA 3HZYA 1BEYH 1YNTA 1IGCL 5IF0A 4KK9C 5ERWA 1XZ0A 2IH1B 2HWZH 1TJIH 4HKXA 4N90E 3P9LA 5JLZB 3FCTA 4PP2B 4WEUD 2ZKHH 3LS4L 3ZDXE 1ZWIA 1CGSH 3RBGA 5JXEC 4U49A 4AEIH 3U79A 4PJ5A 5JW4N 3RGVB 3L1OL 4WJ5B 1J8KA 3MPCA 3SE3C 4L8BA 5DHYA 5J4MA 4PBXA 3PF2A 3U4BL 3ZE0E 2CDEB 3WS3A 3E8UL 4HZLB 5E6YA 1YC7A 1RK0A 3L3GB 3BD4A 5T3XL 1CDUA 1SM3H 5I73C 5JQHC 3GIZL 3VXRA 3MBEC 4KJWD 2NY5H 1Q9OB 4LP4A 4U7SA 4N0UA 3SE9H 1MVUB 1FLRL 2A1WL 4C58B 1L4IA 3C5JB 5HI5C 3MNWB 1V5JA 5DVOA 2P47B 2IALB 1OSPL 1CG9B 3ULUE 3HG1A 4I0PB 2ATPA 4NFDA 1K3IA 12E8L 1RSFA 4JFYB 4K3EL 3DBXB 4XCYA 1CD8A 5I71B 4YIQB 5E8DL 2XQBL 4XRCB 1G7QB 3OKEA 3MROB 4NKDA 4MA8L 5GRJH 1OTTD 1A9BA 4MB3A 3NIFE 2IPUG 4YNYA 4YK4B 5EN2A 3T0VA 4RFNB 5TF1L 5GGRB 1F4HA 1K8DA 3GSNB 2D4FA 2PCPA 4NM8H 1ZT4B 1CDCA 4Y4HB 1QVOA 3BO8B 4P2QA 4HUXB 2XRAL 1ACYL 2IAMA 5H94A 4PG2C 5DJ0A 25C8L 4X9HA 3QG6A 3H9SB 5ICXB 5F1SA 1T1XA 4QWWD 4UZGA 5C09B 4BSJA 4M6OH 4HIJA 2FJFB 4G42A 4F7TA 1YDPA 3SJVE 3O11B 1BMGA 3RWHA 4LASL 5C08D 3AGVA 4PJFA 2RB8A 4HH8A 3TPUA 2H9GA 4XP4H 3DVNB 4ELKB 2AQ2A 4K3HA 2ICEB 3HNVH 4P5KA 3D85D 1KBGH 1XGPB 5LAXB 1NMBL 3GIVB 4RIRB 3W9DA 5IFHH 3ZL4L 4JDVA 3MV01 2E27L 2F5AH 1TJHL 4JO4L 1LP9F 2C4FU 3MRNB 3DWTA 2G2RB 3K1KC 2UZIH 4IOSD 1YJDL 1I9JH 3QCTH 1VFBA 5EUOB 3D25B 4Z0XA 3NFPB 1MCPL 4POZD 3CK0H 4LF3B 4E42B 2VQ1A 4R97B 5CWSA 3KR3H 1LO4H 3MQIA 2DQTH 5IGXL 1Q9WA 1PG7L 1MELA 4LP5A 3CSYB 3ESVF 1ZHBA 1CFQA 3BPLB 4IMLA 2D4DA 3UAJD 1D6VH 1HKLH 1UWXH 2ADJA 4S1SH 2E6PA 3RL2B 4XBEL 1H3TA 1CE1L 3SY0A 5C0BE 1P7HL 1T3FA 1D5MA 1QBAA 1ZGLP 1UVQA 32C2B 1U8LA 5ABDE 5BV7L 5JOPD 2V17H 1SY6H 3I6KA 1YY9D 4XBGA 3S3SA 3B2UD 1AQKL 2A6IB 3JZ7A 3TNMB 3FQTB 1AGEB 1QBBA 1A1OB 4PRHB 1AQDA 4JKLA 1XR9B 2QBWA 3TCLA 4KK9D 2ESVD 1F3DH 4M9PA 5BS0B 3BRGC 5IB5B 3C09B 4X6EB 1RFDL 2Z8VC 4DKEL 4GRLB 5LCVH 4NQXA 3HC4L 4RAVB 1BOYA 4MNGB 2NY0B 4M4PA 1XF4A 2QQQA 3SBWA 2NQCA 4JZOB 8FABA 2NY6C 3LKOB 3MLVL 2H45A 3IJHB 4LARH 4LSTH 4ZUVA 3VGHA 4YO0A 4KTYA 4AENA 2JB5H 1C08B 2HLFC 3MBED 1G7LB 1H3WM 2APXA 3ZTJG 4FMKA 4M5YH 3MXWL 5L8KB 3HRZB 3RVTC 5D72L 3Q48A 2W65A 4IOIB 4GS7B 1JGVL 4JFFA 4JHAH 5HI5D 4ZFGH 4K8RL 4WHYG 4JM4L 4XAKD 2A83B 3UTTE 3B6SA 1JWSB 1P1ZB 3PWLB 1BVKB 4LSVH 3TJHC 4MCZA 3G6JE 4HKBA 3QH3A 3PWVA 3VGFA 5ADOH 2BXZA 2VDLH 4EUPA 2P43B 5HVHB 3TO2B 1WLHA 5GRUH 1T2QL 2VDQL 4RRPG 2X70A 2XWBB 4DKFH 3SCMB 5ENWB 5SWZA 1FIGH 1HXYA 2UY7A 4LMQE 5EIIA 1U93B 3PHQB 4RAUA 2WQ8A 2FR4B 3LKSB 3MMEB 1U3HC 4NZUH 1ZA3A 3P4NB 2ZUXA 1ODAA 1WFNA 4A6YA 1UA6H 5L0QC 4MAYA 2BOCB 4RA0C 3GSRA 5CEZL 4XPFH 4LSPH 5AYQA 1G1YA 4NQVA 5T3ZL 2JJVA 3BKML 5EBLA 3RWGA 4JE4B 3UJJH 4Z5RB 4OD1H 2NCMA 4XT1C 1R3IH 1I9RL 1YEJH 4HAGA 2V2WA 3LQAC 4JANA 1UG9A 3MGTA 2JCCE 4GAGL 4U2YA 2NW3A 4W4NA 1EUTA 3CU1A 4DVBA 5I1IH 4OGYL 3RVXC 2EICA 5C6PB 1HQ4B 4QRQA 3SN6N 2LE9A 3QDAA 1Q1JL 2OP4L 3S5LB 3BIKB 2VO5A 1IC7H 3FO2B 1GHFH 1U91A 3V6ZA 4WI8A 3VD5A 2MPAL 1NFKA 2GEEA 4DN4L 2AJZA 3OX8B 5MENA 4JKPH 5EOQH 5I19H 4ZSOE 2VUYA 1IGMH 1HZHL 2QHRH 3MFFB 3A6CH 1HHKB 4JPWH 4XBPB 3MZGB 3QWOB 2WW8A 2C7UB 1UXWB 1IL1A 1NFDE 5INDB 3S6CA 1T0NB 2ORBH 4ZO8A 1RVFL 4QNPF 1KJ3L 3NCCB 3THMH 3TYGL 4AJ0A 3ZT6A 1VFAA 4HX1A 4NQDD 1EPFA 1MRFL 1FYTA 2D3VA 4K94L 3PP4H 1GXEA 5ISZB 4ZTPL 3BD5A 4Y2DB 4QKXB 5EU6D 2OL3H 2X9XA 3DURA 3MRIB 1IFHH 1MCKA 5F96L 5I66A 4GSDL 1YYML 2C3WA 3QUZA 3I84A 2XPGB 4ZPVB 2Y06L 4WFGD 5HGBB 3D3VB 1NCTA 2N7AA 1DLHB 1ACZA 3K4AA 1HNFA 4HF5H 5C92A 1P7QB 3RY6C 5CINL 1GVIA 2QR0A 1QO3B 2X1OA 1KJ2L 3T1FB 3MOBL 4RGMB 3QUYC 5LJYH 3NFNB 1U95B 3BRDA 5IMKA 4XHQA 2NY6D 2NR6C 1DLFH 4AEFA 4Q7DA 3G04A 3MNZB 4X6CF 4X5LA 2HLFD 4PJDB 4FFVC 3NGBB 4LAJH 5SWSE 4PV9A 5EZIL 4JKMA 3RVTD 3K0WA 3ZT5A 5CD5C 4R0LB 3WFDH 3HE6C 1YPZB 5FHBL 2VIRB 3QXTA 4I0KA 4M1DH 4XNYH 5BZWA 4H0IA 4ONFL 5DVMA 4LLUB 3HZVB 1NFIA 1CU4L 1MHEB 3TZVB 4ENEC 5B22A 2BC4A 1VADB 4OSUH 3I3EA 4LSQL 5K9OA 3FJTA 3Q5YA 3HAEA 5DJXB 5DUPH 1JYNA 2I60H 4LVNB 3PQYD 1WBZB 2X4OB 4K9EL 3I2CL 3VH8G 5IMOA 5IVZA 2X6MA 1HHIA 1U36A 3X14B 3F7VA 4YFDB 3LN5A 4RCAA 3GRWA 1EX0A 1PX4A 4OV6F 3RVWC 2FECI 3RA7H 4JM2B 4UU9B 5CD3A 2PW1B 2XT1B 4X5XB 3NIDF 1BD2E 3MRQA 3O45A 2C9AA 2JE8A 3DYOA 1HCVA 4UV7L 3QIBA 5DJ6B 2G60L 3CSBA 