4MS8D

42f3 tcr pcpb9/h-2ld complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
b'AVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha
molecule tags Immune system
source organism Mus musculus
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
total genus 61
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8D02
3DX9A 5C0BB 3RZWA 1NCCL 5ITBH 5KANG 5FYKD 4V1DE 5BW7A 3VXME 4LP4A 3V4VL 3ABZA 1U0QA 5K9JL 4PJDB 1QFUL 2V2TB 1EO8L 5I1HH 3V5KA 4LSQH 4F58H 2X4NB 4D9RE 1A6WH 5D71L 4JZJB 4WUUA 4G7YH 4DFIA 3AUVA 3RDTB 1YN6A 4UZGA 1RD6A 4R8WH 1UM5L 1CXKA 4E42A 3QCVH 1OAYL 1LO3H 3WJLA 1AQDA 4PG9B 1QRND 3VFUA 2JB5L 3B3IA 1HHIB 3JV6B 4JM2F 4UU9B 3MRFB 2IF7A 1FZJA 5CMAA 1M7DA 4M1GL 1BP3B 5HHQA 1ZGLB 3HG1D 1A3QA 4QGYA 3UYRL 3P0VH 5HGDA 3VW3H 2IPKB 5I2IA 1S7VB 3UP1A 2EECA 1SJEA 1T03L 1KCLA 3CPLB 1J9CT 5MERB 1RZIA 4GBXA 3DV4B 1S5HA 3WSQH 4GJTB 2BVQB 5JDSB 2EDXA 5I8EA 5TE7L 1S9XA 4WFHE 2EIBA 5JR1H 1JGVH 2R1YB 3ALWA 3IRPX 1KTLA 3FQRB 4OIAA 3QA3B 4DOHB 4EKXA 5GS2H 4L3EE 4UV7L 2E5EA 1I1AD 1OAXL 2DM3A 4IJ3B 4FMKA 5FKAB 1G7HB 4OZHB 5HYIA 1UM6H 5FGCE 5ALCH 5E2TL 3CMGA 1QSFD 1IQDB 3BH8B 3E8UL 2IEPA 5HI5C 1LO3L 1OAYH 2XNAB 4JFFA 1GOFA 2P48B 3EDEA 4YQXH 1WQVT 4B41A 1PG7H 3C08L 1OAZL 2W9EL 2R69L 1FORL 4JFYB 4I77H 1X3DA 5FK9B 4JFQA 4ZMAT 4M6ML 1IQWH 1UB6B 1T0PB 1EX0A 4MA7H 5GS1C 3BKML 4DGVH 1U8HA 1VDGA 1JGDA 5HGAB 1NUDA 4Y16D 1N2RA 5GSRB 2G5RA 2FR4A 2QADB 3MXVH 1DQDL 4LSVL 3MRHB 4JFZL 4NKMB 1HQRA 4PJ5E 2XZAL 3RUGE 5L2KB 1JFQH 4JGUA 2FB4H 5IW1A 1E4KA 5D2NA 1NAMB 2I5YH 1C7TA 1EGJH 3ULSA 3C6SB 5HXMA 2EDDA 4QLRA 3HRPA 2HH0L 2XQBL 3GSWB 5AD0A 2A38A 2NY2B 5LAXA 3HG1A 4CU6A 1EV2E 3KPTA 3X3FH 3KPSA 3TCXA 2A6JA 2BRRH 3VXTB 4JFXB 5E24E 4XVUC 4OD2B 3QEGH 3L3DA 4YHNA 3MJ7A 4C58B 3CSYA 3OJDA 1JWMA 1I9EA 2YD3A 2CK0L 2EYTA 2BJML 2YUZA 1HSBA 4TSAL 3FOMA 3O8XB 2QKIA 4NN7C 3QXDB 1ZGLM 4JPVL 1AD0A 1NANH 3LEVH 4EN3A 4RAUA 1I9IH 3OL2A 4R90L 1Z9LA 2QQNL 3PL6A 5HDLA 4TTDD 3UBXB 4M6AA 2VDNH 1L6XA 2E6PA 4ZFOL 4HIIB 5SWSA 1QLFB 4GW5B 3HS0B 1HOCA 1OT2A 2ZUYA 3MGAA 1U92B 1XGPA 1GGIL 2PCPB 3KWWA 1K4CA 3S8WA 1UKQA 1KIPB 4S1RL 1I7TB 5J9PB 3IFOA 3QIUC 4JDTH 3BGMA 3ZDZF 5D93C 4JHAL 4X7EC 5IR1B 1TPXC 1X4ZA 4FQCH 4G6MH 3VDCA 5HYJE 3CH1B 4ALAL 3MBXL 4ZUVA 2ADFH 3FB7B 3NCMA 1EMTL 4V1DA 3QRGL 5F7DA 4NQXA 1R5VA 5FCUH 4H8WH 2BDNL 1KBGH 4XCYA 4YBQD 5EUOE 5EU6B 3KNBB 5D1QA 5ANMA 5GGRA 4Q9RL 3O9WA 1Q0XL 3D9AL 4QHUA 5EZOH 5TDOA 3S5LA 5D70H 3FO2B 4WDIA 1FFPB 2ATPB 2VXVL 1GGBL 2XACC 4JGMA 3UTZB 2H9GB 2HFEA 4X6DA 5CD5C 5C0GB 4X7FC 1NKRA 1I3UA 