4PRIE

Crystal structure of tk3 tcr-hla-b*35:08-hpvg complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
240
structure length
240
Chain Sequence
SGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSARSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I antigen
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priE01
2Z8VC 3QIWC 2R0WH 5DVLA 1YNLL 2GW5A 1I85A 2ADIB 2DJUA 3WIIH 4LKXB 5HD8C 5JHLH 1S7TB 4J4PD 3MV7D 1YPZB 1A7BA 1MCCA 3QULB 1U8JA 1TITA 3MO1B 5JXEC 1JZ7A 3PWJB 2Y5TA 4WW2B 4CW1B 1A0QL 4U1JA 4Y4FC 3AROA 4YBHA 1A21A 4RZCA 3KJ6L 1HILB 3OX8A 4AH2A 1N4XL 4X8JB 4AT6B 3F7RA 2R29H 1MCLA 1NDGB 3GB7B 3QNZB 3V7AE 4KK9C 3TN0C 1T21A 4JRXB 2YD3A 1FFOB 2VMFA 1OTTC 2ADJB 1MJ8L 4NQDD 1BZQK 2H6PA 2VLKB 4N0FB 1PSKH 2X44D 1RY7B 3THML 4IJ3C 3TCLB 3O3UN 3T0XA 3Q6FA 3O0RL 5EA0L 4ORGA 1YECL 5IIEB 1M1SA 2FIKA 3OGCA 4JM4L 2B8OT 1SY6L 1HH6B 1JTOA 4R4BB 5HDQH 3UBXI 5SWSD 1UFUA 3PXJA 3BZDA 3ES6A 3S96A 2EH7L 2H9GB 4TPRH 1MRFH 1OGAA 1AQDB 3CPLA 4S1RH 5EOTA 3GI8H 2ZOLA 1HKLH 1IVLA 3PWUB 1RK0A 1JV5B 4LDOB 2CGRH 2NY5C 2OCFD 4OT1L 5FAAA 1REIA 3PJSB 4I0PC 5IW1A 2YHGA 3MV9D 3B2UD 1BLNA 5ID0B 2HP4A 2FL5B 2VDRL 4MB4A 3MACH 4S10A 5DJYB 5DRWB 4MSWB 2W60A 4B50A 4FG6C 5ANMA 5A3ID 1DJSA 4LOUD 3ZTJH 5AYUL 2GCYA 1MHPL 1P7KA 1OP5H 3W39A 4DW2H 5HHMD 4M7KH 3G5XA 4FZEL 1XR8A 3HPLB 4MA3A 5CJXC 1QFUL 4HKZA 1HNGA 1N0XL 4N5UA 5JW4M 1FPTH 2DM3A 5I6XC 4YH6A 3Q1SH 4LL9A 4PLKD 5GGQL 5DJDA 3QH3B 1U95A 5D2LA 3MA9H 1LDPH 4PRHD 5J56B 5IWLA 3IU4H 3VRLF 4HUMB 3BJ91 4L4TE 4UNUA 3H3PL 3MLUH 3GSRA 1CICD 4NOBA 4X6DB 4ZUVB 2X70A 4GAGH 3ZDXF 4WU5B 1INQA 3U1SL 4WO4B 1HYRC 4YAQA 4QKXB 1KXVC 1DLFH 3X13B 2FATL 4F15B 2EXYD 4HCRL 1A0QH 2BCKB 1H3PL 5D5MF 1I9JH 5FM5M 1R3LB 3TA3B 3FFDB 3KJ6H 3KPMA 4APQD 5F9JA 1FNFA 2EYRA 1N4XH 1RHFA 2DLGA 4FQXB 4GQ9L 3VG9C 4ZFFB 4OBRA 1J9CT 1ZLSL 4Q9QL 1JGLL 3I84A 1I75A 5IBUB 4O2CB 3UBXA 3LN5A 3K81A 4KKAC 1MJUL 3VG0L 4OCSL 1CLCA 5EC2B 5EWIH 4UOJA 3P77B 3EJZC 1PLGL 1QFOA 1FAKT 4JFOA 4PUBL 1PGRB 1BFSA 3OWEA 2FNBA 1YEEL 3QIUB 2PETA 3TJHD 2AKRB 1XF5B 3MGTA 3P4MB 1A7OL 4XNMB 3RWCA 2Z8SA 5CZVL 4JPKL 2AS5M 2NXYB 3O0RH 4UTAH 3I75A 1PDKA 1VEOA 2B5IC 1YECH 2P4AB 4UBDD 4CDHA 1S78D 3MRJA 1SY6H 2JIXB 2HMIC 1T7XA 2EH7H 1MJJA 2YUXA 3ARDB 5E1HB 4JO2L 3ZE1F 3KXFB 5TPWL 5I18L 4MA1B 1IGIL 1HXMB 3GM0A 5SX5K 2PCPA 2ED8A 5IFAH 3D3VA 4NN6C 4HWZA 3O6FD 3CDGA 4XNQA 3MRGB 1BQUA 5C0AE 2PW1A 4Z7UB 1B2WL 3SPVA 2ENSA 2XFXB 3MUGA 2HFEA 5C9KA 1RIHH 1A7PH 3NGBC 3OXRA 4NYLA 4FZ8L 1I8IB 4I18B 3JZ7A 2X9WA 3BW9B 3SO3C 4PP1C 4EI5A 3BX7C 4Y1AE 5AYUH 2WIIB 1MHPH 3UTSA 5JHDE 1YEHL 3C8KA 5HHPB 3UDWA 1X5YA 4J3OC 4WUUA 3OKNB 4LDLB 5CJ8A 3BKCL 5F7FA 1N0XH 3U30B 1G9MC 2BC4A 1K2DA 1YPZA 2V2XA 3QULA 4KAQL 4TNWF 1G0DA 1V7ML 2HYMA 3LPGA 4KY1H 5GGQH 3FQXA 3MV11 4OV5A 5FO9B 1ZT7B 4ZUSB 4HIXL 4Y5YA 3FFCE 4X8JA 1GGYA 3BPOB 2R15A 3QUYA 3H3PH 1YQVH 3SY0A 4LF3A 3OG6B 3GB7A 5E8PB 4PJIE 4K94L 4I1NB 4DKAA 1WISA 2GJ6B 1MCFA 2VXSH 1UKQA 4ODSH 1MPAL 5EUOA 4X0KA 1ULVA 3VI3E 1YEFL 3G9AB 3QIBB 2BVYA 3W5NA 2FATH 5L9DH 5FYJH 2E6QA 4ZUTB 2BY3A 4MJIB 4HCRH 5GS2D 2NY1C 3B6SB 3A6CL 1VACB 4OIIH 1NCBH 4YXKL 4HJ0C 2A6JB 4GQ9H 1GC1H 1TTGA 3O81A 5HYJD 3BAEL 3ALPA 4K7PX 2CJUL 1LP9F 3CSYB 1RJCA 4X6EA 1ZLSH 3RVWC 3QFJB 5AD0B 3EIFA 3T2NL 5ADPL 4IRJC 4TVSa 1B4JH 3VG0H 4OCSH 1S7WA 4LPYA 3U6RA 2WUBL 2Z31B 5KVEH 3GBNL 3HR5B 1JPST 4PUBH 5IB5B 1FJ1B 3I3EA 4IDJL 2QSVA 3PWUA 1JPSL 5B4MC 1K9TA 3AC0A 1KN4H 1YEGH 1E4KC 5CZVH 3O41B 1OM3L 4JRYE 5ID0A 1CVRA 1WZKA 3C6LC 3VXOA 3AAZA 4OCWH 2XG5A 4PJBF 4OD1L 2X4PB 2QQLL 3C2AL 5I18H 3LQZB 2VZUA 2Y7QB 3MFFB 4KK8C 5EH1A 1IGIH 5IHZB 1ZS8A 4BQCA 2J2ZA 3HPLA 3U0TA 1WWWX 5C0CB 3VU2A 4JE4B 1KB9K 2V2TB 1B2WH 1FVEB 2C3GA 4NQVB 4NSKA 5MENB 2OR7A 5E99L 1MAMH 1XIWA 5CZXC 5J6HA 4HUVA 4MNGA 4GW4A 2F74B 4L9LB 4GH7B 1K8DB 2HTLD 4TQEL 4QRTA 3QJFB 1EX0A 4XP1L 2YD7A 1YEHH 2PO6C 1GGCL 3LKNA 5KSVB 5DVMA 3GEWB 3MGOB 4AMKL 3EZ8A 5ITBL 3BKCH 2WSKA 3G6JF 2NYYD 3LZFH 5F96L 5D7LB 4KAQH 3A6OA 2PN5A 1IGML 3VCLB 1A3RL 1V7MH 3QDJD 4NQEB 4PRIB 3RU8L 3ZHDA 1A14L 2BCKA 3CFKA 2X4QB 1X5KA 3MV8D 5DJZA 3MRNA 3WXVH 1QG3A 3MLXL 3MOBH 1KIUA 3MREB 8FABB 3SCMA 1KJ2L 1KTDB 3NPSC 1CQKA 4K94H 5F9OL 1YY8B 1MFAL 4YXLH 1IC5L 4QRSB 4UT9H 3S34L 4F33A 2P24A 1FL5B 1JK8A 2VXTL 2F15A 5D1XC 1OB1A 1YNKL 3A6CH 3IJYB 4XNMA 4M8VA 4R96B 1EHAA 4YDJA 4YXKH 1V3JA 1KXTB 4NFCA 2NY6C 4QRPB 2B4CC 3BAEH 3RY6C 4PTTB 2CJUH 4JKPH 3RZCB 5SWZD 2EIZB 5KSAD 5HHVL 5H37G 3T2NH 3PL6C 3O3EB 3X12A 4UDUB 1KEGH 4HIEA 2WUBH 2QSCL 1IAKA 3BIKA 3QUKA 2A74B 4UAOB 5F9WC 4PJEB 5DC9B 4F7TB 1L7IL 5LJYH 5SX4I 1OTUC 3RKDC 1UACL 1M7XA 5KSBF 4K8RL 2VL5A 5I73B 3U9UA 4MDJB 5ISZA 3PABB 1FGNL 4OLVL 4Z7UA 1TJHH 5IV2A 2XACC 1OM3H 5K9JL 1ES0B 2ZUSA 2FX8L 2XRAH 3TBSA 2JB6B 3TPUA 4OZIF 4BYHA 2CD0A 4M43L 4I18A 2YA1A 1U8NA 1BEYL 1T7WA 3SKJL 1XGRA 4PJCE 4OD1H 2AQ1A 2O61B 3CUPB 2WIIA 2OTWB 2QQLH 3C2AH 3ZKSD 2DI9A 2X4TA 2J6EA 1N5AA 4OLXH 2GY7B 4HJGB 4LIQH 3W0WE 5C09B 1MCBA 3HE6D 3RPIA 4LCUA 5L2KE 3FT4A 3WL9A 3PWLB 5IW6B 5E99H 4JGJA 4XGZA 3KVQA 3QI9B 5L6YL 5DFWH 3UX9B 1DUYB 