1U3HD 1CLZL 1P7KB 5TE6H 1FLTX 1A21A 4PRIA 5EU4B 1I1YB 2EDDA 3BZEA 2DQFA 4KGLA 4LIQE 5C0AE 4MQTB 3CFDB 4NIKB 3E6FB 3QJHA 1NCDL 1D9KC 1GAFL 3OR7B 1CZ8L 4LOUC 1IC1A 3PGFH 4U1HB 4G80B 4L8DA 5DLMH 1BQHB 3TEUA 2V7HA 4NZRL 4LHUB 4KJYB 2AXJA 3RVXD 5TF0A 3O3BA 5DQJB 4NKQB 4P49A 4D0BB 1DP0A 1E4XI 1NGZB 5IM7A 1NAMA 1B88A 2NY7H 2EKSA 1NCUA 2CRIA 5F9JA 2HJKB 1NCCH 1MRCH 3GMLB 4F2MB 1MCWW 2AXFA 4N9GB 3KLSA 3MGAA 5DRZA 3BN9C 4LPUA 5I8CA 1LP9A 3PIQB 3BEWB 1S5HA 5HYSG 1G84A 5FGCE 4WHTB 3RZCD 3O41A 4TSCL 3M8OL 4XZUA 1DUYB 1KC5H 4KTDL 3T2NL 3REVB 4M6MH 1I8LC 3V2AR 3V52L 4OT1H 1J12A 2QSTA 3WFEL 3GHEL 1WT5C 1BZ9B 1RZKL 4X4MA 2XFXA 3EYSH 4YXKL 3U4EA 3OJ2C 2JB6A 4GRMA 3U82B 2YR3A 1S7RA 5EORH 1PW3A 4P5TC 1I9IH 4HWBL 2DMKA 5TQ0L 5J06A 4MD4B 1WIPA 5L2KB 3X13A 1BWWA 3OJVC 3NPSC 4LQFL 3JWOH 4HFWA 4PJCA 3U2SA 5FFLA 3CLFL 4OTXH 4P2RA 1KPVA 5DEZA 4Z95L 1DFBL 4O9HH 3S35H 3PHOA 3SDDC 3UTPE 2XKNB 4JLRA 2GIYA 3HR6A 1IC5H 3X12B 4YH6A 1UWGL 4JFQB 5ESQB 5I1HL 1MRDL 2Q8BL 4PB9H 3QUYD 5EB9A 4FQ1H 3QIUA 3VGGA 4FN0A 5KW9H 3U30C 4YXHH 3JV5A 3WIFA 4MHHI 1IVLA 4PD4K 5I8EB 1T7WA 4X4XA 3MREB 4PTTA 5E9DD 2A9NL 5L2JB 5MP6H 4O02L 1PY9A 2AJ3A 1U58B 2FYYA 3EJZC 4FFVD 3G08B 4EKXA 4EVNA 4POYA 3S37X 2XWJA 1J8HB 5CD5D 4OLZL 3HE6D 1FG2B 3OB0K 3FO1A 3OZ9L 4JDTH 1DBJL 2J6EL 5C0EB 4OLXH 1LEKA 2VDNL 3PABB 4OIAA 4I4WA 1VFUA 2IGFL 5F6IB 1RD6A 3FRPA 4MD0B 3W5MA 5HPOA 5CKAA 4Q58C 1FC2D 4FXGA 4KROB 1JTPA 5FM5M 3ULUH 4XVUC 1JP5A 1ZT7A 4CNIB 2I24N 3TBTB 3QDJB 1QSFB 1NGXB 3TVMA 1ES0A 3FO9A 2IAMC 2OZ4H 5CLWA 4W6WB 3DXAD 4BFIB 1AD0A 5CEXA 2IQ9H 3S5LG 2GK0A 2F8OA 1H3GA 4L29B 3RVWD 4DEPC 1YQVH 2AGJH 3O2DH 2MQCA 5FUOL 1INDL 2FB4H 2H41A 3P30L 5C71A 5KTEH 5F7DB 3MA9H 2W91A 1H15B 5TFSH 3VXUE 3SEPA 1A6ZB 4Y4KB 2BERA 1EFXA 2P8PB 4L4TE 3DTXB 2EH8L 3SKJH 1ZHLB 4OZHB 1QSED 3TA3A 5J1AB 2YPLB 4DGYH 2VL5A 4P23B 1AE6H 2V9RA 4PJAF 4OLWH 5GJSL 4HPYH 2V5TA 2VUOA 1QBLH 1N5AB 1M05A 1D9KD 5BW7C 1N2RB 5KZCB 4MLSA 3H9HB 1JTOA 2A6DA 3QHZL 3ZKXB 4LEXH 3GUTA 1X44A 3QUKA 2W9EL 2X4RA 1KB9J 3D0VA 3TT1H 5F21B 1NMCB 3FB6A 2W60B 4FMFA 1EMTH 4Z7UE 4G8IB 5BMFL 1IAIH 2AEPH 1J7VR 4HQQH 1F6FB 5LQBH 4X7CC 3IJYA 4HHAB 3RUGF 3BN9D 4MD5A 5ANME 3HCVA 2HG5A 4C56B 4EQ2A 4PJ8C 4OM0L 3MV8A 4O2CA 3WXWL 2EEBA 5GRXG 2CMRL 2GITA 4N0YH 3AB0B 4H5SA 1E6OL 5HHMB 2GSGB 3NAAH 3C6SB 1T7XA 4PJEA 3WXVL 3PWPA 2ZG3A 1MH5B 2ICCA 1Y18A 3Q3GB 4Y4FC 3VI3E 1J0IA 4O2FB 4CAGA 1T1WB 4UNTA 3T0EE 5JIPA 1TVHB 3SBWC 3SKNB 3NH7H 1CGVA 2X7LB 1WZKA 3P73A 5IHBA 3H9ZA 1XH3B 4CDGC 3AS3A 4U6YB 3CXDL 3B2VH 3U7YH 1ITBB 3SDDD 4E0RA 3VXRD 2DQHH 1FFRA 1V7NH 4LDEB 5I15L 4ONHB 1DUZB 1JNHA 2BMKB 4XCCH 1AFVL 3KPNB 5E8OA 5IT2L 3G9VA 1ZVHA 4P46B 3ARBA 5FYKH 1F4YH 5EOCL 1WZMA 4PGBB 5BQ7A 1QEWB 1XGQB 3JTTB 3QUXB 4XI5C 1FDLH 1BFOA 3CFJB 4U1JA 4HWBA 4E41E 1V7MH 3EJZD 3V6OE 3IRZA 4PG9B 1DVFA 3MV9D 5E00B 4JB9H 5EC1A 5C0DA 1FAIH 4JFEA 4KKCC 5GIRB 3WJLA 3L3OB 5IW6B 4JRYB 5HGDA 4ZMAT 5EPMA 3CFCL 4JKKA 4KZEL 1NCAL 5J7CC 1DQQB 3MRLA 1A6WH 4EI6B 1FNAA 3ES6B 1U8IA 1CXFA 1HXMA 2AEQH 3WFHA 1G7IB 4PREA 4XP9L 4XVUD 2DIJA 3WIHL 3AAZA 3N1GC 4LLWA 1KJVA 4GXVH 1BQHG 4GLRI 2IAMD 4LHUG 3CXHK 4ZS7H 4V1DA 4TTDD 5H37H 1A3RL 3CDGA 4TQEH 1A1NB 4X5WA 5E8EA 2FNBA 1G9ML 4QOKE 4GG6E 5H8DA 3BW9A 1BX2B 3W81A 2BNUA 4U1LA 5EU3B 5FYKU 3D69B 4HV8B 3BQUC 2IFFL 5MHSE 2DM2A 2WWKT 4KQ3L 4HJJH 1ZKAA 2EDHA 3FN0L 1T6VN 4DKDC 4LNRB 5DJZB 1LO2L 2DBLH 2D0FA 2ICWA 2A6JA 5D5ME 4K3GA 3W2DH 3S3JA 5HDQL 3GSWA 4R90L 1ZLWK 3UP1A 1BECA 1KN4L 5F88A 1T4KB 2J5LB 1FZKA 4P0DA 1T0MA 3IYLW 5H35A 3MYJB 3GMNB 2H3NA 5JR1L 4KKLC 4CJ1A 1E0OB 1PY4A 4U1MB 3EOTL 3RNQB 4MJ2A 4KMTL 4NZJA 3UTSA 1D7FA 1NEZB 1JNLL 1BVLA 4MCYB 2EDKA 1A7QL 1OLLA 3C8KB 4JO1L 4O2EB 1YMMD 2VC2L 4ODTH 5IVXF 5K9JH 3TP4A 5LGJB 2IANE 1R5WA 2X1QA 1KLGA 5DD6A 3ARGA 2YZ8A 1KIUA 1PJ9A 2J8UE 1NSNL 2PXYC 5D1QC 4G5ZL 4RBPK 3GJFK 4PJ7F 1EEUA 5AG9A 3I50L 3DX7A 4YPGA 5DD0L 1GGUA 1OB1A 5GS0L 5I1JL 5DS8B 2OL3A 5FOBA 4LFHD 2OLDA 1IZJA 3F58L 5IBLC 4ISVA 2FBOJ 4WHCA 1CDHA 5SV3A 1TLKA 1MCHA 4L3EE 5BV7B 1F90L 4PJ8D 3L6FA 5MEQB 4LLYB 3QFJE 4IDJL 4QF1B 3DPBA 1ZEAH 3C2SA 1LD9A 4KDWA 1VGKB 4QGYA 2LTQC 4RZCA 2VDPL 2Q3ZA 3L3JA 1OAQL 3QUZC 3CAFA 3IDNB 1FH5L 