2VLKA 1Z9SA 4YNYA 3DURB 2A74B 3QFJD 2BVPA 4NC1E 5GRUL 1T04B 3TZVC 1X5KA 5C0AA 2B1HH 1NLDH 1A3RH 3T2OA 3I2CL 4IOSD 4NQVA 4QHKJ 4M7ZB 3AB0C 5FA4A 2JCCE 4TUJA 4XNQA 3QPXL 5C9KA 4NN5C 3EJYD 3CLFH 3PXJA 4N0CC 2CIIA 4XVJH 3IS0X 3TBWB 5I1LB 3D39A 3WS6A 1KF9B 4JG1L 4LGRB 3MBXH 4NO5B 4PJHB 4FRWA 5E2VL 4K7PY 1N0LA 3S3SA 1A6TB 3PWJB 2YXFA 1U8HB 1KJ2L 3I50H 1FC2D 3OGCA 2YWYA 1JNLH 3LKQA 1OGTA 4EI5C 1OGAE 1ZHLB 2NNAA 3DROB 4DK6A 4LEOA 3RX8A 4XPGL 2HRLA 3W5NA 3WD5L 2A9NL 3ZKXB 3DYOA 1NGYA 5K93A 1UZ6F 1OAUH 2IWGA 3UTTA 2X41A 2R0ZL 2AXJA 1NANI 4JAMA 4PJ5B 1OAQH 3OZ9H 1U6AL 1IGCH 3GSQA 2FATH 4NUJB 2XA8H 5K9QI 3AY4A 2EKSB 3S35H 5I19L 5E5MB 1MFBL 4DEPC 1M71B 1XGYH 2X9YA 1IFHH 1DEEB 25C8L 3EYOB 2AXHA 4JKLA 4S2SB 1JNHA 4G43B 4LP5A 5GISL 5FYKH 4DK3A 1J0YA 4U6XB 4QHMA 3T1FB 3DHJA 3GSNA 1UEMA 2PF6A 3WIHH 3D3VD 3THMH 2LTQC 3GK8H 3KDMA 3VXQA 1ONQA 5B4MC 1OGAA 1WCBA 2NY4B 1DQLL 1FBIL 4HXBL 5EU6D 4YX2H 4LASH 1GSMA 2X4QA 1YMMB 3V7AG 4X80H 5F7KC 1XF5A 1ZTXL 1QO3B 3BZ4B 3ZO0A 1MVFA 3BMWA 2ZUVA 3UTSE 1MHEA 1KTLB 3CDYA 2J8UF 1QR1A 5JHLL 4U1HB 3MQIA 4PG9A 5IB3B 1AKJB 3BKCH 1B0GB 1XIWB 3GMOA 3ULUC 4PTUA 3TBTA 5BXFB 1JGUH 1TETL 1HHGA 5DJ6B 2OZ4L 5IG7B 3WJJA 3PIQB 4F37F 1NEZG 1M7IB 3CU7A 1A7PL 5DUBB 3ULVE 3CPLA 4YDLB 3OKNB 5CSZB 5T3XE 2CKBL 3GB7A 4P9HL 2DQIH 4G8GE 1PLGH 4K3EL 1MWAH 5GGUB 4PP1D 12E8L 4UIMA 5KVGH 2H9GA 2HFEB 2DQFB 2H1PH 2Z31A 5AZ2H 1QRKA 1TZHA 3KPLB 4JPWL 2MKWA 1A3LH 2VN4A 3UO1L 4JHBA 4J2XA 5GGRB 3VG0H 3NN8A 3DMMD 1S9YB 3CMOL 1ZTXH 5IG7A 4FQ1H 1S7RA 1CLYH 4RMWA 4XBPA 1HINL 3K3QA 4MB4A 4OLUL 1NCBH 4X7TB 2FLRT 5DK3A 2HT4D 1G7PB 3CLEL 1FFOA 3O3BB 1S7UA 1U93A 4IHOB 2YD6A 3O4LA 3T4AB 2F53B 4EOWH 4UV4L 1KEGL 1QLEL 2B5IB 3QEQE 5FHAH 4JR9L 2CLZA 5MENB 1CFQB 1FCCA 1RK1A 1LD9A 2D9QB 4YHIB 1DVFA 3BHBB 2V7HA 2YPVH 3SHSA 1GPOL 2VO5A 4OCRL 3ARGB 1BGXL 4ONFL 5FYJE 3LS5L 3T77A 3LN5A 1X9QA 4X9IA 5TF1L 4CU7A 3QHZH 2A83B 4KY1L 3U1SL 1AP2B 5I8OL 4KTEH 1KCRL 1TDQA 3VI3F 1WC7B 3MODL 1NC2D 3V6ZB 1DBAL 4R96B 3VRIB 2DKUA 4OGAD 1WUNT 1BBJB 5F9WC 4FP8H 1MQKH 3L9RB 3QCUL 1L4IA 4JPIA 5CJ8A 3DYMA 4N0RA 2VIRA 3B9KC 4P2OC 5IEKB 1DQTA 5ISZD 4PRBA 1D9KA 3GSQB 3QG7L 3QG6B 3CMOH 2ZUXA 2KQNA 1FH5H 2A6JB 1QEWB 3E6FB 1EEUA 2HFFB 1KXTB 3KYKH 1QG3A 4K3HA 3LKSA 2EDQA 4X6EA 5IB1A 2NW3A 4LOUC 2V9QA 1YC8A 1NGYB 3ES6A 1CGYA 1X5GA 1SY6A 4F7MA 5DEZA 5DA4A 4NQCB 4M93C 5IFAH 5FUOH 4N0YL 1P69B 4ODSH 2YPVL 5F7FA 1NMCC 3OX8A 4JCMA 3RAJL 4N1EA 1ROWA 3UTOA 1A6PA 2OL3B 1F42A 4PJAA 3KR3H 1C5CL 3S5LG 4RWYH 2P8LA 3GGWA 4Z0BL 3T2NL 2QADD 4PB9L 2VDML 2WP3T 4LLVA 4AENB 