5FXCH

Crystal structure of glycopeptide 22 in complex with scfv-sm3
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
224
Chain Sequence
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSIVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCFV-SM3
publication title Design of Alpha-S-Glycopeptides Derived from Muc1 with a Flexible and Solvent Exposed Sugar Moiety
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 54
structure length 224
sequence length 243
ec nomenclature
pdb deposition date 2016-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fxcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fxcH01
5T33L 2DQJL 2R1YB 3CVHA 3ZZ1A 3WIFA 3ZDXF 3SHSA 1FN4A 1KGCD 1MCCA 4LSTL 4KJWD 2DQTH 3A67L 4NRYA 4U1KA 1UZ6E 5TQ0L 3MYJA 4G8GD 1JNJA 5EC1B 4HKZB 2FBJL 4LOUD 1H5BA 2NW3B 1WTGT 5CEZH 4OFDA 2CPCA 1I1AB 3T2NH 4F57L 3OKEA 3BGMA 1UCTA 4YX2L 1NGXA 4G5ZH 4OGXL 4XMKH 1LK3H 4WU5B 5LBSL 4XBPB 4H26A 2BNQE 1FPTL 3BE1H 4XNUH 3PDOA 4O58L 3TJHD 4R3SB 5L6YH 2A9NH 3CFCL 4R90L 5DQ9A 4KRPC 5E6IC 4CVUA 5JW3H 2ADIB 4JY5H 3IKCA 5ALBH 1MRCL 3H9HA 1CICD 1ZLUK 4Z5RA 3B2VH 5CD5C 3QO0B 4OIIL 1J1XL 3CX5J 5F72S 1HI6A 1AQKL 3HG1A 1LE9B 3I85A 3ESUF 3V8OA 5HD8C 3BPNB 3BWAB 3V95A 5F9AC 4X7SH 4GAGL 1E4KC 3FB8B 3K2UL 2BNUA 4IMKA 3JWOL 3RDTA 1PG7W 4NZJA 4ODHL 2G60H 3RU8H 1MJUL 3MZTA 5IW6B 3AS3A 4P3CL 1CN4A 1IRAY 2MCPL 5T1DL 5C08D 4FN0A 4YHLH 3PWPE 1S3KL 5JDSB 3QUKB 1TLKA 5MENA 1U91B 4ZUWB 2C7UA 3QJHA 3THML 1ZGLM 2H6PA 4RX4D 1ZV5A 5FUZH 3DRTA 2A0LD 3KXFB 4OZIE 3TT3H 1WBZA 5BW7A 4WW2C 5DUPL 4RNRB 5IB2B 4G3YL 4K3DL 1F4WL 4UT6H 4WHYG 4HK0A 1I8MB 5DEGB 2F54D 2B0SL 3ET9F 3ARFD 4IJ3C 5SWSA 2DDQL 4HMEA 2VQUA 4L3ED 1MFBL 1N2RA 4PRHB 1UC6A 4XCEA 1PKQE 3O3EB 4DGIH 4PJAA 2GK2A 3V4VH 4WFGE 3ZDXE 2NX5A 4M1CC 4M5YL 1U6AH 2MPAL 3JV4A 4NC1E 1CIDA 4FFYH 4R4BA 5EZJB 1I3RA 2HT2C 2JCCA 3H0TB 5DJCB 1MCDA 5GZOD 1JYWA 1P4BL 4GAYB 5J57B 4JFXA 2C5DC 3ZTNL 3HNSL 4TSAH 5SX4H 5GSVB 4E41B 1U8OB 3KPSA 2ZSVB 1LNUB 1XCTB 4ETQA 4Z7WF 1CVSC 5C8JA 4GS7C 3G6AB 5IJVB 1Z5LA 4O51B 3D85B 1ACYH 4LLYB 4LHUA 3T0WA 3HB3C 1T7VA 4XHJC 3H3BC 3KLSA 4WIQA 2IPUK 2I9TA 1J1PH 2J8HA 4NQDB 2ZUSA 3DXAB 3HMXH 2GKIA 2P24A 1XIWA 1CXKA 4OB5L 3MJ6A 4HT1H 2YEZA 3F7QA 3RTQC 4KFZC 1MUJB 4OF5A 3IU4L 1F58H 3LQAH 1DBJH 2RHEA 4WI2A 5DQDL 3E1F1 3UYOD 2BRRL 1SEQL 2A74A 3WFCL 2DD8L 1Q0YL 3FT2B 2X6MA 1UH4A 4LKCA 2AKRB 2GAZA 3NA9L 4N8CL 4KK8D 2R39A 5E99H 2MOVA 2CSPA 1KNOB 3LMJH 1ZS8A 5D93C 3I2CH 3ZKND 1I4FB 2NQCA 1CQYA 4NKQB 4CW1B 3A6CH 3QUXC 4YH6A 2NNAB 1GGIH 3ZT5A 5DEZA 2NY3D 3TH4T 4Y88A 2NY1B 4QHLA 1T6WA 3O8XA 5MP6L 3EDDA 3G6JB 5D7IF 4ZFGH 3SY0A 4P2QB 2VABA 1U58B 3SDCD 1J88A 1X5ZA 4KROD 5ACLA 4HDIB 1VFAB 3UC0H 5C0ND 1KULA 1ZHNB 3NCJL 4LQFL 4QOKA 4K23H 1PG7X 5I8EA 3DO3A 5JMRA 4LNVA 1RK0B 3PXJA 2BX5A 2CKBB 4HIJB 4NO0A 2BMKB 2IAMA 2A9MH 1NBZB 1X5JA 1FYTD 1QQDA 3BEVB 3LN5B 5B8CB 1NSNL 4ESKA 1HYSD 1MCFA 1YEEH 4KPHH 1R6VA 2V5RA 1XR8A 4RA3A 4ZTOL 1TZHB 1BFSA 1YMHB 2VDKH 1G7QB 4AIZB 4OFYA 4Z7WE 2R0LL 3U46B 1HK6A 3L3DA 4GSDL 4LPVA 4UTAL 5C6TH 2ICWJ 1I3VA 3NCYP 2HLFD 4QRQB 4MVBD 5DA0B 1VEMA 5DVMA 3QJFB 2IANA 1OLLA 2X4PA 4TVPD 3TO2B 1EO8H 2VDQH 4M3JA 3MGTB 1JUFA 3SDDA 4GBXB 2ED8A 2ZJSL 3QEHB 4YDKL 1SJHA 1TPXC 5DJDB 5JNYB 2ZUXA 4PRAA 4X6BA 4Y5XA 4G6KL 4LNRB 3IF1A 2NW2B 4O5LH 5DMIH 1WICA 1XF4B 2FX9L 3CGTA 3VFWA 1TZIB 2H26A 5F6HJ 1ZVHA 2Y25A 1DVFC 5F70A 1KTKE 3QH3A 1LO3H 4ODXB 3IAPA 3CFKA 5HHPB 4NBXB 5ERWB 4AG4H 4FFVC 3MGAA 5T5NF 3LKPA 2D3VA 2DQUL 2O5ZH 3VJ6B 5I1AB 3UTZA 1JJUA 4DFIA 5IROA 4OTXL 1X5XA 5D7IE 1M7IB 3MXWL 5DRNB 5HYSB 4TTDD 2CDFA 5FB8A 3BPLC 3ETBF 3QQ3B 4RAUB 3BP5A 4N8PA 5E94B 5EZLA 4XP4H 3ARDD 5FV1L 4QCIA 2P5WD 5H2BA 1FHGA 4QGTA 5CINH 3EYUH 3SKMB 3DVIA 3FFCE 1DJSA 1I1AC 1DQLH 1BVLA 4P9HH 3IFPB 3FN9A 1V3MA 3QAZB 1HSAB 3LV3B 4ZPTA 4K71B 5EOCH 3QYCA 1HHIA 4OFVA 1MPAH 3ARYA 4KK6C 2FATL 4HG4J 3TIEB 2X89A 1D9KC 4HWZA 1F3RB 4I0KA 5KVMC 4UQ3A 2J5LB 2CIIB 3ILPA 2D31B 3MRGB 5I8KH 1R3KA 1U42A 3O41A 4M9PA 1HILB 2MJWA 5DRWA 3N85L 3QCVH 4L8SB 2CLRA 3BXNB 4JHWL 3RZCD 1YN6A 3X3GL 2FLRT 3SPVB 4ODWB 1FNSH 3MNZA 2G9HB 2V7HB 5HYQB 4HH8A 4P2YA 4IHOB 4D0BA 3MRCA 3FQUA 1FZKB 4HWNA 1AE6H 4L4TD 3X12B 1X5KA 1V5JA 1C7SA 4RZCA 4X6CA 4EUPH 5HYJD 3LZFH 2VN7A 1MF2L 2KQNA 2FX7L 3O3DB 2CO7B 1CXHA 1QBAA 3CX2A 1D6EA 5DR5L 4C56D 1G6VK 4MDJA 5H37H 4K3HA 1Q38A 5GIRA 3VG0L 1B4JL 1S78D 4EI6B 5SX4I 3QNXA 1T04A 2RGSA 1IAKA 4N9GA 4N0FB 3OJDB 4PJIA 3RPKA 4JHZA 3OAZH 4H5SA 1YN7A 3RWCB 1K6QL 4ZODA 5E00B 1I7UA 2HN7B 5D71H 2WP3O 4PJ5B 2X4SB 4Z7QF 3D39B 4MCZB 1HOCB 2EDWA 3SGJC 3P9WB 4U6VH 4HS3B 3WLBB 5IB1A 3DBXB 4WTXA 3O2VH 5DJ8A 4Z8FL 4NQXA 5AAMA 1CU4L 5IEHB 3F7PC 5F96L 4ACPA 3O6LL 2LU3A 3G04A 4OCSH 2W65A 3QFJE 5GGQH 1I1FA 4PFEA 1H8SA 1OAZL 1WITA 5A2JH 1G7JA 3A0OA 5IESL 3GRWL 3SGKA 5ENWA 4N9OB 4M61A 3P4MB 3X14A 4IOSD 4BQ9A 5KS9A 3BKMH 4OF6A 2WK2A 4Z0BL 3LAFA 3O0RH 2I24N 4JN1L 2AK4D 4OI7A 1IVLA 3KJ4B 1ERNA 4NDMB 3TGXA 2H2SC 4YO0A 4QXUH 1IGCH 3C87A 4FP8H 3D9AH 4HIHA 4ONHA 1TVHB 2PW1A 5C0CA 2ZSWB 3S5LG 3T0BA 5DHXB 5EUOA 4U1MA 4DKFH 3EFFB 4LCUA 3CDGA 3GSUA 3IGAA 4YHOL 2ZP0T 