1F6AA 1AJ7H 5CJ8A 3QRGH 4NO0A 1D6EB 2FZ3A 3L7FB 3LPGA 3MUY1 5A2IH 1JPTH 2VLME 5DR5L 1U6AH 3QI9A 1HSAB 1PLGH 4NKOA 4HJ0C 2KDGA 3HUJB 3DETC 1BREA 1AHWB 3BHBB 2R0ZH 2XKUA 2X4TB 1X4XA 5JQ6H 2X4UA 1UXSB 3MZTA 3LKQB 1MCDA 3N1QC 1JGEB 1N6VA 2Y72A 3QFDB 4NO5A 4XWGH 4HIXL 4Z7NE 4DFHA 15C8H 5KS9E 3S9DB 3B9KA 3OTTA 4M3JA 1QR1A 1HNGA 1ADQH 4UBDC 4DOHB 2KQNA 4ZDHB 4XI5D 2YD9A 4FS0A 3B9AA 5JIKA 1FL6A 4NO3A 4QXUH 3TJEL 4ZFZA 2BVOB 1N0XL 4PLOB 3VD3A 3FQNA 2YD1A 4DFIA 1M71B 2AJXL 4AT6B 3O2WL 7CGTA 5C08B 3RIAK 1KCUL 4BZYA 3C2AH 5GS1A 1NANH 4KKCD 1SJXA 1J9CT 1NGPL 3MXVH 5D2NE 1LE5B 5DMJB 1D5IH 1VKXA 3QCVH 3D85B 5EZOL 4XCFH 5SWZD 4BFGA 1KCRL 3UXFA 2MHAB 2BVQA 5EBWB 2FHBA 2GTWB 3KWWA 4R2GC 1FCCA 3VFUB 1G6RB 4I18A 4MNQE 5HHQA 3QIBC 2ITCB 2Q76A 3Q0HA 4NC0B 4XP1H 1FNEB 1ORQA 3GBML 3O3AB 4LEOA 1JWMB 4G8GE 4PY7A 4OZIB 5C2BL 3BQUD 5FECB 5DSCA 5T1MB 2PTVA 1X5FA 4QXTA 4S1DC 3S4SA 2R4RH 3GSOA 2ARJB 1B0RB 3RI5K 3P3YA 1CFNB 3O4LB 1HINL 4OD2A 4J3UA 1XGYL 1JV5B 3F5WA 5ECJE 3C5SB 2YBRA 5M94B 5I16B 1BBDL 1T21A 4HT1H 4XVSL 3D0LB 2FDBP 4KKLD 2XZQH 2BOBA 1MF2H 4X8JB 1BM3H 3VMNA 1R0AH 4NJAH 4ZYKB 4C57C 5D6DA 4F7EA 4OGAC 1CFTB 3INUL 1MIML 3OKMA 4GW5B 1AIFA 3B8YA 1RURL 5MEND 1JF6A 4M62H 3LQZB 4P4RA 3DGCR 3K74B 3VCLA 3SKMB 1H9VA 2AK4A 4NNPH 2PXYD 4JQVA 4X7FC 5D1QD 5DHVA 3ZYOA 5F7LB 1HILA 1OP9A 2CRMA 2P24A 2PTTB 4DGVL 1J11A 1T6WA 3T2PA 4CN6A 5D2LE 3LN4B 3JWDH 1BPVA 2ZSVB 3R4DA 1ZVSA 3DX8A 4LNVA 3NZ8B 4CW1B 2V2XB 4YHKH 3OKNB 4LSRL 2J7LA 3F8UB 3N0PB 4UT9L 3RWFB 5I73B 3WLBA 5GS2H 1S7SA 5IBLD 4GUPB 3MBEB 4RWYL 1FYTD 3EYOB 1KNOB 5GGSA 5HD8C 3QEGL 3RBSA 5ID1B 1YEIL 5F1NB 4Y16B 2NY5C 4R3SA 5FM5O 3KAAA 4HC1A 1HSBB 3H2WA 2YD8A 5HBBA 1BJ1J 4HKZB 2CXGA 4CL7A 1NGYA 3LRGA 1GC1H 4M5ZH 4G43B 3I6GB 3PV6B 5I1CH 4U3CA 1BOGB 1OQXA 3QUZD 3QEQE 3IFOA 1H3XA 2VYRE 3BP6B 3DSFH 1NGWA 1HI6B 4ZUUB 5IB3B 1MJUH 4LPCA 3V8CA 1NBYA 3QQ9C 4YXLL 3S36L 1I1FA 5FV1L 1WC7A 5K93A 1PBYA 5C0RH 3RWCA 3LKPB 4HJ0D 1KJ2B 3QIUC 1VEMA 3L9RB 1B6UA 2Q3AA 1S7VA 4Z8FH 1CGWA 1DTUA 4M43H 2Q6WA 2YSSB 1XEDA 4I77H 4ELMB 4Y19E 5ESAB 4TVSa 2Q7YA 2C1PA 4UILL 3SDYL 3OAZK 1UM4H 1CS6A 4GH7B 4U3HA 3PDOA 2XNAA 1W72L 4WTZA 3RY5A 4MJ5B 4FP8H 3TCXA 4G6KH 4U1SB 1J0KA 5J11C 3H6JA 4UBDD 2OZ4A 5CP7A 3P4LA 1JFQL 5DA4A 4JG1L 2AABL 2B20A 3AREB 4K23H 1KJMB 2GSIB 5CIPA 1CLOL 4Z77A 2KH2B 1VSCA 2VLKE 4NQSB 1D5XB 3MLWL 1GPOL 3U9PL 1JHLL 2OCFD 4PJHE 1UKQA 4QCIA 4P2OA 3UTOA 5DGQA 3HC0A 3QXAB 3T0XA 5AYUH 1NEZG 4R2GD 2YPKB 4MDIA 4HULB 5IB2B 1TJGL 4MQSB 1J86A 4H20L 3QIBD 2OI9B 3UJIL 5HYEA 1CICC 1JHKH 2FD6L 3SJVA 4NDMB 3H7BB 3MV7B 4GW1B 4TNVK 3ULSA 1YEKH 3D5OF 3QNXB 3PG2A 3TIEB 2HVKB 2YA2A 5FHAH 1PFCA 3TA3C 2J3SA 3KJ6L 1CK0H 5TDOA 4UTAH 3U0PB 3VMPA 3R1GH 5J8OA 3IDXL 4I8DA 4S1DD 4WW1A 4HS3A 3WNPA 3HMXH 2VE6B 5F1IB 2C3VB 5I1GL 3VFMA 3C08H 1TMCB 1JZ7A 1SBSL 3QO0B 2R23A 4DGIL 4PRNB 5AAMA 5JOEA 5DVNA 1LILA 2P49B 3B43A 4M6NL 3U36A 3G5XA 2ZOLA 5JPNA 4OF5A 2AV7B 3L3IA 3P4OB 4ZFOL 3QUMB 2ZUUA 4AIOA 2CLZA 3IS0X 3BKJL 2EE6A 4XMPH 4OGAD 4YZFE 5D1ZB 4TULH 5EU6B 2O61B 2NXZC 2W92A 3ARDC 1P4IL 5SWQA 3NIGE 3O0RL 4GKNA 4GAYA 3RJQB 1TVBA 3BX7C 2J4WH 1GGBL 3W39B 5KN5A 4KHXL 2F74B 2X9YA 4OZFB 3EOBB 3LN9A 3VU2A 3GSXB 3OGOE 3VRJA 3BVNB 3TBYB 3V4VL 5C0BA 1B0WA 3WUWB 1JN6B 1DZBA 5IUSA 2NNAB 1IQWH 4QRPA 1EEYB 5TDNB 1I7UB 3EIFA 4GAJH 5JDJA 3OJDA 4AM0B 2NY6B 4P57A 4HKJA 5KVGH 5FB8A 3DROA 4NNXA 3KPRD 1FNLA 3H9SE 1MEXH 3U0WH 1EA9C 3T0DA 2W59A 3CH8A 4XPTL 4PGCA 4PJ7A 1YQ2A 5JOFA 2COQA 4X6BB 3KDMA 5FYJE 5HD8D 4IIQA 5EC2B 4M93C 5IFAH 2DS4A 1IRAY 1TITA 4PJBF 3QXDB 2X5PA 3EZJB 1RUML 4HJGB 4PRAB 3ARVA 4RFOH 3QRFM 3QWQB 5KSBF 2UYLB 3QIWB 3MOAL 4N1HB 4NQUA 3HNTH 3CVIL 2OQJA 1GGYA 2HRPH 4YQXL 3FOMB 3PQYB 1KIPA 3FQWA 1U8NA 2A73A 1MAML 2NLJB 4FRWA 5JORA 1S3KH 3QIUD 5ETUB 5L88L 1GGCH 4PYHA 2BJML 5TDPA 5EUOE 2MMXA 5GJTH 1D3CA 4NN7C 3EYUH 5FUCE 4G7VH 4XCEB 4NHUA 1F58L 1C5BH 3WHE0 3QXVA 1GYAA 4D9QD 3UTTA 1EO5A 4B53A 4R26H 4H88H 2XXCB 1U3HB 3G6JA 4KK8C 3PGCA 3UTZB 4Q9RH 4Z7WF 4HWNA 2FRGP 3G6AA 5F7KC 2EC9T 4Z7VB 5ACLA 3IF1A 2VLLA 5C0GA 2LABA 3O81A 4LL9A 4LCIH 2W38A 3AU1A 3G5VA 3IDYB 1KFAH 3O9WC 1KT2A 4EN3C 1FFNA 4X6DB 1J1XH 3ULVH 1LE9B 4M8QA 