4MS8D

42f3 tcr pcpb9/h-2ld complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
AVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 61
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8D02
3MYJB 1CVSC 4X6CA 3BVNA 3AY4A 3OR6A 3ZMRA 4PJIA 3VRIB 4TPRH 1MRCH 1MLCA 2HAZA 3ARUA 3O11B 3OXSA 2P5EA 5T5NF 3D1MC 1QEWB 1XCTA 1T04A 1VA9A 4JZJA 5I74C 5GSVA 2X40A 3WO3B 1YEKH 3QJFB 5JIPA 2EDBA 4JGUA 3X11B 4GLRH 3IDYB 5GRWA 3U48A 3SDDA 3WJLA 1ZKAA 2H26A 3VMOA 2HT4C 2X4PA 4DN3L 1IAIH 4WY7L 3BSZL 4L29B 5F9WB 1HXYB 4MS8D 5DJDB 2DQDH 4ZFGH 3RU8L 2OJZH 1MCOL 1MFCH 4LCWD 4JKMA 4HUVA 4YHML 3L7EA 4GAYA 4FZEH 2CJUL 1HSBA 1KCRL 2GCYA 4GAJH 1JPTH 5L8JB 4P57B 2YD2A 2NY2C 5MEQB 4RZCA 1QSEA 2EEBA 4R4NC 5E2UH 4NN7C 4ZUSA 4HF5L 4XC1H 5EU6B 4HK0B 1ZWIA 1CXFA 2HFEA 1WC7B 3RVTC 1OTUD 4GOSA 4R0LC 1XZ0B 1AXTL 2A2QT 3WJJA 5F7KC 3NIGE 3REWA 1RMFH 4X7CC 1IGML 5HD8D 5C07E 5SX4I 4I4WA 4XC3L 3QIUA 4PV8A 1AC0A 2R4SH 3V79C 1TVHA 5AD0A 5J9PB 3CFJA 3GMOA 3RBGA 3U6RB 4M6NL 4I0PD 4OFIA 2XN9A 4LCIL 4GXVL 5IQ7L 3BKMH 4YDIH 4ZXBD 4L9DA 5I1HL 1UZ8B 2YPKA 3IU3B 4CRPA 1A1OA 1LNUB 5DD6B 1WBXB 3HNVL 1J9CT 2UZYB 2ED8A 1IEBB 3HFML 4DZBA 2X41A 1DBKL 4ZD3L 3ROOA 4Q7DA 3RZWA 1E0OB 3VGEA 1YEJL 4JAMA 3VXSB 4LQFH 5GHWL 3FAXA 1CG9B 2Y36L 3KPNA 3QH3B 5ESQB 1ADQL 4NO3A 3EJYD 3K81A 2O61A 2EDYA 3ROLB 2Z8VC 1FFNB 4MQ7A 4NO0D 1MHCB 4HC1A 5E6IB 3QIWC 3IDYC 4TVPH 1EGJL 2XZCL 2VLKA 4K23L 2MTPA 2AXFA 4B0MM 1I7RB 5F7WC 1NCDH 4LLWB 1MRFL 3OGOE 1OB1A 1TMCB 1HCVA 5DWUL 4MNQE 1N6UA 1RK0B 1M7IA 2HVJB 2PKDA 3DGGA 4H26A 2FCBA 3SDXF 1UA6H 4YQXL 4KQ4L 3DX9B 4Q6IC 3S3SA 1D7FA 3G9VA 1SBSL 3NCFB 4ONGL 4WW2C 5DJAA 1RZJC 2UYLB 4OZ4B 5DUPL 4RQQB 1KELL 4JCMA 4CMHB 1G9ML 3RL2B 3L9RA 1N26A 5JNYA 3MRBB 1RHHB 4RBPH 5IIEA 4P2RD 5I15L 3FT4B 4YXLH 3LAFA 3IDIB 3GI8H 4LSVH 1S9WB 1PG7H 4U2YA 3ZKQD 3OKLB 1HH6A 1IM9D 2GK2A 1BWMA 4PRHD 4JKLA 3FT3B 3SJVA 2ARJQ 2BNQE 3BDXA 4LMQI 5IQ9B 3OGCA 1IMHC 5L8LB 5K9JH 1HZHL 4GMSL 3FZUD 4L3EA 3K8LA 4PJHE 5IJVA 5A3IC 1A4JA 1A7RL 3HC0A 4Z7QF 2XKUA 2V17L 4JFQB 1TJGH 2DQEL 2CSPA 4P59L 4AM0A 5JW3L 3QFJA 1JPGA 1A3LL 2R9HC 4MAUH 3O9WD 1T89C 1YEDB 3OF6D 1WF5A 4YDKH 1E4JA 3MNVA 3R1GL 4ZFFA 5JORA 1U8HA 3LEXB 2VXVL 3OKMB 4PJFB 2W59A 1U95A 5IGXH 5B8CB 3HE6D 2K3TA 2DQUH 3KLHC 3VGHA 2DM2A 5E6IC 2BHZA 1U3YA 4XPBH 2HT3C 4GG6E 1S5IH 4KKLD 4XCCL 1WVZA 5F3HB 5F70A 3MRHA 1KIPB 4PUBH 2CPCA 4F3FB 2E8YA 4XPAL 5JO5A 3BZEA 2BVTA 2H41A 1BOGA 4EZMA 1NFDB 2AI0H 3QWRA 5ERWA 3TVMC 4G6KL 2WQ8A 3AS2A 3P11L 1OGAB 3AVEA 4ZXBB 2EKSB 2FIKB 1CXIA 3TNMB 2CRYA 2R0LL 1NCUA 3RI5K 2R29H 1OSPH 4PFEA 4M4RA 4D0CB 3T3MF 1AGBB 2SEBB 1I3GH 2EIZB 2Q7YA 4KAQH 2VAAB 3BIKB 4KPHH 1REIA 4K7FB 2WQRA 3RNQB 3WD5H 2NXYD 2A73A 3LIZH 4UBDD 5HBBA 4PG9A 4Z9KB 1GOGA 1NUDA 3ISWA 3ULVF 2XWJB 3HC4H 3QDGD 4NO0B 3SKUD 2HFGL 2ORBH 5DHYB 1K8DB 2DBLL 3KXFB 4C83A 3RNKB 5D93C 1SEBA 4LPCA 4OAWB 4PJEB 1A3RL 4Z7OF 4EUPG 2VZTA 4MS8C 2A83B 2DJ4A 2UVEA 4HJGB 4G42B 1MCNA 4NQVB 3V4VL 3MUGB 2DS4A 4E9LA 2AS5M 3TIDB 2NY6D 1BD2D 4BFBD 3FQWB 2DQTL 5E8OA 3AROA 4ONFL 1DEEB 3MCLL 4RA3A 1TZGL 3CVHA 2IPKA 4J4PA 4O51A 4P5MB 2WINA 4YUEH 3TCLA 3CLFH 4NNXA 2YWYA 1KN4L 3WNNA 1A7QH 5GGVL 1EJOH 2OL3L 1NAKH 2BRRL 2EIEA 4TUOA 1C12A 3IXAB 2K1MA 3VCLA 4MZ2A 1J88A 5AAWA 1CVRA 5MERB 2VC2H 2N7BA 2UZIL 4RAUA 2GAZB 1EJ6A 4NN6B 3WCYA 4HT1L 1EBAA 4XBPB 4OIBA 5T3ZL 1IM9B 2CLZB 4X6CF 1CFSA 1RZJH 1H5BB 4PRHB 5GRJL 5E5RB 4OLVH 4PJIF 5F21B 1KJ2B 5SWQA 3OKKB 2NY4D 5C7XH 2PUQT 1ED3A 4QTHA 1Q9KA 3O6MH 1C5CH 1CGSH 3C8KB 2Y9RT 1NLBH 4MYWB 2DI8A 2EDHA 4QT5B 4UV7L 4IRSA 4NQEE 5FYKH 2HFTA 5E24E 3CX5K 4QHUB 3AM8A 4HKXA 2GUOB 3U1SH 4MA7H 3H42H 5E2VL 2VKXA 3LQAC 3HI1B 3LV3B 2LE9A 1JTTA 3O9WB 1DQDH 2OLDA 2AV1B 2FHBA 3FQTA 3EO0A 2ATPA 3OKEB 1GGCL 3ARDD 3VWJA 3BAEH 2YUZA 2BJMH 5FM5O 3T0WA 5T5FL 3CSYA 5ICXA 4U33A 4XNZB 3HE6B 1IKFL 5FECB 1P7KA 1VFAB 3EFDH 1IARB 3C5SB 3FCTA 3G08A 5CBEB 5EZLA 4DFHA 1AR2A 3HAEA 3PF2A 3O6FA 1HHKA 3QQ3B 1AP2B 4GKOA 3O4LE 3S35X 1DQLH 3FO9B 4O02H 2VDOH 3EGSB 3SOBH 2IBBA 3HI6L 2YBRB 1QSFE 5D1ZD 4UZGA 4PGZA 4BZ2H 3BW9B 3GRWH 1S7VA 3VXMB 4XAKD 4PJXE 1KB5L 1BIIB 3H9HB 1EVTC 4W6XB 1KEGH 2HH0H 2AJSL 3PDOA 2Y1VA 1I1AC 4AIZA 2L7UA 1JRHL 1RJZB 4RGNB 2OTUA 1X44A 1K6QH 2VWEE 3DIFB 4ZTPL 3T0EE 4D3CL 1TJIL 3I3EA 1NGYA 5JR1L 1KN2H 2NXYB 2QQQA 2PO6D 2QSTA 4XBGA 4HH9A 4UU9B 3FQXB 4RGMB 1LO2H 1FL6A 1JUFA 3O2DL 3KHOA 3ZDYE 1I7TB 3P4NB 4XCYB 3ZE1F 4TULH 1HHIA 4Y1AE 5IKCA 1B4JL 3QDGB 4F2MA 1LO4L 1PDKA 4R7DB 3EYUL 4WUKH 3MNZA 3M8OH 1X5ZA 5EU5B 4TVPE 1TDQA 2YXFA 4FG6C 1NKRA 3CXDL 1SY6H 2J6EA 3V4UH 1QR4A 4QRUA 4HULB 4WFFE 1FL3B 5ID0B 4OIIL 3NTCL 1J8HE 5DDHA 3LH2H 5D6DA 2H8PA 3OQ3B 1S7TA 4ENEC 2ENYA 2NY6B 1BD2B 3DETD 4J3TA 1LEIA 1CXLA 3RWDB 1RULL 1CLZL 4JPWL 4DW2L 2R0KL 4MHHG 5JUEL 2AEIT 4JPVL 4QHMB 1JNHA 3VE0B 3JV6A 1U92B 1QFWL 3VD3A 1DBBH 1U8OA 1L6ZA 3NPZB 5ANMB 2EH8H 1IAKA 2DIJA 1ZLWK 1BJ1J 3QUZC 5AAMA 5BXFB 5I66A 4JY4A 4R26L 5KVEL 4KKNA 2AJUL 2PCPA 2DWEA 5ALCH 1ZANL 1KJMA 3MO1A 4OZFB 3RGVC 4NM8L 4Z0XA 2BMKB 4LPTA 1A6ZB 1DANU 4LSRL 2NY4B 3FTGB 5GS2D 5JDSB 