5F1SA 2D31A 1HXYA 5FV2A 5ID1B 1OARH 3REWA 3VFPA 3L3JA 1FZMA 3PV6B 2CXGA 1BD2D 4TQEH 4QTHB 3SJVE 4PBVC 4AG4L 1FORL 1JUFB 4PG9A 5E1AB 4ZXBC 3NVQA 3VD7A 1CN4A 2EIEA 4LRIA 4Y4KB 3QPQD 5DD0L 1XCTB 2KH2B 2CRYA 2DLTA 3ULSA 4CAGA 2NTSP 2HN7B 4OCNC 5LKNA 5FYKL 5F88B 4L5FH 4ZAKC 5F96H 4JVUA 1S7SB 4LQ1A 1A14H 2VWEC 1Z6JT 4RDQF 3R8BB 2OL3A 5EBWB 3ZYZA 1HHHB 4JFXB 4JHWH 3MLXH 4Y16A 3ARFC 4XNZB 1RZJL 4WWKB 4X7FC 4YZFF 1L0QA 4LHUG 4UQ3B 2A9NH 5F9OH 1S7UA 1IC4L 2R2EA 4H5SB 3VFTB 1W8NA 5GJTL 4OQTA 3CMOL 1IC5H 1HCFX 3BPCB 1EGJA 3UCRA 1FJ1A 4NRZA 1AO7A 5HHOE 3N1PC 1U3HA 2VXTH 4WUKL 3C8DA 3ZE2F 3CFBB 3L3GB 3NAAH 1MUJA 1JNHB 4QHKI 1DQJB 1TTUA 3O8XB 3OMZA 4MJ4A 5JZ7D 1MHHA 2FJHB 3LKRA 3B9KB 1XF3A 1UWXK 1FLTX 1H3WM 2L4OA 5HSFA 5IMKA 1SMAA 1FHGA 1MI5A 1T3FA 1G7MA 3GSNB 4JFYA 2QEJA 5ETUB 1U8PB 2QSCH 3LQZA 3MFFA 1EIBA 1GOHA 1WQVT 4G9FD 4CMMB 2YZ8A 1DQML 2AK4A 1UACH 3HC4L 1A7QL 4K8RH 2VLJA 1FGNH 4OLVH 3CSPA 5K9JH 3NOIA 5D96B 3KLHD 2FX8H 5B38B 1BZ9B 2Z8WC 2Q6WB 5ALBH 3D85D 4PJ7E 5I1DA 4M43H 4ENED 3NZHL 4OLZL 3GMLB 4UQ2B 1CXLA 3SKJH 3ZKMC 3E6FA 3VXSA 1T5WB 5EBMB 4EN3B 2GJZB 4P3DB 3P9MA 4PY7A 3D25A 5BS0A 3QXDB 4PJDE 3ECBB 1KT2A 3IRPX 2WQ8A 3NCMA 4UILL 4P48A 3CZJA 1ITCA 5DSCA 4M7ZB 1XGPA 1U6AL 4FQ2H 4F7MA 2AJXL 4XCYA 2G5RA 4U1KB 2HJKA 2MSPA 1MJ7L 5EPMB 4GRWB 4NQEA 4S0SD 3MA7B 2E27H 4LHQB 2CRMA 1X4ZA 3MNZB 2YBRA 3RDTA 4NO2B 2ICCA 4OD3H 2VWEE 3AS0A 4I3RL 5T1LD 4RIRB 1J0ZA 3SDCB 2ARWA 5DD0H 5JNYA 2PXYC 1YNTB 4RWHA 2ZZUT 4HZLB 5L2JA 3S3SA 3RTQA 3HG1D 5C6TL 5AAMA 1R6VA 3D39A 3L3HB 5D1ZD 3QDGE 1X9QA 4LNRB 2MKLC 1AGBB 1A8JH 4KJPC 1KIRB 5IVXF 4XH2B 1IILE 5J4MA 1Q8MA 2VE6A 3B3IA 4XPHL 3RGVB 5F6HI 5F7MC 1MLCB 1OGTB 1RZJH 2CDEB 2IADB 2AAVA 3RI5K 3MRIA 4RNRA 3ARBB 1HWGB 3QCUL 5KW9L 4X4ZA 5GJTH 3O3EA 1WC7B 3CMOH 1OAUL 5BRZB 5FGCE 4WIQA 5DJ8B 3RPKA 2A74A 3QWOA 4KTEL 5LGJA 3VMPA 1A7RL 4N5ED 2VR4A 4JPIB 5C08D 1BQLL 2BNRA 5F3HA 3TBYA 3GO1H 2XTJB 2CDFB 1TZIA 1P9MC 3LAFA 4U1SB 4JVWA 1FSKB 2D7MA 2LVEA 4FQCH 3JWDL 2Z92A 1YYMH 1UENA 4G6FD 4G42A 4WDIB 5B8CB 4N9OB 1UA6L 4P2YA 4ERSH 1MCPL 1S8DB 3CXHK 2GIYA 2IMMA 1NBQA 3ZTNL 3E8UL 1DQMH 5IQ9B 4HMDA 3HC4H 4J3XA 5FUCC 2JK5A 4FQQB 4ZPVB 3PF2A 1DUYA 3D0VB 4J6RL 4ODXB 5DTFA 5D7SH 3PHQA 3NZHH 4OLZH 1LVEA 3ARED 4P2RE 4J8RA 4NQXB 2I26N 5MEQB 4D9QD 4LPXA 2YD1A 3K80A 1QR1A 4XCFL 1MQKL 3HMXA 1BP3B 2FD6L 5IFHL 2BVTA 2AEWA 4NCC2 1HQRB 1U6AH 2HH0L 5E5MB 1NAKL 2AJSL 3L3DB 4URTB 1RUAL 1Z5LA 4C83B 1S7SA 4NJAL 3IJSA 1MJ7H 1YEDB 4KMQA 1D5XA 2LE9A 3UTZB 3S8WA 1AI1L 1Y18B 4I3RH 5BV7L 4HV8A 1C1EL 1FYTB 4HK3N 1GZPA 1ZVHA 5K9QG 2GAZB 3LSOB 1R3KB 2OZ4L 3VFTA 1YJDL 5MHSD 3VRLE 1AXSA 2ITCB 4TSAL 5HPMA 4PRNA 4J23A 5DWUL 3IETB 2ZPKL 2C4FU 4S1DC 5C6TH 3PGCB 1BOGA 1D7FA 1CGTA 1TTFA 3P4OB 4FOMA 4ZTOL 1FYHB 1ORQA 1U91B 3ZDXE 2PR4L 1VFBA 3G6AB 3L3GA 5C2BL 4BJLA 1CLZL 2V9RA 4GBXA 4ISVB 4YEFA 4QHNA 1W72A 3O2VH 4OCMC 4I13B 4EI6B 3UJTH 1CR9L 4S1QH 1HN1A 4ZOBA 1B0RA 2YC1A 4U0QB 3KYOB 2UVEA 3VGEA 5D5ME 1TPXB 4LSQL 3QCUH 2W0FB 3S36L 1OAUH 5ETUA 2X4RA 4OUOA 1P2CB 5TQ2L 4E42B 3QWRA 1T5XB 4KTEH 2HFGL 3P2TA 2DD8L 2FO1A 4DCQB 4PJAA 4FTVE 1O5DT 4P2QB 4LSVH 4RGMB 1BQLH 4MVBC 1A6ZB 1J8HD 3FO2B 1R24A 3RY5A 3RBGA 2DQIH 3CH1B 3D3VD 3EFDH 5C0DB 3HS0A 3BUYB 1K6QL 1NFDB 1H5BB 2I9LB 4YX2L 3TZVD 3JWDH 5HYEA 1BFOA 1HSBA 3SOBL 4M1CC 3VWKB 4HKXB 3T0ED 4LARH 3B2VH 5FA4B 3GMLA 4OLWH 2H32A 3V0VB 3OAUL 1T1ZA 2GSIB 4XMKL 4O2FA 3SKMA 2BY2A 3DI2B 1KJ2B 3TYGL 1AP2A 4JKLA 4PJ5D 1YMHA 2DIBA 3TV3H 1I1AB 3U9PH 5JA9A 3ZTNH 1D9KB 3U7YL 1UXWB 4Y5XA 5CEZE 2A0LC 4NO3A 3TO4D 2B1AH 5C07B 3UYRL 1MCRA 1U93A 1ZGLP 1ZLUH 1T2JA 4WTXA 5KN5B 4J6RH 5F1NB 5IROA 4L8CB 5F7KC 3HCVB 3O2WL 2BX5A 4RMRA 3T1WA 1U58A 2VZTA 5I2IA 4X6FB 4Y4HA 3HI1A 2RQ8A 3AGVA 3SDCA 2GHWB 2E7HA 1L7TL 3OAYK 4KKNA 5DZOA 4OQTL 4HK0A 3VGAC 5IFHH 2HJFA 5L7XL 4ZNEE 1I1YA 3AFLA 5TDOB 4OLEA 2HH0H 1NAKH 4RAVB 1DDHB 4FNLL 4JRXD 1DBBH 4NHCL 1RUAH 1HYSC 4ZUUB 1CE1H 1FH5L 2WWMC 1NAML 3ILQC 5DMIH 1EMTL 5K9OB 1CXHA 1QFWM 3WKML 3WYRA 3WS6C 5IJVA 1VKXA 3O4LB 3ESUF 1MREH 4F9LA 2AQ2A 5GJSH 3HZMB 2VLKD 1AI1H 4OSUL 2Q3ZA 3MROB 2DQDH 3SKUD 4X4ME 4Z0XA 3MRKB 2OZ4H 1YJDH 1DE4A 3P73B 4BH7A 4FABL 3BYTA 2P8MB 1FVCA 5DWUH 4HF5H 2ZPKH 1L0YA 4J4PC 3WIFA 2FR4B 1MAKA 1B0WA 4YGVB 2EE9A 4U31A 4KVCL 5D2NC 4NC0B 4XXDA 3FQUB 2ARJB 4DK6A 5C2BH 1SVCP 2PR4H 5HJ3B 4PGDA 4PGCA 1CR9H 2F19H 3DGCR 1CL7I 1BWWA 5I1LB 4QHLB 1CE6B 3S36H 1U8QB 1BVLB 1TIUA 3HZVB 1F6AB 1FG2B 1H9VA 2J6EH 1HQ4B 2Q3AA 5C0FA 1LP9E 1I7UA 2HFGH 4Z6AT 4LHUA 1WBYB 3FO1B 3VMNA 3IFLH 2VN4A 5C8JB 4YEEA 1CDYA 3P11L 4ZPVA 3GSOB 4ONHB 1K6QH 2B1HH 2KZ1B 1VSCA 4ETQB 1QSEE 4Z78B 3DPBA 3CK0L 3QUZB 4DOHB 1WCQA 1JMZA 2FWOA 5E2WH 1P4LB 4XMKH 5T1KB 3W81A 5DJCA 3TYGH 1UB5B 2F53A 3QEQB 5INCA 5ICXA 4LLDB 4PBWD 2J8UE 4OLUL 5K33A 1V7NH 4GAYA 5KVGH 3UYRH 5E5MA 1H3GA 4OKDA 2EYTA 3MLYL 2IPUK 3B2UC 4LPWA 5DFVD 4WO4D 2OL3H 2EDFA 2R0LL 4HGWB 3FB5A 5E2VL 3VA6A 5E6YA 3LVEA 1KJ3L 1SMOA 1WCBA 3TA3D 3ULVD 1IZJA 5JDSB 4Q58C 1JPFB 1JYWA 2WBWB 3BVNB 1OTSD 1L7TH 1ZA6B 4FQXD 3TBTB 1VENA 2VQ1A 4D0BA 4OQTH 3Q3GB 3O6ML 3RX5A 