4XNUL 4PRHE 4TUJA 5BRZA 1A7RH 4RFEA 1MFEH 2JELL 1F3JB 5B3JE 5F7HA 3VXQB 3CDFA 5BS0E 3UJTH 3FAWA 4NPYA 4BH7B 1FL5A 3GMQA 4HK0A 5F9DC 4PJGB 4NN5C 2DJUA 2MKWA 1NLBH 2VMFA 2WIMA 2D7NA 4N8CL 4MNGE 1BEYL 2OTWA 4OUUB 3T4AA 4XPBL 2HWZL 3KYNB 1X7QA 4CBPA 3TA3D 3V7AE 5CZVL 3TWCL 2YPVL 4PUBL 4WFFE 3VGAB 4OFPA 2JCCA 3DX6B 4OZGB 4WVRA 2MQ0A 1ONQB 1QHPA 4OLUH 3T2QA 2P8LA 4FZ8L 3SO5A 3TFKC 1FFPA 1N8ZA 1UWXK 3EDJA 5D7LB 3HZMB 2WIIB 4GBXC 5E5MB 4KRNA 3EFDH 4NT6A 4Q9QL 3FAXA 1CFVL 1ORSA 5IVNA 2VDML 5I76A 2LVCA 3SOBL 4D0CA 2FL5A 4EOWH 3G6DL 1ZSDB 5IBUB 1KCVL 4ZSOA 4WW2F 5EOTA 4F7MA 2VR9A 3LAFA 2CUMA 2NXZD 4YDKL 1OGAD 3MCKA 1IM3A 1S7TB 2E9WA 1QPPA 3CFKB 4FQXA 1CFBA 2XV6B 1NFDA 5IR1A 2W1NA 1MREH 1IKNC 3ORJA 3UBXA 1U92B 2NW2B 5E94A 1FE8H 1G7MA 4LPYA 2W0FA 3VRLF 3MV8D 1TZHA 1J0ZA 3QULA 4F3FA 4Q6IB 1NL0L 3VG9C 3SGJA 3QUYB 1IGFL 5DEGB 5GRJL 5I1DA 1FPTH 1QA9B 3ROLA 5AUMB 1IGIL 1MHPL 1CI5A 4Q2ZB 3MRJA 4JO2H 4BFEA 1S7QA 3KYMB 4RQQB 5E9DB 4AIXA 3IGAB 3ALWA 3PWPD 3P11H 3FO0H 1N6QH 4N0CC 1DBAH 2VXUL 5E1AB 3RRQA 5LBSL 3ECBA 1NC4A 4NM8L 5CFHA 5DC9B 3QI9C 1PG7W 1OD7A 1T2JA 3AXLA 5GGUA 3EGSA 4WO4A 2QEJA 3DI3B 5GSRA 1T83C 4FABL 1EO8H 1WUNT 4MA7H 3RPIA 4TUKL 1QLFA 1ADQA 4ZD3L 2KUTA 2IG2L 4MXVF 5F8QC 3T8XB 1AD9B 5D70L 4RX4A 3ULVF 3D2UB 1NBZB 3TT3L 4L1DA 1L0QA 4LLAA 3TNNB 2XWTA 4L8CA 4OV5B 5HYJB 1K2DB 3VJ6B 5C0NC 5A2LH 4X9BA 3TBWB 2B1AL 1C7SA 5SWSA 3UROR 1PKQE 3RL1A 2BNQA 1EEQA 4NRZB 1EXUA 4NUGH 1O5DT 2FJGA 4L4VB 3I6LD 1G9NL 3MJ8A 5CJQH 4DK6A 1T1ZA 1E6JH 3GJEB 1AP2A 5FCUL 3P0GB 4JQXA 2JIXA 2UZIL 4NQCD 5HGAB 1DVFD 4OCYH 1I9JL 5GS1C 2ARWA 3OG4B 4OQTH 1YN6A 3B8SA 3SE4A 2OXGA 2AJVH 4KK8D 4HIEA 1U41A 5DFTA 4JRXD 4JEGB 1QSEB 1LO4L 3DUHA 2DQTL 2EDXA 3GK8H 4HMCA 3F6IA 3NTCL 1LEIA 5IG7B 1OAYL 5I2IB 1NBVH 1F6LL 1D9KB 2R2HB 2DQDH 3CVHA 4JGUA 4S1SL 3ET9F 3VWKA 5ISZE 4V1DD 4F58H 5T1KA 1BD2A 3EO1B 4XH2B 1EAJA 2WWKO 2IH3A 4CVXA 4W6XB 3ARTA 4HBCL 2XN9B 4XP5H 1KLUA 1SY6L 3F7QA 1MJJA 3T1WA 1BGXL 4N0FA 5KVMC 3U9UB 3LV3B 4LVHB 4MXWL 3D3VE 1CR9L 4FXLA 5JW3H 1OARL 1V3LA 3DUUA 3HZKB 5C0AA 5FUZH 4P59H 2HN7B 3LKRA 4OZFG 4XMKH 3GGWB 4R4BA 5D7JC 3L5XL 4FQQB 3SE8H 4LRIC 4DW2L 1MCWM 5HHVH 5FCSH 5AAWA 5D6CB 1OGTA 1Q0YH 4Y7MA 4PJDE 3MRDA 4DQOH 1NCBH 4OI7A 5ITBL 1KB5H 2GK2A 3BZDA 5F89B 1FZJA 3GSVA 2WLYA 3ZDZF 1S7UA 3MLXH 1XZ0B 1YPZE 1R3LB 4GBXD 3RVVD 4YGAB 5C70A 4GW4B 2D9CA 2JB5L 1AGDA 3MLZH 4MNHB 1Y0LB 1ZWIB 2NY2B 1FZOA 4OLYL 4WU5B 3AMKA 4JQVC 2GHWB 1IGJA 4P5TB 4NHCH 3MJ7B 1BLNA 3HLAA 4CRPA 2ARJQ 1M7DA 3BEVA 5DHYB 1T22B 5LGHL 3LZFL 3NPSB 1U8PB 1IKFH 5FYLL 2Z91A 3VFWB 2R29H 3JWOC 3SDDB 1S9XB 4OJFL 5ADOL 1YN7A 1Y6KR 3VFSA 4OB5L 4TOYL 4LLQB 1PYWB 3IFLH 3JV6B 3U30B 5D7SH 2E7MA 4G9FB 1O7SA 2YMXH 2VJXA 2ATPB 1A64A 3ZTJH 3DMMA 1JPFB 1D5BB 3B9DA 4UQ2A 4NO0D 1U8QA 3MV9B 3QI9D 4PGDA 1HHJB 4CGTA 1PEZA 1MOEA 4NKDB 4WHYH 3MR9A 3NN8A 4QT5B 1C16B 3MLTA 3MLSH 3UZEA 1RIUH 4NP4H 1C1EH 1JHTA 4XVTH 2X4PA 1A9EA 4G7YH 1K8DB 1EJOH 3GMRB 3K8LA 3BXNB 3QXWA 1TQCC 5HHPB 1F11A 1UB6B 1QVOB 1FQ9C 3ULUC 2BZDA 3HB3C 2HFEB 1SYSA 2IAMB 4XMLH 5C0ND 1R3IL 1DBMH 1YEJL 1MAKA 2DJ4A 1KGCD 1OPGH 2R2CA 4MZ3A 3QZWA 1F3RB 5TJWK 4AG4H 1AXSA 2YA0A 4M7JH 5E2TH 5DZOA 3NCBB 4HIJB 3O8XA 1UJ3B 2GCYA 2EYSB 2XTJB 1H8OA 3QSKB 1IC7L 2LQRA 1Q8MA 1LK2B 2D31A 5DJCA 2HVJB 1A8JH 1NC2D 4UIMB 4UOW0 1NGQH 1WFOA 4KVCL 4WCYH 1YNLH 2VXTH 1RIHH 4MA3B 4J3TA 2X05A 4FQ2H 4L4JA 1OD9A 3A6CL 3V4PL 4JPWL 5IMMB 3FKUS 4ZUTA 3MJGX 3GNMH 2BY0A 1KCSH 5LXGH 4OAWA 1S7WB 1KPUB 1WBXA 3AY4A 3DVGA 1YMMB 1EIBA 3P9MB 1CD1B 4FOMA 2CJUL 3IDMA 2EC9U 5L2KE 2ADGB 4UDUB 4DAGH 4H8WH 2X4QA 4KRLB 4K07A 1IJ9A 2GKIA 4KK5C 4R8WH 1X5YA 4WGWB 3TH2T 2DM3A 4LCYB 2HKHH 4OKVB 3VXUA 4TTGA 3HFML 2DJSA 4L4TA 3GJFB 2AERT 3MRBB 5D7IB 1KTDA 2HP4A 2WINA 5ADPL 3WD5H 2YC1A 1QFUH 4LSUH 4LKXA 1OY3B 1KEGL 1UB5A 3PWUB 3JXAA 1U8LB 5D7JD 1RJLB 5K33A 2FX9H 3WJJA 4XBGB 3EFFB 4N8VB 1A3LH 4PJ8B 3T04D 3EAKA 5HHXH 5F7EL 2BXYA 2IMNA 3KS0H 4HWEH 4NO2B 5L9DH 3QQ3B 3RWJA 1J8HE 4JREB 2NYYC 1DLFL 3K4ZA 3KYKH 1XR8A 4JVPA 3BPCB 4FFZH 4Y4FB 3EZ8A 4A2LA 2AK4D 1BAFH 2Y5TA 2ZCKH 4YR6B 3IFPA 3X17A 5ANMA 4UV4L 4H1LG 1QSFE 4M1DL 3QBTB 1QSVA 5E1HB 4YO0B 4AENB 3RFZC 1AI1H 4K7PH 3VRIB 