4KKAD 1M4KA 4MA7H 2DIJA 3VH8B 4UV7L 1WT5A 3MLSH 3B5TA 4YHNA 4K2UH 1OT2A 1OW0A 1P7QB 1I75A 3EFDH 4WI4A 4LPXA 1XT5A 3PIQB 4JN2A 2HVKB 4P4RB 3ARUA 2J8UF 1QSZA 4JFDB 4YEFA 1YY9D 3VCLB 3SKOB 1NC2A 5EUKB 2ED9A 2F19H 2AXFA 4YUEL 3KPRD 1EHXA 1G9MH 2W91A 5EBMB 5DMKA 5SWQA 1EGJL 3QP3A 3WIHH 2CGRH 3SCMD 2PXYA 3OKOB 4YDIH 2VZOA 2ICES 4WFFE 3R1GH 5MEPB 2WANA 1P4IL 3RVWD 4KI1A 4Z7QE 1Q9LA 4IOIA 1CIUA 2B5IC 2ZUQB 5I1LB 4WUUD 4Q2ZA 2AXHA 3M1BA 1NFDB 5E8DL 1AI1H 1HXYA 4TUKL 1S7XA 4M8QA 3BZDA 4LU5H 4Y89A 3DURB 4OQTL 5TH2A 3UROR 3HI1A 3HE6A 3NFNB 4HJ0C 1TJHL 2EZ0D 1FSKC 1GGTA 4G9FA 1ODAA 4OLXH 5ISZA 3MRBA 2F53A 1QSEB 2NXYD 5KAQF 4OT1H 3VGFA 4XAWH 2J12B 4XI5D 3VFPB 4Y4FB 1QFWM 5IB4A 2YR3A 3MLVL 4GBXC 1MFCH 3RWGB 1PY9A 4F9PC 1G7IB 1UXSB 5GRZA 4CVZB 3D69B 1F4YH 3EOTL 1AO7A 2YWZA 5EZOH 1K3ZA 5KW9L 1P84K 3RAJL 2QKIB 4GAJL 2W9EH 3HNTH 3NH7H 4LAQH 3DVGA 1DUZA 5BMFL 4MNQB 2ID5A 3INUH 1KJMA 4NYLA 4J4PD 5C07D 3T4YA 5C2BH 3SGEI 1D6VL 1OL0A 3BSZL 2H8PB 2Z9TA 3T0ED 1IGMH 2J8UE 2QSTA 5E6IA 4OCYH 3S3PA 2CRYA 4LKXA 4U2YA 2W9LA 4Y19A 5IIEA 4O2CB 3D3VE 3W0WD 2ZG2A 2PYEB 2R2HA 4X8JB 1S7QB 3RKDD 1IAIM 5C0IB 3MACL 4Z7UA 1E4KA 3RY4A 1RU9H 3E6HA 4G7YH 4YE4H 4AEIH 2GSGA 4MNHA 1FZOB 3IXAB 1NGWA 3QAZC 5GHWH 3R06B 4WEMB 4L9LB 4K71C 4YHKH 3SQOH 4I3RL 5BXFB 5EIIB 4JEGB 4I13B 3JV6B 1NCUA 1RJLB 4LCCC 1PJ9A 1FH5L 4PJFF 1DSFH 2DQEL 4WW2A 1DBAH 1EAPB 1YEIH 1JPGA 1K4DB 1WIUA 5CBEA 4HD9A 1T1XA 4KJPC 3BZ4A 4F7EA 1J0HA 1AR2A 4DKEH 4HUKB 4KK5D 1LO2H 5ITFB 3TIDB 4EDWH 4Q9CA 3VH8G 4CN4A 5TF1L 4XMPH 1OP3K 4D8PA 1KCVH 3IETA 2IQAB 1MHHB 1EK3A 1M7DA 5JZ7C 2FZ3A 2H9GB 3MLZH 1EFXB 2X1XR 3FT4A 1PW3A 5CHNA 3TH2T 4G8EB 3WDJA 4L8DA 5TQ2L 2HRPH 3B43A 43CAB 2X9XA 1KJ2L 1KGCE 4QHMA 1JGUH 5EOQH 4GW5B 2EKJA 3DRQB 4R0LB 3FO1A 1F42A 1G7LB 1LQSR 4MJID 5ACZA 4X6DB 3C60A 4G8GE 2Z8SA 1HINL 2DM7A 2X9YA 2ZKHH 2RQ8A 1UM6L 4FQJH 3DUSB 3GMOA 1A9EB 3VG9B 2QL1A 1DQDL 1IGIH 1N4XL 3TPUB 5L2JB 5I30L 4XC3H 1RHHA 2OCFD 4JJ5A 4ODTH 4JPIB 1KV3A 5F88A 3AGVA 1KN2L 4BH7A 3RTQA 3KWWA 5TDPA 3KPNB 2AABL 1I8LC 5GISL 4LSUH 1HHKA 3CFEB 4MA3A 2BY2A 3TBSA 4KHTH 4BSVB 1EMTH 4CADB 5J3HD 1QR1B 2P7TA 2Q8AH 1JNHB 5SWZB 1NUNB 1XAUA 1U8NA 3MV9B 3KYKL 5K9JH 1GCFA 3VFGL 2Y5TA 3O6KL 3MRLA 4PGCB 5ADPL 4J1UA 3QUXA 3QIWB 3VWKD 2RR3A 2X4RA 5K9OA 1LO5A 3L5JA 1RIHH 3MBEB 1R5VB 1FL6B 5C08E 3P4NA 1Q8MA 4NO5B 4PJFE 2R56L 4PJEB 3WN5B 1OCWL 4Y4KB 5I1IH 4YHZH 4WO4D 1JZ2A 5HVWA 4EQ3A 2EIZA 1OWRM 3IDXH 1Q1JH 2E9IA 2I25N 4DK6A 5DJYA 1JGVL 1KPRA 1T5WB 3AS1A 5DD5H 2F54E 1Q72H 1BQLL 2DQIL 3IAGC 4ZXBD 1YMMD 1INEL 3KPMB 1KT2A 5IBTH 4L3EE 4YPJA 1Z0NA 2M2DA 3F6IA 4UDTA 4NNPL 3U0WL 5F7UA 5IHLB 3VRJA 4PRIA 3W39A 4B53A 3SE8H 3UTSB 4M5ZL 3ALXA 3SE9L 2Z0BA 1P84J 5CEZD 4HIEA 1U8PA 3BESR 9CGTA 2X42A 2QQLH 1NCDL 3OZ9H 1UM5L 2H41A 1J86A 2DQHH 5T1KA 4F58L 1WZMA 1T5XA 5DGRA 1LE5A 5CUSL 4R4FL 2EIDA 3QNYA 4KZDL 1N7ML 1NANH 4BM7A 5IMKB 2ZUQC 4HPOH 5J12C 4JLRA 5EBLA 5AYQA 4HIXL 3KHOA 3C5ZD 4XPBH 1I9RH 5DEFB 3B2UC 3NN8B 2VNCA 4H0GA 3D0LB 1ZMYA 2KZ1B 2ZZUT 1HNFA 5DRZA 3ZDYF 4AM0A 3LEXA 1C08B 1HDMA 5C9KA 1JFQH 3JWDC 4TVPL 2DIAA 4CDHA 1DVFA 1L0YA 2Q86A 5IQ9A 1A7PL 3QXDA 2X10A 1F11B 5IF0B 3WLWC 3KPOA 2WAHA 4S1DD 4NO3B 5F8RC 1AKJA 1QEWA 2DQCL 3HC3H 3GMPB 3F5WB 4JPKL 2OZ4A 5HGGS 2YPLD 3MO1B 2D2OA 5KJRH 4Y4FC 1IILE 3BKJH 3S96B 1JZ6A 4I3SL 5J11B 2D4DA 3V0WL 3S35L 1QD0A 4N0UE 4FZ8H 4GRLC 1J12A 1DL7L 1N0LA 2GITB 4OCRH 2BVOB 1P1ZB 4C58B 1XGYL 1J0YA 3T3PF 5EC1A 3PGDB 3KJ6H 4WEUD 1UWEH 2A77H 4ZFFB 5ESVB 3I02A 1I1AA 5IMLA 3JZ7A 4FMFA 3U4BL 4F7CA 3EUUA 3LSOB 4WU5A 1TTFA 1FORH 4OLVL 3FZUC 3N1FC 4XBPA 1BLNA 3CNKA 1JPTL 2VSCA 3FO0L 3PP3H 3TYGL 3T65A 4LARH 3M45A 2C26A 1N64L 4NHUA 2AS5M 4D9RD 1FYTE 4PJ7B 3VI3F 1AJ7H 1MCEA 4Q97A 3GSNL 1HZHH 1IEHA 3MJ7B 3HCVB 3LS5L 3LPGA 2H1PL 3MRJB 3B9VA 3HA0A 5B39G 4ORGA 1LE9A 2EYTB 3EW3B 2ORBL 3V0AC 5T1LB 3FB8A 1NUDA 4OLUH 5JHDD 1CQKA 1V3LA 3VXRD 3BIAX 5DI8B 2VZ3A 5I15H 1GOGA 4D9LL 3MJ8B 3RIFK 4KKBC 1N6QH 1GJIA 1GGUA 4TVPE 5IW6A 4L9LC 3EOBB 3PQYD 3OKDB 5ICXB 1NL0L 5KSBF 4RFNB 1G7HB 4MD4A 3QUYB 3QUKA 1A6PA 3ZDYE 1U91A 4KVCH 5ANME 1OF2B 4ZUWA 4X80L 1Z9OA 3R8BB 4OD1L 1RJYA 5E8EA 5FHAH 4OFKA 4RAVB 3ELAT 4RNRA 2AJUH 3GZKA 5IB2A 3OB0H 4H88L 5C0FB 1CFNA 4MCYB 4MNGE 1G1YA 1I8MA 4JG0H 5JHLL 4PJBF 1U3YA 3QDAA 2NY7H 1RZ7H 1GIGH 2UZIH 2R69L 5D1XC 2E27L 4XP6H 2O5XH 4PRHA 3O3EA 4R26L 1DBML 4XX1G 4JZNB 5E2VH 4JG1L 4GW1B 4ZAKC 5ABDE 5EZJA 4IRSB 1RIUL 3H0TA 4P5TB 3DJ9A 3T3PE 4P4KB 5DJCA 1UCBL 4GAYA 3PDDA 4P2OC 2ITDB 4R0LC 5KVEH 4ENEC 4E41A 1U8OA 1XCTA 3TCXA 3PDGA 1YEHL 4TTGA 2P5WE 1TMCB 3QEGL 1MAMH 5IVNA 3G6AA 1GL4B 5IJVA 1BF8A 1E6OH 4JRWA 4O9HL 4LP4A 4WEBH 3D85A 4LLYA 4MGXA 3MUGB 1MY5A 5T1MA 4KI5D 3UTPD 3L9RB 4HH9B 3VI3E 5KSAB 2O93L 4S1SL 4NQDA 2GJ6A 3DXAA 4RISH 3DSFL 4OD2B 5TE7L 4PJGF 1FNHA 4ONFL 1JHLH 1MUJA 3MLRH 2PW2B 5FEBA 4OCWH 1CGYA 1F8TL 1CD8A 1RUPL 1FZJB 5ICZB 2I9LB 3HG1D 3FT2A 4M93B 3SE3C 1YYLH 2AKRA 1RSFA 1ZA3B 3RDTD 5JQ6H 5DURD 2IH3B 4L4TE 2E7LA 1I4FA 1B9ZA 1TQCB 1U93B 4CW1A 4KJQD 3FKUS 1ZLSL 2BERA 3QIWC 5CJXC 4APQB 5KSBE 5HYJE 2NNAA 1K3IA 2VXUL 4MXQC 3MBEC 4Z78B 4X98B 4ZO9A 4ZS6C 