5L7XH 2AJ3B 1IM9A 1EGJH 3DNKA 3BN9C 5JLZB 4FNLH 4NHCH 4NO5A 4DVBB 3R1GL 3C9NA 5CEYB 1FH5H 3H3BC 1NAMH 1SJHB 3NCYS 3P4OA 2I07A 3F65A 3EO0B 1JGVL 1EMTH 3CX2A 5SX4H 1WFUA 3CC5A 2R4RL 2EDXA 3QIUD 2I5YH 4PLKC 2W1NA 4PJXB 4JZOB 4H20L 3C5JB 5D2NE 4JFFA 3ULUD 1F11B 4U0RB 3FTGA 4JPWL 3LHPH 1ZLVH 1MFBL 2NXYD 3AMKA 5CGYD 4DAGL 1MIML 4W4OC 1BVZA 5T5NG 4ZMAT 1X5LA 2ZOKA 2JIXD 1YMMB 1ZGLB 2ZUQC 4OM1L 1JMXA 3ARDD 4PIRF 2X4NA 3VGHA 3KXFD 3QJHA 4IRSA 3IB4A 3QIWA 1KPVB 5MI0C 4GW1A 3MZTA 4ELMB 2JF1A 3DARA 5L8KB 3S5LB 1T89A 5JXEA 4YXHL 2V5SA 2GITB 2C7UA 1WFOA 5FA4A 4L4VE 1SEBA 5BZWB 1NFIB 2OX5A 4G7VL 4NQCE 4OD2B 2VR5A 1T22B 4HH9A 2VISA 3I6LE 5CFHA 1GGBL 4DN4L 4LLMA 3HUJA 5FYJU 2BMKB 3P11H 4LPTA 4UU9B 5ABDE 5KN5A 1T80A 5E4EC 5F1NA 4R7DA 3RVUD 4WFGE 4EUPB 3FT3A 3BP7A 3Q5TA 4ESKA 1LNUB 1NBZA 2CLVA 4PRPB 2VDPH 2ESVB 3OAZK 2XQYG 1FN4A 2BVUA 2N7AA 3E3QC 5D2LF 3HE7A 4MHHG 4D9RD 4OZIE 2AJYL 2JJTC 1X6NA 1MCKA 2YPLB 4OLUH 3O6FC 1OT1A 2N7BA 3VXTA 4OIAA 5DJXA 2GJ6D 4OZHA 3RWIB 2A9ML 5DD5H 1RZKL 2NXZC 5K9OA 4NBYB 5IB2A 4F7PB 3QIBD 2R0LH 3T4YA 1BAFL 2Z91B 3MBEA 5E2VH 4CBPA 2DN7A 1W72L 4LLVA 5C0BE 4MJID 4N8PA 1PZUB 1KJ3H 2GK0B 5EU7C 2ADFL 1LMKA 3KDMB 4A2LA 1AD9A 4TNWK 1DBAL 3C5ZA 2VRAA 3O6MH 3TC9A 2QQNH 4XMLL 1G9NL 1FIEA 3QFJD 5IMMA 4ZQKB 3RNKA 5AAWA 2A6KA 3STBA 3HTLX 4L8DA 2P5EE 4P4KA 5C0GA 3WIHL 4KKCD 4YDLB 2Z31D 1IGTB 4G8EA 5HDLA 3HNTH 1R3IH 4WNQA 3M1BB 4H20H 1RURL 4XB7A 4G80A 5LQBH 2ERJC 1MFBH 4QLRA 1E27B 4GKSB 5EZLB 4DAGH 1HDMB 1F6LL 4HJJH 2P1YA 3I2CL 3A67L 1JN6A 1GVIA 5FB8A 1J1XL 2YD6A 1X5IA 1DZBA 1FZKA 1NUFA 4OM1H 3W9DB 4YZFE 3FN0L 3S88H 1CDBA 4XP4L 1IAIL 1TQCC 5EU4B 1SQ2N 5E03A 1U36A 1W0VA 3V2AR 5TJWK 5C0CD 4Q6IB 1C16B 3PIQB 3I3BA 5BVJA 5DMKA 5C0CE 3PP4L 4YXHH 3KPNA 5ICZB 4L8BA 1EO8L 5MEND 3AMLA 4KRNA 3ZE2E 3MBXH 1MCDA 4D94A 5BV7B 5HHQA 5T1KA 3ROOB 4PR5B 4H1LB 3CU7A 4YPGA 3E3QE 4LCCA 3VXMB 2R39A 4G6JL 4U3XA 1GGBH 3RL1B 4DN4H 3GMNB 1PEWA 1MOEA 4TUOB 1DFBL 2DDQH 4F9PA 5I71C 3FRUB 4OFYD 3EDKA 2NW2A 1KGCE 1U8KB 3MXWL 1YPZF 4TTDC 1UVQB 2XWBA 4PJ8A 3FQRB 3QR2A 3DBXA 3LDBB 1PZ5A 3FN3A 4X98A 5D7LD 4MXVF 1INEH 5JOFA 4HGWA 3UJJL 1RVFL 4PRID 1S7VA 1UZ8B 4N0UA 4NQED 4ZOAA 3FONB 2J12B 4RGNB 1ZHLA 2XA8L 4O02L 3V5DA 2E7LA 4TSBH 2ILLA 4DZ8B 2AJYH 1AGEA 5F21B 2C26A 5FDWB 1T7YA 3Q3GA 1V8HA 3IDYB 3KR3L 4LVNC 4Z95H 5I1EL 4AIZA 5HHXH 1UJ3B 3VXNA 1CLYH 1NLDL 1OWRM 4GRLC 1T6WA 2XN9E 2A9MH 5EUOF 1SYSB 1OP3K 2CR3A 1IARB 4HMCA 4JZNA 4QCIB 5C92A 5F7EL 1BIHA 3VJ6B 4NHUB 3IFPB 1T0MB 1MHEA 3QFDA 1W72H 3N85L 5TQ0L 5J9PB 2ADFH 5FHAL 1BBJA 3QXAA 4P46B 3R06A 5HGHB 1S9VA 4QRPD 1RJLB 5E0QA 1AFVL 2CK0L 1DBAH 1M4KA 1HHIA 1JNLL 4XMLH 3QG6B 5H35A 3RZCD 4MAUL 5JW3L 2ICWB 3HZKA 4M5ZL 1ND0B 4RMWA 2NYYC 5FKAB 1A6TB 3QB7C 3LKOA 1CIDA 2OS7A 1KPVA 3QEHA 4PRBB 1YY9D 5MEPA 3BEWB 1JWMB 1Y6MR 2BDNL 1LQSR 2OSLB 1T1YA 1HIML 3GRWA 1UWEL 1IKNC 2P44B 5IEHB 4QRQA 4C57C 3QT2A 3SDAA 4MXWL 3FB8A 4BSJA 2H32H 4WI3A 5IVXE 2FX7L 2FJGA 1JPTL 4XWOC 1H3UA 1Q1JL 2ICEB 3EO9L 1HNFA 2R4SL 4J7RA 2D4DA 3FN0H 3RRQA 4AY0A 2YR3A 5GS1B 4LGRB 1A9BA 4IIQB 4XP4H 5HGAA 2HT3D 3TVMC 5H37H 1A6VL 3S7GA 4MAYC 1NGYB 1Q0XL 5C09D 3OHXB 4CADB 1F13A 5E8NA 1ZVSA 4J3SA 3QHZL 1ZHKB 2IQAB 5E7FA 3T1FA 1EO8H 2P5WE 1A7NL 3QI9D 1TENA 5J13C 3SE3A 1QPPA 3E6HB 1WLHA 5CIPH 5AWNL 1GC1C 2OI9B 3T65A 4C56E 3BZEA 3DXAB 5SWQA 1QLRB 3SGKA 3VFRA 3BHBA 4MD0A 3ARGB 1ADQA 3OKOB 4X9HA 4ETYA 4G6JH 32C2B 2YPLA 4R0LB 3VXRE 1T1XB 1OT2A 3KHQA 4Y4KD 1QSFA 5F9AC 5BW7C 1CGSL 5DZLA 2P8PB 4RX4D 3RWIA 3RWHB 1AGFB 4KFZC 4HULB 4OFPA 3GMMB 4QHKJ 1J10A 3SBWC 2AXFB 4XCNB 1FRGL 4F7PA 5HBBA 4AL8L 4WI5A 3MJ9L 2X7LA 2Z91A 4JLRB 3DROA 4JFDA 3WN5B 2C1OB 2XWTA 3F7YB 3ULVF 4O02H 5LCVL 3LKSA 4QHUB 4LLQB 2IAMC 5CP7A 3WJLC 4XB8A 4G8GE 3KR3H 4WWKD 5DEGA 1CL7L 5DURB 5I1EH 3LMJH 1MHCA 4XVUC 3HE6C 4CL7A 5D7JA 5BOZG 1NLDH 4DQOL 1U92A 2R69L 3FAXA 5E2UH 3CSBA 3NN8A 2A83A 3OKEA 1D5BB 4I8DA 4U6XB 5GSRA 1I8MA 3MCG1 4M3KB 1CD8A 5GS0D 4RMSA 1XCQB 4ZFOL 4NQSA 2JLLA 5B39B 2QL1A 5LBSL 3WS3A 3GJFA 2XNAB 1ZHBB 2IPTL 3O8XD 1AFVH 2CK0H 3CSGA 2XKNB 1D6EA 3BWUC 3B9KD 1JNLH 4LVOB 5DJ2A 3H7LA 4MHHI 2EO9A 5IVOA 4E0RB 4CVZB 2Z35A 3QO0B 4YDVA 3VXPA 4YFEA 3KYMB 4AIXA 3LN4A 4PJ9B 2CUHA 3FAWA 4PP2B 4I48B 1IRAY 3RUGB 4U3HA 3PIQA 1CI5A 3F8UB 3KPQA 4MD4A 4Z7UF 2F54B 1UWEH 3TNNA 1HOCB 3C08L 5FF6B 3MRRA 5HGDB 3NPZB 5FECA 2FX7H 4HPOH 5F6IB 1JPTH 2FGWL 4LBEB 5FYJE 1A6AA 1F6FB 5DT1L 5FA3A 4J2XA 4PR5A 4KVNL 3W2DL 3KPSB 2BNQB 4HXBL 2FHFA 1Q1JH 1OAQH 3L5HA 5GRJH 2R4SH 4LSTL 2VLRE 3VXMA 4EN3D 3L7EA 4LCWA 3RA7H 5DUPL 3RL1A 4IOIB 3N50A 1A6VH 1PBYA 4RSVA 3V79C 3L5XH 1U8KA 4PGBA 4NT6A 5BO1L 1EEYA 3QHZH 1UVQA 1PW3A 5KS9A 5F6HJ 1A7NH 2R8SH 2QADC 3ET9F 5DD1L 1IEAB 4NKQB 2NY5L 1GGUA 4JREB 1UZ8A 5E9DE 5AWNH 2YD4A 1FZJB 5HI5C 1I7TB 2A73B 2UWEE 1E6OH 3INUL 3R0MA 4IMLA 3DRQB 4PGEA 2A6DB 4K9EC 3MJ7A 4KHXL 1PG7W 4OUUA 2WBJB 3EYOB 5CHNA 2BHUA 3BEVB 3SDCD 3QUXC 4Y89A 1QTYT 3BKJH 1CGSH 3OKYA 3QQ3B 5FYLH 2CIIB 4HBQA 1KB5A 4YHYB 4MQTB 4AL8H 3MJ9H 1T1WB 4QOKB 4NHUA 3MNWB 1G7HA 2JELH 2R9HC 3KPRA 2IALA 2NCMA 1OP5K 5GXBB 3K2UL 