5E2TL 1Z9LA 3QCUH 1J1XL 4PJDE 1JMZA 3LSOB 2P7TB 4CNIA 5CJQH 5LKNA 4PGBA 1T5WB 4OLWH 1YYMH 2Y6SD 4JJ5A 4RGNC 4F9PC 2APWA 5BO1L 1B0WA 4MJIE 2F54E 5EIIB 1TTGA 2EDDA 2NXYC 3VRJB 4LIQL 4Y19A 4RGMC 2IADB 2I25N 3MODL 4K8RL 4NOBA 3MQIA 1MY7A 2DJUA 3DVGA 2CDFA 2PXYB 4IMKA 4BFIB 2V2XB 4G6MH 2EE9A 2YN5A 3K4ZA 5CWSA 4AEEA 5EUKB 3SDCD 2FBJH 2YUVA 1SM3L 4OCWL 1WSST 4I48A 2VYRE 3FB8A 1N6QH 4PJAE 4NZTH 4CMMB 1G6RH 3KVQA 4FXGB 3LQAH 4MNHA 5FDWA 4CU6A 3CUPB 1FG2B 1WICA 3HNSL 1JPFB 1VGEL 3WSQH 4KZDH 1AGEA 1XEDA 4GBXD 4NRXA 5DJ6B 5FUCE 3V7AE 5JW4N 2F5BH 3MNWB 4WI8A 1EFXD 5D1ZB 4HUWB 4KK6C 2QQNL 4JFPB 2A6KB 3SDYH 2AGJH 3G6AB 2H2SC 4W70A 3HRZA 2BVUA 5GGTH 5HYJD 1MCWM 5IVNA 3CLEH 2FR4A 3SGEH 1E27B 3HPLB 4L4VD 1G9MC 3QQ4B 2O5YL 1R5IB 1BQHA 1YEEH 4ZPVB 5KTEL 3MROB 2R2HB 2PO6B 4I3SH 1KTLB 2I26N 1T0MB 4HV8A 4Y5XB 1IGTB 4I1NB 4WW2A 1RIVH 1F3JA 4GQ9L 2W0FA 1A1MB 1BFSA 4B7LA 2NXZC 4UOW0 3WXWH 3D9AL 3UCRA 4WHYH 4LARH 5C0BD 3VG9B 5ITBL 2XQYK 2JJTA 4WENB 2NY4C 3MRIB 1MCRA 4M7LT 2V9RA 2V7NA 3MLUL 4JN2B 3CFBA 5MP6L 2JKXA 3SCMD 4NBYB 4UV4L 3CX2A 5C0FA 1T0NA 1JPSL 1P4BL 3PGFL 5DVMA 5HGHB 4JY6A 2ZG3A 1GZQA 3WDIA 2ZUYA 1L4IA 5FF6A 3FB7B 5JOFB 3RJQB 3IETA 3BKJL 1A6AA 1YC7A 3LHPL 1KJ2H 2N7AA 2W65A 4JHBA 2YWZA 5H2BA 1A9EA 3KPTA 1D5XA 2PXYC 5DJYA 4WY7H 3BSZH 1B0RB 3BISA 3VXTB 5BJTA 4P5KA 2OL3B 4MXVE 1Q38A 3GMRA 4PRPA 1LEGA 4GW5A 1MCOH 5FB8A 1CT8A 2V2TA 1OAYH 4LHQB 1GGIH 4YHMH 3STZB 1KYOJ 3BGAA 1T03L 1FFOA 1GGUA 1NGWB 4A2MA 1T89A 3S5LA 2CJUH 5A2JH 1KCRH 1CXEA 4YHOL 1SEQL 1DLFL 3B9AA 1RJLA 3H3KA 1H15A 4OGYL 4JVUA 3BPNB 3ZYIA 4HF5H 4LFHD 2CIKA 8FABB 3BN3B 3AREA 5EU6E 4I8DA 3V5DB 5CEZL 2FJHB 3GRWA 3QDHA 4ZUVB 3UTPE 1A1NB 5IOPA 4UQ2A 4M5ZH 4YDLB 1G0YR 4LPYA 5DTFA 2GITB 1ZA6B 4JJHA 4XC3H 5FYKE 1VEOA 5CBAA 3TVMA 2XFXA 1YMHB 2PO6C 4LCYA 1NCCL 5DC0A 5KOMC 3P4MA 1QRKA 5IHZB 1FJ1B 4M6NH 3S37L 1ZA3A 4LCIH 5GJSL 5I1EL 4GXVH 5IQ7H 1PYWA 4Y5XC 4XX1G 3G9AB 4CVWA 1P7QD 4DKAA 2VUOA 5I1HH 3IDJA 1R3IL 3ARPA 3SDCB 2Y7QB 3B9KA 4FFYL 1YEGH 3I75A 1QR1A 3HNVH 2FEEI 5DO2C 3PWLA 1P5VA 1S7QA 2A77H 1WGOA 3HFMH 3MA7B 2AJYL 1DBKH 2VABA 1HN1A 1ND0B 3OKDA 1YEJH 4OM1H 4GBXB 1AQKH 5FAAA 3VXSE 3WYRA 4NP4L 3OX8A 2Y36H 3QUYA 1ADQH 1FZKA 4KMLB 1EFXB 3LKSA 2AK4A 1JFQL 3JZ7A 3HAEG 1HXMB 1O0VA 5T1MB 4KJPC 3PWNA 2DLFL 2VE6A 2XZCH 4K23H 4HK3N 2OQJA 4KRMB 4LAQH 2BSRA 2ZCHL 1IAII 5J1SC 1A64A 1PX3A 5CCKL 1XMWA 4L4VB 5DWUH 2P8LA 4Y4FC 3FB6A 3FRPG 5FKPA 3TBYA 4YQXH 4KQ4H 3WDJA 3LRSB 5EOTB 4AYFA 1SBSH 4ONGH 3QNXA 3QUXA 3BPNC 5C0BB 2EC8A 4WUUA 5DUPH 4M61A 1KELH 1IGFH 1JZ7A 3HLAA 1G9MH 3SKOB 3BWUC 4M7LH 1IAOB 4M1DL 4OV5B 3LD8C 3SCMB 4LCUA 5I15H 2X9WA 3NH7L 3HCVA 4XVTL 3NCBB 1MCWW 2L0DA 3CFDB 3VFNA 4OZFH 1BVKA 3G6DL 3MRNB 3QNZB 1JI2A 3FRUB 1JNNL 3SDAA 3DVIA 4BH7A 1I3RB 4QCIA 1LGVA 3HZYA 3Q6GL 2XZQL 1QFUL 1HZHH 2BOCB 4GMSH 4GS7B 4UQ3A 1CQKA 2GK0B 3BP5A 4F8TA 1L0QA 3IDNA 1UENA 2LV4A 4FFZL 4R4FL 4G7YL 4KDTC 4NQCA 1G6RA 2ZUQB 5DJ2B 1CXHA 1JK8A 2DQEH 4P59H 3F58L 5JW3H 4WHTA 4M62L 3CPLA 4E42A 1DBJL 3SKJL 4NZRL 2VLLA 3R1GH 1VKXB 3V0AC 4NHUA 2VXVH 4PJFE 1EPFA 1TETH 5FCSH 2ICEA 3P73B 3L3DB 2LABA 4J3SA 2R2BB 5GZOD 5EBWB 5GZNC 3EFFA 4NPYB 2EYSA 4XCCH 2LAAA 1C16B 2C9AA 3VFUB 3H7LA 4RAHA 4Q9QH 3G5YB 4NSKA 4HMEA 2HKHL 2P47B 1RUAL 4PTUB 1MLBB 4G8FB 5CSBA 4AH2B 1NFDE 4Z5RB 4W6WB 4YHPB 1ORQB 1JP5A 3CFEA 4H5SB 5F1IB 3TYGL 4I0KA 1T3FA 5IFHH 4MVBD 4G6KH 3T2NL 1FZJB 2QL1A 1Z9SA 1OGAE 3UJTL 1P7QB 4HK3J 5IR1B 4X4XB 4MAYA 3O2VL 1I1AA 4PGEB 2EZ0D 5C0GB 3CAFA 4HAGA 2KH2B 4HKJB 4JHAL 3WIFA 1AD0A 2MOVA 5KVDL 1OOAA 1YEFH 2JELL 4K3EL 3SCMC 4IS6B 4YNYA 1SBBA 1EZVX 1HIML 4YBLB 4LSTH 1AXSA 1ONQA 1G7QA 3V5HB 1YN6A 5IB3B 3C8HA 1FVDA 5IHLB 4X9GA 4XNYL 3IJSA 3CZFB 3RA7L 4EDXA 1WBYB 2HFGH 1W8NA 3AU1A 3HG1D 2OS7A 1ZGLM 2OCFD 2DBLH 2EDOA 4G80B 4Y16D 1UQSA 3KXFE 4XPGH 4JKPH 5J3HD 4GS7C 1NFIA 7FABL 1A3RH 4PJEE 1ZXQA 4G43B 2FZ3B 3T1FA 3PHOA 1YN7A 1MHEA 4Y4HD 3D18A 1PJ9A 3VI4E 4N0RA 4OF0A 3V6BR 4OLUL 4F7CB 3L3IB 1ZHBA 1TJHL 2DQTH 2FD6L 4ONFH 3MCLH 2VISA 3DYMA 1F11A 3K2UH 5GGVH 4P4KA 2OL3H 4X4ME 4D9RD 4PRAB 3DV6A 1ITCA 2NX5D 3QUZA 4PRDB 3MLZL 4QY8B 1SHMA 4B50A 3PWJA 4NYLA 4HIJB 4Y88A 2UZIH 5IB2A 1KLGA 4XH2B 4WW2F 1NDMB 2ADJB 3DSNA 2V2WB 3RWEB 5T3ZH 2XZAL 3NMEA 2DLGA 3E1F1 5EUOB 5C0AA 1IEHA 4CADB 4PRHE 5GRJH 3GGWB 3GJFA 4LVOC 3BP4A 3E3QC 3ZT6A 4EVNA 4HHAB 1CDCA 2I07B 4U05A 1EVUA 4K8RC 1AO7A 2XIDA 3HNTL 2NNAB 5ICZB 4LHJB 4WU7A 3OTTA 3VXOB 1E4KA 2APXA 4M9OA 4UV7H 5GPRA 4F9PA 5D7IA 3CDYA 4R2GC 4IBLT 4N8CL 1J05A 1TQCB 5I9QC 1FLRL 5FCUL 1K5NA 3UMTA 5E5MB 5E2VH 5C0JA 2E7HA 4JDVB 2YSSA 2GFBA 1U58B 5F8QC 4G9DB 4LDEB 4OZGB 4UT9L 3WE6B 4AEIL 4U1MB 4ZO8A 1Q0YL 1S7UA 3FO1B 4BELD 1GGCH 3N1QC 5DA4A 4IJ3B 5T5FH 3G6JA 5BV7L 5KSBA 3S5LG 1XGUB 1EGJA 2WWMD 4N9GB 3V6OC 5CKAA 4DKFL 3MBEC 5E6YA 5JHDA 1G7JB 3QZWA 3GM0A 4JHZA 5DMKA 3I3BA 4AEHL 1VCAA 4JN1L 4YLQT 3BPCA 5DURB 3PIQB 1WIPA 3VFWB 2D4FA 3REVA 2ICWJ 5D72L 4IOIB 3NIFE 3QULA 3VXME 1KB5H 1S5HB 1INQB 4DVBA 1ZT7B 1KCLA 2AJSH 5CKGA 3V6FB 1JRHH 4LEXL 1B0GA 3I6LD 4K3GA 1HHJB 4PJ8D 4RGNE 4D3CH 1NMBH 