3WFDH 3G6JA 1BAFL 4C56E 1T89C 3CIQA 4Y4KC 4P2QA 1BGXH 3CU7A 2GFBB 3LRGA 4HDIA 3VXNA 1N6UA 4AIOA 5BRZB 5E4IA 4MX7B 3C2AH 1MCWM 4PJBE 1ZHNA 3V6FB 5GS0C 1T0MB 1VGKB 2MCG1 1RK0A 1NANI 4WI5A 3F7YA 3I6LD 3SDAB 2CKBA 2BMKA 4OZHB 4PBVC 4O00A 5SWSD 1NBZA 3BEVA 5B8CA 3NA4A 5IHUH 2XY2A 4EIGB 3L5WB 3MV01 4YXHL 2HTLC 2EO9A 2NX5D 4QTIL 1TZHA 5DA4A 5EA0H 1YMHA 2FHFA 5EG6C 3TNMB 1GPOL 1G7QA 3D6GA 3MCKB 3JUYA 4I0PC 1UG9A 5ESAB 3QI9B 2Q20A 1JWUA 3S88H 1FIGH 3U46A 1RVFL 4HWUA 1FAIL 3ZT6A 2OR9H 1R0AL 2FO4B 4K7PL 1N5AB 1KPVA 2VDNH 3V9FA 4KGLA 1G7MB 2H45A 1PLGH 3QJFA 5F1IA 5BV7L 3HR5B 3GMMB 3TO2A 4HGKC 3AROA 4JO1H 1BBJA 3WUZA 4LHUD 3P9LA 1VFBA 3MGTA 5AG8A 1Z3GL 5DD3H 4FOMA 4GBXA 1IEAA 3MLUL 2MMXA 5HI3D 4F9PA 4TQEH 1NGZB 4X5LA 4PJGE 3O6FB 4V1DB 5DJDA 5GS1B 1XIWD 2I07A 3GHEL 3BGAA 3OL2A 4LNRA 1AR1D 1VB9A 2NW2A 1A5FH 4M7LL 3RP1A 1FL3A 1S7RB 2AK4E 5F8QC 3S5LA 3T8XA 4FA8A 1P2CB 1TZIA 2QSQA 4TN9A 1QYGH 2ICEB 5GGRB 5ALCH 3BMVA 2BVTA 4ODXA 1IC7H 2X70B 4NQCB 1YNLL 5HHPA 4ZSOE 5ERWA 3MA9L 3KPLA 1JV5B 5JW4N 5I1AA 4BJLA 5F7FA 2NY6D 4H0HB 3V2AR 5CCKH 3FOLA 1M7IA 5DRNA 1U8KB 3U7YH 2IH1B 3O8XD 3QQ3A 4UT7L 1L4IA 3P30L 5E94A 3QO1B 2FEDC 4PTTB 4M7LT 5F3HB 1RZFH 7FABL 1DQMH 4DAGL 4N8VG 4MAUH 1JPSL 3SKMA 3IJHB 1F90L 3KPRE 4F7PB 4QOKD 1RZJL 2YXFA 4XHQA 3OB8A 1ZLWH 5IT2H 1NDMB 2IAMD 1HSAA 4LSQL 3LV3A 3FMGH 5F93C 3OGOE 1CG9B 4K9EH 5BS0B 4WUUE 4EJ1C 2ARJQ 2LTQB 5JO5B 2FD6L 4U2ZA 4HBCL 4BQ8A 3TIEA 3OAYK 4XPGH 1JK8B 5DJ2A 1LDPH 3OR7B 4LEXL 3MRGA 2CIIA 2D31A 1CF8H 2YD3A 5DD0L 1HILA 4YC2C 5D2LF 2EDDA 3BXNA 3SPVA 2B4CL 1QHOA 1J0JA 2V7HA 1A7NH 1JPST 5HYQA 1DEDA 3G5ZA 4IHOA 2ZNWA 3RZWA 1FZKA 4PRPB 1I3GH 2EXWC 1W8NA 3X12A 1EEQA 4PLJD 4WI9A 1QHPA 3FT3B 3ILQD 1WFTA 2EDRA 2IAND 3U9UA 3WSQL 4KDTC 4XAKD 3NCBB 4JO4H 4M1DH 4K3JL 1RUQH 25C8H 2BP3A 1DBBH 3O3DA 3SDDD 2NPLX 4PJ8B 4UDUB 2FYYB 4GFTB 5HI5D 4RFNC 1JZ8A 1A7BA 4WNQA 3QUYC 3P2TA 1A3LL 5L9DH 4QRTB 4N0YH 1AY1H 3TFKD 2J88L 4EI6A 4MAYB 2XWBB 1KB9K 3MA7B 3S3SA 2VAAB 3OJDA 2NYYD 3ZKXC 5I71B 3JSSA 5ILTL 3QUZC 3B83A 1KJ3L 5C07E 4PJDF 4H8WL 4PJ5A 2X4SA 3DX6B 1HOCA 2R0WL 4CN1A 4R9HA 3T0EE 3WLBA 4EOWL 3DBXA 3T0AA 1QLFB 3K8MA 1X5LA 5IEHA 1YEDB 5FF6B 1I8LA 3W0WE 4PV9B 5B38B 1CXIA 12E8H 1T03H 3NGBB 3EYQC 2B7DT 5F9OL 5E56A 2CXKA 5FUOL 4W6XB 2UVEA 5BOPA 3TC9A 3PWJB 5DJ0A 4DUVA 2ZUVA 3PL6B 3DIFB 1S9WB 3BD5A 1ETZA 3IT8D 5TDOB 3SKJL 3P4MA 5KSAC 1I85A 1JRHH 4XCFH 3W5NA 3KR3L 2OL3L 2EDTA 2F5BL 4CVWA 1A4KA 2X89D 5D2LE 2HVJB 1IGFH 4NDMA 1AC6A 4O02H 5E2WL 1A6VH 1SY6L 5HYIA 3GUTB 1U3HB 3BRDA 3U2SB 4I18B 1MAJA 1Q9OB 1DTUA 4GRWB 3CDYA 3IDJA 3GIZL 3TH3T 4Z7OF 1IC4L 3WDHA 2HT4C 5AWNL 4QRPA 1CDJA 2FH8A 3VH8A 3LCYA 3BZFB 3DX9B 1OPGH 1TCMA 3DETC 4XWOD 5E4EB 1P7QA 1TQCC 4NP4H 3KPPB 4PY7A 4APQC 4M7JH 3PIQA 2HVKA 4P4RA 2IPTL 4RFEA 1HXMA 4JFDA 2WBJC 3VCLA 4Y4HB 4ZUSB 4Q6IB 5C6WH 2AV1B 3VFSA 5IJKC 1CFSA 5A43C 5EUKA 4UOJA 3GMQB 1YNKL 4ETYA 5CFHA 1F2XK 1UM4H 5EBMA 3QRGH 5CZVH 4P46B 3Q6FA 4MJIE 4J8RB 1WBYB 1V7MH 4PJDE 3SDAC 4M02A 3STLB 1Y6KR 1JGDB 4WW1B 1CT8B 4NWTH 2EEBA 3UJTH 4FTVB 3HRZB 4Q9RH 5CEZL 2A83B 2VKXA 2Z8RA 1NFDA 5D9SA 3MPCA 4G5ZL 4MQXC 5DHVA 5IKCA 5I1JH 1FRGH 4TNWK 3BE1L 3DURA 2R29H 4XNUL 3KYMB 2A9NL 4CVXB 5L6YL 1NC4B 4OIAA 5HGDB 3O4OC 5JW3L 4JY5L 3S3JA 4P2RB 5ALBL 3B2VL 1QSEA 1EVUA 3MGOA 3S4SB 4NQSB 2ZOLB 1G6RA 4Y4FA 3BD4A 1OAUH 4X7SL 2CR6A 4NM8H 2ADGB 1UXSA 4GRLA 3O6FC 3D69A 5GS1C 2G60L 4X9GA 3H6JA 3Q3GB 3RU8L 2FJGA 4YXKH 1LEGB 2QKIA 3QBTB 4MD0B 2E8ZA 4YHLL 4Z7OE 5C0CD 3RWEA 4MNQA 3RRQA 1CLCA 5C3LD 4ONOA 1WLHA 2EO1A 1J8HD 2YXMA 4UBDD 5A16B 5FUZL 4HQQH 2IBGA 3MRDB 2EDOA 4L29A 3HAEB 2H8PA 3TT3L 1CE6B 1BQHG 1VADB 5FDYA 2CDEB 3C6LD 4TYUA 4UT6L 1YMME 5MI0B 2XXMB 3MCLH 3QSKB 3QIUB 2KPNA 4X8JA 1S7QA 4DGIL 4HW6A 5CEZE 3V4VL 1YNTA 4M62H 2H2PC 5DD1H 3K46A 1U6AL 4FFYL 3V6ZB 2PXYD 2DWEA 1FZOA 2M1KA 2G75B 3RIAF 4TSAL 3R06A 3HZVB 2JB6B 4L9LA 2BNRB 5BXFA 5DF0A 4YDJB 1X4YA 3P77B 3PWPB 3JV6A 1RJLA 1GSMA 2E7CA 4JM2B 1ACYL 3VGAB 5EIQA 2GI7A 2WQRA 3CUPB 4AQ1B 4EI5D 5CS7A 4FQPA 5GGSY 3HE6D 4QTHB 1OGAB 2YD6A 4U49A 4C4KO 4CMHC 3HMXL 4U3CA 3KPQB 4PLOB 4G9FD 4HT1L 1XGTB 2PUQT 3HRPA 4BFGA 2F53D 3O81A 1G9NC 5IOPA 5E6YA 4P99A 3FB7B 1F58L 1D7FA 2MHAB 1DBJL 5ITFA 1MJUH 2YPLE 5HDQL 3ISWA 3EBAA 3P0VH 4P3CH 2XT1B 2IQAA 4PJ8C 1MHHA 5E99L 1MCPH 4ZAKA 4LCIH 2H9GA 3MNWB 3LMJL 1AO7D 43CAA 3I2CL 3MUZ1 2VZVA 4PP1C 1BZ7A 3OXRB 1PG7H 4GW5A 2R4RH 1BVKB 2GCYB 2GJZB 3DRQA 4MAYC 4P2OA 1YA5A 3A6CL 1MCBA 2BSTB 4MJ2A 4R0LA 4JREC 4N5EC 1G7LA 2YN5A 1GGIL 3S36H 2J7LA 2JIXB 2WBKA 3NFSH 4YIQA 3VWJC 5ETUB 4GRMB 1V8HA 4ZFGL 3PE9A 1A9EA 2R0KH 3CVHL 1XGPB 2HFGH 5D5MB 3UPAA 3VXTB 2P43B 3D2UD 2NLJB 5BO1L 3UC0L 2Z31B 5L2JA 3EOYG 2X5PA 3U0TA 3MOAH 4K23L 2DRUA 1HH9B 4KRPD 5E6ID 4KI5F 2V6HA 4D9RE 3UYPA 1X7QB 4Y19D 5B39A 2A9ML 3KPNA 2E3VA 1AH1A 1YPZA 5CD5D 2ZCHL 2VXVH 3NOIA 4EXPX 4PP2B 1YEEL 4KPHL 1SHMA 5DHVH 4BSVA 4CADA 4JFZH 5HD8D 3SE3A 5B21A 3ARQA 3NGBC 5E1HB 1YZZA 3U7WH 3ZYIA 2Y1VA 4R7NB 1QR1A 1KYOJ 4LASH 3HNVH 5FO7B 2VDKL 1JNHA 3J7HA 1HEZA 3MV9A 3ZMRA 5JHDE 3STZA 5JIHA 2I26N 3VXRE 2P5EB 2DAVA 4PGCA 3QIWA 5CJXA 5EO0B 5C6TL 