4O4YL 4TUJA 4NNPL 1UB6B 3RGVD 4PJFB 2YN5A 3WEXB 1BWMA 3WJJA 1CL7H 3JV4B 5ICYA 4W70A 1MNUL 1RZIB 3ARBD 1ED3B 1DQDL 3DMMB 1MY5A 1NCWL 3I9GL 4G3YH 4DQOH 2Y06L 3VFSB 4LQFL 2R69H 2ZUVA 4JHBA 1I85C 3WLWC 5E6ZA 5BRZD 1G1CA 2O5ZL 4FRWA 2UYLA 3UTOA 1I8LA 4PRBA 2BERA 2DI8A 1CDGA 1FDLL 1P53A 5CCKH 2XTJD 2EE2A 3W9EA 2ARJQ 3ARSA 1DSFL 8CGTA 4QGTA 4QNPF 2IPTH 3TLRA 5FGBC 3H7BA 3UZVB 3HI5L 4KH2A 4JFHE 2X1OA 2C3XA 3GMOB 5HY9B 2HVKB 2ICEA 2Y4SA 3RVXC 4ZXBA 2IC2A 3UTQA 4IIQA 4ZO9A 5DA0B 4M9OA 4OZGB 1ITBB 3U4EB 4JO3H 2X4SA 3QRFM 3PQYE 2F5AH 1TJGL 3E0GA 4KI5D 4JFQA 4YHIB 1WBZB 1M05A 3WFHA 1O7VA 1OPGH 5FGSA 5CBAB 3K8LA 5T3ZH 4KUZL 1V3KA 2BOBB 2PKDA 2PYEE 5IF0A 4XXCC 5EO9B 3STLA 1W0YT 2P43B 4IOFD 2FGWH 4R26H 5DT1H 2Q86B 3NCEB 3FB7B 4KVNH 3NZ8B 2OTUA 4HXBH 2ZJSL 3D0LB 3T77B 3VXUA 4Z76B 1EEZB 4LSTH 4MX7B 2JE8A 4MS8D 1Z3GL 3RAJH 1FFPB 4NKMA 1F4WH 3QUML 2WUCL 5DUPH 4R4ND 1X44A 3WSQL 4U1IA 5IR1A 1CLOL 1S3KL 5C0EA 4HD9A 4JQVA 1FZOB 4CKVX 1DBKH 2KUTA 3T2OA 3ARQA 1FL6A 4N0YL 4XCNA 4Z7WA 4P9ML 3RL2A 3I85A 3DO3A 3FT2B 4X6CB 4F58L 4YHLL 3INUH 3X3FL 5F93C 4J3TA 3DX7A 4QHUA 4X4XB 3TNMB 1FL3B 4KHXH 2DMCA 3FMGL 1HSAA 4GSDL 4MB3A 5DJ6A 1AIFB 2X42A 1FYTD 1BX2B 5CAYB 1Q9LA 3HMWL 3KLAA 2IH3B 3WFBH 2GEEA 3EYSH 3K1KC 3O9WA 5H2BB 1A5FL 1G9ML 2BRRL 5I74C 4ZFGL 1AC6A 1XCQA 4LIQE 2Y6SC 3NTCL 3GRWL 4Q7DA 4LEOB 4F7CB 2NW3A 5GZND 3O3DB 5EU6A 4O4YH 5CIPB 5IWLC 4WENB 1A4KB 3QCTH 2EH8H 3S35L 4FQHA 2Y06H 4LQFH 4CVZA 1RHHB 1E4JA 1YQ2A 2B0SH 1H3TA 4PJEF 3ALXA 2O5ZH 4R2GB 5AUMB 5FCUL 2DTML 4I48A 4PJGB 4P2QD 2CRIA 4HIJA 4IBLT 1QHOA 5DK0B 3ZDZF 3GMQA 5FF6A 4JN1L 4V1DB 4ZOEA 4ODTL 4YDKL 3NCYP 5DVKA 1FNGB 2R23A 3HI5H 4HS6B 5D4QA 1KTLA 2X89A 3VWKD 2AK1L 1JPGB 2QKIB 1NFDE 4M93C 1QRNB 1ADQL 4OZ4A 1MCHA 5CSZA 4OJFL 1YEIL 2W38A 3HFMH 3UO1L 2NY4B 1N5YL 1VADB 5EG6C 1I1AD 4HMEA 4YBQD 1D9KD 3EYUL 4JZJB 3VRIB 5KVFL 1TJGH 3HAEH 4RDQG 1XH3B 4F8TA 4GKNA 5EUKB 1OGAE 3DV4B 5C07D 1TZHA 5I16A 1VGKA 5EO0B 2H2SC 3KG5A 4MZ3A 1FO0L 3BT2L 3IFOB 4K07A 3VWJA 4JO4L 3BXNA 3C09C 1FZJA 4KQ3L 1DANU 1RZJC 4MNHA 1N6UA 3DRQA 1Z3GH 1KJMB 4YE4L 3JTTA 4EKXA 2G60L 4L1DA 5DMGC 1I8KB 1CT8A 1MVUA 1NEZG 2EDWA 4ZD3L 4U7KA 4OGAD 5ANME 4WI6A 1IM3B 5EFIB 1UWXH 4N0YH 4N0RA 4OZFG 3ILPA 3VH8B 3T0EC 3MRFA 4MWFB 1HHKB 1U8LA 3IXTA 1IGCH 3O4LD 2HRPL 3Q2CA 4XAWL 4X7SH 3RIFF 3O3AA 4AZ8A 3FMGH 4EI5C 4Y2DB 5AZEH 4Y5VB 5DI8B 1S9YA 1SM3L 3UPCA 5D2LE 3G5VB 4P3CL 3UDWC 2DQHH 3WUZA 4G6ML 1TLKA 3IDJB 5GGUB 2IH1B 1I9RL 2OLDA 1B6DA 4S0TD 3MRMB 4W81A 2PW2B 2HVJA 1A5FH 2GTZA 3GMRB 3WFDL 4DKFL 1KEMH 3BWAB 1T04B 4Y19A 3NTCH 3GRWH 5D7IA 1NMCB 4M6AA 5IQ7L 3OR6B 5DJ0A 4XAKE 1IQDB 4HUUB 4BKLA 4CMHC 4Y5YC 4P23A 1WICA 3QUYC 3MRCB 3S35H 5HY9A 4KJWC 4UDTA 2DBLL 3Q5OA 5HYSG 3TYFB 4JB9H 4AEHL 1Z9SA 4HC1L 4L3EA 5C1MB 2I27N 5T3XH 4AENA 3ZSTA 4OZGA 1JGEB 4UIMB 1SVZA 5EIIB 3RNQA 3ARZA 2DTMH 4KPHL 4PJAF 5DMYA 2LU4A 5FYKD 1WBZA 1IGYB 2AEQH 4JFEE 2DLFL 1AKJB 3NCFB 2IQ9L 2FH6A 3IAPA 4OF0A 3C60A 2AV1B 2EDYA 3BQUA 5F1IB 3BZFB 5J12C 1XGTA 2Q86A 4LNVA 1CDJA 1KG0B 3FB7A 5FO7B 2B4CL 1T20A 5HI4C 1KIQA 4O2EB 3QUZD 1ADQH 1CVSC 2Y23A 5T1KD 4UB0H 3H9HB 2ITDA 1X4YA 1N5YH 1NLBL 3QEQD 2YPKB 2VKWA 3PHOA 1UG9A 3EYUH 4O51B 5KVFH 2HT4D 5TE6H 3BGAA 1NUDA 5BQ7A 4OF3A 3BT2H 2FSEB 4MCZB 1DUZA 5I8EB 4ZFOB 4RAUA 2JJVA 1YN6B 4L4TB 4CN1A 3P40A 2D2OA 4XC1L 4Y4FB 4DKDC 2H3NB 4Z7VA 4KK5D 3AS1A 3FQNA 1P7HL 1WFNA 3QSKB 4NJ9L 1NUNB 2EZ0C 2YSSA 3IDMB 2G60H 5FOBA 3OJVC 1RAMA 5I15H 3ZZ1A 2ZCKH 1RJYA 1SJEB 4ZD3H 4UINL 5E94A 3TN0B 4YNYA 1LO4H 3LEVL 3UTSE 4KWUA 5LWYL 4ODVH 4P4RA 3T0AA 3RWFA 1IL1A 4XBPB 2VITB 4RAHA 1GIGH 3MRLB 2NZ9D 4WUUE 3BH9A 3V0WL 1XIWC 5I1IH 4DTGH 2MQ3A 3JWDC 2HRPH 3FOLA 3UTTA 3CFJA 1JHTA 3GJFH 4XAWH 4CN6A 4R8WL 2ATPB 4IJ3B 4WFHE 2N4IA 2XZCL 3O6KL 1A4KA 1F4YL 4LLWA 1P7QB 1SM3H 4KROC 1PG7L 2HTKD 4G6MH 1NL0L 1A22B 1XGUA 5I75C 1YMMD 4GXVL 1RV6X 4YR6A 1P4BL 3WFDH 4DKFH 5DD6A 1O7SA 4QO1A 1T4KA 1NKOA 2DYPB 2GTWB 5EUOE 1LD9A 1S9WB 1UM5L 5IQ7H 5JPNA 3ULVC 2GSGA 1C12A 4N1CA 2YD8A 4I0PB 4E41A 1G0YR 1JL8A 1I4FB 5J89A 5EZJA 2NY7H 3SCMC 4M5YL 1QRNA 5DEFB 1MWAB 2DBLH 4PJBA 3UPRB 4AEHH 2I60H 4MCYA 1LO0L 4OV6F 4D0CB 1F58L 2DL2A 4KPHH 3MQIA 4JZJA 4KI5F 5C0AB 4OM0L 3V6FB 2IANE 3VDAA 4C54A 5EUKA 3DV4A 2DLFH 5F3BB 5EO0A 3NH7H 1KELH 3AB0B 4YHPB 5I6XB 1G7QA 4PFEA 5CGYC 5ESQB 3WS6A 3JTSB 4EQ2A 1XGQA 4PY8I 4Y1AB 1DEEB 4ZDHB 4X9BA 1DVFA 2B4CH 2PTUA 4PRPD 5JHDB 1TCMA 5E70A 5BXFB 2ESVD 4KC3B 3DLQR 2BJML 2YZ1A 4PD4J 3FOMB 2Q8BL 4I77L 1S9KC 2AEPH 3EOAB 2EC9U 4XX1G 3PWVB 3SGDI 2YPLD 1DBML 2R0ZL 5JTWA 2MNUA 3MV7A 2FH8A 1KB5H 4HWBL 2WBKA 3CZFB 2VSCA 5GGSB 5GRUL 3FCTB 2O5YH 4HLZG 3H0TA 4RGOL 5HI3D 3TWCL 4P57B 1OSZB 5KJRH 3FFCB 3GK8H 5IFJB 4I18C 2LAGB 3KPPB 5K9KB 1W8OA 4PJIB 4OCXH 4JFPA 5DGQA 4Y2DA 4MNGE 4QF1A 3VG9B 1OF2B 4CN4A 1XF2A 5DK3A 3FB6B 4X5WB 1M7DA 3DRTA 4ZS6D 4UINH 2SEBB 5CBEA 4Q97A 3GHBH 2DICA 2YPVL 3DURB 2CPCA 2HKFL 2UZXB 4PJHA 4A6YA 3U30C 4JANB 1R3HB 4NQDA 2BSSB 5DRNB 5HDOA 4Z7NF 4WTWA 2PW2A 2XTLA 3RVUC 1G7JA 1GPOL 3V0WH 3DUUA 3VFOA 3RWDB 3T0DA 3HLAB 1J0HA 3I6KB 3QHTC 4HEME 3PDOA 