1A7OH 3MA7A 1CXHA 3F7QA 2A9MH 1KB5A 2FYYA 3TA3C 2BSTB 4R4FL 4YZFF 3C2AH 4YO0A 3TP4A 3U30C 2VZ1A 5JPNA 4X0KA 3OKKB 5JPMA 4IRJA 2XY2A 2QHRL 5IWLA 4MJ4A 4X6DB 1B4JH 5KZCD 1YMHB 2JF1A 1CYGA 1T0NA 3CDGA 2A74A 5F7NC 3DTXA 2A77H 2DQGH 4XXCA 4XGZA 2ADGA 4UDTA 1G1CA 3Q6FB 4LNRB 5C08A 4WJ5A 4JO3H 3QFJA 3ESVF 2RAMA 3OMZA 3T04D 5K9KA 4NOBA 4H0GA 1HEZB 5JUEL 3S34H 4ZG1A 1UACH 3O2VH 3HRZB 3SDAB 4OCNC 4PLKC 3RHWK 4HLJA 5EUOB 5EU6E 4HQQH 3DI2B 3O6ML 1CVRA 5AG8A 2QR0B 2M8XA 1CDJA 3T2NH 5KSBF 2VLRB 2VDKH 4I2XA 4LCWA 3IU3A 1UYWH 4RBPH 1RZ8B 3REVA 1UENA 4WENB 4QRQA 1T21A 2XWTA 4NZTL 5DLMH 4OD3H 3QUML 4UAOB 5LCVL 3GO1L 3IXAA 2EC8A 3WMSA 4O9HL 5D1ZD 1A9BB 1XGUA 3MRBB 3OJMB 3O8XD 3JSSA 5D1XC 1OQOA 1Z0MA 4LSSL 1MFDH 2FIKB 1L0YA 4PB0H 1IGIL 3D6GA 1QSEB 4IRZH 3UC0H 2PW1A 3FFDA 3QO1A 5KW9L 2OXGA 5H37H 4Z7QF 3H9ZA 4UQ3A 4LHUB 1CFQA 1RUMH 5I6XB 3DECA 2XTJC 2V9TA 4C54A 3L9RA 4XMLH 5DQDH 3HR5B 1XR8B 4H25B 1NGQH 1QACA 1RUPL 2DQDL 4K3GA 2NY1C 4ZSOA 3F7YB 2ZZUT 3QJHB 4P5MA 5E2UL 4KKBC 4R3SA 4AIOA 2H3NB 2R2HA 3MZTA 3WKML 3V0WH 2CKBB 5J89A 3KDMB 4LIQH 4NCC1 5FV1L 3ARFA 2VDRH 1Y0LA 2ITCB 2ZOLB 2WWMC 2K9UA 5CCKH 2BFVH 3GSNB 3M8OH 1NFDB 1BLNB 4B0MM 2G9HA 2O5ZL 4IS6B 4OF5A 5IVNA 4Q97A 1G9ML 4PJFF 4MNQD 3TIEB 1BVLA 2WUCL 2DQCL 4I0PD 4P4KC 1DBBL 5TPWH 4PJBA 4L3EB 1IGYA 1XF5B 3MV7A 2YS4A 1CDYA 4Y0GA 1FNGA 4N5UA 4HMEA 5FYLL 3DRQB 4GRLD 3AROA 2Q7NA 4PRHB 4G9FB 3LN9A 2WQRA 2XZQL 1JE6A 3VWJA 1DQML 3I02A 5E4IA 2W07A 4XNYL 4CJ1A 4OZFH 4KKCD 3WUWG 4U1MB 1J8HE 4NP4L 1EGJA 1T20B 2XI9A 4OQTL 1OT1A 3NFNB 3WDHA 3AMLA 1KFAL 5B39A 1I7UA 1XIWD 3IFPB 5IQ9A 3HAEB 4OCWL 3WNLA 3T0ED 3T1WA 4LPCA 3NCYS 3QAZB 1A1NA 1GXEA 1KPRA 2GITA 2X5PA 5HI5D 5J13B 4PFEA 3ARFD 5M95B 1I8LC 1YEHL 2Q76A 4Y2DD 3BPNC 2Y6SD 3HE7D 4XWGL 1PEZA 1HZHH 2GT9B 3RZCC 3KPPA 2DQCH 4ZUWB 3QDJA 5DD1H 4UTAH 5HYJD 5DRXA 1DEDA 4P2RB 4A6YB 4EN3C 5J12B 4PTTB 1GZQA 3ULUF 2OCFD 2BRRL 1FL3A 3CFBA 3DMMA 4MX7B 5E8NB 3VGBA 2OP4H 5ESAB 1TZIA 1P4IL 4MQXD 3ZHKA 2AJZB 1KENH 2CK0H 4AYFA 3IETB 5D72H 2Q7YB 1KV3A 3TT3H 2A6IA 4XHJD 1A6VL 4R4BA 3ULUE 3SKOB 1CU4L 2AJYH 1JF6A 3WCYA 1QSEE 3ARDD 2KUTA 3H3BC 2PO6B 4ENEC 4KV5F 2H6PA 1T1YA 1E6OL 1CFSA 1FYTB 1TNNA 4ZTOH 4MNHA 1UQSB 1MCIA 3IDNA 3UPRA 3P4NA 3EFFB 5HDOA 1EEZB 3M17B 3WBDA 2BNQE 4FQQA 4Q6IC 4M5YL 1RZFH 1RZKH 3DX9B 4FTVE 1Q94B 3MMEA 4KQ4L 1SYVA 1MJJB 4KHTL 4CVXA 5C7XL 2P8PB 1INDL 5T5FL 2R29L 1WC7A 1Q38A 3QUKB 4ZFGH 3S9DB 1LO4H 4JHWL 3R0NA 3RWFA 3L3OA 4GBXD 4ODBD 3QDGA 2CJUL 5F44A 5JMRA 5D70L 3TO4B 4TNWK 2Y5EA 1ZT1B 5EU5A 4Z7UA 3V5HB 2QSVA 4HF5L 