2EYSA 3OSKA 1KIQB 1A7QH 1FG2B 3MBEA 1G6RH 1R5VA 1FL6A 3PQYE 4WHCA 5EU4B 4NO5A 1IMHC 4PJEA 1T89A 2CH8A 1EO8L 2VDQL 4JFEA 4Y16B 5F7NC 3FRPA 4BQCA 4Y4KA 5EC2A 1RUMH 2E6PA 1HHHA 1IAOB 1U3HC 3QG7H 4H25B 3I50H 3VE0B 4BA8A 4OZFB 4M9OA 1IJ9A 3KYOB 4N8CH 4PPTA 3BUYA 5D70H 4O5LL 5DMIL 1A0QH 5K59F 5E4EC 4Z7NF 2C9AA 3KPMA 5DK2B 1E6JH 3D0VB 1LO3L 4M1CD 1N5YH 3UTSA 1J1OH 4Y4HC 4AG4L 4I0PA 2HT2D 4PJAF 3GJEB 3C5JB 2O5ZL 4UB0L 5FCSH 4J3VA 3CLEH 4UNUA 4I5BB 1OTUC 3RNKA 1N3NB 2VLLA 2JCCF 1D5IH 1UACH 4KMTH 4P46C 4LQFH 4YPGB 1GC1C 2AK1H 4M43H 3UPCA 1CD1B 2J4WH 4JGUA 1GVIA 1U3JA 4LPTA 4XP4L 3HB3D 5IMKA 2D7OA 4XHJD 4ZOBA 5CINL 3EYUL 4DGYH 4KI5E 3PWUB 3UTPE 1DQLL 4P9HL 3ME0A 1WC7B 5DEFA 4P9MH 2KDGA 4OGAC 1IT9H 3NN8A 5D1QB 5H8DA 4ZTOH 3D0LA 1S9YB 4L8BB 4PIRF 3RTQD 1CDGA 1OSPL 5D7JB 2A6DB 1BOGB 1CGXA 4M7ZB 1TVDA 4KMLB 4QKXB 5EOCL 3KG5A 4HF5H 1KCLA 1MPAL 2CRMA 3HZYB 4R7DB 4JZOA 1F11A 1CDYA 3GB7B 4D3CH 5IF0A 3HG1E 4NO3A 1U9KA 4Y2DC 3GMPA 4A6YA 3F5WA 5EOTB 3TVMB 4C4KT 4CU7A 4XPFH 1FNSL 3S96A 4YJZL 1JYXA 3QUXD 1CE1H 3OAUH 1AE6L 4NN7B 2VDRH 3LN4A 4JRXB 4ZO6A 5D7IB 3G5VB 2GITA 5F71A 2BVOA 1P1ZA 2IQ9H 4JRYB 3OX8A 3O2WH 1ORSB 2XA8H 3LZFL 2YRZA 4UTBH 3PGDA 1QR4A 1E27B 4RIRB 3UTOA 1L0XA 2Z4QB 4N0RA 4ZFFA 4XCYB 5ESVA 1J0IA 2ZOKA 1ES0B 3U36B 3GSQA 4OFPA 3FFCB 1T2XA 2HYMA 5K59E 5IBLC 2FO1A 4Z7NE 3I6LE 1MCIA 2IMMA 5SWSE 1DE4B 2XWTB 3GSOB 4PJ7A 4Y1AA 4RGOH 4HUUB 5MI0C 4PJAE 1T7YA 4PRID 4XP9H 3MJ7A 2NX5E 3HCVA 4MS8C 1XF3A 3QIUC 4S1QH 1K8DB 4PREB 3CXHK 2JCCE 4ERSH 2EYTA 3HPLA 4U6VL 4UQ2B 1A2YB 3SO5A 5I1DB 5T1KD 5T1LA 3LEVH 3O2VL 4FQ1H 5DI8A 1AD9B 3LPFA 3MJ8A 3TO4B 4LVEA 4KDTA 1JNNH 3WUWB 3NIFF 4OCSL 2V2XA 4YFDB 3OKDA 2CMRH 4JFPB 2OXGA 4ZUVA 3WD5H 1G7HA 3VXUB 3QUYA 1OD7A 4JM2C 4X83A 1OF2A 3REWB 1IZJA 1Y0LB 3BKML 1XCQB 1DVFD 3I3EA 5C0FA 1CDUA 3G6DH 4MCYA 3OGCA 3QUZA 2VC2H 5LXGH 3SJVB 5T3XH 1AKJD 5ELIA 4QXUL 1IGCL 1NBQA 5GS0H 5A2FA 3D9AL 4FFVD 4ZS7H 1IGYB 2FH6A 4JZNA 2F15A 4DKFL 3IJYB 4GW1A 4XGZB 1KEMH 3BP4B 4MA7L 2D7TH 3MLSL 5CJOH 4P4KA 1MEXH 4N8VA 4K2UL 4QHUB 5HGBB 3EFDL 2ITDA 1D3CA 5CD3B 5LCVL 5IVOA 3QIBC 1JVKA 3CFDB 4RRPG 2XZAH 1I1AD 4O2EB 3M17B 1FFOA 3HC0B 4FABH 4QOKE 5AYUH 2F19L 2UY7A 4UILH 2AJZB 2C3HA 3IFLL 4RGNB 1G9ML 1IKFH 1GHFH 3UAJC 3AS0A 4HH9A 5KSAA 3WIHL 2CGRL 4YDIL 4KK6D 3R1GL 1D9KD 4KY1H 4OD2A 4GT7A 4P23B 3K0WA 2PW2A 4KQ4H 4OV5B 2D7QA 4UU9B 4JFQA 5ICZA 5F7EH 2I9LA 4G9DB 5DC4B 3WNKA 4EDXB 1AI1L 1QVOB 2BZDA 5DZLA 2W0KA 1ZA3A 4LU5L 4MQ7B 2PF6A 4U3XA 3S6CA 3NIFE 5ECJE 1MFDH 8CGTA 4CU6A 2IH3A 4K3GA 1FBIH 2G2RB 5DJZB 4GLRH 4U1SB 2IANE 1KIRA 1EJ6A 4XAKE 4APQA 2Q76A 4OZGB 4A6YH 4OLXL 3L6FB 4Z78A 4X6CF 2I27N 4X98A 3HC4H 5HY9B 4XAWL 1QZ1A 4CBPA 4Y16C 3RGVC 1ONQA 2C3WA 3F12B 1LP9A 4X6EA 2GFBA 4G8IA 1MFCL 5BRZA 1T0MA 5F7DB 1F4YL 3LKSA 3ZDZF 2UUDH 4MLIA 3ARTA 5KSVA 3SDAA 3GDBA 4LLWB 6CGTA 4PJIF 2ATKB 2W9EL 3K8KA 3BUTA 1B0RA 3HNTL 3NH7L 4LAQL 5EU5B 4PRHD 1JF5A 3L5WA 2GT9A 3INUL 4J3OC 2YUZA 4Z76B 5C2BL 2IPKB 4KVNH 3VD4A 2ESVB 3TNMA 5E6ZA 2DLFH 1QLRB 3RL2B 1A14H 5ESAA 5B22A 1A6TB 4Y5VC 5EU7E 1JWSB 5IBUB 3VFTB 4U0QB 1YEFH 4OCYL 4E41D 1N5AA 5FUCE 1EGJH 1G7MA 4XH2B 2JB5H 4LPYA 3B9KC 3N50A 4U6TA 3CPLB 3ARVA 1JGEB 1T0NA 1Q9KB 4X4YB 1AIFB 5C0AD 1RU9L 5KSUB 4G7YL 3O6FA 4V1DA 4YE4L 4NQDD 4AEIL 5GS1A 2GJ6D 3DXAD 3OPZH 2J6EA 5GHWL 2H2SD 3MR9A 4JDTH 5D7JC 5KS9F 4M7ZC 4PBXA 2VXSH 4YHKL 3RWFB 3SQOL 4BSWB 2NXZB 3MV8A 5C3TA 2ADJA 2V2WB 4NQCA 4QT5B 5INCB 2P49B 3C9NB 3TVMC 3DGCR 3JVGC 1DBAL 1YEIL 5EUOF 4KK9C 3RQ3A 4X6CE 4QO1A 3C8DA 2HH0H 1M6OB 3MLVH 3QISA 1HKLH 1B0WA 2P45B 3ZYOA 4NN7C 5F7WC 1U8KA 4GG8B 5HHNB 1AGDB 4DKEL 4W81A 1TVBB 3D3VB 4DKDC 1LO2L 4EDWL 4PTTA 5F3HA 5KW9H 4P2QD 4WDIA 3UXFA 3W82A 4XMPL 4GAJH 1BVZA 4P48A 3ZDZE 1KCVL 3GMNB 5EFIA 3IJHA 3MLZL 3QWQB 3SKUD 3PGCA 4LLMB 3T3MF 1D5MB 4PJIE 2HRPL 1KUMA 3ROOA 2AV7B 1JGUL 3K7UA 5EOQL 1NDMA 1VEPA 2XA3A 1CI5A 1NJ9B 3U9PH 3MBXH 1CG9A 5BS0A 1QFPA 5I2IA 5AUMA 2BVEA 5JO5A 2ZKHL 4LDLB 2RB8A 3TBVB 1L6ZA 4FQJL 4GUPB 5EO9B 3OKLB 5E5MA 1JK8A 4YGAB 4NC0B 1IGIL 3HR6A 3PP4H 4NRZB 3FONB 2YC1A 2D9CA 2YS4A 4XC3L 4HJ0D 4ODTL 2DMKA 5FGSA 1ZHBB 3GSWB 4L1HA 1F6FB 3T2PA 3FB6B 1DQQB 5J7CC 3VFVA 3N0PB 2OTWB 1UYWH 3S8WA 3TO4C 2GTZA 4LSUL 1H8OA 1U8JB 5EOCJ 5DO2C 4JR9H 4Q9QH 1R3HB 4KHTL 1EMTL 2YPKB 1JPFB 3B5HA 4XXCC 3ARPA 3QEUB 4GBXD 4PJ8A 2FYYA 3S35X 4X7FC 2Q8AL 1E4WL 5K9JL 5F89B 5KS9E 1CTNA 4QRTA 2W0LA 4GKSA 1C16B 4RA0C 4MAYA 2XWBA 3MA7A 3PWLB 3W81A 2VAAA 5DVNA 1RIHL 4G8GB 5I1GH 4IOFC 5C0CE 1HWGB 3VWJA 4G80A 5I74C 1A47A 4KHXH 4UT9H 5I1IL 1BQHA 5EUOE 4P2CG 1RV6X 3RHWK 3L3KB 2ADFH 4YHZL 4V2BA 4WRLA 1J8HE 1T3FB 3VFUA 3JTTB 4N1CA 4YBHA 3IDXL 4XCNB 1Q1JL 3O3AA 1C5CH 5D8JH 5D1ZB 5GSRB 5DD5L 1QLFA 3FAWA 1Q72L 1YEDA 5FF6A 5JUEH 4PV9A 5ID0B 3WHE0 5B38A 1CICB 3WV0A 1KCUH 5IBTL 3TZVB 1YQ2A 1BP3B 1BWWA 2EIBA 3EJYC 3BIBX 3BPCA 3T3ME 1MLCA 5IBUG 4QNPF 4L8CB 4HIIB 3TCLA 3PV7A 1U2HA 3BEWB 2VL4A 2D9QB 3PWJA 1UM6H 4L5FH 3F8UB 4GLRI 1KENH 3FCTA 3PL6A 3DIFA 1S9WA 4Z7UF 5IVZB 4B0MM 2QQLL 3OZ9L 2DQHL 1T7WA 4RGNC 5TDOA 3AAZB 2VDOH 2DWDB 2AJ3B 1PGRB 3C6SB 4HWBA 5C08B 1NUFA 1YECH 2HVJA 4P23C 