1GAFH 1XT5A 3BP5B 4BSVB 2XZCH 1ZTXH 5F71A 2B5IB 5A2LH 2QR0B 3DYMA 5D6DA 4JY4B 4TULH 4FP8L 5SWSA 5TDNB 4LRIC 3KPLB 1PG7H 2WZPD 1U8IA 3QUMB 3WLBA 1ONQB 4LLAA 4H88L 1NL0H 5KG9B 2ATKA 3WV0A 5IVNA 3MR9A 3O6LH 1DR9A 2R1XB 4GXVH 5D8JL 5GS3A 4YWGL 1P4BH 4I9WE 4MJ5A 4UV7L 5EBLB 5JQHC 1IGYA 4NN6B 1FNEA 4JRYB 1RK1B 4LLUA 3KPOA 1CBVL 1UM5H 2OR9H 2VLME 1K8IA 4U1NA 5E8EB 5BOPA 3MV9A 1VEPA 3OKLA 4NIKB 2OJEA 3LKPB 4ALAH 4UOW0 5DJAA 4Y16C 2G5BB 2EKSB 3NGBB 4I3SL 2VSDA 4O2EA 3HR6A 2NX5E 1LE5A 5JW5B 1QBAA 1A6WL 2EDOA 3P30L 2AI0H 4KKCC 1F58H 4CRPA 2JCCA 4L29B 3VXMD 2EO1A 4LCYA 2J4WL 3IU3B 1NCTA 1U3HC 1KIPB 3D5OF 3HUJF 3CNKA 4QY8B 2WWKO 3RWGA 3P9LB 2VUOA 5I8KL 3KNBA 5AZ2H 1WK0A 4KKBD 5IBLD 1CD1A 1R5VB 4A2MA 2V6HA 5IMLB 1ZMYA 1JNJA 4JY5L 4GKZA 3HB3D 4AM0B 5ISZE 5MERB 4PRHA 1KTKE 4WHYG 2J88H 3PWPE 1LEIA 3L6FB 2PYFB 1RZFH 4RGND 2MTPA 5F9DC 3MRDA 1QZ1A 1KXQE 4H25A 2Q8BH 4I77H 1JCKA 3M8OL 1CICA 5EZIH 1JP5A 2IGFL 3VFVB 3ZT7A 1DBMH 3S97C 4XBGA 3EUUA 4TVPD 3ZO0A 5JW4Q 4LFHD 4OZHF 2D3VA 5GRVK 1EJOL 3AXLA 3S4SB 5CJBA 3CVHB 1KV3A 4HHAB 5J1AB 3DETC 4APQA 3MRHA 4L9LC 1KNOB 1J05A 1U2CA 3LS4L 5EULV 1UKTA 4NWUL 5J1SC 3SDDB 5I17A 3L5WA 1F02I 4XBEH 4P46D 3EOBB 4P49A 4UNTA 1G7IB 2H2PD 3I02A 2Q7NA 5CEZL 4PV9A 1ACZA 4EJ1C 3V5KB 5DRZB 2DM2A 2J8OA 1YA5A 4IRJB 2HKFH 3GKWL 3S37L 3BJLA 4JN2B 4N0CD 5IMOB 3M17A 4RWYH 4JFZL 1MIEL 1HZHL 4YHNB 2ZSWB 5CSBA 2LABA 1BQHG 2GQHA 1NEZA 1FO0B 2HFFA 2GTWA 5GRZA 3H6JA 1Z9LA 1C5BL 5I30H 4HUWB 5F1KC 4QXGL 4OZFA 3L3IB 1FE8H 1MCSA 4FP8H 1FGVL 1NJ9B 3C6LB 1MCOL 2R56L 1I9EA 5CILL 4IDLA 5HYQB 1QO3A 4H88H 2OR8A 1JGDB 3VMOA 5DQJB 5D8JH 3RTQC 3IXAA 3TESA 3OF6D 4YWGH 3MRBA 1UGNA 3VE0B 2ID5A 3O6FA 4YUEL 4UV7H 5EO1B 1C5DB 2BOCB 1Y0LB 3TBWA 4PRDB 3QO1A 3WE6B 1AO7E 4ODUA 1KLUB 2NY3C 4MNQB 5EZOL 2VZSA 5ESQA 4S2SB 3ZKXC 2ADGA 5IB1A 4PJCB 3MCKA 4MQ7B 4I3SH 4DZBA 3LY6A 5E56A 3ME0A 4JY6A 3CDYA 4L1HA 1A6WH 3GMPB 3DXAD 4YHKL 3W0WB 5F7UA 5JQ6H 5C9JB 3WUWG 3ARGD 3SDXA 2PO6B 3LIZL 4UAOC 5KZCB 2VO5A 5L2KB 3TIDA 1IEBB 2J4WH 3PWVA 3W82A 1MI5E 4KUCD 2XI9A 5HYSA 3BISA 4U6VH 5E8OA 1WVZA 5CJ5A 1EO5A 4P57A 3SJVB 3QZWB 2IBGA 3EJJX 3K8KA 2VLJE 2VYRE 2APTA 5ALCL 3FZUC 4NN7B 3UC0L 4HKBB 4MD5A 4BZYA 2CIKB 1MH5A 2XPGB 1RU9H 5I1KL 5KVDL 4NKDA 3OKMB 1CFVL 4X5WA 3M8OH 2VDOL 3NPSB 2C1PB 3KLSA 1GZQA 4QRRB 2EXWD 2CSPA 2VXUH 1S5HB 4ODWA 5DURD 3VXSE 3DURA 4LVHC 4XCEB 1J0IA 5BS0E 3BE1L 1EJOH 1JWUB 3BD5A 1KLGB 4EBQL 5D1XB 3N1GC 4ZUWB 2IFGA 3PE9A 5CMAB 4NWUH 2Q1EA 2E5EA 3TCXA 4KKLD 3SQOH 1ZLUK 4DUWA 2VKXA 4Y4KC 5HGGS 5DYOA 1C7TA 3RGHA 2NR6D 3PL6B 4O5LL 5HHOB 2R2HA 3MLVL 2R1XA 4JFZH 2E7MA 3OAZH 5F9WB 1U2HA 1HZHH 1D5ZA 1TMCB 3O11B 4MJ2A 1JIBA 3MNVB 4G43A 4PJ9D 3LRGA 7CGTA 4HFWB 5E8EA 3D39E 1C5BH 5GIRB 3LKQB 3OR7A 2F54D 2YEZA 1UCTA 3OZ9L 4XNZC 1FGVH 1PKQA 1MCOH 3KS0H 4RMVA 2R56H 1MQ8A 4NZTL 3BPLC 2V17L 2C9AA 2DKMA 5DRXB 5C6WH 3KPSD 2BNQD 4I2XA 5FDYA 4AYFA 5TGBA 3WNPA 4YUEH 4NUGH 4IOSD 5GS0C 4NUJA 1KIPA 4PB9L 5EN2B 3OKDB 4U3CA 5I66B 3T8XA 1WZMA 3O3BB 4PJ7B 3QEUB 3BGMA 4X7EC 1VFAB 1UYWL 2BNRE 2E7BA 4AM0A 1ZAGA 3B9KC 1HH9B 5JPMA 2Q7YA 3ZDZE 3DVGB 2X4UB 5A2JH 4PJDB 1SYVA 2HT2C 3U46B 4POZC 2GT9A 2ZKHL 3QEGL 1M6OB 3LIZH 5F7LB 5C0IB 2WBJD 3DGGA 4IHOA 1R3JA 4WW1A 5E00A 3DTXA 1AHWA 4M7JH 1J18A 3WO3B 2HKHL 1ZSDA 2NY0B 4ZAKB 1FVDB 1IFHH 1MEXH 3QDJA 4FQJL 3CVHA 5TF0A 4OQ1A 2X1XR 3WNNA 4QOKD 4XRCA 5D7KD 3MV8A 4M6NL 5ALCH 1OAYL 12E8L 3UC0H 1IKNA 3T3PF 3RVTD 4J1UB 4YPJA 4K23H 4EN3C 2L7JA 2I9TA 5I1KH 3ARFB 2FO4A 5KVDH 4TRPL 5CWSB 1KPUA 1ZT4A 2G75A 2VDOH 4W6XB 4OFVA 2R1YA 2XQBL 4Q2ZB 1YC7A 5DRZA 4Y5XC 1BIIB 3P0VH 1KC5H 3QDGB 3Q5YA 4JN2A 3DMMD 4QYOB 1DBJH 3BE1H 2AV7B 3IF1A 3EGSA 2VERN 3IFNL 3UYOD 2G2RA 1AJ7L 4N90D 5IROC 1QKZL 3ABZA 3QNYB 2APFA 4Y4HC 2PUQT 2VAAB 5EU3B 5SWZA 4E5XA 5KSAA 1B88A 4XVSL 3LEXB 4FQ1H 3SDCC 1U8OB 5FGCB 3MLTB 4CUCA 4X9GA 4HPYL 2DJSA 4XCCL 5FUZH 1TVHB 2YA2A 5T1DH 5AEAA 3MLVH 5DQJA 4DGIL 4EDXA 2A6IA 3VE0A 2DQTL 3TH3T 2C4FT 5T33H 5EO1A 4GFTB 1Q94A 3HHRB 5I1HH 5MEOA 4PRAB 3VFGH 3LQAH 1CFNB 5GISL 4F9LC 5E24E 3U79A 4PJCA 1EEUA 1F42A 1L0XA 1JZ6A 2HLFC 1MLBA 1S7QB 5DS8A 4KJYB 1ETZB 4FFZL 3IDGB 1R5IB 2BHZA 4FXGB 4JO1L 4O9HH 1GOGA 4NNYB 1EXUB 4XVTL 5T5NF 1BQSA 4PB9H 3X3GL 2WLYA 2Z4QA 2XTJC 1M71A 3WIIL 2PTVA 4LEXL 1K5NB 4PJAE 1W0WA 5KS9F 1UYWH 4P2RB 3MTRA 3DX8A 1BZ7B 2DQUH 1BD2A 4KV5F 1ERNA 3BD3A 2E7CA 3HPJB 3MGAA 3ORJA 5B8CC 4WFED 5FKPB 4HKBA 1CK0H 1FP5A 4FXKA 2H41A 2ZKHH 4P59H 3ARYA 5FFLA 2PXYB 5F89B 2C1PA 5DO2D 4YIQA 2MMXA 4KI5C 5IG7B 2E3VA 5IB4B 4BUGA 2RCSH 1JWSB 4JDZB 3BSZL 5DDHA 3EYVB 2JTDA 5L8LB 1XF4A 3P9WB 5L88L 1M7IA 3VFNB 3U0PA 1E28A 2X40A 1P6AB 4NZJA 4M6NH 4FS0A 12E8H 3X14B 1ORSA 1DQQB 2OTPA 4R4NC 1NBYB 4CNIA 5DHYA 2XQBH 1PKOA 3HN3A 1A1MB 4G6KL 4AEIL 1TJIL 5JORB 1BJ1H 3F6IA 4UTBL 5I76A 1BPVA 4L3CB 4K7FA 1MRFL 3IVKA 4U2ZA 3IFNH 1DQLL 3L3OB 3GI8L 4K71C 3SKNB 2N1KA 4R2GD 2AJVL 3G5ZA 3QQ4B 1NC2B 1N3NA 2AXGB 2ZCHL 4G8FB 2QHLA 5D5MB 2CGRL 3P0GB 4K7PH 2OP4L 1INDH 1CXKA 4Y0GA 4DEPB 2DKUA 2EDDA 2BSTB 4V1DD 4XVSH 5TDPB 4QHMB 3MACL 4KJQD 1A1NB 1FFNB 4U1LA 5DRXA 