2WZPD 4D9RE 3MRKA 4ONOA 4KMQA 5DUPL 4I5BA 4IIQC 3VXTB 1ND0A 4JPKL 4WFED 1K5NB 3OBAA 3OMZA 1BF2A 3OG6B 3ALXA 1BZ7A 1JPST 4XCNA 2H32A 5AG8A 2QTEA 5DQ9A 1LNUA 4GMSH 4NGHH 3B6SB 3X3FL 3T0EA 3H42H 5CHNB 1JNNH 4MCZB 5J6HB 1QD0A 4QHMB 5CJBA 4CN4A 4ZODA 4OZHE 4WY7H 1SHMA 2ENSA 3OXSA 2YPLE 3N50A 1MUJA 5H2BA 1JRHI 3BP4B 2CK2A 1TFHA 1YY8A 5TE6L 1A22B 5BO1H 2YKLH 3QNZA 5E8PB 3OKLA 1JMXA 4HEME 1F5WA 2G75A 4WWKA 3STZB 3OKDA 4O51B 3ULUD 5I1EH 1T20A 1Q0XH 4M48H 5JTWA 1W72B 3HB3D 1FNHA 2VN7A 4S0TD 3ZKQD 1VEOA 2FECL 4HK3J 4E41A 5DHXB 1QRKA 3PP3H 4K2UL 3GSUA 3V6OA 3WO3B 3K2UL 5D8JH 2C3XA 3V6FB 2IF7A 3GSRB 4PV8A 4YHYC 1MLCB 4W81A 2YK1L 4NRXB 5MEPB 3KG5A 1OW0A 1WCBA 1BQSA 3BQUB 3GMMA 2DQJH 1RULH 5GGVL 4MJ4A 4C56E 2N56A 3B3IB 2PYFA 2FIKB 1OHQA 1Q38A 2O5ZH 2V2WB 3PL6C 2QQLH 1YEDB 4U1KB 5DD3L 2BVUA 1HH9A 2NW3B 3G5YB 1ZGLB 1OAUL 3V0WH 4WTXA 5TQ2L 1A4JB 1XF3A 1RZGB 1A1MB 5HHME 3U4AA 2GYSA 4LLDA 2R4SL 2V2TA 2V7NA 4QOKA 4NQTA 4GG6A 2B5IB 3DRQA 4WEMB 3HI6L 1F4XH 4OT1L 4RISL 4U33A 4UT7H 5J13C 3RAJL 5D7KD 4LVOC 5IQ7H 1J0JA 1GGIL 1QYGL 1EHLH 3BOVA 2DQGL 3ZE2F 3MACH 4L3CA 2IMMA 1T5XA 4HDIA 5D5MA 2C5DC 4KK5D 3RNKA 3HS0A 1VFMA 5E2VL 3X11B 4B5EA 2PXYB 2WUBL 5D1QB 1KPRA 1ZTXL 4HGWA 5T3XE 4L9LC 5DXWA 4OBRA 4MAUH 1SEBA 4JQIH 4P48A 5IK3A 1RMFH 2BCKA 4U6XB 5KVDH 3JWOL 3FONA 4X80L 1KLFA 3WFBL 4XNQB 4OTXL 3O6FC 1A7BA 1FYTB 3U46A 5C3LD 4G3YH 3ETBF 4KXZH 2P8MA 1LO5B 3QDGB 3C6LA 3QNYA 3LSOA 2J2ZA 2CDFB 1F4WL 4PB9L 2IANA 4CADB 3NPZB 2DQCL 4KK6D 4XC3H 1IE5A 3KLAA 4GQ9H 4JHWH 4BSWA 1MFDH 3VA6A 1QBML 3ILQC 2CQVA 4FQXC 1V3MA 1R5VA 2NYYD 4XP6H 4JRYE 1YEFL 3QUZB 4K3JL 5F9OL 4XPHL 4JY5L 1WWCA 2IPKB 3ELAT 2YN5A 1I7TB 2DQIH 1G7HA 1I1AC 5C0BD 3IU4L 5GGTH 5KSAA 3M17B 2FATL 1HYSC 4QRPD 4X4YB 3CX2A 1EZVY 2R0WH 3SGJC 1RZJH 1JGLH 5C6TL 1A6VH 2PW2A 4JDTL 5DA0B 2XICA 4XVJL 4YDIL 2JK5B 1I3VA 3GSQB 3KPQA 4GMTL 2DQEL 3QFJA 2YEZA 5T1DL 2P48B 5IJKA 5HGGS 4D94A 3SQOL 1FVDB 3MCLH 2LU4A 3CZJA 4DCQA 3M45A 1MNUL 4J3VA 43CAA 1PZ5A 1U3YA 4I9WD 2YOCA 5EUOF 2W0PA 2DMCA 2EDYA 5FYKD 5D9SA 3IDIA 4KVNL 2UUDK 4PBWD 5FIEA 1EHNA 1NLDH 1HE7A 5EULV 1A0QL 4Q9BA 3SGKA 2GQHA 2AGJL 2CDGB 1M6OB 5ESVA 2EYRA 5EOCJ 3OF6A 4J12A 2J12B 1XCQB 1N7MH 2WUCL 4YHLH 2MNUA 5I74C 5TFSL 3F7VB 5T5NG 4A2MA 4POUB 1ZHNA 3Q1SL 4OQTA 3UYRL 3C87A 5KS9A 5DGRA 1WAAF 3SKJL 3RKDD 3HMWL 1KTLB 5CD3B 3CFEA 2A74A 4R2GB 3QG7H 4F9PC 4NNYB 5ELIA 2A6KB 4URTB 4JQXC 4Q6YA 4OLWL 5FAAA 1MPAL 3UTTD 2R2BA 4DUXA 4M1GL 5IV2B 4JN2A 2FBJH 4FQIH 4ODHH 4LCCA 3SE4C 1YEGH 4PJIF 4Q97A 2X42A 3P0VL 2R1XB 2WBJC 1R5IA 3RGHA 4JHBA 4L5FH 4KDVA 1WQVT 4HIIA 3VMOA 5D2NA 4LAQH 1UQSA 1F00I 3SDXF 3NCJL 4I3SL 5IJVB 3P0YH 1H3PL 3CUPB 5EZJB 1VHPA 2R15A 2E3VA 1IAIL 5E6IA 2AEPL 3WLWC 4MNQA 4HQQL 4NYLA 4YBQC 1WWBX 5BRZD 3W9EA 1AC0A 3NCEB 2EDRA 1U0QA 1YNKH 4N8VG 1N3NB 5EA0H 1RZ7H 1FO0A 4G8GA 5MEOB 1KIQA 1SJEB 2AI0H 5FO8B 3LHPH 2FSEB 1JVKA 3N9GH 1V05A 1J88A 4S2SB 4WU7A 5GGSY 2BSRB 3HUJE 3O6KL 4HUUB 3NAAL 1KACB 5DRZB 1LP9B 3UDWA 4Z76B 2B4CH 4ZAKA 4TRPH 6FABL 1QOKA 3KJ4C 4OLVH 5T1LB 4NSKB 4QRSA 4BFBD 3B9EA 3DUSA 1K85A 1U3ZA 2Z31B 3OB0H 3A6BH 3VW3H 3KYOB 4WV1B 2CRYA 3JWDC 2EDEA 3KPRB 4DOHE 2AV1B 5FM4A 5FYJL 4EJ1C 1T0PB 2O5XL 2R1YA 4QLRA 3MJ9L 5DJYB 3VXNB 4LLVB 5AZ2H 2OX5A 3K46A 3MNVA 3NVQA 3VDAA 3VFTA 4KJQD 3BN3B 5C08E 2MQ3A 5FO9B 3RWEB 4X7TA 3ILQD 4FQXD 4DKAA 1J5OH 1KPVB 1VB9A 4KI1A 1GC1C 1IC4H 3MODH 4UUJB 5D2LA 1A5FH 4I48A 1Q72L 1ZLSH 5IIEA 4QRRB 4MWFA 5JUEH 1SVCP 1HYSD 3WSQH 2YD5A 3DHJA 3QIUB 1T04A 2XQYG 5JW5B 4TUOA 5BZDA 2DDQL 3WIFB 3V7MA 1UM6H 1EH9A 1NDGA 5HJ3B 3DMMC 2KPNA 1L0XA 1T5WB 1BBJA 1DCLA 4JR9L 2Y23A 5T5FH 3IRPX 1MFAH 1RY7B 1I3RA 1KYOJ 4OZIE 5CEZE 4WI6A 3CZFB 4ZS7L 3JTSA 4I1NB 1JWUB 1LEKB 4RRPA 5T3ZE 5J11B 5DEFB 2HJFA 1OF2B 4WNQA 5EO1B 2VISB 4AIZA 4K3DH 5J12C 2V5MA 3C60C 3CXHJ 3O4LE 2A38A 2VZUA 5C0CA 4RX4D 4EDWH 2F5BL 2DICA 1E27B 3GI9L 3M1BA 4FQLL 2BVYA 2X89A 1DEDA 5KVFH 1N0LA 4HJJL 5DUBA 4Y19A 3FO9B 2DLFH 2DBLL 3FT3B 4LVEA 2JJSC 1BFSA 1P4BL 4G6JL 5SWSD 5CEXB 2BNQD 3RTQA 1GOFA 3WFCH 1H5BA 5IWLA 1G7PB 4LKCA 2PTUA 3LD8C 3O8XC 4LBEA 3V5DA 2A0LC 4R96B 1DQTA 5EO0A 4PRDB 2EXWC 4FQCH 5JHLH 2VITA 3TYFA 4Z7OF 4B50A 2CLRB 4HLZG 