4QXWA 5IB5A 1MI5A 1PD6A 1N5AA 1TJIH 5JR1H 1HEZB 3LN5B 3RY5A 5DUBB 5MENE 3K2MC 5DMGD 3O8XC 3MCKA 2QSQA 3AB0B 3QJHB 5DJ0B 3VGDA 3ZYOA 2CLVB 5IB1B 4RRPA 1AGCA 2FJFB 1UVQA 4XMKL 1B4JH 2HTKC 5B39A 5I1JL 1LO4H 3QDGE 1JCKA 2UWEB 3EYUH 2E6JA 1RSFA 3HG1B 4XBEL 3WUWG 1LHZA 5TH2A 1J1PL 2JB6B 2RHEA 4Y16B 3D0VA 1FE8L 2B4CL 1DVFD 1Q9OB 4ETQB 3QA3A 1MUJB 1QBAA 3CXDH 1DJSA 3F62A 1VENA 5J6GB 2AERT 4HKZB 4U3HA 2BVOB 5I8EB 2Q6WB 1ZTXH 3HKFA 4HIEA 5JW5B 1W0VB 2I5YH 2WIIA 4JFZH 4OIIH 3NTCH 5D9SA 4Y4HB 1DLHB 4L3CB 1NC2A 4IDLA 1PY9A 3U30B 2X4NB 3MGOB 4V1DA 1BD2E 1JV5B 4U1LB 1CLZH 4JPWH 2GY5A 3MRCB 4RWYL 3ZT7A 4X80L 4PD4K 4JPVH 3LPGA 2IQAB 4QXTA 4ZUWB 1QFWH 1B6DA 1G9EA 2NX5B 4JZOA 3D25B 1P6AB 1C1EL 3KPSA 3A6OA 5C0NC 2VLRA 5ANME 3D3VA 5B38A 3IDGA 4NWUL 4IEFB 4P5TD 2QBWA 4KFZC 3GM8A 4R26H 5KVEH 2XKNA 2AJUH 3L5WA 5E4EC 3TNNA 1Z9OA 1ZANH 4D0BB 3CMGA 4ZUUB 5C92A 2C4FU 4NM8H 5EB9A 5HJ3A 1N64L 5IF0A 1N4XL 1XIWA 1N8ZB 2W9LA 2QEJA 3EDKA 4LSRH 4MVBC 3SGKA 3EJZD 5F3BA 5IHBA 4LDOB 4PGDB 3FOLB 5BZWA 1J1XH 5MEOB 5F7LB 4R7NA 2WZPD 5FYLD 2XT1B 3RY6C 1Z0NA 1UACH 1WIUA 5HYSG 5BO1H 4WNQB 2HG5B 5D1QA 3N1PC 3MODH 5BVPH 3D0LB 4K8RH 1U8LA 3D85A 3AB0C 4MJ5A 3H3PL 1OP3K 1KG0B 5ITFB 5A16B 1T1ZB 3NACH 3DRTA 1T7ZA 1VEMA 5GS0L 5F1OB 5JIKA 4Y2DD 1MSPA 4RSVA 5B4MD 1SM3H 4OCWH 3DROB 4PP1D 1MH5A 1HCFX 4QHKI 4LRNL 5HHNA 1EO8L 4LLDB 4RFNC 4P46D 3RX8A 3CH1A 1GRWA 3UAJC 1CDJA 5EFIA 3HNSH 4JQXC 5TQ2L 1JN6B 3HUJB 4F80A 1OCWL 4JFFA 4KQ3H 1JGDB 4P3DB 4EXPX 3RVXD 1MCFA 3ARZA 3VFGL 1JWMA 2NTFA 1I8KA 1LO0L 3O41B 4PJHA 4BSWB 1FZMA 1P84K 5MHSD 1UEYA 3PWVA 4XAKE 5BZDA 5EO0B 2BY1A 1GHFL 3PL6D 4WO4C 2WUBL 5F44A 5F7EH 3OG6B 4N0UB 4Y4FA 1OQXA 4PJ8B 3T4YB 5IBUB 2O5YH 1BJ8A 5CJBA 4U6VL 4KUCD 3IFLL 3IKCB 5EC2B 4YIQB 4OKVA 1ZS8B 4E0RB 3K1DA 3SY0B 1QSVA 1SYSA 1U8NB 3D9AH 3I02A 1IM3A 4PRBB 2VLJD 5ITBH 4RIRB 3BHBB 4YHYC 3DECA 4OJFL 1NCAL 4ZFZB 4Q58C 3MLUH 4NC1C 4S1SL 3ZL4L 1HSAB 2EO9A 1DVFB 4H25A 3RWHA 3GSRB 5HHPB 1X5IA 5MP6H 1J0IA 1MCQA 4URTB 2MCG1 1TXKA 1IEAB 1P4BH 3E6FB 3PGFH 4IOFC 1RZGA 4BH8A 4F7MB 3OBAA 4NRYB 4U1SB 4YXHH 4QTIL 2JB5L 2G60L 4D0DB 3LHPH 3W0WD 5CGTA 3EUUA 4H0HB 5K33A 1FNLA 2H6PA 1AKJA 2CH8A 4KDTA 3VU2A 5C6PB 1VGKA 3MJ7A 5JOPE 1BZ7A 4NZJA 3LVEA 1RJYB 4F8QA 1EEZB 4OBRA 2HN7B 4HXAL 4MDJA 1FYTD 1T03H 1OY3B 1QYGH 5FDYA 5C2UB 1GVIA 4L8DA 4ESKA 4YHOH 2D7TL 1SEQH 1DLFH 4UIMB 5AWNL 4KI5C 4CU8A 1X5XA 5CZXD 3BH8B 3S6CA 4U0RC 5J56B 3CDCA 4PJBB 5HHXL 5FO9B 4XWGH 3PGDB 2YD6A 2IGFH 1TZHA 4WW1B 2PYFB 1MWAB 2OJEA 5L6YH 5C0CB 3U9UB 4ZOBA 3ECBA 5ENWA 4BSJA 1BX2B 1M05B 5FFLA 3SGEI 1IFHL 3HC3L 3MOQA 3P9LB 4I3RL 4PJ8C 12E8H 3NPSC 2ZOKA 1T7XA 3PWPD 4OIAA 1F6FB 3O2DA 5F88B 5I1EH 4DKDC 1U8KB 3I6KA 4BM7A 3ZE2E 4KY1L 2J7LA 4LVHB 2WP3T 5D7IF 1R3IH 4PGJA 3GIZL 4FFYH 1V3LA 4Z7UB 4WEBL 2CKBB 3LKQB 4P46B 3EOBA 1UZ6E 3QSKB 5DRWA 3UROR 1DVFC 3S98A 1LO3L 5T1KD 1FV1A 1FFQA 1F4AA 5DQJA 5FV2A 1MCBA 5F96L 4LRIC 2YXMA 4NP4H 5JXEC 1YY8A 3G6JF 1CFNB 5KSBF 3T65A 2Z4QB 4YHNA 1WWCA 4RX4A 5TQ0H 3QZWG 1KNOB 2O5XL 1F3DH 1A5FL 3S97C 4OT1L 3MRKA 3PL6B 4LSQL 1WFOA 2ICES 2ZCHH 4X6DA 2Q8AL 5E9DA 4ZYKA 3VD9A 2HJFA 5CCKH 3IVKB 5DJCB 4RFEA 5EBLA 4L4VE 4UIKL 5E8NB 4MCYA 1PG7X 5SWZD 3WFHB 2DJSA 4PYHA 2Y25A 4PGCA 4N0YH 1RZ7L 4F7TB 4WCYL 2O5ZH 4Y4KD 5CIPH 4BKLB 4MXQC 3IJHB 1P6FA 2NTSP 3C5ZA 1D6EB 3NFNB 1QQDB 4PY8I 3UZQA 1IC1A 2VLJB 5C0BE 2ZKHH 2ARJA 3FO2B 5IB4B 1MVUB 2X05A 2Q86A 1EIBA 1I8IA 4M1DH 3O4LA 3K80A 3NH7H 2CMRL 2VDNH 4KK9D 2P44B 1AHWB 1Q9LB 4XVTH 4Z7WB 4KV5F 3NIGF 5JPNB 5CHNB 3IKKA 3G6DH 5GGUA 3MGAA 4GMTL 1FNGB 2AXHA 1XR8B 25C8H 1W72A 2ITCB 4LLQB 1FBIL 1JNNH 3W0WB 1IGIL 2W60B 4G8GB 3L5XL 4R4BB 3MJ6A 1FN4B 1RZFH 2XZQH 1QFUH 3HHRB 4RMQA 1E4WL 3RJDA 1K4DB 4E5XB 3IXTA 3V6ZB 3VFRA 4FFZH 4C55A 4R4FH 5BV7C 1EK3A 4G7YH 2YD9A 2VN7A 5IM7B 1FYTB 3WS3A 3F58H 4DK3A 2HJKB 3R0MA 1VADA 4JFEB 4MWFA 4M62H 3CSBA 1NDGA 2VUYA 3B83A 5EG6C 1DBJH 3SKJH 4NZRH 3ZKMD 2FATL 2G9HB 3TBSB 2XV6B 3WEXB 3BZFB 1WT5C 3PWUA 3RVXC 1LE5A 2YPLA 5DJZA 1YECL 1B2WL 1QLFA 4RMUA 3TA3D 4YDJA 1JF1B 5TDNB 5L7XH 3BXNB 3QO0B 3PL6C 3PQYA 2DQIH 1KUMA 3MREA 3W5MA 5J11C 2DRUA 2HKHH 5J13B 1F8TL 4IHOA 3KLAB 3ZYJA 1JZ8A 3PWPB 3TYGH 3VFVA 4OQ1A 3T2NH 5C0DB 4JFXB 3VRLE 3UJTH 3QXAB 3S4SB 1NC4A 4PJGA 2ESVA 2APVA 3MBXH 1NFKA 1NKOA 4G6FD 3ARQA 3VGAB 4H8WL 3HR5B 1ETZA 5KVDH 1I3UA 1T0PB 2XKSA 1QVOA 2B4CC 3O8XA 4JO1L 3GSQA 4JM4L 2IH1B 4C56A 3QUML 3EOAB 1HIMH 2RB8A 5EIQA 1AHWC 5HI5D 4LHUG 1UXSA 4ZOEA 3DV4A 3QAZB 3QIBA 1P69B 3U0TA 2NZIA 4XNYH 1GGYA 4PJCB 3RA7H 1FORL 2Q87A 1ZHNB 3MUHL 4RMVA 2X1QA 5I16B 2H2PD 3V6OE 4NZUH 2EYRB 3NCCB 3H9SD 3HZMA 4JO2H 3U4EA 1FAKT 4PV9A 7FABH 5E8PB 1IQDB 1FC1A 3HPJB 2VB5A 4ELMB 3IB4A 4XWOC 5SWZB 2FH8A 3E2HB 4XP4L 3QG7L 2A6DA 3ZDZF 1GH7A 4PJHF 4U1NB 2DQJL 1BVZA 5JQ6H 4OLUH 3E6HB 2IJ0C 4Y4KB 4MA8L 3BIAX 2FD6H 1BQSA 1V3JA 2VRAA 4R3SB 3LKNB 4A6YL 4HXBL 1U8MA 3VD5A 1I7ZA 1M7DB 3BUYA 5KS9B 1QBML 4XP5L 1QOKA 1IGYA 1HYRC 4I2XB 5IESL 3QI9A 4MSWB 1WCBA 3DMMD 3TBTB 5I1IL 2JCCB 1AQDA 4PTTA 2CGRH 2IWGA 2V7HA 3IAQA 5JMRA 5EH1A 1BJMA 4WI4A 4JG0L 