4KMTL 4X6BA 4FTVB 2B2XL 4G9FA 1QRND 4DGIH 3DUSB 3REVB 3UAJC 5C0ND 3MLWH 4XI5C 2NY4D 5FK9B 5LAXB 1YDPB 2VDLL 2CKBA 2OQJA 3SGDH 2BNUA 4HIIB 1G6RB 3AS2A 5F7DA 1JYVA 5DC4B 1PD6A 2DIAA 1FPTL 4HWUA 3D85A 2FJFA 1PYWB 1BQHA 1TPXC 4O58H 4NPYB 2R2BB 5IBUG 5IHUH 4GG6A 3KYNB 1UZ6E 1LDPL 3IU4L 1S9XA 4JO1H 4CVUA 2H45A 2VZOA 1OQXA 3U7WH 1QQDB 4NNXB 5JO5A 4XVTH 5HGBB 2ZUTA 4Q9CA 5EC1A 5FM4A 3X3GH 5DC0A 1AD0B 2EE3A 3A6BL 1NGPL 4GAGL 4LEXH 5JMRA 1OY3B 4CVXA 4U1MB 1T89C 5ESVA 3V52L 4Z7WF 2YUVA 3ROLB 1DLFL 2G9HA 2CLRB 9CGTA 3MLZH 2F8XC 3C6SB 1N7MH 3D2UB 1PQZA 1I9JL 1KCVH 3MRQA 2Q76B 4LSDA 5T1LA 5FGBA 5HHNB 2LAAA 2EDBA 2XKUA 1HHJB 1N26A 4Y2DD 2V7HA 1QEWB 1BIIA 3HG1A 2F53E 5EU5A 3BSZH 1CFTA 4OI7A 3KAAA 1F2XK 1SEQL 5D1ZA 2AV7A 5ENWB 5EWIL 2Y72A 2M1KA 5C0JB 3WUWA 5L88H 1D6VL 4GW5A 1CYGA 3LB6C 1ZVYA 3EFFB 3CFEA 3E1F1 1XFPA 3MYJB 5ACZA 1S7XB 3TO2A 3OKKA 2DLEA 3RWJB 4OZFH 4XXCA 3GKZA 1NPUA 3HE7C 4U6YA 5CD3A 2VAAA 4GUPB 4UTAL 2BVQA 1HINL 1YUHA 3MYZA 1TVBA 3C5SA 2Y25A 4G6KH 4OGAC 4AEIH 1TJIH 1N2RB 4UTBH 3F5WB 3RIFK 4ONFL 2DLIA 5D1QB 1DLHA 5GSVB 5ESAA 5C08A 1DQLH 4D3CL 3BGFC 1U0QA 1DEDA 5DVOA 2AJVH 5IFAL 1WIUA 2CRZA 1UXSB 2ZCHH 3MBEC 3MRPB 5IOPB 1QLFA 3UMTA 2OP4H 2AJZA 1AKJD 2P48B 5FYLE 4ZPTB 4L8SB 5L8JB 4JAMB 1JZ2A 1RIHL 1A7PL 2JB5L 3DX6B 1LP9B 4LPUA 2R2CA 3C5ZC 4ZFZB 3J8F7 4JFFE 4KMTH 3U36B 3IJHA 2HRLA 2B2XH 3IS1X 3FQWA 3OG4B 4FXGA 1CFQA 4JDVB 3ZL4H 5CEXA 4P4KC 2VDLH 2IBBA 1LK2A 3BP6B 3NIGF 4PV8B 4J3UA 1QSEB 4X99B 1FAIH 3DV6B 1MFNA 1HCVA 5HD8D 4NKOB 4NGHL 5J8OA 4JG1L 3AREA 3IYLW 4KY1L 4MYWB 5GGTA 2XA3A 4L4TD 2KPNA 4OFDA 2J8UB 4Y4FD 3OXSA 4QRUA 3WFCH 1A9EB 3OJDB 4HEPG 2IPKB 1YQVL 4WJ5B 1UQSA 4OKVB 3VGAB 2KDGA 3DVNA 3V8OA 4OLYH 1JWSA 2HLAB 3TN0D 2VXSL 1ZA3B 3A6BH 3FQTB 1NGPH 3ZYOA 3MX0A 4ODSL 2RFXB 1HI6B 4EEEA 5GS2H 1K4CA 3MFGB 3V52H 3L95A 43C9B 4LASH 1OTTD 1IAOB 1RJZB 2AERT 4NZRH 3BH8A 5FYJL 5L9DL 4X9IA 1BVKB 3G08B 5DQ9B 4OIIL 5T3ZE 1NCBL 3Q0HA 1AR1C 1BJ1J 1GC1L 3GBLA 4PJFF 1XZ0A 1ZWIA 1AY1L 2VABA 1BJ8A 5DEZA 1C5CL 4LCCC 2F8VA 4IMKA 1QFPA 1JTTA 1P7QD 2DQJL 1L4IA 1H0DB 3ALWA 1LEKB 4GG8B 1B4JL 1SEQH 2IBZY 4F9PC 5DHVA 4CGTA 2OBGA 4ZSOA 5KVEL 2CDGA 2RHEA 1D6VH 4OCLC 1A4JB 5D2NB 5JOEA 4PJ8C 1I7ZB 3DX9A 5IVZA 1CG9A 4PY8J 4G8FA 3QA3B 5D7IF 1KN4L 1YEGL 4BFIA 4KK5C 2DYPD 4WGWB 3P4LA 2DWDA 2UY7A 3IDUA 2MFNA 1HINH 2E7LC 3V6OA 4I0PD 4YDIH 4ZO8A 4G6AC 1OSPH 4OCWL 1AXTL 3PGDB 5I9QB 4ONFH 4M3JA 4FG6D 1LO5B 4OZGF 3TIEA 5LAXA 3STZB 2HG5B 4D3CH 5AG8A 1J8HA 5I19H 4I3GA 2E8ZA 5E6IB 5C0AD 4F57L 1A6UH 1R5WB 1NC4B 3MJ8A 4L4VB 3TZVA 3LV3A 4OF8A 1J0JA 4HIHB 5ERWB 1RULL 4RFEB 3T0EA 3ZKQD 2XICA 1MAML 4U0RC 2NTFB 4XTRC 4ONGL 4QWWC 4NQCB 2JB5H 4F7EB 4KHTL 4Y1AD 3O45A 4QXUL 3CFDA 2LU3A 3RWEA 3HZYB 4PJ5A 5JHDD 4RQQB 1ZOXA 2H26A 4JJ5B 3HKFA 4BFBD 3OBAA 5H94A 3TO4A 4M8QB 4U1HA 4GMSL 5IBTH 2ADIA 4WI7A 4LKXA 1S7TA 1AGDB 5H8DA 2P8LB 4OGYL 3LZFL 1A47A 3MO1A 4MQXC 4NGHH 3QDAA 5FM8A 2HA1A 1IAIM 4LKCB 3PWJA 2EICA 4G5ZH 4JG1H 2XIDA 1V3MA 3SDAC 4WW2A 3DSFL 4CW1A 4OZIB 4GT7A 3FFCD 4BSWB 4X4YB 3ZT5A 1HILA 4Z7VF 4MJ6B 3WXVL 3MOBL 4AT6A 1GGIL 1NDGA 1RSFA 2AP2A 1QEWA 3QNZA 1N59B 1F3JB 3U82B 2FEEL 4JRXA 4Z18A 4MA8H 4YXLL 3UTPE 1IMHC 1FFOA 4UT9L 4KKAD 2ADJA 5C0BB 4JHAL 3EJZD 2NLJB 2VLKA 4K3EL 2FX9H 4R7NB 3SE3C 4N0FA 3ARWA 4X4MA 3L7FB 4OF6A 3TCLA 5BZDB 1KULA 4GUPA 5T1MB 4MLSA 3SGKC 3B4NA 1AY1H 4YHOH 5JR1H 1OW0A 5IIEA 3S9DB 4HS8H 1C5CH 2E9BA 4JKPL 4N0UE 5BJTB 1HH6A 2P5EB 1WAAA 4R4BA 4K9EL 2DQJH 2X05A 1PAMA 2OXHA 2H9GA 1QNZL 1KEGL 1AQDA 4RFOL 2CKBL 4BH8B 1EBAA 3LPWA 1D5MB 5MI0B 3CXDL 3ARXA 3H9SE 1JV5A 4HX1B 3MRPA 4NC2B 1RQ5A 4JRYD 1TJHL 3PJSA 3NA9H 1ZV5A 4L8SA 3FHAA 2H8PB 2XRAL 3TPKA 2FL5A 3B8SA 5DJYA 5DRWA 4MSWA 4FFWC 5C7XL 5C70A 1AXTH 1L6XA 5D7JC 4PP1D 1FG9C 5FIEA 3BO8B 3LRSB 4YDLC 5TH2B 5J06A 4PV8A 4PGJA 4ZYKB 4OLXL 4CJ0A 4C4KO 4F57H 4LIQL 5JIHA 2BHYA 4UV4L 1RULH 4NKOA 2WV3A 4ONGH 3MMEB 4X5XB 5KSUB 1OARL 3G5YB 4KHTH 3QH3A 1YZZA 4QXUH 4Y8DC 3Q6GL 5C2UB 4DK3A 5TFSL 5J6GB 2IPKA 4GRMB 5E5UB 3QXWA 2COQA 2EE6A 5KOVC 4G8IB 3PHSA 2V2WB 4GMSH 4X6DA 3OSKA 1A1OB 3CH8A 4Q6IC 4ZUVA 2QTEA 5I1CL 1MFDH 4OGYH 4WU5A 4L5FL 4N1EA 3ARPA 1QHPA 5T3XE 4WO4A 5DR5H 2VIRB 3U7AA 2NXZB 3X13A 4M00A 1IAOA 3DSFH 3ZYJA 4HWNA 2K1MA 2CK2A 1R3LA 1JZ5A 3TA3A 3FFDA 2NY1D 2D7OA 1JRHI 4FQXA 4ZFFA 4JHWL 2YMXH 4U1GC 2KL6A 4HJ0D 3SDDD 5IB3B 3D1MC 3BKYL 1GGIH 4WHYH 2A9NL 2XN9B 3RVWD 2WMPA 4O2CA 2QHRH 1OHQA 2F8OA 1T0NB 4PJHF 4IRJD 2RB8A 5EC2A 3P77A 4KKBC 2I25N 5B38G 1E4XI 4JHAH 3QIUA 1QSFE 3VI4F 4XPGH 2AKRA 3TFKD 4K3EH 1XF5A 3P4MA 1MCWM 1XEDA 5B4MD 3NAAL 2NMSA 4OFKA 2KQNA 4QXWA 4ZTPH 1MCEA 2ERJB 3GSUB 4PS4L 2KBGA 4JFDE 4P0DA 1DN2A 1I9IH 4N1HB 2JIXA 4K9EH 3C6LD 3ARDA 1UJ3C 4H0HB 4NRXB 1P6FA 4M02A 4G9DB 4PBXA 1QNZH 3KXFA 5DQDL 4RFOH 3MLRH 1CXEA 2CKBH 1TQCB 4OI8A 1HXMA 3EOTH 4WCYL 3VRJB 4TUKL 4KK8D 5I8CB 1A6PA 3CXDH 2R1WB 4Z5RB 3MRGA 5IVXB 2BK8A 4NO0B 2XFXA 4RMTA 3GFUA 4MNQD 2H2PC 1UM6H 1TCRB 3NFSL 5CZXD 5ALBL 3QNXB 4BA8A 1I8IA 4MNQE 2Z93B 3WJJC 5JMOC 1T66D 1JZ3A 2Z8RA 5C7XH 3BW9A 3CCHB 3T08A 4XNUH 1F3DJ 5HHPA 3W0WD 4WFFE 