5DMYA 4LLAA 5I6XB 1WWBX 4LF3B 2O61A 1CTOA 4HPOL 3GUTA 1U3HA 3MRFB 3U2SA 2AABH 4DFHA 4QYOB 1EHLH 5CWSB 1Q9OA 2BOCB 4XPBL 2J6EH 5LQBH 4NO2B 5JPMB 3PHQA 1INQB 2P44B 4KJPD 2NY0C 4G9FE 3BZFA 3DX9A 4PV8B 4WW2F 1KJ2B 2LVEA 2F53E 1JFQL 2UZYB 4UNTA 3AU1B 3IRZA 4DOHE 3KPPA 3IDIA 4PGEB 4U6YB 1PY4A 1KIPB 3VXMD 4JDVB 4AJ0A 4WUKH 3HC3L 5JZ7D 4Y4HA 4ZUSA 1MWAA 4Q6IA 5BJTB 5KJRL 2WNGA 3BKJL 1BFTA 3GMQA 4ZO8A 1AO7E 4X6FA 3E6FB 2UWEB 3RJDA 2YD9A 2Y7QB 4L4VB 4P46A 4J8RA 1WBYA 4Q6YA 1WCQA 4OCRL 1KB5H 2CLVB 3STLA 5DSCB 1TETH 1L7IH 4WW1A 1CT8A 5JXAH 3KJ6L 1ZGLP 3EZJB 4FTVA 4N1EA 3HRZA 1F4XH 1OAYH 1UWEL 2A77L 2A83A 5FO9B 4PJ5D 1H3VA 3HE7B 4U1HB 1LK2A 4FS0A 3L3GB 4PJ9B 2IWGA 5GGVL 5SV4A 3VDCA 1FORL 1WUNT 4NQEB 3TV3H 2IF7A 4Y19E 4HJGB 1J0KA 3H8NA 1NEZB 2OTUB 4LARL 2L7UA 1NC4A 3QHZH 3CC5A 5CP7B 5D2NC 5HGDA 4QNPE 1NCDH 4HCRA 4OF7A 1AJ7L 2YD4A 2OYPA 1HZHL 4V2CB 2QHRH 4Z7UE 5MERB 1WCBB 1G0XA 4MXVF 3GSVA 5DMJB 1DLFH 3EJZC 4OLUL 4F9LC 1G9NH 4POZC 2VZ1A 2WUBH 3MREA 5DWUH 5CJQH 5I15L 3Q3GA 1N6QL 3EO1B 2F74B 2NY3B 2B2XH 1S5IH 3BW9B 1LEGA 3SBWC 1HE7A 2Y72A 5M94B 2HRLA 4FXKB 3D5OF 5E8PB 2NXZC 2H32B 4KVCL 4HGMA 4PBWD 3O9WB 4QRPD 1F6AB 2BVUA 3QPXL 5A16A 1BFVH 5FHAL 5L88H 4D0CB 1CE6A 4LPUA 1P7QD 3WYRA 1VADA 3C09B 1AXTH 2CDEA 3QNZA 4PUBH 1JZ7A 5FA3B 4I3SH 1KIUA 3V0WH 1FYTB 4JG0L 5DYOB 5DDHB 5F97E 4MJ6B 1WK0A 1RZ7L 1H0DB 4XNQA 1GIGL 3QIUA 2UZIL 4PR5B 5KG9B 5CAYB 1K8IB 3FQNA 4XP6L 2APXA 2O5XL 2V7NA 4RMUA 2Q87A 4ZNEA 1XGYH 3IJSA 3MYZA 5L2KB 5E2VL 4LVOB 4WTWA 4Y8AA 3U48A 2F8VA 2X7LA 3NABH 4K7PX 3V6ZA 1U8MB 2RJMA 3CZFB 1CR9H 1U8QB 1F00I 2XZCH 4NIKB 4ZTPH 3CSPA 4Q7DA 3AS2A 1MRFH 3WFEH 3MFFB 4OLVH 3SGDH 5KVEL 3HZVA 1MHPH 1UA6H 2BNRA 4ZQKA 1T20B 3LKOA 1MAML 5CIPH 1E6OL 3P77A 3PWPA 7CGTA 3B2UD 4WEBL 4JM2A 1BECA 1AC0A 1IQDA 3AUVA 4XVTH 3BFOA 1E4JA 3TBTB 5C0GB 3KYNB 5ANMB 3LS5H 3CUPA 1P4LB 4JCMA 4U3HA 4D0DB 4QTHA 1OGAA 1RD6A 4RISL 3GJFK 1AQDB 2E7HA 3WLWD 4MXVE 1A1OB 4ALAH 1XGTA 1JHLL 3MLRL 1QSED 4OCWL 5F1SA 3FB7A 2MHAA 4Y4FD 3NAAH 2YK1H 4YR6B 5GGVY 1YYLL 1ZA6B 4NJAH 2BC4B 2V2TB 3MNWA 1MCKA 5JQ6L 4GRLD 4G6MH 2HWZH 3RWHA 3OXRA 1BVKA 2IFFH 2GJZA 4BYHA 1NDGA 1R5IB 3HI5L 3GI8H 1D5ZB 1MWAH 3ARDB 2JIXA 4MNQD 4CKVX 2P5WB 3WFDL 5ETUA 4GRMA 3D18B 5I9QC 3GMLB 1FNGB 2YWYA 1XGPA 5D5MA 3FO2B 1BGXL 3LHPH 3FZUD 1IQWH 4F7MB 2NLJA 3PP3K 5DFVC 1GC1H 3C2AL 1HKFA 2Z31A 5IGXH 3MRNB 4KDVA 5D1ZC 4MDIB 3TN0B 4F37F 4G6FD 1X7QA 2A1WL 1ITBB 4PRIE 2AEIT 4FQIH 5IHUL 4CMMA 1IE5A 4OD3H 1W8OA 3WO3B 3TZVC 5CKGA 3HUJB 5DUMH 3RZCB 1MCOH 5HDOA 1YEHH 1O5DT 4R7NA 3CJJA 5EA0L 3BP6B 3VD7A 3QEGH 4EVNB 5BQ7B 3OKMA 3DYOA 5ID1B 3WCYA 4KKBD 2P5EA 3S88L 1FIGL 1WFNA 4L4TB 5FM5M 4NRXA 5FKAB 2OR9L 5EO0A 2BY1A 1SYSA 3LRHA 4HKXB 2VDNL 1FG2A 4UIKH 5HYJB 5EU4A 3BKCH 1OHQA 1PLGL 4QHNB 3WJLC 1EJOH 2NCMA 4Y16A 4AENB 4JO1L 5J6GB 3RGVA 2DKUA 5I6XC 2PETA 5DD3L 2NY4B 1QNZH 3CLFH 4F7TB 5JTWA 4H25A 4JFYB 1QRNA 3ARGC 1NPUA 4TQEL 3IDMA 3VE0A 5HJ3A 4JO2H 2EDQA 2XICA 3OB0K 4PJBB 1H3GA 3NTCH 2B1AH 4HUMB 3HZKB 4RMSA 3B9AA 3MJGX 3W2DH 1A5FL 4FXGB 1VFOA 5D1XD 1QYGL 5DK2A 5ESQB 3L3IB 3D0VA 4UIMB 5ALCL 4YDVB 1ZK9A 1WFUA 3N1PC 1IC7L 4GKOA 1MHEB 4ZAKD 3QZWB 3VFOB 3AC0A 4QRSA 3C5JA 4FQQA 4Y5VA 2DIBA 3QUMH 4NN5C 4YDLB 3P9MB 2C1OA 4I5BA 4P2OD 4ENED 4F80A 1S9VA 5CCKL 2P42B 4YPGA 3U7YL 1NCCL 1TENA 3B9KA 4PGZA 3TT1H 4ISVB 4W6WB 1RZFL 3CH1B 1DQML 3BPOB 1HHGB 4MAUL 3DTXB 3PWUA 3BOVA 3HE7C 4DVBB 1BIHA 2F58H 4OF3A 4PJ9C 4PJGB 1A3RL 1P6FA 5FYLD 1KLUB 1P5VA 1S9YA 5IT2L 3FMGL 5D7JA 2A6DA 3RY6C 5KN5B 3QWOB 4HV8B 5GRYA 4K9EL 2WIMA 1MCHA 3DV6B 2HJLB 2MSPA 3HZYA 4R7DA 5EZIH 3GB7A 4XPGL 3S34H 3IDUA 1LDPL 4QY8B 1NLDL 1CF8L 5I8CA 5EOTA 3TVMA 3MV9D 1BF2A 3JVGA 4RQQA 1MCWW 4YHYB 3VXQA 1Z3GH 4KRMB 1A7NL 1ZOXA 3QIWD 1FZMB 3ULSB 1MJJB 1NGQH 3BWUC 4MXQD 1I3GL 3MBED 3ULVC 1NMBH 4JRXA 5JORB 3V8CA 3PWVB 4ZS6D 4RGMB 4M1DL 4JO4L 1ZHLB 3MJ9H 1F4HA 4JFED 2BDNH 1ORSA 1RUQL 25C8L 4FQHB 4JRYA 1UQSB 1DBBL 4Y4KD 1E27A 1R3LB 5T3XD 3U82B 5J06A 4XXDB 1ES0A 3G6JF 5GS0D 2E7BA 4JZJB 4HWEH 3V5DB 3KPRB 3RWDA 5L9DL 1AY1L 3SGDI 4DGVH 3O9WC 3SCMB 1BX2A 3BZEA 1DE4A 1I8IB 3C09C 3GSOA 1XF1A 1PSKH 4PRHE 2HTLD 3EOAB 4HUUA 1K2DB 5GGTA 1BPVA 3UTSD 5HHXH 3WEXB 5BV7B 3FJTA 4C54A 1T1YB 2O5YH 4I0PD 2R9HC 1K8DA 4PREA 2Y06H 3OJ2C 3ARBB 5GGSA 7FABH 1QSFA 4PRDA 4LVOC 1A2YA 1OD9A 5I1DA 2VDMH 2ZCKH 4E41E 3DLQR 3TO4A 3MRQB 3FOMA 1E4XH 1U8HA 4ONGH 3SKNB 3OBAA 5KOVC 2LQRA 3LRSA 4PS4H 1AD0B 12E8L 1T03L 4XXCA 1C5DA 3FQWB 4JFPA 4DN4H 1VGEH 1CDHA 1J9CT 3VXUA 4NGHH 1PYWA 5C0AE 1PX3A 2VR9A 4NQDE 2GJ6E 3DXAE 5JPNB 1Y0LA 3BHBB 5MEOA 5DZNA 2CRIA 3HS0B 5C0BB 4BFIB 4FFWC 1WIPA 4LIQL 1BBDH 5I75B 1NMCB 1IGFL 2HKFH 3SJVA 4O02L 1A6VL 2FSEB 2X1PA 2PTTA 2WWKO 2DICA 2VE6B 4WGWB 4BUHA 1IL1A 5CGMA 1IGYA 3X11B 3VDAA 1SBBA 2Z91B 3IJYA 5E8NB 1QPPA 4ELKB 4XGZA 1JGLH 2QLVB 3BGFB 3BP4A 4TNVK 3WKMH 3L7FB 1HN1A 1Z0MA 4IIQB 4E42B 1X4XA 4JQIH 4OLZH 2FEDD 4QHUA 3ECBB 3W0WB 2Q7YB 5JR1H 3G6JE 4M7JL 1DLHB 2IALA 4P2QE 1FVCA 3CFDA 2DQDH 1MFAH 1NBVH 4O2EA 2YRPA 2HFFB 3ES6B 3M17A 5DK3A 2AI0L 1ZLWK 5FM5O 5B4MC 4IRJB 2AJZA 1FC1A 1UM4L 5BVJA 1U2CA 2FRGP 4M1GH 5TDNB 2HJKB 