4IDLA 4IHOA 1JPGB 5F7MC 1FV1A 1V8HA 3OAYH 1A7NH 4ORZC 1CICB 4IRSC 4QY8B 3GKWH 4MZ2A 2P5ED 4NBXB 5CBAA 4DZBA 2PN5A 3UO1H 1MHCB 2QV2A 5EBMB 4UINL 3MYZA 2VLKA 4GKSA 2A77H 2RFXA 3HR5A 5CEYA 4ODXA 4PJHA 5DDHB 3QDMB 4JPVL 4TVPH 5T33H 3VWKD 3GEWB 2IH1A 5T1KD 3V6BR 1BD2D 5JLZA 3AUVA 4JCMA 3WLWD 2EDNA 3ZYIA 1MCSA 2IBZX 4YBQD 1JYXA 3CNKA 3ARFA 3WL9B 1DQMH 5C07B 1U8OB 4YWGL 1OP5H 4EBQH 2RBLA 4NZDA 4WJ5A 3C9NB 4IRZL 4QGTA 2R8SL 2OR9L 2CDEA 3CH1B 2NXZB 2CGRL 4XGZB 1SVZA 1OGAB 2F15A 2X2YA 3ARDB 3L3GA 5C0AD 5I1AB 1XF1A 1H3UA 1Q9OA 4NCC2 3RIFK 3ZMRA 1AJ7L 1MVUA 5CUSH 3QRGL 4HWZB 4ELME 4HXAH 1P5VA 5INCB 2RQ8A 2EYTB 4PJXF 1PKOA 2D03L 3MNWA 1FRGH 1Z2KA 3NOIA 3WNMA 4JO3H 3FT4B 2IALA 4KI5F 5M7QA 5DQDH 1E28B 4I0PA 1BJ1H 1HEZB 4JFYA 5IW1B 4UIKH 4YHZL 1N5YH 4YIQA 1DEEB 4MJIB 1X5AA 4XRCA 1G7QA 1RUQL 2OM5A 3MROA 5GS2D 1VGEL 3DVFA 4M93B 2EEAA 3NFSH 3QP3A 4DZ8B 2EIZB 3DIFB 4U0QB 3ZTNL 3CFBA 4WI2A 3VFGH 3GSNA 3RWDA 4Y4HA 3BO8A 2P45B 4HUXA 5MI0C 4ZPTB 1TTFA 1JNHB 3BESR 3H3PH 3Q5OA 1CF8L 1UZ8B 1SYVB 3H9SA 5F9WC 3C2AL 3MLRH 4M1CC 4J2XA 5ICXA 5CAYB 4IM8A 1NAKL 3NA4A 3X3GH 4YJZL 2FJFA 5B4MC 3MV7E 5GRYA 4HUWB 1WVZA 3DMMD 2OTUB 4NN7B 5CCKH 3O11A 4TN9A 1QACA 4NQCB 1IQDB 2I5YH 3DVNA 4ELKA 4N1EA 1UCTA 4XP1L 2ICEA 5J9PB 2C4XA 2C3HA 4X6CB 4APQC 1XGPA 5LAXA 3GIVA 4RIRA 4YX2L 3WHXA 4Z0BH 4JRXB 2DWDB 3C60D 1MJ7L 1RZFL 4J1UA 3HE7C 2G2RA 3LH2H 4UQ3B 3G5ZB 1DQJA 5I18H 4HS8H 4NZTH 3S34L 4MQXD 2DL9A 3EO9L 4AMKH 3O9WB 3JSSA 2B39A 5EUOA 3D25A 5EUKB 4EN3B 3NFPA 4F80A 4LF3A 3GM0A 4E42A 4F8TA 4X5WB 4YBLC 4CN1A 4BZ2H 3K81A 4TSBL 3TV3L 3V6OC 5EU6E 3WMSA 3BH9B 3ULVC 2QQNH 43C9B 1UZ6F 4BZ1H 5FGBA 2F54D 3BZFA 3CSYA 3O8XD 3V0AC 2GFBB 4ODUA 2A0LD 1OW0C 4OGXH 1HIMH 2EXWD 2HRLA 3OR6B 4WFGE 5DYOB 4NJAL 2EE3A 2AXGB 4NN5B 3QHFL 4JFZH 5FV2A 3LMJH 1GIGH 3SGDI 1E4KA 32C2A 5CILL 2AJUL 1VPOH 2Z93B 1B6DA 2GI7A 3MUGB 2P4AB 4X9IA 4F9LA 4OFDA 1TENA 5DFVC 2HH0H 1I85C 1TTGA 2DN7A 2A6IA 3HPLB 1NCWL 3TNMA 3FQTA 1FVCB 3KLHC 1AGEA 1FNSH 5DMGC 2BRRH 4HH9B 1JPSL 4PRHA 4V2BA 2ATKB 1XR9A 2XZZA 1AO7B 4WUUD 5F6HJ 3JWDL 2R0LL 1I9EA 4V2CB 4PY8J 5BS0A 5IB5A 1KXVC 4X6EA 4GBXB 5BXFA 3H0TA 4O5LL 4GRLA 1TCRB 1C5DB 3BT2H 2FX8L 3SDAB 4LLMB 5E2WH 4MNGA 3W0WB 3RHWF 4XNMA 3TO4C 4MDJB 4L4TD 2EH7H 4JZOA 1MCNA 1TZIA 1IGCH 3LKOA 3PQYE 3VGBA 3IJHA 1LO3H 5A2JH 2EDOA 3LVEA 4ZFFB 4BKLB 1C08A 3LS4H 5GQBA 3CFIC 5HHOB 5I1CL 3L3KB 1G7LA 3S96B 4PJFF 1AGCB 3HRZA 1I3GL 1TPXB 3L1OH 3BPNC 4IOIA 4OF6A 4EUPH 1QR4A 2EC8A 2HTKC 1MSPA 5D4QA 5GGTA 3IDJB 4MA1C 3E8UH 5L8JB 5GS3A 2A83A 2X44D 4FHBD 1JWSA 4M43L 3PWLA 1BVKA 1NDMB 4I77L 4QHLA 2ZZUT 1Z9LA 3HN3A 1UM4L 1CT8B 4X8XA 3TO2A 1FLRH 2A1WH 3QCUL 4Z7VE 3VE0B 5DRWB 4FP8L 4I2XB 4G6KL 5C0FB 2XWBA 3R06B 5IROC 4ZO7A 3A67L 1KIRB 1OSPH 3BKYL 5ENWA 2R56L 5DMIL 2FX7L 4X6DE 4QXGH 3MOQA 12E8H 4K3EH 2X4UB 4CVZA 1U93A 4LGPB 1PGRB 1T7VA 1QFWI 3PHQA 5E8DH 2XQBH 4YDJB 1HH6B 2FR4A 4K23L 1IT9H 3MMEA 3QAZB 2DI8A 3P4NA 3Q6FB 4M1CD 1KEML 2DI9A 5F6HI 5FKPB 2YRLA 4PJGE 4PY8I 2L0DA 5KANI 2B2XL 4NO3B 4C59B 1A47A 4IS6B 3SGKC 2P1YA 4Z5RA 3FFCA 2XRAH 3VWJC 1ACYH 25C8H 4PGZA 5F7FA 4OZGE 4WI7A 1NC2B 3QO1B 2H6PB 3VI4F 4OF8A 1JHKL 1HQ4A 4S1QL 4K55A 3O2VL 4APQD 1VKXB 3S5LA 3BIKA 2AXHA 5FHAL 2ICES 5D7LE 3D9AH 3FO2A 3HE7D 3U6RB 3D48R 4UTAL 4YEEA 2CKBL 2QADC 4LASH 5CGYC 4KV5F 3R1GL 1PKQA 1MCOH 3OX8A 3C08L 3V5KB 2BRQA 4E41D 1YMHB 5IHZB 3MFFA 3MUJA 1NMBH 1HHKA 1B2WL 2DLGA 3BSZL 3ZL4H 3N85L 3ULVD 4XBPA 3QWOA 5GPRA 1TJHH 4JO4H 2C7UA 1QFHA 1X5JA 4PY7B 1UXWA 2APVA 2VERN 1YJDH 5DSCB 4JZNA 3D39D 5INDA 4P3WA 3E1F1 1MCIA 2APTA 1MCPH 4TULL 1T7YA 3PJSB 2NY3C 5BJTA 5IGXH 3RIAF 1PG7H 1C8PA 4Y1AD 5D7JB 4RGNC 2G5BB 5DFVD 1ZS8B 5ISZA 2G9HB 5IHUL 3QEHB 2HT4C 1MWAL 5E9DE 4Y2DA 3KLHD 4XBEH 4QOKD 1CE1H 1A7OH 1FCGA 1ZOXA 3MRIA 3VXOB 3ZSSA 3NBNA 2GTZB 3FQXB 5FO7B 1ETZB 4P3CH 1J05B 5MHSD 4ZPVA 1OTTC 2BSSB 3D3VA 1DLHA 3UDWC 4ZAKC 3U0WL 4PJAB 4YHIA 8CGTA 1AQKH 1QO3A 3T1FA 2O5YL 3AFLA 2AK4B 3NFNA 3TO4D 1U95A 4XTRC 4PRBB 5FEBA 5SX5H 2I26N 4Z7QE 1NJ9A 2FGZA 5HYJE 3IU3A 3MNZA 4PRPA 1OTSC 1RFDH 1G0XA 2IADB 3VXMB 3MRMB 4PJDA 3V79C 4QWWC 1I3UA 3ZE1F 3GZKA 4U7MA 4XB7A 3EBAA 4R0LA 1HDMB 2HT3C 2YD7A 1YPZA 5C0JA 3K8KA 