4F7EA 4CW1B 1EO5A 5E8DL 1YEIL 2XZAH 5J13C 5EUOE 4XCNB 4KXZH 3BEWA 5ID1B 2FX9H 4GW1A 4OCXL 4YFLF 2ADFH 2NY3C 2R0WH 2CK0L 1OTSD 1OP5H 3OZ9L 3VWKD 3HNTH 1T4KA 1MWAH 3RY6A 3JV4B 3S3PA 3ZYZA 2E9WA 5GS0C 2IAMC 5F93C 4LNRA 4N8CH 1FLRH 3BJ91 4ODXB 5FCUH 4JM2C 5K9OB 3SEPA 4NKOB 4ZTOH 1S9XA 1P2CA 4H1LG 3X13B 1CQYA 1UYWL 4N0FB 4UT9H 5D7KD 4OZGE 1KTRL 1X5KA 4IMLB 1OAKL 1TPXB 4FQQB 4J3VA 3QAZC 3CCHA 2K9UA 4XP9L 4NHCL 5BV7H 5CD3A 2P24B 4FTVA 3TA3B 2CKBH 4DKFH 4LSPL 5C0IA 5IEKB 3PG2A 5LGHL 3LN9A 2CRZA 4FQ2L 4NO5A 4AEHH 5DXWA 3SPVB 1FFPB 4WU5B 3X11A 3F7RA 4XNMB 3B9DA 4JN1H 3TO2B 5KG9B 1SMOA 3D39A 1T80A 5IMLA 2A9MH 5CIPA 1DANT 5ADOH 1UADC 1LD9B 4L29A 1BGXL 3KPRD 4X5LA 1HXYA 4YK4C 4WO4A 4Y4KC 5D72H 1P84J 5LQBL 2FGZA 5E95B 1I8MB 4F37F 4G6FB 2Q8BL 2V5SA 4JRYD 4PY7B 2YRPA 1DZBA 4MA1B 1C08A 3IU4L 5DT1L 2I9LA 3QFDB 4OLEA 3QDME 4KK9C 1E6JL 4NDMA 5F1NB 1TZIA 1CL7H 2VDML 1KLUB 4MCZA 1KT2A 4XMKH 1ZT1B 5I1JH 3UTTD 4G6JL 2UWEE 3N9GH 3HG1E 4XBEH 1U3HA 3UYRL 3X3FL 3MLTB 1J1PH 2B4CH 3ILQD 5TGBB 3DO7B 1AD9B 3UTSD 3U6RA 4MD4A 5C3LD 1X7QB 2A0LD 2ZG2A 4ODWA 5FYJD 5T3XL 1FL5A 3HB3C 1M71B 2FHFA 1CIUA 5EWIH 4S0SD 3IU3A 4BQ6A 3PJSA 1FVCA 4RWYH 4X6DF 1TFHA 2VL5B 2CO6B 1CD0A 4OFYD 1JYNA 4D9RE 3P9MB 1A6TB 3NGBC 3DMMB 1C1EH 2NX5E 1OW0A 4CVXA 4WI7A 2PW2A 3NFSL 3N50A 1CG9A 4QHNB 3DXAB 1U8PA 4NFDA 1MFBL 2XWTA 2YC1A 4FMKA 4PB9L 4ISVA 5EN2B 4D2NA 1MHCA 3UTZB 1HDMB 1N64H 1N4XH 4MD0A 1BFTA 3U7WL 1I7RA 4NJ9L 1DN0B 1BAFL 1Z5LA 2XTLA 1CU4L 4LLWA 4NQDD 1N5YL 2OP4L 3MUY1 4OB5L 3AC0A 3VWKB 2X9XA 3CH8A 3V0VA 1EUTA 4DUVA 5IMOB 2HVJA 1U9KA 5ISZD 3FQUB 4G6AC 3EYSL 2BY0A 4QYOB 5HDBE 4L9LB 3L3KA 1JRHI 1LK3L 1GXEA 3O3UN 3SE8L 4LAJH 1D5BA 4MA1C 3ARFA 3M1BA 1NMAL 1T22A 3P4OB 4QRRD 1Q9WB 3CSPA 2EXWD 3OSKA 2I60L 2QADD 4JCLA 1KIRB 1BEYH 4UUJB 3UBXI 4X5XA 3SO3C 4RQQA 1R3KB 3FN9A 1MVFA 1KENL 3MGTA 3W81A 1FDLL 1SJHB 3H3PH 3RL2A 3DLQR 5DS8B 4RDQF 3BN9D 1CE1H 5GS0H 4WJ5A 1UCTA 4HW6A 5ACLA 5HGAB 4LRNH 2H2PC 1UKTA 5EIVA 1F4YL 1XF5B 1OD9A 1CDUA 5IWLC 3DI2B 4XNUL 3VFSB 4TNVK 3X12B 5JXEA 3C8DA 3HUJE 4JO3L 1OCWH 2GJZB 4YGVA 5T33L 4WI5A 2BDNL 1OP3H 4MD5A 2LVEA 1A9BA 1CICA 5DGQA 3VFGH 4L8SB 5D6CB 3GMQA 2IALA 4GW4A 1LO0H 1UH2A 2PTTA 4GKZA 4BUHA 3MV01 3EYQC 4LCWA 1GHFH 2I27N 1OPGH 4JFQA 4HX1A 2WUBH 1KCVL 4TUJA 4M93C 5I0DA 3MRQB 4XNQB 1QFWI 4JRYB 3I6LE 3Q6FB 4X98B 5JIHA 2ED7A 2X89A 1EHAA 1LP9B 4IIQC 3DX7A 4O9HL 3H9ZA 3LEXA 5JPMA 1F02I 4FQXA 3OKMA 3VFOB 4JDZB 1IAMA 4YGAB 3J8F7 1UKQA 2C1PA 4PJGF 1R0AH 2F53D 4P2YA 5D2NC 4XCEB 4EEEA 3VA2C 3MV11 3UTTB 2EC9U 5CSZB 3B5TA 3TH3T 3MLVL 4OJFH 1NCAH 4KK8C 4S1SH 3ZL4H 1IGJA 3IAGC 4PRNB 1OTTD 1NFDA 2VQ1A 1UJTA 3UTSB 1FRGL 4I0PA 5I1GH 4JGJA 2OI9B 2IPUG 5IJKA 4N8VB 5MEPA 4PJDF 5IW1A 3QG6B 4ZXBA 1HHHA 4QTIH 2FIKA 2G60H 1A4KB 5GRZA 3ULUL 3V4PL 1KPUA 4A6YB 1BOYA 3MYZA 2EIZA 2VH5L 1I75A 2FSEB 2VAAA 4AQOA 1QRNE 4K7FA 2ERJB 3WKNA 4YBQD 3NCYP 1SJEB 3GMLA 1NEUA 1KV3A 4UDUA 1MF2H 5KN5B 2DL2A 2DM4A 2V6HA 1OT2A 2DQGL 2A6IB 1CFQA 4JFYA 4PLKD 5IMKB 1HI6A 3MV8E 2YA1A 3LMJL 2D7TH 5HHOD 4QOKD 1BWWA 1ZAGA 5AWNH 1WT5A 4LEOB 1JTPA 4PJAF 3VXRD 5KW9L 1K8DA 3C60D 5FUOL 4OGXL 3GSOB 4PJBE 3V7AG 1G7PB 1CF8H 4XRCB 3CFCL 4Y0GA 3FFCA 4G42A 1NCTA 4P2QD 3WDHA 1I1RA 4JFOA 4UT7H 5E94A 3MRLB 4Z77B 2X4UA 4KJQD 3ULVD 5C0CE 1JWSA 4JRWA 4PJ5A 5ISZB 3KYNA 5IV2A 3WNMA 3HC3H 3UXFA 3BJLA 4M3JA 4G9FB 1TCRB 1NBQA 4P49A 1G7MB 3MRFB 4UI2A 3MRGB 1II4E 2CLRA 2QADB 3MSPA 5EC1B 43C9A 2DYPD 5HYQB 4UTBL 1I4FA 1RI8A 2B7DT 4KY1H 4UMGA 4ZDHA 3PHQA 1QLEH 1EO7A 1MEXH 3RUGB 3SDXB 3GIZH 4P2RA 4B41A 5DZNA 4Z7UE 3DPBA 1OAZH 1XGYL 3HE7A 5FO7A 5E08L 2AXGA 1T1WA 4Y5YA 2NW2B 2VDRL 3NN8A 1LO3H 1TCMA 4CN6A 2H3NB 2BC4B 2RFXA 3GB7A 4AY0A 5F96H 5LXGL 2GT9B 2LTQB 4I77H 1HWGB 1YQ2A 3AS0A 4NCC1 3Q3GA 4GAFB 3WN5B 5IW6A 3JXAA 2ENSA 3MV7A 2ZSWB 2O5XH 4UB0L 5F7NC 5MHSE 4ETYA 1UB6B 5E56A 4I0CC 1HOCB 3TJEL 3RZCA 4QHUA 4LSQH 5DMJB 5EPMA 5I73B 2ERJC 3QHTC 2WANA 1BZ9A 5J1TC 2KZWA 3QPQD 5TDOB 4UIKH 3GSUA 1IZJA 3RWJB 1D5ZA 1XGPB 2AABH 3OKEA 4WCYH 3F7QA 4HGWA 1A7OL 3QWOB 1VFAA 2F53B 4ODUB 2V5MA 3UPRB 2MPAL 5SX5K 3U4BL 4M1GL 2VLJE 2XNAA 3V5KA 1J0KA 4LPWA 5FKAA 3SDDD 4KROD 1IKNC 4KTYA 1WTLA 1NCWL 4KKBD 5SWSB 3JTTB 5H94A 4X0KA 5INCA 2Z8WC 4Z7WE 3CFIC 4J2XA 3WMSA 2Z91A 1Z0MA 2Z35A 4GMTH 4X7SH 4MA3A 1FBIH 1IGIH 2D31A 4X8JB 3W0WE 5IEHA 4G8GE 1VEPA 2ZSVB 5FYLL 5ETUB 1QSED 4N5UA 4K2UL 1E4WH 3O0RL 2HLFC 2IAMA 3DTXB 4X4ZA 3BQUC 3TT1H 1ACYH 2W92A 4JM2A 1P4IH 2FWOB 2Z9TA 5FK9B 3U82B 4L8CB 3O45B 5I6XC 1FYTE 5ELIA 5GIRB 1LK2B 1GZPB 4F33B 5H35A 5ICYB 4JFEE 5FM5M 4TOYH 1NBYA 2V5TA 4QOKB 3VXRB 1SJXA 2FATH 4U49A 2LTQC 1NGPL 3C60B 5HI3C 1XR9B 4QRSA 3GMPA 3O3AA 2Q76A 1S9VA 2XN9D 3W5NA 43CAA 4Q9RL 1B2WH 3OAYK 5DEGB 2G75B 5DK0B 4P2QB 5ID0A 2VSCA 4AT6B 2BVPA 4FFVC 2J5LC 4EN3A 1Y0LB 1A7NH 5A2FA 1WV7T 4EKXA 1BFVH 1M6OB 5GISL 1F8TH 1BFOB 3LKOB 3WV0A 4JKWA 2WP3O 4MNGB 4L4TA 4LF3A 4WEMB 1A14L 1A2YA 1TQBB 5EA0L 1AXIB 5DHVB 4QHMA 2KUTA 4J23A 4W6YB 1DDHB 2DYPB 4O2CB 4D9LL 2DD8L 3WXVL 2DLTA 3TLRA 5KSAC 3WFDL 3TO4D 4NQXB 1JNLL 4FQIH 2MFNA 4PREB 3DJ9A 