2ENSA 2FBOJ 3KVQA 5HYQB 5B8CC 1T2QH 2J8UE 2YPLE 5EU3B 3TIDA 2ATKB 4LDEB 4J3VA 4J4PA 2AV7B 2ZUSA 2OQJA 4NFBA 3X11B 3NIDE 5C86A 3LKNA 4UB0H 1I3GH 1ZANH 4PRDB 5I30H 1AGBA 1QSVA 1XGRB 4IMLA 1W0WA 4JFDE 3VGDA 4OD2A 1ZMYA 4U1LA 5EG6C 1J1OL 4C56B 1F4YH 4P46D 5HHPA 4JFFD 4ERSH 2VDLH 3D5OF 4FNLH 1HHHA 3BH9B 4XVJL 3FAWA 4KK5D 3FO0H 5DD3H 5H35B 4NO3B 1GOGA 1I85C 3W0WD 2CXKA 1SM3H 3GSUB 2L0DA 4OF0A 5GS1B 4M61A 2EEDA 3VGGA 2V17H 4Y4FA 4GW4B 2CDEA 3QIWA 4QXWA 1ZS8A 4E41B 3FTGA 1CICA 5GGSY 4Z5RA 4LARL 1X5ZA 1WIOA 2IAMD 3O3AB 1TJHH 3GBMH 3VWKC 1N6VA 4NNXB 5D6DA 3LKPB 3VFPA 8CGTA 2YUVA 4HK0A 4M8VA 1H3WM 5HHMB 1ZLSL 1Y18A 4KGJA 5ALBH 4X8JA 2HFTA 3DXAB 1G9NC 5HD8D 1KCVH 5CJQH 4LCUA 1TXKA 3QXTA 5T1MB 4K8RL 5HDBF 4HUWA 1OAUL 2R4RH 1JV5B 4NZDA 2ENYA 4XNUL 1KPUB 1BAFH 4P2RD 5DT1L 5INCA 2AJSH 3WHE1 4PRPB 5CGYC 2VXQL 1HEZA 1FVCA 4MQ7A 4GFTB 2IPUK 4FQLH 2VRAA 43C9A 1INQB 1DUZA 5IOPB 5JOEA 4ZFFA 1T5XA 3BRFA 3B2VH 4F7TA 2CK2A 3LB6D 1JK8A 3RWCA 2Z4QA 3LN5B 4HK3J 3QNXB 3QQ3B 1OLZA 2BC4A 2UYLA 3GHEL 4OZIA 4MJ5B 4KKNA 4HMDA 2DKMA 3PGCB 3TH4T 3BHBA 5GGVL 4YBQC 4GSDH 5SWZD 5E99H 4OFIA 1R3KA 1BBDH 4U7MA 1DLHA 2E8YA 1YY8A 3K8MA 3SKMA 2OZ4H 3WNOA 1SVZA 4I48A 1S7RB 2FWOA 3LEVL 4PGBA 4APQC 3FT4B 1HQRB 4MJ6A 4LCIH 1DDHA 5I0ZA 1INQA 2QQNH 3CVHB 4H5SB 3MBEA 5I1EH 5HYEA 4I3RH 4K3JL 1N8ZA 3MUZ1 3GRWL 3MNZB 4IDJL 2NZ9D 4WI5A 1IM9D 3ET9F 3ULVF 3HNTH 4X99B 3P4OB 4HCRA 4EDXA 4OFPA 3KJ6L 4MYWB 3VFMA 4BUGA 3TWCL 3QUYD 4LSTH 2X44D 3BEWB 1CD0A 3E0GA 3WDJA 1AP2A 5F1IB 1D6VL 3C6LD 4NQCA 4C83B 4HJGB 5EFIB 4AEHH 2VZVA 3S3JA 2UV3A 2BK8A 5FB8A 2XOTA 4P5TD 4YBLB 3BI9X 3AVEA 2FX7H 4LDOB 3HI5H 3TF7C 3SDAD 3DRQA 4PR5A 5E9DA 3TGXA 4F3FB 1KEMH 3PP3H 1YEIH 4G6KH 3LEYH 3HR6A 3S88L 3D39E 2F5BH 4JLRA 1VPOH 3F6IA 3KLAA 4YFEA 4NHUA 2CDEB 1GL4B 1ZEAH 3KHOA 4ZQKA 1I7TA 4PTTA 1DVFD 4P2QD 2OTWB 4K3JH 1YYLL 5DZLA 4WUUD 4RA0C 4NHCL 2YBRB 5BRZD 5I8EB 4WCYL 3MV7D 1B2WH 3OF6A 2CUIA 3PDGA 3EBAA 1FGVH 2VLKE 2Y06H 4H1LA 1F4AA 5J06A 1CDBA 3V5KB 4I3SL 3LMJH 5ADOH 1CXIA 3TESA 1AD9A 4FABL 2JTDA 4HS3A 1KLGB 1ACYH 2EDYA 4ZTPL 4NRYA 2XRAL 4M43L 3SDDB 3EJYC 5EOTB 1HSAB 3Q3GB 4F7EA 2GI7A 3UTTD 5DJYB 4Y4HA 1IEBA 4MNGE 3RGVB 4AEHL 1AR1C 2ZCKL 4LLAA 1A0QH 5EUOA 1AQDB 5IFJA 5GHWH 2VKWA 3FB6B 2JELL 4D0BB 1I4FB 4U6YA 4B7LA 4E41E 5CZXC 4PRNA 2YD1A 2VL5A 1SEQL 2AI0L 3RL2A 1PG7X 1HH6B 3WIHA 1KB5H 1MCBA 4NGHL 2APVA 4BK4A 5DD6A 2UZIL 2NNAB 3DROA 1T03H 3SY0B 5KSVB 1BEYL 1P53A 3F12A 1NGPL 5EZLA 3HPJA 5DVOA 3GIVB 1HQ4A 4JPKL 4MHHI 4Y5VA 3PWLB 3WLWC 4JFDA 4AEIL 1FO0A 1XCQA 4O2CA 3MV8A 1AH1A 