2L0DA 3QRGL 2ZCLH 5CZVL 4FQXB 1B90A 1P5UA 1V7ML 5CMAB 4Y1AD 3TN0C 1EXUB 4DZ8B 4P23A 2IC2A 5DVLA 1N26A 4FRWA 5D2LB 4NWTL 1FVEA 4OV5A 5KANI 1Y6NR 4Q9RL 4UU9A 4YBLB 1EEZA 1XF2B 3UO1H 4EDXA 2IBZY 1QVOA 3MNVB 3T2QA 3IKKA 2FIRT 2BSRB 1JN6B 5I1JL 1FRGL 2EXWD 2R29L 4KH2A 2YA1A 4DVRH 5DJZA 1OVZA 2ATPB 5FGCB 4OZGA 2YUXA 3QCTH 4M6AA 3L6FA 4LIQE 4J3TA 3T09A 4HZAA 3KR3H 5HY9A 1AFVH 4I0CC 2EYRA 3QUYD 2F5BH 2CLZB 5TGBB 3F12A 5E2WH 4NN6C 1OAUL 4J3XA 2NY4C 4NM8L 1IFHH 5F7DA 1OARH 3ZYZA 3ZE0F 3LB6C 2CDGB 4X99A 4MJIB 3QUZD 5EDXA 1FAKT 1IC4H 5AWNH 4MD5B 4YXKL 3ZKSD 5FOBB 2LVCA 2ATKA 3E3QC 5F1OB 4NKIH 4Z76A 3HKFA 4WFHD 1XF5B 4NZRL 2ESVA 4F15B 1QLRA 3RL2A 4HQQL 3CCHB 4I48B 3ULUC 1EA9C 4Z7VB 5GGTH 1UH2A 5D2NA 3RY5A 2V17H 1DN2A 3X13A 5IM7B 3MCLL 4XNYH 2OL3B 3EYQD 1UB6B 4JAMA 3IFOB 4XH2A 3U4EB 5J1TC 3WE6A 3MV7B 4I77H 4R4NC 3FB5B 3BPOC 3CMGA 4M62L 1A6WL 3LKNB 5DD1L 3MROB 1J8KA 5KSAD 4F9LA 4PRNB 1AIFA 1RZIB 2WWMC 4L3CB 3HI6H 3EYVB 3I6KA 1T6VN 5E5UB 2XTJC 3SBWA 2FB4H 3RWFA 1A6ZB 4JPVH 2NZ9C 4JHBA 4ZDHB 4XNZC 2V2WA 4OCXH 2HT4D 5INCA 4EKXA 5IK3B 5AZ2H 1LEKB 3WBDA 3DETD 4OZ4B 3MLWH 4YHYC 1CYGA 1DUYB 1T0PB 1ZGLA 1M6OA 4APQD 2WWKT 4QXTA 4Y0GA 3BH9B 1YMMB 5AD0B 4BKLB 1FGVH 2WBJD 3VXME 5HHNA 1TVBA 2XN9A 3D3VA 3CAFA 4WV1B 3TF7C 2PN5A 1BD2B 1JZ5A 3P0VL 4HHAB 3ZE0E 1EFQA 1JI2A 1NGYB 5T3ZH 5HPOA 2DQFA 3GMNA 5BRZD 1MCPL 4LCIL 4JZJC 4LLMA 4OKDA 3LQZA 1E4XI 3U7AA 2AV7A 5D7KD 3SDAD 5KVDH 1PG7L 2R4RL 3NACL 3ZKQD 2XKSA 2XZZA 4P5KB 5J13B 4RMQA 4Q74A 4WJ5B 3S36L 4WENB 4PJ5E 3NFSL 1UWXK 4GUPA 4M6MH 3VXSA 3OKLA 3U4AA 1J5OL 2R0KL 4MQXD 3QWRA 3BI9X 3Q5YA 2HFGL 1X4ZA 4NRZA 3BVNB 2KQMA 3FONA 1NFDF 4PB9H 3NBNA 4QRUB 3ARBC 3MOAL 3TYFB 1ND0B 3WMSA 4GMTH 1K5NA 3GSWA 4U1IB 3UYRL 1DQQA 1A7OL 2OTWA 4HG4K 2VXVL 3DX7B 5FO8B 2R1XA 2VERN 1R3HA 2YPLB 3IDYB 4E9LA 4JFZL 2YPKA 1JPFA 2BSSA 3C60C 5AEAA 1TTGA 1SYVB 5E2TH 4Z18A 3U7WL 4LASL 1EEUA 3HNVL 5C0DB 4OI8A 5FYJD 3O6FD 4V1DD 3UTQB 5C09D 1YJDH 5K9QG 1WWAX 3NCEB 1C16A 4GW4B 3DGGB 1IARB 1HHJB 3PWLA 4KZEH 3U6RB 4KWUA 2IGFH 4YNYB 3X3FL 4MSWB 1A7QL 5KBNC 3I9GL 1G6RL 3MV8D 4G8GA 5I75C 1NMCC 3QDJB 1JHKH 1TNMA 4XB8A 1RUML 3O3BB 3F58L 4H1LB 3QG7L 1T3FA 4QRPE 3I50L 2QR0B 3C5SB 4G42B 1FC2D 4XCNA 1YEKH 5HDQH 1DBKH 3T2OA 8FABB 3V6BR 5D1ZA 2IADB 4IDLA 5D70L 1I8KB 2R15A 1A0QL 3ESVF 1MI5A 4IIQC 1FLRH 3EYOA 5ID0A 2JKXA 2LU4A 2AXJA 1W0WB 1E6JL 2F9BT 2XI9A 3TZVA 1FO0H 2PO6B 3DMMC 5CP3A 2H2PD 3O45B 1N5YL 1J1OL 1UVQB 1RUAH 2DJSA 4Z77B 4L8CA 4HIIA 3HFMH 3BEWA 4XVSH 3WHXB 2RIKA 2C3VB 5JHDB 3CVHH 3CLEL 4M6OH 5IVZA 3VXRB 4IRJC 2HFTA 1GH7A 1OB1A 4LVNB 2B4CC 5BO1H 2DWDA 1QO3B 3W9EB 5BS0D 1D5IL 4NSKB 3RPIB 1UACL 4KMTL 4FQXC 2AJ3A 2AK1L 2ZNXA 5J1SC 3C6SA 3M8OL 1T4KA 4M43L 2X4UB 3PQYB 5C08A 5HHQB 3WJLA 2J4WL 1NFDE 3PGFH 3PABA 4LF3A 2F8OA 1XR9B 3MRFA 2P48B 2ZCHH 4DGYL 4QYOA 5F6IC 3ARGA 5CWSA 1SVZA 3QQ9C 4YBLC 2BOCA 1A1NB 4P9ML 1IT9L 4LCYA 3AY4C 2ZUYA 1AGEA 1INQA 1NAKH 1C5BH 3ZYJA 2YSSB 4IBLT 2XXCB 4GKZB 1QSEE 4Q9BA 3AU1A 3QEQA 4YFEA 4HF5L 2AEPH 1Z9MA 4IS6B 4PLKC 4PG2C 1Y6MR 1KIPA 4D3CL 3OXSB 4PJ8D 4YAQB 1CFVH 3L95A 3ZT7A 3RWJB 4U0RB 35C8H 5BJTA 1OP3H 1WZKA 3TWCH 3MRHA 1IKNA 4HS8H 4XPFL 5GS2H 3WIFB 5DC0A 4PP1D 4LCWB 4MAYD 2UWEA 4ZUTB 1M1SA 1CE1L 4N5ED 3OAUL 4NRYB 4U1KB 1F5WA 2VDRL 1X6LA 4L4VA 4EBQH 4WVRA 2CIKA 2FJHB 4MNQE 3VWJD 2IQ9L 4HPYH 5DSCA 3O2WL 3FTGB 2XA8L 4ZFZB 4I1NB 2VR4A 4UTBL 3CXDH 3H42H 4EN3B 2Z92A 5I73B 2GSIB 2YPVH 5FO9A 2X2YA 3HE7A 2XG5A 4U1HA 2VLRB 4P59H 3L3GA 4PJ9A 2HAZA 3WNNA 4XMLH 4NQEA 1EEYB 3ROLB 4F15C 5I1EH 2FEEI 3RY6A 4UB0H 1AGFB 5CP7A 2D7PA 1VESA 2Q1EA 5HBBA 3QQNA 4XNMB 4GAFB 2ARJB 4N1HB 4M6NH 4RGOL 1I9JH 4JVWA 1YPZF 5HPMB 4XP9L 3VGHA 3HG1B 2LFGA 3AXLB 4ELMA 1WCBA 4S1QL 4XP1H 2FL5B 4ERSL 4XCCH 3ZKMC 1KJVB 3L7EB 1I9IH 4LEOB 3LEVL 1B3JA 5J9PB 3VDBA 3MLXH 5EORH 4FQ1L 2YA0A 4KUCD 3B6SA 3S97C 4LFHG 1JNNL 3EO1A 3UCRA 1S5HA 4B5EA 3BW9A 4OJFH 1OSPH 3SGEH 2AEQH 5B3JF 1U3HD 2Z35B 4I8DA 2CMRL 4HXBH 5HHVH 2C7UB 3WD5L 3QT2A 5I18H 1UEYA 2H32A 1S8DB 4M4PA 1WBZB 3O9WA 2RBLA 1KF9B 1F6AA 1QFOA 4HK0B 4D0CA 3V0VA 3UJJH 5SWSB 2ZUTA 3G6DL 4H1LG 3BPNC 5FA3A 2VC2L 5DYOA 5LXGL 1OTTC 5DDHA 3BT2H 4XCEB 3VRLF 5T3XL 1H3TA 1UFUA 4PJAB 1NQBA 4U1LB 4Y4HD 5GS0L 2CK0H 5KG9A 2NX5B 1PDKA 1L0QA 2BVQA 4ZS7L 3VFRB 4WFEE 4R4BB 1I3RB 1ZXQA 5L2KA 2JCCB 1OTUD 3K2MC 4JFFB 1KEML 1U8MA 5DS8A 4P46D 2D7TL 5HDBF 3CZFA 5CJOL 4UNVA 1MEXL 2EE9A 4XNXL 1U8QA 2Y07L 2VTFA 4ETQB 1LEIB 5CP3H 4DUXA 3MFFA 5CZKA 4UUJB 2WM0A 1R3JB 2RFXB 3KAAA 4FTVD 1KPUB 1T20A 2XZAL 2GTWA 3GKZA 2JJVA 1XFPA 4OGAD 1SM3H 5DVKA 4FABL 2EH7H 4MZ2A 5AYUL 3HZMB 4AEHL 3TBTA 5C0GA 3GI9H 3KYNA 4UILL 5ANMA 3U1SH 3JV5A 5FYLE 2P24B 1P4LA 1IKFL 1GHFL 3ZSSA 4KKLC 1NC4D 2YEZB 4D0DA 1YPZE 1F3DH 2EDYA 3O4LB 1WGOA 1CGSH 4KY1L 4Y2DD 4KQ4L 4EUPB 1U92A 3MODH 2GAZB 3EAKA 5F7EL 4ZFOL 3MV9E 4YR6A 4G8FB 4IMLB 3MOQA 2DTML 1V3JA 1R24A 2N1KA 5J6HB 3VA2C 1TJIL 1ZA6A 2BC4A 2V2TA 2YUWA 4ODVH 4NNYA 2NY6B 1FFPA 1MFDL 2XKNA 5B3JE 1FBIL 5HHOB 1FG9C 1I9EA 4QHLB 3WS3A 3F6LA 3MMEB 4JFEE 4A6YL 4AIXA 4HC1A 4FQCH 1MHCA 3SY0B 2ICCA 3RVUC 2GYSA 3HC4L 5T3XE 4LSVL 3D18A 1IGTB 5IBLD 