4Y2OA 2IG2H 5JXAL 3RL1B 2R1YB 2NY0D 4KVNH 4CVUA 4G5ZL 3QR2A 4U3CA 3O3DB 5IG7B 1QO3B 4JO1H 1T7VA 3WL9A 4KJWD 3QUMH 4X6BA 4PJ7B 2LAGB 3MRJB 3FTGA 2P45B 3UJIL 2P8PB 5DFVD 1FNHA 4EDWL 3K4DA 3RVUD 1R3LB 3KDMA 1NGQL 3CVHL 1ITBB 3L7FA 3EOYG 3T2QA 4X6CB 3BVNB 3G5XA 5DC9B 1KBGL 2GEEA 3OR6B 2ADIB 2EXYD 4PJIB 1CDBA 4ELME 4EI6B 3PXJA 1EA9C 4XP4H 3QG7H 5SWZE 3HI5H 3OXSB 2P5EB 5DR5H 3LDBB 2ZUXA 4KVCH 1Q1JL 3L6FA 1F6AA 4PLKC 4BFIA 5ADPL 3ARDA 1XCTB 1W8OA 1WISA 5E6ZA 1T04B 4JZJB 4MA8H 4RMWA 4X9IA 1OP9A 4OCSL 3RDTA 1AIFB 4EOWL 4A6YH 4HXBH 5GSVB 1QBMH 5DQDL 5KS9E 3C60C 4K9EL 5IESH 3SJVD 4I2XE 1FZOA 4G3YH 4X9HA 2X70A 1QBLH 3SDDB 4KROB 2JCCE 1KCUL 2X4PB 4HSQA 5IFAH 3P0YL 4KJQC 3MLYL 4JG0H 1RZKC 5DVKA 3RVVD 4KGJA 4RGOL 3DVNB 5D1ZA 5E8DH 1YEIH 5ESAA 4HUVB 2YS4A 2R1XA 4LK4A 3L7EB 4GAYB 3ARBA 2H1PL 1HHGA 1T7WA 3LB6D 3NZ8A 1HSBB 1TQBC 3I85A 4UILL 4HUNB 3C2SA 4RZCB 2UZXB 3DURA 1NFDF 1QSEB 3OZ9H 4K71B 4ZUSB 4U4BA 5CILL 4KJYA 4ZPVA 2HFEB 3MROA 2R2HA 2P42B 1LDPL 1R3HB 4U31A 3L1OH 3ALWA 1IGTA 1CFVH 3T8XA 3REWB 4ALAL 5CINL 2BCKA 4ODHL 1PAMA 1EDQA 4I4WB 1UYWH 1JHTA 3QIUB 5C09D 4PV8B 3QPXH 2APTA 1OAKH 1TVHB 4P3CL 2ATKA 3CFJB 3EKCA 3GMOB 5CUSL 3QWRD 4HWBL 3MLXL 4JN2A 3P30L 4XP9H 4NHCH 2C5DC 2XN9B 2M8XA 1G7LA 2YPKB 3KYKL 1MIEL 2DKMA 4FQ2H 5JOFA 3AY4C 2G5BA 3QPQC 2C4FT 3DX8B 2NPLX 3F6IA 4PJEF 3ROOB 4BZ1L 1BGXH 5D4QA 4JZJC 4KRNA 3KPNB 3VFPA 4TSBL 5LQBH 3TO4B 5FEBA 1PLGH 3B3IB 4NO3B 3R4DA 2ZCKL 3STZA 4MDIB 2O61B 2FO4A 1EERB 2E5EA 4OCRH 4E41A 4MQ7B 5F7HA 5IVOA 2J12B 2NY0B 5K9QI 4OZIA 2X4TB 3WJLC 2VLKB 2AXFB 4U1KB 3RPIA 2J6EL 4KKBC 2APBA 1OB1B 5TE4L 4APQC 3NCYS 5AG9A 4QEGA 1INDL 4YPJA 2DAVA 5D2NA 2VDMH 1M7IB 4ZUVA 1D6VH 1A1NA 3DGGB 3N0PB 4H26B 4KXZI 1MJ8L 3MLSL 4WWKA 4G6JH 2COQA 2FNBA 3QYCA 4J4PD 3UYRH 2DM7A 1ZA6A 5DJAB 1IAIM 3H3BC 4K71C 3SE9L 5LBSL 2QQLL 1QD0A 4YHLL 5M95B 1UM4H 3L9RB 3PV6A 5IHZA 1FJ1A 2CRIA 5A2KH 3RKDD 4OD2A 2NY7L 5JNYB 3WJJC 2MSPA 1ZVHA 5IIEB 1F2XK 4OD1L 5IVXA 3O2WH 1NEZA 3QIUC 1HH6B 1I85A 4HIHA 1QSFD 1TIUA 4N9OB 2X4OA 1F42A 5LJYH 3SJVB 3NFPA 1F90L 4FXKA 3T1WA 3WFBH 1EAJA 3S36X 3OGCB 4L3EB 4GBXA 5AUMA 3NFSH 1B4RA 3T0ED 3DXAE 1PQZA 3HC0B 3OWEA 4ZO7A 4NGHH 5EU7C 3FJTA 1GGTA 4PB9H 3X17A 3S35L 4AM0B 3QFJB 1JPGB 4CGTA 3ZKND 5F6HJ 5HYJA 3U7WH 1EFQA 1X6NA 1BAFH 1FSKC 4LSUL 1CU4H 5JLZA 1OAXL 3MNVB 1N5YH 2OP4H 3KS0J 1U8HB 5JORB 4PB0H 1KSRA 3DARA 4J7RA 3KJ6H 4OB5H 4L4VA 2DI9A 1Y18B 4DK6A 1KGCD 3VWJD 1BF2A 1U95B 1RZKH 3P0VL 4KMQA 2YD1A 4TVPD 5GGSA 3TN0C 2AV7A 3STLA 3EYSH 2Y72A 4XAWL 3NIFF 1LK3H 1HILA 1Q94A 3SE8H 4ODVH 3QUMA 1NMAH 3MRHB 4FNLL 1EHLL 5DHVH 2I60H 5JO5B 3BZEB 5C09B 5D7KE 2VR4A 1KENH 1BOGB 1MCKA 1FDLH 1WAAE 1U8IA 3V0WH 1YC8A 1O7VA 3WLWD 2Q3ZA 4JM2F 4QRPA 3RVUC 3A6BL 4M7KH 3F7YA 4GSDL 2DWDA 3CFDA 1NSNH 3P2TA 3OAUL 4AG4L 5HDQL 5LCVL 4BFEA 4XNUH 2J8HA 3FRUA 4PP2A 3TFKC 2MQ3A 9CGTA 2P5WA 3BOVA 2EXYC 4JO3H 2Q7YB 1BF8A 5T33H 1C5BL 1G6VK 3OJDA 4U6TA 1IGCL 2BOCA 3GI9L 1A0QL 1BVLA 3BPLB 1XAUA 1DUYB 2JTDA 1AGFB 3DYOA 2R56H 2MWCA 1GIGL 1KCVH 1JYWA 4OLZH 3WFEL 4N90D 4F7PA 4ZS6C 4JRYE 4C83B 1MREL 5GS1C 1SEBB 1LP9E 2HA1A 1P1ZA 5IUSA 3RVVC 1ZLSL 4MJID 2F54D 4O2EB 2OK0L 2F74A 1ERNA 2PW1A 2HJLB 4I3GA 1AI1L 1EXUA 2YD4A 5C6TL 1C16A 4MMXC 3UTTE 4OZFG 2HT4D 4JRXA 3MLVH 4O51B 2IPKB 1CGUA 2WINB 1CXKA 3TCLB 4UINL 3VD7A 4NNXB 1YMMD 3BYYA 5CZKA 2PF6A 4AH2A 1W2KT 2VTFA 4EQ3A 3QUKB 4TUOB 1C12B 3UTSE 1FZJA 3VCLB 2CD0A 2R4RH 2E9IA 1P7QA 1QKZH 4X4XA 4RAUB 4XXDA 3FMGL 2NY2D 4PGEA 5FHBL 4R4ND 2WW8A 4M7ZB 4HCRL 2C7UA 3DX6A 3BQUA 1CFSB 4F15C 3A67L 4DUXA 4Z0BL 1HH9A 2VAJA 4O2FB 4BK4A 5SWQB 5I1KL 3DYPA 3WO4C 2YUXA 5JTWA 1OAQL 2E9JA 4QTHB 1CS6A 1Q9KB 1KB9K 3PHSA 3QBTB 2R2CA 2DQGH 3GIVA 4IRSB 1MCPL 3T0EB 3B4NA 3LMJH 4ZFOB 3BO8A 4V2BA 4YE4H 1TNMA 1NCBL 5KW9H 1RIHH 3CC5A 3RRQA 4OFPA 3RIFF 5FUOH 4OGXH 4Y19D 4M5YH 4RNRA 5D7JA 4FQ1L 3FQTB 3BPLC 3CFCH 3EO0B 2ATPB 2F19L 3VWJB 4ODTH 3L3OA 4L5FL 3CSYB 3M17A 1PKQA 1P7KB 1T20A 3L3IA 4M6OL 1D5IL 3FCTB 2ICWA 3G08B 4G9FE 1MJJB 4M43L 4NQSA 3O6FB 3CGTA 1HHKB 1MRDH 5J7CC 4M3KB 5F9OL 2Y07L 4C4KT 5DD5L 1R24A 4OI7A 2X4SA 3OJMB 4PRDA 1HKLL 1MCHA 3QIWD 4BQ8A 2WWKT 4HC1H 2W0KA 4JR9L 3RUGE 3SDXE 4GKNA 2GW5A 5GS3A 1S7VB 1NDMA 2XPGA 4RFOL 4J4PC 4U7KA 1XGYH 4WEUD 1R5WA 2V2WA 5E08H 1ZHKA 2WM0A 4CADA 3PDOB 3GBNH 4AIZB 2D3VA 4KDVA 1T1XA 1RUPH 3IRPX 5LXGH 3QCVL 4HHAA 1NGYB 1OGTA 3FO0H 4XBGB 5L9DL 1OSZA 3E8UL 2NNAA 1FL6B 1JUFB 2LVCA 2LU3A 4LLMA 4PLOB 4Z95L 1HHIB 5EU6D 3VD4A 3TJEH 5IKCB 1R5VA 1QP1A 3TC9A 3KGRA 3HZVA 4F2MB 5GRUL 1S3KL 4V2CB 1UXWB 3MNZB 3G5ZA 4NO2A 1F4WL 3HS0A 4EBQL 4JDVA 1XF3A 1CZ8L 5BRZA 2W1NA 5ESVA 1X5GA 4OZGA 3BESR 3WE6A 2VDKL 3TZVC 3O6KL 3I9GL 3L95A 4IRSC 3EYFA 1G7HA 4MJIB 1XGUA 1HQ4A 4QGYA 4G8EA 3IFOA 4Z7QE 3AM8C 5DDHB 4OF7A 2H8PB 2F53E 3UC0L 3QP3A 1S7TB 2MPAH 3U4BH 4HBQA 1LEIB 4M1GH 4JHWL 4OZIF 2CQVA 4OF5A 3RTQC 1DUZA 1YMMB 5A3ID 5EZOL 4NIKB 1NCWH 3EDFA 3JV6B 5L8KB 5SWSE 4PRPD 2J2ZA 1U8OB 3PIQA 5J6HA 2CR3A 1RZ8A 1IAKB 4CBPA 2R9HD 5GRVK 4BA8A 4OF3A 5I66B 5SX5H 2NY2B 4JY4B 1QZ1A 2PCPB 3MRPA 2DWEB 3O6FC 