4GRWH 4YBHA 5HGAA 3BAEH 5I8KH 4OGXL 5DJZB 1KCUL 1KIRA 2DRUA 3FN0H 4OZGB 4LKCA 2NR6C 1CCZA 4JKPH 1JK8B 2WNGA 1YY9C 3IYLW 4X9HA 4P5MB 2V5SA 1ES0B 3ULUD 4P46C 1R3IL 4KJWD 4F8TA 5EC2A 1CT8A 2XYCA 3SBWC 5TFSH 3UPAA 5E8OA 3HR5A 1BZ9B 1IAIM 4ZS7L 5HGBA 2KDGA 2LABA 3HHRB 3MTRA 4GT7A 5EUOF 1IC5H 4M3JA 3G5XB 5BV7B 3OR6A 3SO5A 4R2GC 4BFBD 5JZ7C 4TPRL 1V3MA 3PL6D 4ODXB 5T3ZE 4BYHA 1HDMB 1T1WA 2DQHL 2H41A 4AT6A 1LDPL 3O3EA 4NRXA 1BQHB 4QRRB 1NDGA 3KYMA 1BZ7B 3O2VL 3P0YH 3ZDZE 4N0FB 5H94A 2O61B 4I0PB 2X4PA 1KB9J 3GHBH 3SCMD 1T7YA 5IB1B 3I75A 4HK0B 3L7FB 1NDMB 3ZL4H 1FDLH 3IB4A 2FB4L 1ZHNB 1IJ9A 4NZTH 1L7TH 4OD3L 3VG9C 4RGOL 1SEBB 3FFCE 2HT4C 1WZKA 2GTWA 4GRLB 4PJFA 3L3KB 4MQXC 4HUWB 1F3DJ 1U58A 1K4CB 1U8MB 3MCKA 2HLFC 2MHAB 4LEXL 1DTUA 5B39B 5FDWA 2B0SL 3BQUD 3TIEA 5T1DH 4UTBH 3CX2A 3MRJA 5IMOB 3MJ8B 3KYMB 4NRZB 3RJQB 1CXEA 4WUUB 3ECBA 4Y4KB 3FOLB 5E8DL 2NMSA 3H3PL 1FPTH 1MUJA 5DWUH 1RJYB 4LVNB 4PJXF 1LK3L 5C0AD 2P8MA 1DQQA 2IGFH 2RIKA 4PJAF 2MTPA 3OKDB 5T1MA 3IRZA 3MRQA 1B88A 1WV7T 3LSOA 3BVNB 5EZIH 1T2XA 2IQAA 1W0YT 3GHBL 3T3ME 3WEXA 2R8SL 4JQXC 1AGDA 2GCYA 3U9PH 3VXOB 4HD9A 4GBXB 3V4UL 1G9MH 4U1KB 4PRHD 3IJHA 3WL9A 2N56A 5C3LD 5I8OH 1E4KC 1OD9A 4Q9CA 3WO4C 5E00B 3E6HB 5DS8A 3BUYB 1CGXA 4X5WA 3BPOC 1MJ8H 2VITB 1XF1A 3SPVB 2CUMA 3MV8B 1B6DA 4KI5C 4ELMA 1DUYB 1I8IA 3QIWC 3CCHB 1EBAA 1FNSL 4AJ0A 2F54A 1VFAA 4X7SL 3UYRH 1AO7B 4G80A 5E03A 3V9FA 5DD6B 1KIQB 5IM7B 3IF1A 5DR5L 2AK4A 4APQB 3WEXB 5JNYA 1R5IA 2DWEA 9CGTA 4NZRL 3ROOA 4Z7UF 5JO5B 3WSQL 5I71C 2GW5A 3ZTJH 5GRUH 4L4JA 5ACMA 2XY1A 3OV6A 3IXAB 2I07A 1YPZB 4YHNB 4XPHL 1A3RL 1Q9KB 2ZUTA 3VFOA 2OSLA 4RAVB 3TCLB 1B90A 4CDHA 3FQXB 5FUCE 5EU5B 3V5HA 3SCMB 1F8TL 2Z31C 4UBDD 1JCKA 1RU9L 4K9EH 3NCBB 4KKAC 1JGVL 4G6FB 1IKNC 3LN4B 1K8IB 1NBZA 1CQKA 3VDBA 3OWEA 2CMRH 4LSUL 3U0TA 2YKLL 5B21A 1D6EA 5E2TH 2J4WH 3UZEA 5DJ6A 5F93C 3U36A 3E8UH 2DMKA 1H3GA 1R6VA 4OJFH 2XZCL 3P4MB 5E5MA 4H25A 2DTMH 2SEBA 4OZHF 4UINH 2XFXB 1AR2A 4KI5F 3BN9D 3HZYB 4R0LB 4Z7NF 3L3JA 3L7FA 2O5YL 2X4QB 4QY8A 3HMXA 4RFOH 5F96H 3U0PA 5D6CB 1KCKA 2HMID 2OI9C 3QWRD 1YJDH 2BNQD 3OKOB 1NCWL 1URLA 5C0RL 5D7JD 1E6OH 1EFXB 4TUKL 3HC3L 2R23A 4IIQA 5J6HA 3GBNH 1FO0H 1Y6MR 4ZAKB 5EU4B 3NPSB 5C0DB 5KSAD 2VLLB 2NY6C 1MFAL 4I1NB 5HYSG 2R1XA 3F5WA 3PQYD 5K59E 2MQ3A 4G9FA 3W2DL 4GMTL 4UIKL 4NNXA 3VH8G 3X17A 4QNPE 1KTDA 3RUGA 3HC4L 1NKOA 1AXTL 2MCPH 2YXMA 4I9WD 4OLVL 4IRJB 2Q3AA 2J8UA 2YPLA 1PKQB 5DUBA 3FQUB 5FF6B 3B8SA 3WUZA 1RURL 1CXLA 3JVGC 1S9XB 2W38A 3C6LB 5ESQB 3QUMB 3SGDH 4XZUA 4C56D 4MQ7B 4DUXA 