3GMLA 1FNGA 3EYFB 3FO2A 1YC7A 4QOKB 1LD9A 3DO7A 2KBGA 3MRNA 4XX1E 1SBSH 3VRLE 1I1RA 4G7VH 4JY6A 3TN0A 4MDIA 3EKCA 2EC9T 4O4YH 4MS8D 3QIUD 4WGVB 2JTDA 3UTSE 2E7LC 1CFQA 4PJ7F 2NR6C 4XC1H 3SDXA 4HX1B 3MRKB 2PO6C 4KKCC 5LCVH 2VJXA 5HDBE 3HUJA 1CD9B 4KVNL 4U7SA 3BP6A 1BWMA 2NY1C 2DLFL 4ZOEA 3MLPA 1A14L 4X9HA 5ID1A 3RI5F 1Q0XH 5F1NB 2E9BA 5HYSG 5FKAA 1DQJA 1YEFL 4LVNC 3IFLH 2X4PB 1JZ3A 4X8XA 4DW2H 2BNRD 4AMKH 4QHNA 2JB5L 1F3JB 1JUFB 4HFUH 3PWPD 4AENA 1SQ2N 4JM2D 5J6GA 2R0ZH 3V52H 1LO0L 1SJHB 3GM8A 1TDQA 3LQAC 5K33A 3VGDA 3ULVH 4NNXB 4JFYA 5B8CC 4PRAB 3P4OA 4X6BB 4Y5XB 1OGAD 4PGDB 1B6UA 3FN0H 3OPZL 3HZKA 2H26B 4GXUM 2AJSH 4U7MA 2XY1A 4UINH 4JDTL 3AM8C 1W72A 3QH3B 2VXSL 4FXGA 1KTLB 2H32H 2VIRA 3CFKB 3BH8B 5ESQA 3L3IA 4UIMA 4YDVA 3LKPB 1MHEA 3VFOA 4LSRL 1LHZA 2KZWA 2D0FA 1PZ5B 3RUGA 3LH2H 1MFEH 4NBYB 2HH0L 2VDPH 1CGVA 3N1GC 2ERJB 1HKLL 2O26U 3QIBD 5KZCB 5EZLB 1CGWA 2JIXD 4QCIB 5H2BB 4DWHA 4BH8A 5J4MA 4NOFA 32C2B 3SQBA 4ISVA 4CRPA 2HLAA 1RZKC 2NTSP 1BVLB 4HBQA 1HHGA 4EN3C 1ZT4B 5I73C 3UAJD 5EIVA 4DVBA 1P69B 3S37H 4ZPTB 4ZNCD 1HHIB 4PJ7E 4Y1AE 5EO1A 5KN5A 2N7AA 3U9PL 1M71B 3MBXL 4HV8A 4HWZB 2P8LB 3DV6A 2HJFB 3O41B 2IJ0C 5DRWB 4QY8A 3UBXB 2X09A 4G6AC 4OIBA 3PP4L 4KJYA 1N0XH 5IHZB 1PZUB 4FQLH 4HUWB 3FQUB 3IDNB 2J2ZA 2DI7A 2P5ED 4WCYH 2MNUA 1TTUA 1CZ8H 1FZMA 4BQBA 3ULSA 1MJJA 3B3IB 1BZQK 5DJAA 3V6OC 3ORJA 2ZUWA 4WI6A 3QDHA 5KVFH 2PR4H 1UYWL 3PWVA 4Y16D 1X5IA 3RNQB 1ZHLA 4LRIC 3RGVD 4JR9L 4NJ9H 4Q9QL 1UQSA 5GRVL 1FNFA 1YYMH 1QLEH 5E08L 1R3LA 5GIRB 2NTFA 1QRND 4XXDA 4GO6B 4JZJA 3QNXB 5FFLA 3VMPA 3V5DA 1LP9F 2EDJA 1FLTX 3MLYH 5E9DB 2J5LC 4HC1H 3EGSB 4AEEA 4PJXA 4L8SC 1I8IA 4KTDH 5HDLA 3K1KC 1UENA 1HYRC 5I1GL 1CDCA 4LGSB 1QKZH 3V5HB 4W6YB 3G08B 4KHXL 3WEXA 4UT9L 4WFHE 2ADFL 4NT6B 3TPKA 1T1YA 3KNBB 3UJIH 5IB1B 3ARBA 5DJ8B 5DJXB 1IGJB 1C5CL 3BMWA 3BYTA 5D8JL 1N59A 4R2GB 1MAKA 1KBGH 2W65B 4KAQH 1TJGH 3B9KD 3GBNL 4XB7A 5JUEL 3MRQA 1FL5B 1KCUL 3SKNA 3IXTA 1AD0A 1AHWB 4LRNH 3FQWA 1OTSC 5BVPH 1MJ7H 2ENYA 3OQ3B 2F5AH 5C0EB 3DVFA 4L5FL 4M61B 1KENL 3VW3L 3X14B 5KS9B 1VHPA 5M95B 1UXWB 2XNAA 5D7JD 3CSGA 5JPNA 1T21A 2VDOL 3O3UN 3BHBA 4YO0B 5C0BA 4LSDA 3E8UH 1YECL 2E7MA 2VLJB 2PW1B 4MA1B 1YUHB 2FSEA 4OAWB 2VL5A 3GMRB 5FA4A 3TVMD 1EHLL 1UB5B 2DL9A 2FECI 1QFWH 1J8HB 2X05A 5LQBL 2J6EL 1WV7T 4KK9D 3GBLA 3X11A 1R3IH 2ZG3A 2Z91A 5E8NA 1YEJH 4ELKA 1W72H 3WNPA 4CJ1A 3EO9H 3RVTC 4Y7MA 3C6LB 4JRXD 3L7FA 1E4WH 2GQHA 4IIQA 4E42A 3D87B 4JRYD 3ECBA 2Q7YA 4FNLH 4YHIA 4U1JB 2YRLA 3DMMA 1LP9E 4WUKL 1I85C 4DZBB 3MXVH 3ULUH 2C4XA 1RZ8B 2A6KB 3FFDB 2AXFB 2HFFA 5BRZE 5TPWH 3G9AB 5DMKB 3CSYB 3KJ4C 4S0TD 5GRWA 5SWQB 3MV11 4CUCA 4IRJA 4W4NA 1CBVH 5D7KE 4OV6F 4HXAH 2VWEC 5TDNA 2HJKA 4HK3J 4KRNA 4FQXA 1KB5L 4Q2ZB 2OP4H 1EXUA 4DZ8A 5CEXA 2AEWA 1TETL 3M1BB 1L7IL 4CAGA 3QHFH 5JXAL 1GGCH 4NQVB 1F4XL 1OAKH 1OAYL 2B1HH 3OAYH 4XRCB 1IAIH 2FJFB 1XF2A 4S11A 2GK0A 4ZD3H 4BQ6A 1QSFD 3NVQA 3DUUA 4EI5B 3AY4A 3QXVA 5TH2B 2FIKA 3HI1B 2BSRA 1JN6A 3TV3L 1C12B 5IQ7H 4NM4H 4YGVB 3TO4D 1S7TA 4FMKA 4IDJH 5GS3A 2FNBA 3QHZL 3MRBB 5DO2D 2F53B 4PB0H 2ATPA 5J1AB 1NCBH 4PG2A 1A4JB 5GRVK 3P4LA 2QHRL 2K7PA 3VXUD 5FYJE 5TGBA 1OSZB 1KACB 4V1DE 3T0VA 5C09E 1DLFL 5BZWB 2WZPD 1G9NL 2E6QA 3LVEA 2WUBL 4JDZA 5DWUL 5CJQL 2CDGA 4IOFD 3MV8E 2QTEA 4X4MA 2BVYA 2B2XL 4MD5A 3SJVD 1S5IL 1QFUL 1RZGA 2EXYC 3LY6A 3T4YB 3VFMB 2VH5H 3D2UB 4D2NA 2DLIA 4NZUH 1XF5A 2GUOA 1TQBB 5T3ZD 1BFVL 4R97B 3CCHA 5L88L 4LKXB 3VD3A 2F8XC 4Y19B 4Z7VA 3A6BH 1AXTL 4PUBL 5JOFB 4YK4B 3V4UL 4QLRA 2ZG1A 2QQKH 2ERJC 2R1YA 4Z6AT 3EJYD 1UT9A 5IM7A 1T83C 2OL3A 3IFOA 3U4EA 2DI9A 2W92A 4TUOB 3MV7A 4M00A 4Z95H 3T0XA 3FB5A 3SDYH 1V3KA 3BJLA 2BJMH 3E6HB 3SOBH 4HKZA 1CLZH 2NW3A 4M7KH 4RGND 3NABL 3MROA 4PRNA 2N7BA 5EU6B 3VGBA 5GGRY 1RZIA 5BS0E 1CR9L 2ZWLT 4L3CA 3EYVA 2XZCL 4ZTPL 1MFNA 4NKDB 5GGVH 1MRFL 3WFEL 4P23D 4YFLI 5HVFB 1OQXA 2X1QA 1MHPL 2BXYA 3DVNB 5I8OH 4R3SA 1UA6L 3MQIA 5FHBH 4KUCF 1A6ZA 1BEYH 3GJFB 2CJUH 2ADIA 2BCKB 2D0HA 1MVFA 2ENSA 2QV2A 4XPHH 4XVTL 4WW2B 1JPGB 5HGHB 2NY0D 4QRRB 1Q94B 4WY7H 5IK3A 1LEKA 3QO0A 4OZ4A 4HWBL 1DUYA 4IJ3B 1NAMB 2Q3AA 3BWAA 1XGQB 3BH9A 4ALAL 4BKLA 3G5XB 2PCPB 2ZUUA 5EBGA 4JQVC 3PUCA 4D8PB 4LSPH 2OM5A 3NAAL 1T7XA 1BD2A 4OLWH 2YK1L 3ZLQC 3R4DA 4HHAA 2V5TA 2DYPD 1NGYA 1X9QA 4NJAL 4KU1A 2X40A 4QHMB 3V79C 3KYAA 3BDXA 1U8IB 5JDSA 4G6ML 1KCSH 3BKYH 2JJWA 5ACZB 3QDGB 2D4FA 3ARXA 4LMQI 2HWZL 3IVKB 4OM1H 2IFFL 4G43B 3QPXH 3GI8L 3KXFA 1MWAL 3FRPG 1MCJA 3SO3B 5DEGA 1MIMH 4WHYH 1II4E 1WZLA 2ESVD 3LHPL 1IQWL 1GGBH 1RHHB 4GG6B 3BVNA 1CLOH 1GC1L 5IGXL 5EU3B 3KWWB 1ND0A 3MCG1 3TM6A 5I66B 3MRPB 5JXEC 4U1IA 5FGRA 4R2GC 3TBSB 2XQYG 2Y36H 3TA3B 3DX7A 5GRXG 1QFWI 4FQIL 5FO8A 4OD3L 1BIIB 4LBEB 3BYYA 4EQ2A 3H9SB 2Q6WB 2P7TB 2R8SH 1K4CB 5GSVA 3EJZD 2BSED 2ZSVA 1LNUA 1MCOL 5DUML 1SYVA 2VXQH 4Y8DC 5C0DA 4POZD 1V7NH 2EICA 3QUXB 4O51A 2X4RB 1MNUH 5K9OB 1BJ8A 1LO5B 3VG9C 2WBWB 2DI8A 4GW4A 4HCRL 1D5BB 3W11C 1VKXB 3DI3B 3P4NB 4YNYA 4LAJH 4UIKL 2NXZD 3BKCL 5GRJL 4BFEA 2D7NA 2V9RA 5CSGA 1EJOL 5F44A 4NFDA 3QDJA 4F3FB 2NY5C 5T5FH 3V5KB 1U95B 3O3BA 1QNZL 3CLFL 1QBLH 4H1LA 5DJYB 