4X99A 1E4XL 4EUPA 1ZGLA 1KJMB 3MO1B 1QPXA 3KLHD 1FPTL 1BBDL 3O0RH 4Z0XB 1PG7W 1I9RL 1HEZA 2HT3D 2R69L 2WMPA 5CJOL 5TDPA 1YEHH 5JW4R 5HDLA 5LGKA 1NL0L 3T2PA 4BSVA 4FQCL 2CDGA 4KHTL 4CNIB 3EJJX 3KPMB 4HKBA 4IOSD 4JFDA 4QOKE 1A6VL 3TP4A 1A6PA 3VXRE 3TVMD 1UZ6F 3HG1A 1NGPH 1CD1A 1JE6A 2UY6A 4RMSA 4Y19B 4P2OC 2YPVL 5CJ8A 5JHLL 4TQEL 4HUMB 5J6GA 3B9EA 4OQTL 3VMNA 4P2QE 3VA6A 1XFPA 4P48A 4ZO9A 3ULVE 1DLHA 3B9KD 4I48B 5GISH 4XMPL 5C9JA 2ZCLL 4HH8A 5EOCL 4MNHB 2XXCB 4MNGE 3R0NA 5FDWB 1A14H 4XP6L 5BVJB 2BNRA 2C3HA 1AGEB 1AJ7L 3LS5L 4YJZL 2DQCL 3OHXB 4NRXB 3OAYH 1Z6JT 4QKXB 2H32H 3WXVH 4D9LH 1MPAL 3MXWH 4XP1L 5D6DC 3R8QA 3QIWB 1VHPA 4OLYL 3T0VA 1RZIA 5JXAH 4XHJC 3CFKA 2EIDA 2IANA 1ORSA 4APQA 5I17B 2X4RA 1KACB 4WRLA 3GSNL 5IFJA 1K9TA 2X1WL 2FR4B 4PJ7E 2MCPL 3FHQA 1VFBB 4I9WD 1BQHB 4U6HB 3UJIH 4GAGL 4Q6IB 4PGDA 4EDWH 4YHZL 3HTLX 3H7BA 3MX0A 4HV8B 2I9TA 2E3VA 3QWQB 4LOUC 1NGQH 4WW2B 1F3JB 4RISL 3CVHH 5I1LA 2W0FB 4JLRA 3UZEA 4JO4H 3S88L 3QUXD 3GJFK 3EIFA 4NUJA 4WUUD 2X09A 4X6CE 4YZFF 5EOQL 1KBGH 4J3WA 2DTML 2HG5A 4POYA 2HWZH 3U0WL 2V7NB 4PJIE 5J1AB 2E6QA 4ODBD 2P5EE 1X9QA 5L88L 1CD9B 1ZGLP 1T1ZA 1T0NB 4DGIL 5ADPH 4N1HB 3RIAF 3KWWA 1YDPA 4JY6B 4EXKA 2D7QA 3PNWA 4OCSH 1GZQB 1MQKL 4YHKL 4EOWH 2GJ6A 5EU3A 2XG4A 4GRLC 3DROA 4Z7VA 1B9ZA 3IETB 5HVGB 5DQDH 3NBNA 2Y5TA 3BPOC 4LLYB 3V2AR 1OGAD 4LDLB 3BMVA 2W65B 4AIXA 5H2BB 4LFHG 5KZCB 1A9EB 3PP3H 2QJDA 5HXMA 4PRID 5DJYB 4IMKC 1JGDA 4UT6L 5KVMC 3P0YH 5BJTB 1FNEA 4P5KB 1H3VA 3MLYH 3EBAA 3GMRB 3ARGA 4PRPB 3JWOL 1LEGB 5BS0A 4GW5B 4NQCD 5FB8B 5J8OA 1FFOB 1FQ9C 3QHZH 4B7IA 5FXCH 5M94B 1BHGA 1RJLB 5B3NA 1H15B 4N0UA 2HMIC 2DIBA 1QSEE 3T4YA 3AAZA 3W9DA 5CILH 2CIKB 3TN0A 5D96C 4JY5H 1WWBX 1W0WB 2D7MA 3K1KC 2ZUUA 3KXFD 5IOPB 5HY9A 5DC4B 4ALAH 5I2IA 5DTFB 4F57H 2BNUA 5CINH 5DD1L 4ODHH 1V7NH 3HAEH 4WGWB 4POUB 2QKIA 2X7LA 3Q2CA 5CBAB 1IQWL 3TVMB 1DEDA 4P3CH 3HMWL 4NT6A 5CUSH 5MI0B 2ITDA 4LCYB 3MLXH 3P4MB 1VFUA 3P30H 4DN4L 3GSRA 1MCSA 2XN9E 3T08A 1PYWB 3FONB 3E6FA 1IEAA 4KK5C 3JTSA 1I1AD 2B1AL 4LU5L 1NUGA 3IDJB 3KYKH 2PTVA 1YNLL 3B9KB 4P9MH 5EU7E 1QBBA 2MQCA 3I75B 1QR1B 2JJTC 1JGVL 2EH7L 2D0FA 3PWLB 1S7QB 5C0RL 2VABB 4BZ1H 4Q2ZA 5C71A 3OKDB 5F1SA 3LN4A 2GI7A 3OX8B 4TSBH 3Q5TA 3QUYB 1FZKB 1TVBB 4NWTL 2ZCKH 3LKSB 5TF0A 2R39A 4HIXL 1YUHB 4P5TA 1A47A 4WI2A 4Z78A 1FCCA 5DRNA 5D93B 5GS1A 3KPLB 1JHLL 4FG6D 3VXUA 2VE6B 4UIMA 2GTWA 2VLKE 4HUKB 4XPFL 2C26A 2BSRB 4DZ8A 3BUTA 3BH8A 2J6EH 1RFDL 5TE4H 2XI9A 1BQLL 1INDH 2P8LB 4ZPTA 1MELA 1FGNH 4ENED 3FB6B 3PGDA 1MJUL 4TUKL 5FKPB 3TBYB 2ILLA 3T0DA 3NCJL 2EO1A 4KGLA 5E2WH 3LPFA 1BX2A 5D7SL 3QNXB 3QUXB 3RX7A 2XQYG 4DWHA 5FV1L 4WUUB 4M61B 3SE9H 5LBSH 2QQLH 4P0DA 3AREC 2Z92A 3HLAB 4YHLH 4ZUTB 3ZT5A 2FJGA 3D6GA 4GG8A 1LQSR 3QUZD 3M07A 15C8L 5F88A 2Q3AA 3VI3E 4LCUB 4YO0A 4JGMA 1SYVA 3HCVB 3L3HA 1X4YA 3F7PC 3RGVD 5EZIL 4Y2DA 3KPPA 3BMWA 4Q0XL 5C0AD 1BVKB 2R15A 3GUTA 5F6IC 3LKQA 5ECJE 2OM5A 5MI0C 3O6LL 2J1KA 3BKCL 3SJVE 5CEYA 1U8QA 1F90H 4GRWF 4OZGF 4QCIB 3VXMD 3HZYB 3TWCL 4BH7B 2CXGA 1AO7D 1N3NA 4PRIB 4UQ3B 5I19L 2OR9L 4L3EE 3OKOA 4HIIA 4CN1A 3QDAA 4HZAA 3ZKXB 2FECL 3IDNB 4RGND 4QHKJ 3B9KC 4NQCB 1G6RB 5C70A 1WFTA 1JK8B 3S35H 5MEND 4WHTB 3QFJE 1FAIH 3CPLB 2EC9T 4EJ1C 1NPUA 1UB5B 4QXUL 3GBMH 2H32A 4J12A 1OM3L 1OAXH 3IVKA 3WFHA 3QUYC 3BRFA 1KTDB 1CK0L 1NGXA 3P0VH 4NRZB 2ICEB 4F7TA 4XAWH 1GAFL 1JZ6A 3EFFB 3IJHA 2EYSB 4B5EA 5JHDD 3RGHA 5T1DL 1N2RA 1D6EA 1L9MA 3KPOB 3NFNA 2ICWI 4NSKB 5BOZG 3KNBB 5C09E 3VFTA 1F4XL 1H8OA 4F9LC 2LU7A 3S7GA 3HMXL 4KK6D 4YXKH 4Y8DC 2JIXA 3CFEB 5C2BL 5EO1A 1L7IH 2H2SD 4QGTA 1HINL 5D71H 4ZNEA 4NKMB 1UH3A 3AFLA 2XTJC 2CO7B 3QEUA 5IHUL 1QFHA 3T3PF 4GSDH 4D8PA 3VW3L 2PR4H 4MAYB 5I0ZA 1I1AB 5JZ7C 1DSFL 3MFGB 3OAUH 3QUXC 5JPNA 2XRAL 5CHNA 1DL7L 5LCVH 5HVWA 4U1IB 1NQBA 4NJAL 4TTDC 4X5WB 1YPZA 1J7VR 3LEVL 3WIFB 3NA4A 1AD0B 2W60A 3BH9A 1S7XA 4JDTL 5GSRA 3RAJH 1MAML 4LLAA 5HGDA 4XZUA 1C5BH 1A7BA 1IGCH 4YNYB 1K4DA 1A0QH 2NXZD 2QSCL 2UV3A 3GI9H 1H3PL 1AXSB 1ONQB 1G7QB 2EYTB 4HFUL 1YN6B 3IS0X 3CVIL 3F5WA 1FVDB 3JUYA 4AENA 1UFUA 3MRDB 5IM7A 3IJSB 3Q5OA 3GMNA 4EDXB 3WFEH 3AU1B 2DOCA 3SDAC 3TZVA 1LVEA 1BQUA 2X1XR 5ACZA 1UQSB 2E7LA 4EIZC 1GOFA 4K7PL 3TBSA 1IBGL 4KH2A 1CCZA 3WEXA 1NFIB 4B53A 3VXNA 2VXUL 3MLWH 4X6EA 5DMYA 3ZKXC 5DEFA 5DLML 1ZLSH 3PHOB 4YFEA 1YN7B 1RIUL 1GC1L 4DEPB 4HG4J 3D18B 1CDIA 2Y4SA 1NC2D 1JF1A 3RTQA 2QLVB 4S10A 2PXYD 2VDLL 4FQJH 1JGEA 1F11B 5JA8B 2DM3A 5DJXA 4P4KB 2XACC 2NLJA 4J8RA 1Y6KR 2HKFL 1K8IA 3PWPA 2WAHA 3DV6B 3QUZB 1YNTA 5TPWH 2VLRD 2F8XC 1A6WH 3D3VD 5FM4A 1WBZA 3PWJB 4NYLB 1I1FA 5IB2B 1KLGB 3ULUF 1LE9B 4M48L 3FMGH 1NAML 2P49B 4F37K 3RGVB 5HDBF 2BXZA 3TT3L 5C0AB 4HCRH 5DEZA 4NFBA 2PYEA 3A67H 4HWBA 2GSGA 1XIWD 4P3WA 5IP4A 1DE4A 3GJFB 1DBMH 3BP4B 5DYOB 4O4YL 5CP7B 4DQOL 5IT2L 3FRPA 2NZ9D 4M00A 1OAQH 5T1KA 2FLBT 1AO7B 4MAYC 4WU7B 2ZOLA 3F8UB 4IDJH 5D7IB 4Z7VF 1ES0A 1J05B 4PJCA 5DD3L 1K5NB 4P2OA 2EEAA 5MENB 1TTFA 1AE6H 1L7TH 2P46B 5C0JB 2YSSB 2GFBB 4PJ9C 5C6WH 3HR6A 2CDEA 3VDAA 5D1XC 5FA3B 3TIEA 4ZO6A 1S7UB 5HDOA 3B2UD 