4L4VE 2VIRA 2HTKD 3ARPA 5TGBB 3MLVH 4LLUA 3HZVA 5C7XL 5K59F 1S3KL 1MHEA 1NGYB 3RUGB 4QRTA 4X9FA 3GB7B 3GRWH 2VDOH 2UV3A 3IFOB 2HKFL 5DJXA 1KTRL 1NGWB 1ZANL 5GJTL 3MXWH 1WBZA 2X4OA 5D72H 5DRNB 1AR1C 3VFPB 1QSEE 1JGVH 4JFXA 3X14A 4K8RH 4J4PC 5E8NB 4JM4H 3RWCB 1V3JA 4LU5H 3UZVB 2RHEA 2Q6WB 5DJAB 1CFSB 1WZLA 4Q9RL 3ARSA 4JM2A 2UZXB 4UU9A 3QYCA 2PW1A 3PHSA 1UFUA 4X5XA 4EDXB 1X5LA 2AK1H 1T2QH 1TQCB 3F6LA 5DJ6A 2VDQH 1OTUC 4QXWA 1KFAL 2BHUA 2E7CA 2XN9E 1P7KA 1KV3A 1UYWL 5EU4A 1I1YA 3NCMA 2IPUK 4BH8B 1QLRB 2ZUWA 3CFDA 4YHNA 3E6FA 3BWAB 3VWJD 2AVGA 1EFQA 1J0YA 1NAMH 2D7TL 4NKIL 4G80A 4U1HA 1RIVL 3RDTC 1UEMA 5I17A 3OF6D 3VFNA 1BQHA 1YY9C 4OCXL 5JHDB 3MGOB 4LHUA 4KJYA 1L0YA 3I75B 3D18B 5DQJA 1JF1B 3RTQC 5IWLC 4D0BA 3LEXA 5T3ZH 5JDSB 1NGZA 3BKMH 2XZAH 5TPWL 2QADD 5CGYD 1OAKL 1AKJD 1I9RH 3BP5B 2HJKA 4R8WL 3BZ4B 4G6MH 5DI8B 3GMLA 4GAGH 4F2MA 3KPOB 2ZSWB 4N9GA 4BQ9A 3NABH 1MLBB 3PIQA 1J1OL 1EAPB 2Y36L 1Q1JH 4KRPC 4LSSL 3BEWA 2OP4H 4WHTA 4UOW1 1CL7H 4H8WC 3REVA 2Y07L 3ALPA 4DN4H 3ME0A 1XCTB 4ACPA 4TPRL 2FHFA 1BZ9A 2R23B 3LRSA 5E6ID 1MY7A 4ORGB 1HZHH 2VXQL 2NY3D 4MNQD 3WDHA 4YHML 3FQUB 3U36B 3ARFC 4Q0XL 4RGND 4KZDL 4G9FE 1ZV5A 5KJRH 3FB8B 3ZKSD 2HT4D 5F7WC 4H26B 3SKOB 3VG0L 5L2KA 3T3PE 4D0DB 4HW6A 1F3DJ 3EYVB 2ED9A 1RVFH 1KJ3H 3MV9E 5DTFB 3BE1L 3TYGH 2ZG1A 3W5NA 1TVBB 1MRFH 4JO2L 3X12A 4K94H 5I1LB 4ZAKD 4JFQA 5ESQA 4AL8L 3FO0L 4ZTPH 1N6QL 3E6HB 5DWUH 1DBAL 4TNVF 5HDBE 1JTTA 2MCPL 4QRPB 4XTRD 4QYOB 2C26A 4GSDH 1YYMH 5IVXB 4PJ9C 3OJDB 1NUNB 3CLEL 4XXCC 2CPCA 4P9HL 2Y06H 2M8XA 5DJ2B 5L2JA 1OTSD 4BQBA 1U58A 5I71C 4KGJA 5CINH 4PJ7B 3MRRB 5B38B 2WBWB 1J8HA 3RKPA 1FG2A 1EBAA 2HT3D 2XTJE 3CX5K 5C0EA 3OHXA 1DQDL 3PABA 1X4YA 5SX4H 3CIQA 3OV6A 4OKDA 4MD0A 4KH2A 4DVRL 4R4FL 4XXDB 3B5TA 5KBNC 4Y5XB 4NJ9L 4ODWB 4U1NB 4CNIA 4FTVD 1A6AB 3TBTA 5FGSA 5EZIH 1QSFA 1NGXA 5CJQL 1E6JL 1AR1D 1FN4A 2GJ6D 4J4PD 4ONFH 5DD5L 2OK0L 1IAMA 2VLJA 4BFIA 1CU4H 1RZIB 1W0WB 2AJVL 4F33A 4L29A 4LSQH 1YMME 5E99L 5DFWH 4K9EH 3I2CH 1E4WL 3MRHA 3OSKA 1EGJA 5F7DA 1LK3L 1H15A 2CK0H 1OTUD 1NBVL 1AC6A 4AEEA 2DQDL 4Y4KA 5CLTA 3ARWA 2P8PA 1HHGB 2VDRH 5D7IE 2D0HA 4J3XA 1QHOA 1ZHLA 4OZHA 1MI5A 4FZEH 5IFJB 2YPLA 2Z4QB 3CSPA 4OCSH 4JY4B 3ZHKA 3V8OA 1S5IL 4YHYB 5ILTL 5C0CD 3N1MC 1L7IH 2JF1A 2AS5M 1N5AA 4PJCF 4UV7H 35C8L 1S8DB 3IXTB 2EDTA 2X89D 2G60H 3H9HA 3RDTD 1KT2B 3JVGA 4Y19D 1CLZH 1FFNB 2Z0BA 5JW3L 3O6LL 4U0RC 3H3BC 3PL6B 1QFOA 4KY1H 4Z6AT 1NBQA 2ZUVA 2X4NB 5FUZL 1FGVH 5L7XL 3RTQD 5BRZB 3MUHL 1GAFH 2VAAB 2W60A 4NUJB 4JCLA 1CZ8H 3BMWA 3WKML 4G8IA 3GMQB 4AY0A 3IS1X 4NZRH 1KB5L 4QHKJ 4HHAA 4AQ1B 5IB1A 4LVOB 3UTQB 3RJDA 4KRPD 5A40E 5IP4A 4F9LC 1IGYB 4C56A 2IQAB 4X98B 2VLKD 4LPVA 2H2PD 4MMXC 3B83A 5TE7L 2R1WA 2B1HL 4UNVA 4L9LB 2P8LB 1PEWA 3MSPA 1N8ZB 3BYYA 1YZZA 4MS8C 4BUHA 1IKFL 1BFVL 4YFLI 2E7LA 1MH5A 1TXKA 1ORSB 1HQRB 3P77B 1QNZL 3Q3GA 4TSCH 3ARFD 3O6FB 3M8OH 3SO3B 4S11A 4KTDH 3T2NH 4O2FA 4PB0H 1T1WA 1TETL 1L6XA 3V52H 1TVHA 1I7RA 1CGXA 4RMVA 2X7LA 4GRWH 3GHEH 2L7UA 1VEPA 5E2UH 1RZKH 2XZCH 4U6YA 4YXKH 2ZCHL 4KWUA 1IM3B 4U05A 1OLZA 1FGNL 4ZXBB 3EO0B 2WAHA 1DUZA 2BMKA 3KPNA 4HWBH 4GAFB 1I1AB 1X3DA 2W0FB 5TQ0H 1G6RL 1TZHB 1JF5A 3S35X 4F3FB 4EIGB 4G6FD 1MAJA 1A6TB 4PGBA 1QEWA 1XGQA 3JTTA 3QUXA 4PJ9D 1RZJC 1DN2A 1KTKE 1MFCL 2NY1B 3MLSL 2VXVL 2AJYL 3BKCL 3ZDYF 4XVTL 3CFJA 1S7QB 3EDDA 2MWCA 1UWGH 1EJOL 3EYFB 2QLVB 5I1HH 4PG9A 3EJYC 5E00A 1MRDH 2Q8BH 4L8SC 5IMLB 2BHZA 5GIRA 3L3OA 4IOFC 4JRYA 4MHHG 3STLA 1VDGA 5L6YL 1QPXA 1UCBH 4PS4L 4XMLL 3EGSB 3ISWA 4QHKI 1DBML 1E4JA 1DQQA 4GG8A 4HXBL 1TTUA 3RPIB 4EI6A 3ES6A 1GOHA 4WDIB 4O02H 5E24E 4M03A 5E2TL 1G7IA 4Y0GA 5JA9A 4OCRL 3JV0A 4OLZH 1P84J 3OZ9H 3ARXA 1DBJH 2J6EH 2NX5D 2VDNH 2XKSA 2XY1A 2Q20A 4M6AA 1A1NA 3CJJA 3QISA 2RJMA 1XF2B 1BQUA 4WCYL 1YNLL 5SWSB 2VXTL 2CRZA 4NCC1 2BNQB 5EU3A 5I1KH 3D69A 1F42A 3BDYH 4HV8A 5EH1A 3QJFB 2GUOB 5EZLA 2FJGB 6CGTA 5J0BA 4I3RL 1RPQA 2XXMB 5DJZA 3MLPA 3RZCC 1IM9A 4PJEF 2NXYC 5FM8A 2APBA 1PZUB 2FJHB 1OSZB 1UH3A 4JPIB 1T4KA 2ZUQB 2UZYB 2P5EB 3MYJA 2WBJB 3GMNA 2FEDC 4U1MA 5FUOH 3RNQA 2F58H 1INDH 2ILLA 3P30H 3PP3K 5B8CC 3DRTB 1NEZA 2CO7B 4MCYA 5GRVK 5DJDB 3DX9B 4OCMC 3C8KA 