1QPPA 5TQ0L 5FECA 5DJZA 4FQIL 3UBXG 4LFHG 4GXVL 4P59H 3CC5B 1OSPL 4LGPB 5BS0B 4HZLA 4HDIB 1YUHB 1JZ3A 1F4XL 1JHTB 4XNMB 4NO5A 5SX5H 5IWLC 2R2EA 4XH2B 2EIEA 1NJ9A 4ZFFB 2I60L 1G7PA 1D5BB 1EAPB 4PJXE 5AZEL 2X9XA 5MEPB 4EDWH 5EOCH 3T0EE 1YA5A 3SOBH 4B7IA 4P46B 5B22A 1PAMA 1J8HD 4X7CC 1B0WA 4LVOC 4URTB 1ZKAA 3BE1H 1QNZH 3T0EA 3CJJA 3EDJA 3HC0B 4XC1L 3H9YA 3EDKA 4P5TC 2HKHL 4PJXA 1YECL 1QVOB 5ICZB 4QXTA 5BZDB 2ZUQB 4WV1B 1FV1A 1FQ9C 1RUAH 3CVHL 3QRGH 5JHDE 1XGQB 3WHE0 1F6FB 3BO8A 3NGBC 1MHCB 1GGBH 4OB5H 5B4MD 1LEIB 4QRRA 4L9LC 1J1PL 2NXZD 2XN9E 2HFFA 4G9DB 2YA0A 1BFTA 2YD9A 2BOCA 4OBRA 3QDJE 2JCCB 3MV9D 5D1XB 4I0PC 4MCYB 1F4XH 1I7RA 2A6DB 3I2CH 4CGTA 3U0WL 1YC7A 4MZ2A 4YGVA 5EC1A 4OLZH 1FAKT 4AG4L 4JG0L 3RNKA 1OF2A 4HKBB 1FYHB 2DQTH 1MHEB 4PGDB 1F97A 4N8VG 2EYTB 3CDGB 3MJ7B 5JMOC 4OM1H 1B4RA 4Z8FL 3LKOB 4PBVC 1G7MB 4NDMA 4GAFB 1S7QB 4XAKE 1MH5A 5IBLC 3GMLB 3MZGB 3L6FA 4XC1H 1H5BB 2VISA 2VUYA 1JNLL 5DD1L 3TBTB 1VA9A 5BXFA 2A2QT 4S2SA 2WWKO 4QYOA 2FGZA 4EDXB 2ICES 1HYRC 3ARBA 5GGUA 1PZUB 1KJ2H 4ZQKB 3JXAA 5KAQG 4HUXA 1J1PH 2LQRA 1HXMA 2C1PA 4RAHA 1LHZA 2E27L 3IDJB 3E2HB 3O8XC 1MCHA 1CD8A 2B2XL 5BW7C 1MLCA 5I75B 5CHNA 2V5TA 4EVNB 3U0WH 2Y6SC 1DLFH 5C09A 5D8JH 3FB7A 4OTXL 3FB6A 5CINL 4GQPH 3GGWB 3SKOA 4Z6AT 4JDZB 1VFBA 1NC4D 3BDBA 25C8H 1P7KA 3BJLA 3C5ZC 5EBLA 5FO7A 4BH8A 4OM1L 2KKQA 4WUKL 1CDIA 1NBQA 1PKQA 4U1IB 4U6VL 2GJ6E 2AGJL 3DBXB 5CGTA 3VXRB 2A9ML 2J6EL 3NAAL 2Z0BA 4R4FH 5C6TH 3Q2CA 3IJHB 3WL9B 4N0UA 3D3VB 1WLHA 4BSWA 1CL7I 5J1AB 2VDOH 3TJHD 2V5YA 4FZEL 3VGAC 1LILA 2DQUH 4ZUUA 2VABA 4YEFA 2IANA 1MI5D 3K2MC 1R3LB 2FEEI 5CWSB 5CJOH 3BKCL 3MLRL 1SJXA 3QEUB 1WJ3A 2HFGH 4GMSH 4BSVA 4JM2A 3EYFA 4G8EB 1ZLUH 2FZ3B 2DS4A 5EH1A 2EO9A 3H9SD 3LRSA 3SCMC 4P9HH 1CICD 1WT5C 4KKLC 3RWCB 3RY5A 5FIEA 4F7MB 3VWJB 5L2KA 2FEEL 3TZVA 1ZHLA 4RA3A 4W4OA 4XPAL 3BW9B 2ICWI 4NM8L 5DD5H 4EQ2A 4DAGH 2ARWA 1SHMA 4J4PC 1QHPA 1AGFA 3DV4A 2L7JA 1G7JB 3BIKB 1U8QA 3OSKA 2K1MA 5TF0A 1WF5A 1LE5B 2NY0B 4U3XA 1Q9WB 5ACZA 3IFLH 4GAJH 1CLYL 2MOVA 1N8ZB 3B6SA 4JKMA 4PBWD 3P4MA 4OZFG 1XH3B 4WW1A 2W1NA 1SEQH 3NIGF 1RJZB 3LY6A 3QI9B 4DKAA 3UDWA 1UH2A 3IAQA 2QQKL 5C08E 2CRYA 1ZVHA 3LD8B 3KYNB 3U82B 3ZKXC 5I1CH 3CLEH 3QJHA 5D1ZB 3X14B 3MRIB 1JYNA 2M1KA 3LKPA 2P42B 2VLKB 5ITFB 1JL8A 4CJ0A 3Q5OA 4LSPH 4YXHL 4PJAE 5I15L 3A67H 1WTLA 3VXSD 4CMMA 1IC7L 3DUSA 4JRYD 5B8CB 1NC4B 2ICWJ 4YDKL 3CFKB 1DZBA 2IMMA 3GMLA 4FG6C 5FM5O 5CZVL 4QHLB 1PYWA 2XV6B 1OPGL 4TVSa 1REIA 2WBJC 5TPWL 1S9VA 2Y9RT 1RJZA 4RRPA 2MKLC 1CGVA 3NA9L 4J3XA 2Y7QB 1HHGB 5F7DB 