2F19H 4TPRL 1MRCL 3KAAA 1KGCE 4L5FH 5SWZA 2AEPL 4H0IA 3G6JB 4LPXA 5KSBB 3D2UA 2VN4A 2WNGA 5DO2D 1WTGT 3V8CA 4M6OH 1D5IH 4WV1A 5JHDB 4R3SA 2BY2A 5K93A 3JV5A 4CJ1A 5DMKB 4M43H 3C09C 5IBUG 1AGDA 1Z3GL 4XI5C 4YBHA 4ZS7L 1V7ML 4JFFD 4MSWA 3S96A 2Y07H 5DD5H 3BPCB 3TBTA 4DEPC 1KEML 1HKLH 3JWDL 5IVZA 1XGTA 4KJPD 4NNYB 5IBTL 3REVB 2W0LA 2DQDL 4PY8J 4ZFGL 4N1CA 3QULB 4RFOH 1T21A 2OJZL 1FVEA 1U91A 3QQ9D 1URLA 4DVBB 3IT8D 5JOPD 1O5DT 4XCNA 3VXPA 4P4KC 4Y4FD 5ID1A 1KCSL 1FNAA 3GHEH 1B0GB 2DMKA 3QCVH 4OFDA 5IB5B 1MI5B 3GMMA 4GAJL 4P23C 1YNKL 5C0EA 5L9DH 2YN3A 2RCSL 3E8UH 2NXZB 5T3ZD 3MCKB 1IL1A 1S7SA 3Q1SL 3WBDA 1GJIA 3CMOL 5I75C 3U7AA 1AGCB 2NYYD 1UVQB 3THML 5B39B 5K9OA 3JV0A 5GRUH 1S3KH 3VGFA 3GKWH 3QQNA 1XF2A 1F4WH 4EBQH 5F7UA 1CZ8H 3U2SA 1A22B 2J4WL 4N90E 5GJTL 5TH2B 4ZAKC 3D0VB 4S11A 3ETBF 2R4SL 3K46A 3QA3B 2GSIA 2A74B 5K9QG 3O6KH 3QRGL 3ULSA 3I9GH 2DI7A 4NM4L 4Y5VA 1E4KC 4TSCL 1Z2KA 2CRMA 4GRLA 3KPQB 4HIEB 2WIIB 1B3JA 4RMRA 3BKML 4YDIL 3TA3A 5ALBL 3BE1H 1NC2B 3UC0H 1W72L 3S8WA 5IEKA 4V1DB 3FN0L 4KDWA 5FGSA 1SMAA 4J1UA 4KI1A 1AKJD 4P4RA 1T6VN 5EZOH 1YMME 4RMTA 3K4AA 1GGBH 1J5OL 5I71C 5F8RC 1KJVB 2DL9A 4QXTB 2C1OA 2VXQL 2AEQL 3KPSB 3IDXL 2NY1D 1LD9A 2VLRB 3D3VB 5B38B 3IDGB 1KIQA 1KLFA 2XKNB 1KPVB 4L8BA 5AYQA 3L5WB 1ZSDA 5GRXG 1PX4A 5HPMA 1E4XH 3TNNB 4HDIB 1FO0A 4NQTA 4R97B 3SKMB 3ZDXE 1ZV5A 5HJ3B 5CEXA 1FPTH 1BBDH 3BZDA 4TNWF 5IF0B 4DCQA 1XIWB 1I9RH 1CI5A 5GZND 2R69H 5CJOH 5F3BB 1RQ5A 3QFDA 5BZWB 1NL0H 1P5UA 3KR3L 5F1NA 4HPOL 4ZODA 5I1AB 1RK1A 4R7NB 4FQCH 4XHQA 4KHTH 4X4YB 4QXGL 4Z18A 1UA6L 5EDXA 1RURH 4MHHI 1CYGA 4J6RL 1JZ5A 1A6VH 4HJJL 4R90H 1I8LC 4OLXH 2C3VA 3H9SA 3MV9D 5D1QB 3RWGA 3GHBL 4Y19E 2YPVH 2L4OA 2MNUA 3AUVA 1U8LB 3D85B 4TQEH 4MJ5B 4TRPL 3U9PL 1U93A 1BBJA 1T1YA 3VFMB 1JF5A 3DRTB 5DHXB 4M8VA 5I76A 4C4KO 1MH5B 4HWEL 1RAMA 5HHNB 2OYPA 4LSVL 3CH1B 5EOCH 1DQQA 4XP6H 2WWKO 1ZE3C 4JFFB 2DQCH 4U1GC 3W82A 1MPAH 1HYSC 4KUCF 4FRWA 4X83A 2A6JA 1I8KB 3S9DB 4RX4D 4OLYH 3QXWA 2VQUA 1FZMB 5L2KA 3PWVB 3R06A 4JREC 4LKCA 4DN3H 5BZDB 3U36A 2GTZA 3BRGC 3B8YA 3GSNH 3RU8H 5E9DD 5HHMD 4JZNA 4Y4FB 1ULVA 3BT2L 5F89B 3ZTJH 2XA3A 4YHZH 2IBGA 3FT2B 3VWKA 2QV2A 4U2ZA 3KHQA 2VO5A 1FC2D 4RISH 4HCRA 2DQUL 2EDEA 3L3GA 1SYSB 3I02B 4R97C 3QNYB 3S88H 1IM3B 4QNPE 4XPBL 3VXQA 2AKRA 5AEAA 3TV3L 1XIWC 1YPZF 1AXTH 3LD8B 4PUBL 3SGKC 2NZ9C 2JE8A 3SE3A 1DBAL 1IGMH 1R3KA 1WLHA 4H25B 4YC2B 2R2EA 1SJHA 1C5DA 3EAKA 5L88H 2OSLA 5I1CL 4DGIH 5DS8A 4BH8B 3GO1L 1MQKH 2G2RA 1VDGA 1QLRA 4JPKL 4ZQKA 1T2QL 3DUHA 4CJ0A 1WK0A 1XF5A 3GJFH 1MFNA 5D1QC 4K8RD 3RWIA 5FIEA 1A7PL 4OZHA 5DFWH 2H6PB 1AKJB 3B2UC 4KAQL 4UT6H 4R2GD 1VGKB 2UUDH 2KKQA 2X1PA 3LIZL 2BSSA 3MJ7B 4L8SA 2YA0A 3J7HA 3C9NA 4PRPE 5C1MB 5D5MA 1BZ7B 2NY1B 3KPRA 4MDJB 4ZD3H 2OX5A 4L3AA 3WUWA 4L8DB 4Z76A 3BP6A 1WFUA 5GHWH 4I13B 3GZKA 3AXLA 3SKNB 4JRYA 4K94L 3QDJA 3C6SB 2YPLD 4YDVB 1LP9A 1GOHA 1DQJA 3MBED 4ELKA 3F12A 3HZKA 1EGJH 1KB5B 1J10A 3S4SG 1YZZA 4KHXL 1PKOA 1TZHB 3QQ9C 1MRFH 1F13A 3PQYD 2JLLA 5KOVC 1WWWX 5ENWB 4F9LA 1J87A 4GKSA 1GPOL 4QRTA 3HMWH 3UBXB 2ZOKB 1QHOA 1U41A 4XTRC 4YUEL 3CLFL 3MV9B 4CVZA 3AMKA 2YEZA 5E8EA 3Q48A 1FGVL 1NAKL 5KANG 3BGMA 3ES6A 1TTUA 1CDYA 2B1AH 4LU5H 3MRRA 2ESVD 2NYYC 3IFPB 1YNLH 4PJCF 1JL8A 4NUGL 2O93L 1JGVH 3EOBB 2ARWA 1YA5A 4LBEA 5C0RH 2D03L 4YC2C 3O8XD 4HGMA 4C56D 1VPOL 1FV1B 5DQJB 4OUOA 4OLVL 4OFYA 5KVFL 1SVCP 4MGXA 3DUSA 2HTKD 1YY8B 4EI5C 3QEQA 3QIBD 1CIDA 1GC1C 2AQ1A 3T65B 4YHNB 4NWTH 2DLEA 5HGBA 1CGSL 1FP5A 4HIXH 5HYSA 4BK5A 3VGBA 2BFVL 5FYKL 3MRKB 4XPFH 4LQ1A 2NY5L 4OGAC 4X6DB 1A7RH 3D5OF 5E9DB 5HHMB 4ZYKB 3H42L 2V17H 2HJFB 3B2VL 3EW3B 1FLTX 3WHXA 3T0AA 3CX5J 4RFEB 5EBLB 4I9WE 2JCCF 2NY1C 4U3XA 1XCQA 4NQDA 4XRCA 4PGCB 4IM8A 1MJUH 1A3LH 1JTOA 3BAEL 1EAPB 3NCJH 3HA0A 3ILPB 4HEME 5ISZA 5F1KC 5D7SH 3EFDL 3VH8B 4OCMC 3B6SA 3FFDA 5JQHC 5CEZD 4U6YA 2ARJB 4WUUE 3IFNL 1HQRA 3QI9D 5C0ND 5CD5C 4QRRA 4BUGA 4MJ4A 2Q86B 15C8H 3L5JA 5HYQA 5SV3A 3D87B 2VDOL 4XPAH 5BW7C 5K9KB 5EZIH 4Q0XH 3RUGA 2W9DL 4QWWD 4BZ2L 5DURD 4LVOB 3IS1X 5GGUB 1PSKL 1MFDL 1W72B 3O6LH 3P11H 4U1HB 2HH0L 5HYIA 3C6LA 2XXMB 3TWCH 4OQTA 2R0LH 1GCFA 5F9AC 3JSSA 2EEDA 3ALXA 4PRIE 2OR9H 2VL4A 4R2GB 4NQUA 5E03A 5D2LA 3IXTB 3VFRB 5I9QB 4OF8A 3A6CL 3O4OB 3BGFB 4NQCE 3WS3B 3G04A 2LU4A 1J12A 1VFMA 4PJ9A 1VADB 3QDMD 3WS6A 5I8OL 5D1XA 2HRPL 1NDGB 3K7UA 3OPZL 1PBYA 1OM3H 5KVGL 4FA8A 3WUZA 5TDOA 1KXVC 3PWUB 4LLVA 1LE5B 3EDEA 2YPLB 1PZ5A 1CK0H 3JWDC 5DJZB 3MBEB 1K3ZA 3L3JA 1QLFB 5DFTA 4YDJB 1GAFH 3UAJD 4GUPA 3IF1A 5E7BA 3GSNA 3PQYB 3QWOA 5T1DH 3LH2L 4HFWA 3V4VH 1CGVA 3PGCB 4IHOB 3HMXH 3UX9B 3BKYL 1F5WA 4R96A 5C2BH 1UM6L 2CUMA 3VFVB 1HINH 1TZGH 1QFOA 4WO4D 5D7LA 5IHUH 1KN4H 1DBBL 3C5ZC 1RUQL 2AQ2A 1S7WA 1DSFH 2R1WB 2R23B 1NC4B 4PJGB 2BRRH 2ESVB 3LS4L 5DI8A 4KRPB 1OP5K 4P23A 3LEVH 3ORJA 1RUML 4N8PA 1E6OL 1ETZB 3TF7C 4JDTH 3L5HA 1MAMH 3O8XB 3GSQB 4HT1H 4I18A 4XCFL 4C56B 2QSCH 1G7IB 3H0TA 1J0ZA 1H3PH 4ONOA 1UXSB 3F7VA 4HFUH 3QIBB 32C2A 3W39A 5F9JB 3U0PA 2ZJSL 3U0TB 4LLUB 1Q0XL 2B39A 1OD7A 4ZAKA 5CJQL 3I2CL 