2QR0A 4G42A 1KPRB 2WUCH 4JO2L 3NTCL 2B1AL 8FABA 5GS2D 2IADA 5LGHH 1NKOA 4TPRH 1I8KA 3W2DL 3OG4B 1KNOA 4KC3B 3UDWC 2RAMA 1IAII 3UP1A 2XN9D 3VRJB 4PRIB 5DQJB 1W0WA 5I1CH 4CU8A 1M05B 2PO6A 3HI5H 1Z9LA 2OZ4H 1ZEAH 5DMGC 4Z77A 3EZ8A 3WHXA 5T1KB 1MQKH 1CFTB 4UMGA 3WN5C 5MEND 3QUML 2C3VA 1LE5B 1U58A 2EDKA 2I60H 4RWYL 5H35B 1G7PB 3QNYB 5F7MC 1QO3A 1VFAA 1A3QA 4NSKA 1ZKAA 3GEWB 3RPIA 4FTVE 1D5XB 5LKNA 2X4UA 4MB4A 3VXSD 3TT1L 4HIJA 2A1WH 3FL7A 3QWRD 3G9VA 1TPXB 1PBYA 3LN5A 5L7XH 1ACZA 3OTTA 4B7IA 4JM2F 1A1NA 1KSRA 2F58L 2QQNH 4HAFA 2X4QB 1DVFB 5IMOB 3AM8A 2W60B 3QXDB 4AIZA 1J11A 3KPOB 4GKZA 1TCRB 4K94C 5IW3A 2XQBH 1T22B 5EZIL 3OXSA 3TEUA 3KPSD 3S34L 4QRQA 5AG9A 3P0YH 4YAQA 3RWJA 4DUWA 1YY8B 5IB3B 1N8ZB 5JMOC 4PD4K 1DDHB 4LCWA 4ZUTA 3KLHC 3BPLB 1H3XA 1NGQL 5BOZG 1EERB 2CRZA 3Q1SH 1NMBL 3QEHA 2DLTA 3UTTB 4Y5YB 5JNYA 2FJHA 3MJ9L 2BDNL 3FTGA 3I02B 4ZFZA 5IMLB 3ZSTA 5AAWA 1XF4A 2OJEB 4EN3A 4F7CB 4JPWH 2GSIA 5DFVD 2APTA 2FWOB 3O6MH 4LGPB 2VLRA 1BLNB 4HWEL 1OOAA 5D5MF 5D1ZD 1TQBC 3QDMB 1RIVL 3T65B 1ZHKB 4UOW0 4NOBA 4DGVL 1EEYA 2W9DH 4NHUB 3ROLA 5FM8A 4R97C 1HCVA 4OCLC 1MI5D 1D9KB 5HHMB 1AGFA 3VJ6A 4YK4C 5CSZB 4XNMA 1Q9WB 1PSKL 3TZVD 2ARJA 1FVDB 5J11C 4HLZG 2OJZH 4MMXC 4ZNEE 5HPMA 5HHXL 5HYSA 4ORGB 3AXLA 4QF1B 3CSBA 1NCCH 2FDBP 1LO4H 4RAUA 2O5YL 3VMOA 2FL5A 3CFIC 2Y06L 4FFZH 4CGTA 4GMSH 1KJVA 3L7EA 4LEOA 2VDML 1QOKA 3V6OA 5J9PA 1CVRA 2ZCKL 3CK0H 5CLWA 4ZG1A 1NGPH 1GZQB 3SEPA 2BNRE 3BRGC 3IFPA 1A3RH 1E4XL 1FFRA 1JTPA 1WWWX 4LRIA 4NO0D 4ONGL 4PS4L 4MD4B 3RWIB 2Z35A 5DRXB 1TZGH 3ARGD 4DN4L 1VGEL 1S8DA 3BO8B 4NGHL 2HA1A 1RJYB 5E8EB 3P11H 1ZLVK 2V5YA 4FQ2H 1OGAE 4MQSB 1NLDH 4YLQT 2HT3C 3JXAA 3I3BA 1MQ8A 1CFNB 5DD6B 4L8SA 3QCUH 1FNEB 4OFYD 2WLZA 3ARSA 3QEQD 4ODWA 4PJHB 4U1NB 2G9HA 4U33A 2APBA 2XRAH 1KTRL 1BBDL 1HCFX 4H1LH 3RBGA 2HKFL 4U1LA 4JKPH 5E70A 2OTPA 3C08H 2ZPKL 1NCNA 3VFRA 2QQQA 2W1NA 3GSRB 4R8WH 3GK8H 4JFFA 1JGLL 1UJTA 4L4VD 1UKQA 3WKML 5J8OA 4JQIL 1LEIA 3VXPB 4OLZL 5LJYH 3H2WA 1KCRH 4XVUC 5JR1L 4UUJA 1R3JA 2RFXA 3KGRA 1KPUA 3WHE1 4N0FA 2DQDL 1NUGA 5D5ME 2R2CA 1MFAL 5E2JA 1NBVL 3ZTJG 2P8MB 2UV3A 5T1MB 1T1WB 3HE7D 3LIZH 3STBA 3TNNB 3SO3C 5JA9A 3TESA 4K55A 3DUHA 4PJ9D 3RWCA 4B50A 5K9QI 2EDXA 3HZMA 4BZYA 5C0AB 5E00A 5TE4H 4NQED 4JJHA 1OGTB 2GJ6B 2HN7A 4M1GL 1FDLH 2AGJH 3D39A 2ZCLL 4MCZA 3O4LA 3WXWH 2CKBH 1GOHA 5FOJA 1I3UA 4HS3A 5C1MB 1X5GA 1U41A 3MLTB 5I16B 1L7TH 4EUPA 4IRSC 3TA3C 4P5TC 4P4KC 5HI4C 4TRPH 1CXEA 3BAEH 3IS0X 4G8FA 4IMLA 3UO1L 4O2FB 2R2BB 5J6HA 2P5EE 1MRDH 1FE8H 3ULVD 2IG2H 5JQHC 4M4RA 4DVRL 3BN9C 4UAOB 5HHOA 5FYKH 2W0FB 1JP5A 3WFHB 3MMEA 5ACMA 3QCTL 1RUKH 4D9QD 3TLRA 1JTTA 3FN3A 2EH8L 3KLDA 3I6GB 1AFVL 1QRNE 3VXNB 1MH5B 4LIQH 1IGTA 3N9GH 1NKRA 2UYLB 3O9WD 3EYFA 4N90D 4MJ4A 1IFHL 4J3SA 3QA3B 4BELD 1TVHA 3F7YB 4P57B 2ZSWA 1T66C 1OARL 2VLKB 3S36X 4M93C 2B5IB 5C0JB 5E8OB 1RZKH 3EFFA 4PD4J 3JTSB 2EECA 4K8RC 1HQRB 2R9HD 3JUZA 4HX1A 3MRKA 4NUJB 5L2KD 4NKIL 5IVXB 1DEEB 4NPYB 1JWUB 4URTB 4RDQG 3OKYA 3W5MA 3T08A 1FSKB 2L7JA 1CWVA 3SKOA 3QPQC 1KPVB 5F1NA 2AI0H 5GGTL 4Q58C 2EEDA 1X5FA 1OAQH 2V17L 1UGNA 5IFAH 5F1IB 1ZVYA 3TBYB 5A2IH 3GBMH 4XNYL 2A6IB 4JFOB 2ICWB 1BBJB 3P9LB 1VFBB 1REIA 2VN4A 1F3JA 3OKOA 1HH6B 1IBGH 1KYOK 1ZANH 1QP1A 5MEPA 1IEAB 2DLEA 4I77L 5D7LB 5I1LA 3RX7A 2DBLH 1ADQA 4CN6A 4NNXA 1FV1B 2I07B 5GXBB 4FG6C 1FL3B 4PGDA 3S5LB 3T8XB 3HI6L 4FFWD 3REVB 1VPOH 1MIEH 2FEEL 5I1HH 5TF0A 2FB4L 3QI9C 1KTLA 4NFCA 3BH8A 4JPVL 2EDEA 2YD1A 3NFNA 2EDHA 1EBPA 4OCXL 1BM3H 5EBWB 3KPLB 3LS4H 4Y2OA 5AZ2L 4KRLB 4H20H 3VFPA 4JRXE 3MLWL 3FOLB 2AJYH 3DPBA 1PZ5A 4PJCB 3PNWB 3RL1B 4JRYE 4NWUH 3RWGA 1ZVSB 2VXTH 3WIHA 1T83A 1FGVL 5M7QA 5HVHB 1G7IA 4NQTA 3ARWA 4Y5YC 4CVZA 32C2A 4CJ0A 1WBXB 5B4MD 2OR8A 5T3ZL 1ZT4A 3AREB 3NFPB 2X1WL 4NKMB 3UPRB 4BZ1H 1FFNB 3TN0D 5KVDL 1XMWA 2RCSH 4YBQC 2BY0A 4NZRH 4ZUUB 5C6PB 3W9DB 5GRUH 2WINB 1NCAH 1M71A 2BNQB 2DN7A 5DJ2B 4LCCB 1WWCA 2P8LA 4P5MB 2HJFA 1NLBH 1A02N 2FX8H 4M6ML 2YD2A 1QSFE 5CEYB 3UBXA 4O2CA 1E28B 1NCTA 4X4XB 2PYEA 5IHZA 1A7RH 1BREA 4PB9L 3G5ZB 1A6UH 4HUWA 3NPZB 1NC2D 3IDNA 5C0IA 3L3HB 3HMWL 5KOMC 5C7XH 4GMTL 3H9ZA 1A6WH 3U9UB 3B3IA 3ZO0A 1A8JH 5B38G 1NCWH 3VU2A 1JYNA 4JQVA 4K7FB 4X5WB 1MREL 3VXMB 1RFDH 2AVGA 5DJ6B 3RNQA 5J0BA 3K8LA 4RWHA 4OZGF 2OK0H 3IXAA 3VXUE 5IR1B 4RMWA 4WNQB 2NY4D 3VMNA 5E2TL 5EIIA 1NEUA 2LTQC 3LB6D 1HWHB 4MLSA 1YJDL 5E9DA 3EGSA 5LWYH 4KZEL 3MSPA 2IGFL 3SJVE 3MRRB 1EAPA 1K4DA 4OZIB 3U0PB 3V5HA 3G08A 1O7SA 1JHKL 5ISZD 4NT6A 2VR5A 2P8PB 3KNBA 5A40E 4XZUB 3TIDA 3ULUD 3P0GB 5T3ZE 1YEKL 1DBKL 5DJXA 1PKQB 1IGJA 1JL8A 4HEPG 2D03H 5C0RH 5JXEA 4LLQB 3MUY1 3CVIL 4TOYH 2VDLH 1EFXA 4ODBD 1BZ9B 2SEBB 4G8EA 1FLRL 1KCKA 1JNLH 1FL5A 4TSBH 1ZSDB 3U30B 1MCRA 4R4ND 3NACH 1AP2B 1FO0L 4K9EC 1AHWA 1SVCP 3ALPA 5DLMH 4X6DA 4WHTB 5DJ0B 3FQXB 3FHAA 1RUAL 2XIDA 2XWJB 5I71C 1K85A 1H3UA 3HFML 4RGNE 1ETZB 2WWMD 4XVSL 5C0EA 1J5OH 3DUSA 1C8PA 4I2XE 1UXWA 4M6OL 2M26A 2XTJD 4R96B 1H3PH 5AZEH 2EE2A 5E2UH 1A4KB 3TPUA 1GGYA 2R4SH 4WWKB 3RA7H 2NZ9D 4JPIA 2VLJA 1ADQH 1FJ1B 3PGFL 3UYRH 1YUHA 1A21A 5MHSD 4OAWA 4ZPVB 1A7OH 3GMRA 2COQA 3IDJB <