3FQWB 3PHSA 2VLRE 3U83A 4WW2C 4PJHF 4UDUB 4LSDA 1PSKL 4HKXB 3DMMC 4NNPL 2P7TA 5CEZH 4R7NB 5J9PA 3RTQB 4N0YH 4GW1B 3D69B 4PD4K 1GIGL 4J23A 2FHCA 4XP1H 3QUYA 5IFAL 3NFSH 5JR1L 3HAEG 1DUYA 1I8IB 2R0ZH 3BD3A 4N1CA 1HCVA 1FVDB 2YZ8A 4IIQC 1I8MA 3INUH 4XNMA 1FZKA 2X42A 1LO0L 5DMJB 4X5WB 1R0AH 3WLBA 1T89C 1U41A 1TZGL 5EA0H 2VSCA 5IK3B 2X4UA 3BXNB 3KPSD 1OAKH 1QVOA 5ICZA 1CD1B 3DIFA 3F7RA 4Q7DA 4XMKL 5JORA 3ZKNC 4NQTA 2FHFA 4P3WA 4ODVL 4QTHB 3NZHH 1FL3B 3PGCA 2H2SD 4NCDA 3MRMB 3PP4L 3JBG7 3GMNB 1QFWL 2IANB 3T1FA 4WIQA 2GSGA 1DL7L 3BWAA 4JKKA 4Q0XH 1S7TB 4J8RB 1S9WA 3D3VE 3RX5A 3ARUA 4L8BA 1KENL 1W2KT 4WTWA 1QSFE 1VGEL 2GFBB 2P4AB 3VFNB 1RFDL 4X9FA 3SDCA 1M4KA 3I84A 3LRSB 1FG2B 1U8PA 1FGNL 1H3UA 3W9EB 3OKEB 3LQAH 2APBA 2J2ZA 2VH5H 4U7SA 2HJLB 3BWUC 4G6KL 4Z7WA 1KPVA 2HJKB 3C5SB 3T65A 3OB0H 3ARDB 1J87A 2FX8L 1WIUA 2V6HA 2DIBA 2KH2B 4LLWB 5C70A 4HMCA 1Q72L 2NW2A 3BRDA 5IW6B 1BVKA 3FRPA 2QTEA 4X5XB 4Z78B 5GRVK 4DTGL 3O41A 1ADQL 3LKSB 1WITA 4LLDA 2CSPA 5DRNA 5D7IE 2W65B 4U4BA 2IPTL 2QQLL 3T3PF 5EO1B 2B4CH 5I9QB 5ACZB 2P44B 1RZIB 4L4VA 2G2RB 2P24A 2Q20A 3HE6C 5AAWA 1VB9A 2OL3A 5H8DA 1YEKH 2R1XB 3F5WB 1YZZA 5IROA 2G5BB 1QQDB 4NRYB 2DBLL 2UY6A 5GZOD 1DBKH 3SGKC 1JZ4A 2GKIA 2VLLA 4D9RD 5SX5K 1E4WL 3HUJB 2HKFH 4CMHB 3BESR 3ROLB 5E2UH 1AHWB 2E7CA 3GJEA 3VXPB 1NCCH 4UNTA 5TE6H 1PJ9A 2VLME 3N1QC 4XPHH 5MENA 2PUQT 4GRMB 1L0XA 4KRNA 5GQBA 3IDYB 5INCB 5F6IB 2BVUA 2ORBH 2X1OA 5EZLB 1HK6A 1K2DA 4R2GB 2CIIB 1U8LA 1G0DA 4FQCL 2FJFA 3FOLA 1P2CB 2QQLH 2R1YA 3JWDC 2NY7L 4BA8A 5JIIA 4GUPB 1E28B 1N0XL 4FP8L 3EDDA 2V17L 4PRIA 2PW1B 3FFDB 4P2CG 4OIIH 2OJEB 3EDFA 3GSOB 4PJ9B 4QGTA 2WMPA 1U8NB 3U2SB 4KK8D 3WV0A 2DYPB 1F3DH 3PV7A 3TYFB 5CAYB 1GVIA 1XR8A 3BP4A 3E3QC 3G5YB 1GAFL 1QBBA 4RIRB 4MD5A 3T0EB 3ZHLA 1I8KB 5DA0B 3HZVA 2HT3C 4MA1B 5LAXB 3UTSB 1KFAH 1JPSL 4YDJB 4I3GA 2MCG1 4PJCA 3IDUA 4GUPA 1UKTA 2EDEA 1DDHB 3NN8B 3VU2A 3RDTC 4R9HA 1TQCC 1WCQA 3TNNA 4TRPH 3REWB 4RWYL 2XKUA 2O5XH 1AXTH 2MCPL 4TTDC 5A2JH 2R4SH 3DVNB 4YGAB 4IRSD 3M17A 2NZ9C 1J11A 1FL6A 1IGFH 2GAZA 5F6HI 2R69H 4GG8B 3GSWA 1I3RA 1TVBB 2VLMD 5CUSL 3NOIA 3T3PE 3EOBB 4NUGL 4KJPC 5CBEB 1U8MA 3OG6B 2DI9A 4OGYL 4LCWD 1EDQA 3ARYA 3B6SB 3L3DB 5IB3A 3GUTB 4JVUA 3VRJB 4Z7WB 5MEQA 1N5AB 4RGND 4BH7A 3M45A 3C5JB 1ZT1A 3K2UH 5KOVC 2A6KB 4GAGH 1NMAH 3BT2L 1MI5E 1DQDH 1MRCL 3NCYP 3ZMRA 1YMME 5CJBA 4PV8A 4YJZL 1IKFH 3HE7A 4OV5A 3MRLB 1FCGA 5BO1L 3PNWA 4KRPC 4HQQL 3TBVB 4PRPD 1O7SA 4S1SH 1AY1H 5HHXL 7FABH 5SWSE 2R8SH 1K8DB 3UTQB 2NY2C 3VFMB 4X4ZA 2MHAA 5FDWB 4GO6B 3D0VA 