3GIZH 2JCCF 1EJ6A 4M8QA 3PNWB 2PO6D 3OKNA 5KZCD 5L2KD 1I8LC 5DK2B 2P5WB 4UV4H 5I71B 3NACL 4FQ2L 2W59A 1FNHA 4XVJL 5A16B 5IGXL 4C56B 4ZS7H 3SJVD 2E27L 2X2YA 5FO9A 3P4NB 2MPAH 1ZT7A 3PDDA 3Q6GH 4LLYB 3VXRB 4ZUSA 3JV0A 4OD3L 4GQPH 5SV3A 5TFSH 2ZUYA 4U7MA 3U4BL 43CAB 1LE9B 4IIQC 1QBMH 5T5FH 5E8PA 3QCVL 1P84J 2GJ6A 1G7PB 4QRRD 1X5XA 1JJUA 1MCIA 4GRLB 4LCWE 5I1CH 4WHTB 4L3AA 2XWJB 4QRRE 3TBVB 1MY7A 3QIBA 3V8CA 3WHE1 1CU4H 4ZUTA 3DYOA 4MJIA 3B6SA 3GSQB 1VACA 5D1XD 1P5VA 4G8GB 2XZQL 5KS9E 2A6JA 4YO0B 4HLJA 2NNAB 4KV5E 3BKYH 3NFPB 3CSYA 3SGJA 3QFJA 4R0LC 5AD0A 3BOVA 2AEIT 4HWEH 4JQVC 4HG4J 4JG0H 2EDJA 3PL6D 5HHOD 2Z31A 1K3IA 3HR5A 3W11C 2EC8A 5IB5A 3EHBC 2MCPL 4D9LH 5IEKB 2ZWLT 1Q9OB 1BBDL 4NCC1 3GO1L 1OTUD 3RKDD 3VDCA 3O41A 3RVVC 5B3JF 1ZXQA 1ODAA 4PD4K 1NQBA 1RZGB 4PS4H 4FQCL 3KPRE 4OCRH 1YYML 4U05A 2EXWC 1MAJA 5CSGA 4OGZA 1HHGB 2HAZA 5GRVL 5D6CB 2X4PA 4M61B 5DQDH 3EYFB 4ERSL 2Y7QA 3EDFA 3LRSA 4WCYH 5IHZA 5JIKA 3GBML 1KOAA 3TVMB 4TUKH 2FGZA 3HC0B 3O9WC 4P5MB 2FCBA 4D2NA 5C0CA 2WM0A 2BVOB 2GFBB 4MAYB 2V2TA 4ELKB 1FVEA 5MENA 1BF2A 4NQVA 4WRLA 1WWBX 4KKLC 4HW6A 1UCBH 5GGTH 3SKOB 1X5AA 3NFSH 2F74A 5D7SL 2VLRB 4HZAA 4L9LA 1K8DA 4P99A 3V6ZB 4OAWB 3BDYH 3QJFA 4BQBA 4HKJB 1UJTA 1F8TL 3TH2T 3WHXB 1AH1A 5TE4L 3CX5J 3PWNB 3M45A 2Y9RT 4OB5H 3SDXF 3BRFA 5KSVA 1WTGT 3MGOA 4OFYA 4PB0H 4XZUB 4PJ9C 2NPLX 4MXQC 4BFEA 3NACH 1QA9B 2BSED 1DN0B 5E9DB 3L9RB 4XVJH 3UPAA 5D7LA 2NY0D 4ZAKD 3OPZL 5IGXH 3VCLA 4PRIA 2UWEB 4NM4H 3H42H 5D93C 4HDIB 2YOCA 3Q48A 3L5JA 2Q87A 1EDQA 2X4QA 2EYSB 3GHEL 1CD9B 1B90A 1KSRA 3IDNB 3RJQB 3QRGL 3MREA 2X4OB 3U4BH 2IAMB 8FABA 3EYQC 3RIAF 1KTDA 1RZ8B 3ARFD 3IDIB 1L9MA 3QCVH 1YY8A 3MUY1 3VXUE 3VI3F 4JCMA 5DHVH 4QRSA 3QDGD 1F3RB 3EJYD 3KWWB 1TQBC 1FL5A 3DSNA 4Z77B 3VWJC 4D0DB 3D69B 3IJYA 1U8HB 4R96A 5F8RC 1P1ZB 2XZQH 3TJEH 2O26U 3DO7B 4QRPA 3O2VL 4Z7WE 3UJTL 4S1QL 3HRZB 4PTTA 3GJEB 2IWGA 2GUOB 3VXQB 3RZCA 2EIZA 4HFUL 1ROWA 4UDUA 2JJSA 4PJEA 4F7TA 2MCPH 4NQUA 2EKJA 3BZ4B 3QQ9C 1BBDH 1FC1A 4LSVL 4N8VB 4MDJA 3PABA 2DQIL 3EFDL 5GGRB 3SE4A 1ES0A 3V7MA 5I1AB 1RUPL 4I5BB 2JB6A 1J8KA 4LARL 3B2VL 3CLFL 4P5KB 4OLWL 5EU6E 1NMAL 1Q9WB 2O61A 1X6LA 3CUPA 2OTWA 3PQYB 4XPAL 2X5PA 3ZKMD 3TV3L 3SN6N 2UUDH 3U9PL 5GZOD 4EVNB 3GBMH 3GJFK 4X7TB 2YKLH 4HJGA 2PYEB 5C09A 6CGTA 3GSWB 5DK2A 2B1AL 1BJMA 2VZVA 3EO1B 3PWLA 2WLZA 5IW6A 5A16A 2VLLB 3QI9A 2QADB 5ID1A 3TT1L 1FC2D 4NRYB 3ULVL 4P2RD 3PV6A 3WNKA 4P23C 3JBG7 1GXEA 2P49B 3KGRA 3LS5H 4QTHA 4LLYA 4X7DC 1F8TH 4BK5A 2DWEB 4HS3B 4N9GB 1JUFA 1SY6A 5E1AA 2APBA 3HI6L 5TE4H 3T4AB 2C3VB 4Y4KA 3A0OA 1XR9B 1XCTA 3V4VH 4X8XA 3QUXB 2PXYD 5IT2L 1IGJB 2HN7A 4RX4A 2Y5EA 1QVOB 2D03L 3VFUB 5F88A 5E7BA 1DBBL 3NIGE 2FEDC 1CE1L 3OPZH 3C60C 1BM3H 5DMIL 3BQUC 4KXZI 2BVPB 1F90H 4LU5L 4PLNC 1A2YB 5EBWA 1MREL 2XOTA 2EEAA 3GHEH 4KJPD 5GJSL 3T09A 1HHHA 4JFXA 1DANT 4HUXB 5A2KH 3QRGH 2DQDL 4WWKA 2ZSVB 4JQXA 4UQ3A 4XNXL 4H5SA 3BPCA 4HF5L 4GOSA 1VA9A 2CLZB 5HVWA 5F7WC 1FQ9C 1OLZA 1U8JB 4ZG1A 1TNNA 1AGCB 3CFBA 2VDQL 2Y5TB 5FEBA 5K59F 1NC2D 2ZP0T 1JNHA 1DQJA 2LU7A 4U1JB 1VESA 2NZIA 1EVUA 3O8XA 4RZCB 1GCFA 2FJHA 1MFCH 4XP9L 3B9KA 2W65B 1LO2L 3OX8B 3SEPA 4AH2B 2EIDA 2F19L 1UH4A 3O4OC 4HFUH 3GSNA 1YYLH 2J6EL 1U8PA 1T21B 1ZLWH 4FTVD 4DN3L 4CMMA 3VA2C 3IFLL 2XQYK 4CVWA 2H6PB 4UMGA 1Q9KB 1CIUA 2B1HL 5FUCE 5B38A 1RUPH 1WWAX 4B7LA 1BZ9A 2Q6WA 3HNSL 3Q6FB 4PJCF 5D7IE 3CLFH 3OGOE 4ORGB 1QRKA 4OAWA 2W0KA 4UQ2A 2FIKB 5E2WL 1NMAH 1T5WA 5EBMA 1JRHL 4EN3A 2GJZA 3ES6B 3S96B 4XPAH 4P3DA 5CEZD 3QXDA 3S6CA 1OGAB 3ECBA 3CPLB 3T2PA 5EOTB 2E6JA 2ZOLB 3RFZC 4L3EE 3ZE1E 1V7NL 5KVGL 2AVGA 2N56A 4U1KA 1E4XL 5BMFL 5EPMA 3TT1H 2UWEA 2C4XA 4DKEH 3MA7A 5IW1B 5JW4R 3ULVH 2OL3L 3MNZA 3V4UL 1BLNB 4NO2A 1CCZA 15C8H 2EYSA 2W92A 3D2UD 3HI6H 4WVRA 2W60B 4RIRA 5ANMB 2WAHA 1YNTA 4MDIB 5IT2H 3W39B 4HZLA 3G5XB 4JZJC 1EGJL 1XR8B 2D03H 4MA3B 3S5LG 4HKZB 4IM8A 3EDDA 1CQYA 3EDEA 1OAZL 3T2QA 3L3HA 5FV1L 4S1DD 3LQAC 4LNRA 1AGBA 3ULUH 4OCYL 1KIRA 4LU5H 2I5YL 4XH2A 5JOPE 1DVFC 3DO7A 5DJDB 4WEUD 3RGVA 5D2LB 5ECJE 1MLCA 3IRZA 1OGTA 2WINB 3LHPL 2CDEA 1J12A 2IADA 1LEGB 4XNXH 1OWWA 3ARBA 1WC7A 4K3DH 4X7CC 2O93L 5BRZA 3GSRB 5DJ8A 1F00I 4LSSL 4EUPG 5D1QD 1AC0A 5C3LD 1INQB 4JPIA 4P9HC 3QPXH 2QQQA 1URLA 2CDFA 2VDQH 4RBPH 4GAJL 4R97C 1T03L 4U1SA 4OTXH 5GGRA 4LP4A 5I1AA 4UOW1 3KPMB 4XP9H 5F9JB 2UV3A 1LO2H 2EYRB 4WEMB 1YEKL 2D9QB 4Y2DC 4WDIA 5B8CA 4M1CD 3UZQA 3UTTE 2DF3A 5J0BA 4GS7C 2WP3O 4M93B 5TE7L 4JM2B 1Q9WA 1S8DA 3MJ6A 3QDHA 1U3YA 2EEBA 3UBXB 3LN5B 4JFEB 3FRPG 4DN3H 3CDCA 2JKXA 1K3ZA 4JFOB 3L1OL 5IQ9A 1TETH 2HFTA 3GSWA 4FQQA 1IC7L 4QT5B 2A0LD 2H1PH 5LG1A 1NMCC 3MGTB 5JXAL 1QSED 3RWCB 3D0VA 3HNSH 4BUHA 4ODXA 4M62H 2JJUA 3I75B 1JGUL 2VDPL 4LPCA 5D6DC 2E6PA 1WIPA 3MRJB 4GMTH 4GG6F 4KI1A 1Z9OA 1JRHH 4NQXA 5MEQA 3KJ4B 4E41E 4WI8A 2C3VA 1CFBA 4JR9L 1J1PL 3U2SB 1F5WA 4PJBE 2APWA 2PCPB 1NEUA 1EPFA 1HQRA 4HWZB 1K4DB 3L3DA 1IAMA 4C83A 3CDGB 4XNQB 5CJOL 1E4XH 5DD5L 5BMFH 5J57B 2PW1B 1QFHA 3E2HB 3SPVB 1YEDA 3DWTA 3ILQD 3MUGB 4OBSA 3V4UH 2EDNA 2HFEB 3UTZA 3OXRB 4NYLB 5A3IC 