1FYTE 4O2EA 1U8JA 5GGVY 5J3HD 1ZK9A 3QDGE 4O4YL 3BUYB 2EH8H 1QFUL 5LGJA 3RX5A 4GRWF 3KXFB 1BJ8A 3RP1A 5CJXC 4CVXB 2YUZA 3BH8A 5GJSH 3BMVA 5MERB 1MJJB 3HI5L 4LQ1A 3WCYA 1MY5A 3QHZH 4HWEL 1KB9K 5DS8A 5TE4L 5L9DL 3HC3H 1AXIB 4U6VL 4KUZL 3LKRB 5CJOL 2WNGA 4YFLF 1QFPA 2W9EH 1IARB 4GOSA 4Z78B 4P4KB 2B4CC 5MEQA 4LLYA 4Y2DC 2FHCA 4QF1A 5BMFH 2ZCKL 1CBVL 1KN2H 4PRHD 5F70A 1VGKA 2WMPA 3FB5B 5DUMH 5LWYL 4KPHL 1S7UB 4MS8D 4LHJB 2H8PB 1BQLL 3IDNA 5B38G 2A9MH 2RR3A 3IT8D 1AGDB 4K7PL 1IEBB 2D2OA 2E7BA 3WXWH 4JAMA 1HSAA 4X7SL 1D5ZB 4KDTA 2CMRH 1MHHB 1ZT1B 3HUJA 4YDLB 1E6OH 1AHWA 3BHBA 2PYEA 4MXQC 1BLNB 1JK8B 4WGVB 2X4TA 3WYRA 4WFFD 1UXSA 3LKQA 4DK3A 4UNUA 3QFDA 1A7PL 4QHUB 4AZ8A 3I02B 1XGTB 4XAWL 5DK3A 3PV7A 4KHTH 2BVTA 3ABZA 4H1LH 1RV6X 4N1CA 4ZDHA 4HGKC 1Z9SA 5BO1L 2BVOA 5KSVB 1WEJL 1I8MB 1AFVH 1M71A 5IT2H 4AT6A 2HT2C 3LPWA 5C08A 3EJYD 1K8IB 4KI5C 4PTUB 1ZHKA 1LDSA 4IOFD 1LE5A 3A6OA 4YAQA 4M48L 5EOCH 2WANA 1QQDB 2OJZL 1CWVA 2DLTA 4MX7B 3VXSD 2MHAA 1VA9A 2CIIB 4JM2C 1SJVA 5EBWA 2GTWA 5D8JL 3C60B 2UWEF 3VFUA 5JZ7C 1JRHL 2DQJL 5HDLA 3QUML 1FNEA 4PJBB 3IDUA 3CFCH 4KZEH 4HLJA 1NCAH 1T89C 1KCKA 3O3AA 2QQLL 4NN6C 1S9YB 5ALBL 1JWMA 5KSBB 4MSWB 1YECL 4HK3N 3LIZL 1H8NA 4OZIA 2F54B 5FECA 3WIHH 5T1MA 3O8XB 3FFCD 5ITFB 4X6FB 5DURB 1LP9E 2ARJA 4JJ5B 2D31B 1B0RA 1IILE 2PETA 5DJCB 1CFNA 2NXYD 3O4LA 2E8YA 1A3RH 2XTLA 4JZJC 2YXFA 1G9MH 1JV5A 3UYPA 3C5SA 5JNYB 4IRSB 5GRZA 3V7AG 2JJTA 5I16A 4HUVB 4JFHD 1OWRM 2ZUSA 2DTMH 2FEDD 5DZLA 1WFTA 1OL0A 4KQ3H 4X4ME 4ZYKA 1OAXL 3KPRE 4G8EB 1BIHA 1LO2H 1CFTA 3MLYH 4LCWD 4GW5A 4KU1A 5DHVH 2CKBB 1J0HA 4PPTA 5HDQH 4WUUB 4Z7WB 5BVPL 1NUDA 3WKNA 1KN4H 3LQZA 2OR7A 4OUOA 5KVDL 1INEL 2BY3A 3IDMB 5JR1H 3EOTH 4F37K 4KMTH 3SKMA 2ZOKB 5JXEA 1X5HA 4Q74A 1J10A 1JNLH 1KENL 4OI9A 2FO4A 3TBVB 2PTTA 2BNRB 3FQRB 4L4TB 5A16A 3SE3A 4ONGL 4ZO9A 3GMOB 2ZSVA 4HC1H 2P5WA 4LCUB 4QRRE 1W2KT 3WUZA 3NZ8A 4CW1A 1MFDL 3ILPB 3MRGB 2YC1B 3OKNA 4ZTOL 5C8JB 2H1PL 3RWFA 3F7RA 3MBEA 3EYOA 1KNOA 2FH8A 5ID1A 1NSNH 4G5ZH 3P9WB 5ISZD 4OIIH 1MQ8A 1I7ZB 3F65A 5F1NA 4Y16A 3LEVL 4YBHA 4Y2DD 5GGRY 3TIDB 1AGFB 3I50H 5DD0H 1L9NA 2V5YA 1MWAB 2NZIA 5GS0H 1JGLL 5I1JH 3EOYG 3I6GA 3PV6A 4G43A 3W11D 1I8KB 1WZ1L 1VACB 3H8NA 5SV4A 5E5RB 3RWJB 4D9QE 3TF7C 3BP6A 3F58H 4E9LA 1HI6A 3ARQA 4ZUUA 5FA4B 3D3VD 5IB3A 4M7LT 2NTFB 4NQED 3RVUC 1F90H 1OT2A 1T03L 4IDJH 4LDLB 1KJ2A 3V4UL 4ZOEA 3N06B 4MXQD 4HG4J 3O4OC 2VDPH 1OAQH 3LQAL 5ESAA 4PRPD 2CXKA 1FH5H 3BGFC 4MB4A 4TTDC 4QHNB 2VABB 5I8KL 1NLDL 5DR5H 4MJ5A 4WW2B 5MI0B 1LVEA 3MRFB 5GGQL 4U1SA 2C1OB 4PG2A 1TIUA 1CTOA 5CIPH 1JGDA 5F9WB 2ADFL 3GBNH 1QRNB 5F6IC 5DQ9B 5IEHB 1RUAH 1X9QA 4KROC 5FKAB 4I3GA 4WHDA 3AREA 4HIXH 4HPOL 5IQ9B 5KAQG 1KJMA 3QG7L 2GSIA 2HT2D 1IAII 2VKWA 4FQJL 4KI5D 4W68A 3WEXB 4NQSA 1D5XA 2KQMA 3VFVB 1I8IA 1SEQH 3QEUB 3TPKA 1FL3B 3QDME 2VXSL 4APQB 4W6YB 2X1XR 4JM2D 3REWA 2X4SB 4ZUWB 2YPKA 3HE7B 2AJXH 5IB2A 3OKLB 5JZ7D 1KCUH 3NA9L 3FT2B 1U8KB 5TH2B 2GAZB 5C07E 2HFFB 1X5GA 4Y4KC 4NDMA 3MV7A 4GW1A 3QNXA 3D87B 3TIEA 5ACZB 2HVKA 1KCRH 4YBLB 1NCNA 4H25B 5BVJB 3U0PA 1OGAE 2VLRD 4PV8B 4R7DB 3ZDXF 2VB5A 4HIHB 4ZOBA 3GMMB 2VE6A 3D39B 5F1IA 2C3VA 3B4NA 3QO0A 5IW3A 1NQBA 3JVGC 5HYFA 2P46B 5HY9B 5EU7C 3LHPL 3ZKXC 4CJ0A 3N9GL 5D93B 3ZE0F 1HH9B 3OAYK 2DB8A 5EIQA 4D9LL 1CE6B 1U8MB 1XF3B 4ODSL 4Y1AB 2Z9TA 5C2BH 5GZOC 3P4OA 2F53B 5GHWL 4TRPL 4GJTB 4LRNH 5D1ZA 2V7NB 4MJIE 4GXUM 5ID0B 1HINH 4UTBL 3CC5A 1B0GB 1PSKL 4PJ5D 5IOPB 3A6BL 4TVPD 1BBDH 2RCSH 4KTEH 3ULUF 3KNBB 2F74A 2WLZA 4XVSH 4OZFA 4QNPE 5E70A 3GSXA 3MBXL 3BVNA 4NCDA 3TBYA 1JN6A 4N5UA 2NNAA 2W9DH 5DK0B 2IPTL 1EEYA 2FO1A 5FYLE 1MCRA 3INUH 1MIMH 5TDNA 3Q6GL 3TO4B 3AB0C 1OP5K 1I7UA 1NMAL 5HXMA 1RURH 1G0YR 3LKNB 4GFTB 4AM0A 1RHHB 2K9UA 3C5ZA 3MTRA 3NIFF 3ROOB 2BCKB 1HCFX 4UB0L 5FDWA 1P2CB 5CMAB 2UUDH 1J1PL 2YUWA 4X6BA 1IC4L 3MODL 4ETQA 1A5FL 3HG1D 2BSED 5EC2A 1XGRB 3BRFA 4KJPD 3EOAA 4CU6A 4DGVH 2P8MB 1ZGLM 3BPNB 5JUEL 1PQZB 3LSOB 2WP3T 5L2KD 1Q9KB 3WSQL 3QXDA 3PWJB 4MA1B 4B7IA 2OJEB 4NQCE 4HJGA 4PRAA 4LSRH 2V9TA 1LEGB 1WSST 2UYLA 3Q2CA 3QIWA 4UT9H 1DQLH 1RU9H 4RWYH 1GOGA 4X6CE 2YUXA 5C86A 3FOMA 1AY1L 3RVUD 1YEIH 4JFDA 3U7WH 2B7DT 3FTGB