5HHOA 2QQKL 1S78D 1YYML 3HZMB 3U4EB 4K7PH 4IOFD 2YZ1A 5A43C 4PV9B 4PLNC 1N59A 3O4OC 3BGFC 1QA9A 3EO9L 1GC1H 2A6DB 3DUUA 2B20A 1DTUA 4W4OC 4X7DC 4G6ML 1I9JL 4XMLL 1RU9L 2FBJL 3LRHA 2VDLH 2Y06L 5EZJA 1FYHB 1U8MB 4H1LH 1I7ZB 3QO1B 4ZOCA 1M6OA 3BUYB 3RKPA 4Z7NF 1ZHLA 3LKOA 1IKFH 4MB3A 3QI9B 3LKRA 4XPTL 1WCBB 3WSQL 2FLRT 3LZFL 1AQDB 4NCC2 4PTTB 2FX7L 4FOMA 5KAQG 1DDHA 4WHCA 2V7HB 3QXDA 1NGZA 3H6JA 4RAVA 5E4EB 3SBWA 3NCMA 3O3BA 4F7EB 5HVHB 4KI5D 2Z31A 4HJ0C 3TT3H 5C0AE 3TBVA 3HI6H 3RL1A 2R1YA 5J06A 4N0CC 3ESVF 3QHFL 2AXJA 4HAFA 3O3DA 4LSSL 2VZVA 4KKAD 5IT2H 3SGJA 3X14A 2WBJA 4PJ7A 3MLPA 1AO7E 1T4KB 4Q6YA 2DQFA 5GGVY 3KYOA 3MRJA 1YEEL 4I5BA 1I8LA 3CD4A 1OLLA 4ZTPH 4KRPC 3TM6A 3OMZA 3WLBA 5D7IE 3BP7A 2HT2C 3WNKA 4FP8L 2RIKA 3ARFD 1P2CB 3QDMB 1P4LA 3UYPA 3O2DH 3FQNA 3RWFA 3LKPA 2H9GA 4OZHF 2YD8A 4N5EC 5EBMB 4HWNA 4CL7A 2ADIA 5T5NG 3IGAA 3QIBC 4EI6A 3CCHB 5C07A 2QSVA 2AEPH 3FL7A 5CD3B 3G6JE 4ONHA 5D5MF 5AYUL 1CDGA 4FTVB 4RFNB 5KSBE 5HHQA 4QRQB 5C0IB 1QNZL 1AIFA 5JHDE 4K7PY 1JPST 5DQ9A 1FG9C 4NO5B 2AEWA 2Q7NA 1H3XA 1I7UA 5JXED 1BREA 1IT9L 1Z3GH 2P4AB 5DK2A 4ZS7H 1KJ2L 4S1QL 1V7MH 2JK5A 4GRMA 5H37G 3D39B 1KEMH 1CICD 1LP9F 5JDJA 5IMLB 3JWDH 1RULH 5CIPB 5IMMA 3D48R 4DW2H 5IBTH 2R0KH 3FB5A 4WO4B 4X9BA 5JUEH 3O3EA 1QRND 1TVDA 4HGKC 3DVNA 2VDQL 5ABDE 3K8KA 1OAYL 1GGIL 4DUWA 3JUZA 2N56A 3QI9C 1KCSH 2BVQB 1OQOA 3OB0H 1N0XL 4BFGA 1MI5E 5IBLC 2X89D 3MV8D 2AJZA 1C08B 3RWCB 1T5XA 4DGVL 1EEYA 1YNKH 1JZ3A 4MXQD 2I9LB 5FUCC 3MJ8A 4FQXD 2RCSH 4N8VG 5HVHC 2OXHA 4NDMB 1TZIB 3Q1SH 2JJVA 3IDMA 1R3HA 3CMOH 5DZOA 4MCZB 4QWWC 1KT2B 5IW3A 1CGWA 4KV5E 1NJ9B 4YHYB 3BWAA 3THMH 4M5ZL 5E2TH 5DK3A 4HWZA 1JGUL 3ABZA 4MNQA 1U3HB 2J4WH 5GJTH 3K8MA 2CIIA 4XPHL 5C0CD 2P8MA 4WDIA 3QRGH 1AY1L 4NM4H 4TSCH 4MQXC 1YY9D 5T1LA 5GQBA 4MD4B 4ODWB 1FL5B 4LIQH 5ALBH 2AP2A 4M8QA 3BFOA 1W72H 4V1DE 3FN0H 3DHMA 4NKDA 3PJSB 4HS6A 1FVCB 1YEGL 1V8HA 1T66C 2FX8L 1XH3A 4LHUA 3CK0L 4K94C 2WLYA 1J5OH 5INDA 1F3DJ 3DX8A 2A77L 2VXQH 1MHHA 2AEQH 3IDXH 5E00A 3ZE0E 4CVXB 3KPSE 4OM1L 2VLRE 3F65A 5E7FA 3D3VE 3DWTA 1AQKL 2PW2B 1VACA 1VGEH 3TO4A 5HYFA 3B3IA 2BNQA 1U8PB 1XF4A 4MDIA 3AS3A 2XWTB 4U0RB 3HMXA 2YC1B 4OTXL 4ISVB 4OFVA 4MX7A 1KXQE 1LO5A 2QQNH 2X4TA 4MD0B 2ADGA 5JOEA 3CJJA 4U1KA 4LAQL 1Z5LB 3GSVA 3MUJA 3I50L 5F9WC 3ALPA 1KPRA 1S7RA 2OTWB 3FFCD 3KR3H 3PABA 3V0VB 4HPOH 4QXGH 2YZ8A 3NPSB 4PJ5D 3RUGF 5KBNC 4WTWA 3EHBC 4J6RH 3L3KB 4HJJH 5KTEH 1H8NA 1D5BB 3ARFB 1BLNA 1T22B 3M1BB 4FZ8L 5C9KA 3IRZA 3GHBH 4GQ9H 4X5XB 2MHAA 3GJEA 3H9YA 3GNML 1IGFL 3MGTB 2G5RA 4TRPH 1FHGA 3U9PH 3MRMA 2YD3A 4GG6A 4M7LL 3T77A 5F7DB 5D2LF 2AJXL 3CXHK 4IRJA 4WJ5B 4LKXA 4HWEH 1WWAX 1U42A 3EDJA 1U3HC 1QSZA 3HE7D 1TENA 4UV4H 1K2DA 5LAXA 4CAGA 1S78C 4YHIA 3OKNA 1JPSH 2NY5C 3FQRB 1K4CA 3PE9A 4EI5A 3UYOD 4FQHA 4YGVB 3MFFA 4JFFE 4MD5B 3BKJH 1A9BB 1CICB 1YQVL 3GMQB 2IALB 4GW4B 4G8GD 2M2DA 3ZDZE 2PTTB 3MV7D 4GKZB 1OARL 4H1LA 3C5JA 2VZ3A 3DRQA 1QRNB 3I3DA 4LCWB 1LEKA 1S9KC 3RZCD 1KYOK 4HX1B 4TUJB 3RIFK 4XWOD 1IJ9A 3N1FC 3BT2H 2Q1EA 4YPGB 3NCEB 2OZ4A 2M1KA 1OW0C 3MV8B 4JFED 1D5MA 3DX7B 5JPMB 1NAMA 4X6FA 4HS3A 4FQXB 1Y18A 3K3QA 5DRZB 4OGYH 5T3ZE 1TETL 4U1JA 1IC5L 2C1PB 1E4XI 3G5VA 3FOMA 3UTQA 5CEZH 3TV3H 5I8CA 5IK3A 4KKAC 3W2DL 4Q9QL 4UDTA 2E6PA 1UJ3A 1IGJB 1DBAH 5C09A 5BW7A 3RHWK 4HUXA 2BOBB 2VQ1B 4OI9A 4AL8L 1I1CA 5I1CH 5IFHL 1J8KA 3GO1H 4I0PB 1NBZA 2IPTL 5MEPB 1XGQB 1NCCH 4JPKH 5IW1B 1T2QH 4UTAL 3S37H 2NY3D 1HHHB 3ARFC 5GJSH 1WFNA 1A7PH 2YKLL 1KPUB 1U8JA 5FA4B 3MOBL 4CMHC 5GS0D 4F58L 1RUKL 5BV7B 4XNXL 2IAMD 1MHPL 3TYFA 3VMPA 4ORGB 1YEFL 3GMLB 3LQZA 4JG1L 4JM2D 4UDUB 1FIEA 1ZOXA 1U0QA 4LSTL 5FO8B 1L9NA 5BCAA 1DUYA 2AJYH 4JFYB 1CBVL 1CFQB 3U79A 3BD5A 1AGFA 2Z93A 1HI6B 2D0GA 2X1OA 2XG5A 3QXTA 1D9KA 1UG9A 3I6GA 2NW3A 3I84A 2D2OA 4M03A 4K94H 1JFQH 1CICC 4XPGL 4JKPL 2BY3A 4NQEA 2DLFH 2IF7A 2HP4A 5F72S 4KHXH 1IC7L 3FFCB 3DGCR 3JVGC 3IDUA 4JFOB 4O2EA 5E94B 5J11B 2X4UB 4EN3D 2HJLA 1JWSB 4PJ5B 3KYNB 2D9CA 5IV2B 5E1AA 1GPOH 2VITB 4C58B 4L4TD 4XB7A 4LNVA 2J8UB 3K2UL 2CLRB 4MJ6A 3MV9E 1T83A 4FQXC 4JANA 4PJ7F 3MMEA 4HLZH 4JVPA 43C9B 1ZVSA 1FGVH 4OD3L 3QUKA 5B8CC 1I4FB 3S3JA 1FIGL 1OTUC 4O58L 4ZDHB 2QR0A 1L6XA 3PHQB 4ZSOB 4P2RB 2RR3A 3QEHA 5HD8C 4NUGH 3IJYA 1EEQA 2OMNA 5FUZL 3HE7B 5FO7B 2AXGB 4NC2B 1T1WB 4QF1A 4Y5YB 2D03H 3DBXA 3NN8B 4JPIA 4Q74A 1QSFA 1VPOH 1XT5A 3OXRA 5C8JA 2RFXB 3GB7B 1YY9C 2A1WL 4O2FA 5KVFH 4TNVF 4PJXA 4I0PC 2FDBP 5IJKC 5FGRA 3Q3GB 5IW6B 1U6AL 4KTDL 4ZXBC 2FB4L 3MV7B 4KWUA 3Q6GH 3OR7A 2BFVH 3T0EA 5TE7L 4IRZL 4ZFOA 3RZCB 5I18L 2YD5A 2NY5H 1GSMA 4WTZA 4K3DL 4X6DE 5EPMB 1I1YA 4NC0B 5E9DE 5HHME 5FHAL 3B2VH 1BZ9B 3HB3D 1JWUA 4W4OA 3GSUB 4Y1AA 3U7YL 3MOAL 3ARRA 2BZDA 4YR6A 1D5ZB 2EE2A 1CLCA 4LCCA 3OG4B 4HGWB 3EJYC 3TPUB 1CWVA 3RDTD 2FL5B 5CS7A 4L1HA 3UDWA 2XNAB 3V5KB 3IFNH 2DMBA 2HLAA 1MJJA 5FKAB 2H45A 8CGTA 2YK1L 1H0DA 1F58L 2YHGA 1J8HA 2FYYB 1CFTA 1ZT4A 3CDGA 4M1CD 5GRYA 5H94B 4X0KB 1RUAH 5INCB 5EO9A 1OAUL 2BSTA 2W9DH 3ARBD 1PSKH 2Z91B 3E3QE 2Z35B 4LIQE 1MFDH 2NY3B 4H88L 4MA3B 1S8DA 2D31B 4U6XA