1Y18A 1WT5A 4KRMB 4LOUC 4R9HA 4EI5B 1FYTA 3DVFA 1C8PA 3UTSB 2GAZA 3IKCB 3LSOA 4Z7OF 3C8KB 1R3KA 1KYOK 1UM4L 2ITCA 2QQNL 4S11A 1Z2KA 2D7NA 2EC9T 4HUNB 4WUUB 5A43C 4JCLA 3IETA 2ED9A 3PGCA 1OAZH 2CLZA 3U83A 1T7ZA 2BC4B 1K2DB 4LCIL 2V2XB 1AGCA 4OCYH 3HNTL 1R3IL 2FBJL 3MV7E 4KRPB 1U91A 5CZKA 3G6AA 3G6JE 2A77H 4ISVA 3WXWH 4EI6A 3FQXB 4H1LG 4OV5B 3QDMD 4AQ1B 1L6ZA 2W65A 4CMHB 1EAPB 2GI7A 3KYOA 4XPFL 5LQBL 4Y5YB 2I24N 3ETBF 3QUYB 3QDME 5IK3B 3SY0B 2M26A 2W0FA 4HJJL 4LF3B 3V4PH 4JQIL 1CICC 1P2CA 4M1GH 4E42A 1T5XA 3S88L 4LSSH 5ITFB 3B9AA 5EUOB 4FQLL 4DCQA 4X0KB 3S37X 4P2QA 3ARTA 1A6ZA 1I3RB 2EXYC 2Q8AL 5LVEA 4PJHE 2XG4A 5E6ID 4GAJH 3FO2A 3WD5L 4NQDE 3CH1A 1T03H 4APQC 5C0DA 1Q9KA 2O5XL 3BUYA 1IT9L 4WI4A 1NFDA 1H5BA 1NC4D 2I9LA 5DLMH 4L4VD 3VI4E 3AVEA 4HKXA 1YEKH 3MXVL 3VWKA 5J12B 1U41A 3MBXL 3BPNC 1JTPA 3V0VA 2GSIA 4NQCD 2YUZA 4X6EB 5TE7H 4LFHG 1KJ2A 1SJVA 3K8MA 3I6LD 3H2WA 1I1AA 2IANB 5SWSE 5K9QI 1S7WB 1D9KA 3HMXL 3U6RB 3NBNA 3CJJA 3C87A 3L1OH 1UXWA 1IC7H 3TJHC 5C07A 3B5TA 2FHBA 4GXUN 2DDQL 5LGHL 4B0MM 3H3KA 3FO9B 4WFGD 5JXAH 3ZDYF 2B7DT 1KCUL 1GL4B 1OAXL 4UBDC 5KSBE 4L8CA 1S78C 1TDQA 1INEL 2DQFB 3HCVA 1JGUH 3KYAA 4X6FA 3VXOB 3MV9E 3AAZB 3BESR 3N1FC 3F62A 4K3HA 2ZNXA 1N6VA 4TSBL 4JR9H 4MDIA 3ELAT 4L4JA 1J1PH 4Z95L 2BY0A 1ZS8B 5HHXL 3U0TB 5TDOA 5EIVA 1V5JA 4RAVA 3NABL 5HHME 1CLYL 1DDHA 3BN9D 5GS0L 5CJOH 4ZUUA 2JCCE 4DGYL 1K85A 5B3NA 3BRGC 4RISH 3AB0C 4PG2A 4NSKB 5C0BD 3C8HA 1XIWB 3O4LA 3JUYA 5J6HB 4HUVB 3NCBB 3D6GA 4MNGB 4YLQT 1S7RB 4GW4B 5FHBH 3HZMA 4LRNH 4QRTB 3MROA 2WINA 1LEGA 4WY7H 3MRKA 4PRHE 4KROB 3N9GH 3GSNL 1FBIL 3P73A 4NP4L 1UM4H 1E4WH 3LKNB 1X5GA 2P5ED 2P8MA 4KZEL 4EZMA 4WTZG 1YNLH 5I75B 1FCCA 2FR4A 1EHNA 4I4WB 1JHKL 4LCIH 4YGVA 3AUVA 4ZODA 3S98A 2FDBP 3FO0L 2FBJH 3FQUA 2ARJA 4RFNB 5HJ3A 3IDXL 3CFKB 5GGVY 5DJZB 3MRNB 4XPFH 2CXKA 4KZDL 1QACA 1II4E 4FA8A 5I1LA 4QHLA 1CE6A 3R4DA 1U8QA 1BVLA 3SCMB 4JM2A 1V3LA 4JQIH 3HZVA 4Z7QF 1F6AA 1FG2A 1HQ4A 3VD4A 1VFUA 4JFEA 3R8QA 4FQLH 1WBYA 4F33B 1MJ8H 2P24B 3FO1A 1JK8B 5C8JA 2Q8AH 4QT5A 5DMJB 3WD5H 3GSOA 4ONHA 2O5XH 1OB1B 1ZEAL 1IT9H 2E8YA 3WMSA 4ETQA 3THMH 4YDJB 5A2FA 1VDGA 3MXVH 2NX5B 5EA0H 4Z78A 3QUZA 4KK6D 4JM4H 1CGWA 1P4LA 5B3JE 3LPFA 3CLEL 1UB5A 3QEQA 3TF7C 3X12B 2X09A 3HMXH 4HIEB 4LLDA 4S1SL 1IAKB 3BIKB 3QUKB 2DTSA 3U2SA 3AU1B 4M6ML 3QG7L 1KGCD 3MC0A 1NBVL 5LGHH 3DECA 1K4DA 2VL5B 3U9UB 5B39G 5ISZB 2DM4A 4OT1H 3PWPB 2B20A 2CKNA 1KCUH 1OAXH 2XKSA 5IV2B 2NXZD 3QQNA 4WW2F 3TBSB 2VDRH 1CF8L 3TPUB 1MRDL 1X5ZA 2X41A 5JDSA 1U8NB 4XP6L 3BN3B 1JPFA 1XGRB 3BVNA 3TBTA 1ZA6A 3IKCA 2X4TB 5EU7E 4FZEH 1N5AB 2AJ3A 3LMJL 2XN9D 1NCAL 5JLZA 4K7PY 3AM8A 3NABH 1QFUH 4DVBA 5GS0H 5CEYA 3SDXE 4DGYH 3KHOA 3RPIB 1UT9A 4LCUB 1SJHA 3FT4B 5E2UL 3EO0A 3WL9B 4XGZB 1VB9A 4LAQL 3WFZA 2D31B 1HXYB 1ZHNB 4PJXA 3REWB 2HTLC 3KPTA 3VFPB 3L3JB 1FZMB 4JZOA 3C5JA 3U0WL 1F11A 1EAPA 4QGYA 3LD8C 4PG9B 4WV1B 2L0DA 3V6BR 5IK3A 3GSNH 1FBIH 4NP4H 1CS6A 1JVKA 2DS4A 1WAAF 1HK6A 4DUVA 4KTDL 1YMMA 3JVGA 4KZEH 3SGEI 3ULSB 1ZGLA 1AHWC 2XV6B 2X10A 5IUSA 4W6WB 5ITFA 1JHKH 5L0QC 5E95B 3U1SH 1I3RA 3FO0H 1WV7T 4ELMA 1LGVA 1H3PH 3IDXH 5CINL 3S5LA 2OL3B 2GITA 3ZE0F 3SDDC 4NO0D 3OB8A 5J7CC 4Y16B 4HPOL 4KZDH 5HYJE 5BZWA 1U3JA 1S7UB 4Q9QH 2GY5A 1NFIA 1JGLH 2R2EB 4X9FA 5GRJL 1OAQL 4OD2A 1MJUH 2IANA 3TH4T 3JV6B 3IT8D 4PLOB 1T22A 1PLGH 3RA7L 2Y07L 1U8MB 3OJ2C 4NRZB 1YEEH 1AO7B 3TFKC 1U3HB 2BMKA 3NCJL 4UU9A 1NAMB 1P4IL 3L5XL 3FO9A 2P5WD 1A7OH 1ZEAH 4GRWH 4JPKH 1MUJB 4EUPA 4LPVA 2R8SL 1LNUA 4KXZH 4TTDD 4PRPA 2DQFA 5F44A 4C56D 1MHHB 2ESVA 3LKRB 4YFLI 5KSAC 1XF3B 5E5RB 4UI2A 3CLEH 5IMKB 2C5DC 2J8UF 1E6OL 4JO2H 1MI5B 1T3FB 1G7MB 4JFYB 3VXRD 3VGBA 1PKQE 5EB9A 4S1SH 5TPWH 2MJWA 4J3VA 4M6MH 3QG7H 2DL9A 3WBDA 1NBVH 2AK4B 3BKJL 4I2XE 4X6DF 4AIOA 2VLJB 1L9NA 1NANI 4P3WA 4GRLD 3FRPA 5FYLL 2YK1L 4F80A 1MFEL 4AK1A 1S7RA 2JELL 5J1TC 1CF8H 1T66C 4JJHA 5KANG 5I1DB 4FZ8H 1MRDH 4X5LA 2W9LA 2GK0A 3VD5A 4POUB 3KDMA 4XP6H 3MOQA 4G8GD 3E6FB 3VXSB 3K3QA 3P9MB 4PY7B 3D25B 4EOWL 3ZT6A 5BS0B 3G9VA 1KT2B 1NCAH 4ZQKA 4G3YL 4I4WA 5DSCB 5D71L 1XGPB 4F7MB 1IGTA 1J1OL 2VQUA 1QLEL 4XCYB 4LAQH 2HJKB 3M1BA 1IC1A 3ULUF 5CCKL 2YBRB 3RDTB 3U0WH 3QDJE 4NN7C 1LHZA 4Q74A 4HIXH 4NZUL 1E27A 4GKSA 5CKGA 5EZLA 5C6PB 1HDMA 3PP3K 3QPQC 3MV8E 5GGSY 2ICWI 5JNYB 4KTDH 1MCJA 4XWOD 3G6DL 3W9DA 3AS3A 1SHMA 2BXYA 5TF1L 4MQSB 5L2JB 1MPAH 3RTQB 5EU4A 1HKFA 5I1JL 1T83A 1YEFH 4JO3L 2XY2A 3D39B 3TVMD 3PXHA 2F5AL 2VC2L 4Q6IA 1C16A 1OPGL 4MAYD 5CINH 5T3ZL 5GHWL 3K46A 2VE6B 5ICZA 2NY3B 4M7LT 5FYJD 2NX5A 3B3IB 2DBJA 3MUJA 2APXA 4XX1E 3ZKXB 5K59E 4NN5C 4M7LL 4R26L 1UKSA 3ROOA 3MRIB 4RNRB 2VLRD 5ADPH 4H1LA 2OZ4A 5SWZE 3QAZB 3RAJL 1F4WL 3GBNH 4ODHL 2Y07H 3AU1A 4P5TB 3QWOB 4IDJH 5LGJB 3GMNA 4TUOA 2UVFA 3NCJH 1JPSH 2YXFA 1RZ7L 3FRUA 1P4IH 1DBKL 2BNRB 3TBYB 4V2BA 5F3HB 3CGTA 2NY2B 5A40E 3PWPA 3GDBA 1KCSL 1TZIB 3FQRA 4IRZL 5JZ7C 5E9DD 2GJJA 2WW8A 5F72S 2Z92B 3BYYA 3FONA 4ODBD 5DF0A 4G42B 2ICES 4DZ8A 5FDWA 2IAMD 1UJ3A 2AXJA 4F2MB 4XVUD 4NFDA 4LVHB 2JK5B 1WSST 3WFBL 1SYSA 3KLHC 3EYSL 5JW4N 4QCIA