3RPIA 2I5YL 2GJ6D 3QUZD 4JHWH 2G60L 1K9TA 3V4PH 1SJEB 3C9NA 4JFOA 4KHTH 1FBIH 3VRJA 5DJ0A 5JW4Q 3RWHB 4X80L 1P1ZB 4POYA 4ZFOB 1P7KB 4HF5H 4OFVA 3WFCH 4U7KA 5CEZE 3MRKB 4EN3D 1SJVA 1UJTA 3VMPA 5I8CA 2NPLX 3QXAB 1U9KA 2HTKC 4LKCB 5INDB 5DDHB 2AVGA 3V2AR 5ID0B 4PRIB 3O2DH 3DV6A 4WEBH 4BSWB 4Y16A 1I9IL 4R90H 3F6LA 3ZDXF 4O2FA 1FLTX 3IDJA 4I0KA 3FO0L 1V3JA 4FFZL 4Y2OA 5ENWB 4JDVA 1RK1B 4S0TD 5I1AB 3OXSA 1NLBL 4PY7B 2FJGA 1H3PL 3WIFA 3KPSE 5I17A 1S9KC 1ZSDA 3HG1E 4ZUUB 3VRIA 1PX3A 4HSQA 1QFUH 4PD4J 4M7ZC 2BNQA 4F58L 1MCSA 1QRNE 4Y4FD 5LQBL 4G6ML 4PV9B 3WFEH 3ZKMD 2KL6A 1A02N 3RRQA 5DFVC 2PTUA 1FRGH 4PJAB 5BJTB 4YAQA 3RVVD 1RJLB 3QCVL 5CJ5A 5HY9B 1EEYB 4KQ3H 3WFCL 3DX7B 1J12A 5F8RC 3SKJH 5ILTL 3FFCB 2YUWA 4NKMA 5GZOC 4YDIH 1S8DA 2J88H 4J3SA 2FGWH 4L9LA 3SGDI 2ICWA 4LSRH 4OT1L 3QDJD 3PWUB 1I1AB 4JR9H 4U1MA 3F12B 1T7XA 4W4OC 2XN9D 5J7CC 2X4RB 4ELKB 3EKCA 2HT2D 4KDTA 1KJVB 4W81A 1NBVL 2DLFH 4QT5B 4ZUTA 4KI5E 1CZ8L 5T1KB 1NLBH 3RVUD 3SKMB 3U0PB 3KPRB 4RWHA 3BDXA 5E7BA 2PXYA 2ZUUA 2FNBA 1TJGL 1FAIH 3CSPA 4JKWA 5DHYB 2ATKA 4NJAH 5I1DB 2E9WA 4GMTH 5KS9A 3VGEA 1EXUA 2A6DA 2YA1A 3VXSE 4CNIB 2C4FT 2GY7B 2PCPA 3KWWB 4PJGE 1UWXK 4ZODA 3ARED 5I1JH 2Z8VC 5F72S 1RIHL 3B2VL 4X0KB 5LGJB 2CLVA 3OKLA 3AC0A 1M7IA 3CFBB 1QLFA 4GW5A 4P9HC 3DO3A 3F62A 1EZVX 1MJ7H 5F3BA 5HI3D 5FOJA 3WN5B 5E99L 4F80A 1SBSL 5C08D 1H8NA 3GHEH 3AS1A 2ADGB 3K80A 1IQWL 1J8HA 5E08H 5J57B 5FV2A 4GXVH 4HEME 1T1XA 2W0LA 2JJSA 1OM3H 1NUNB 4N0CD 4XT1C 4RMTA 4KK8C 4DUWA 4G6AD 4K23L 3S6CA 2PXYD 2D7TL 4XCNB 4HJ0D 1MI5B 2NY2D 3VFUB 5LXGL 1AFVH 3S35L 3RPIB 1MLBA 3MRHA 2FYYB 1FNEA 3EYUL 4N0UE 3AXLA 1NFIA 1D5BA 1EAPA 1UFUA 4OZHE 4FQXC 1L6ZA 5E8EA 4I5BA 2ZKHH 3QUYB 5CHNB 4F57H 2N1KA 3MNVA 2VSDA 5D9SA 4Z0XA 5T1LA 4MXVE 2R29H 3DVGB 2NY6B 1BQUA 2RCSH 3PHQA 1H0DA 1QFWI 4ZFGL 5A2IH 5JOFA 1ZAGA 1ZA6A 3PQYE 1TZIB 4LSTL 4KTDH 2HVJA 3VWKB 5BZWA 2IQ9L 2JJVA 2E3VA 3HE6A 4JDZA 1KEML 4HXBH 2AK4D 3T4YA 3WJJC 4PJHA 3O6FB 1FG9C 2DQEL 2R0KH 3ZT6A 2B1AL 5E9DD 3W81A 1T5XB 1LEGB 3NIDF 1NBYA 2QQKH 3O6LH 4KK6D 1NJ9B 3TBWA 1T2JA 1AC0A 1S7WA 3PWPB 4YFLI 2EZ0C 4RZCB 2NY3D 4Y19A 4P3CH 4PIRF 4MNQB 4KMTL 1NCAL 3QG6A 1MWAL 2GAZB 2BSED 4PRBB 3U6RB 1AGBB 1CN4A 2WIMA 3MGTB 3MRRA 5E6IC 5LXGH 4JG0H 1U8KB 3MSPA 4QRPD 4DCQB 4YZFE 3LDBB 3DX8A 3DETD 2OJZH 4YIQB 1B2WL 3VXNB 1ZGLP 4KH2A 3MLVL 4F57L 4ZNEE 3HMWL 1BOGB 3O6FA 4Z8FH 1AI1H 4WO4B 5IHUL 2BY0A 4JPWH 2AXGB 4LLMA 1XGTA 5DJCA 1IBGH 4BZ1H 2V2TA 1FJ1A 3WFBL 1V7MH 3QJFA 1OP9A 2F54B 4JRXB 4WEUD 4WW2A 5SWQA 5L9DH 4HUKB 5BQ7B 4X6FA 5I74C 4QRUB 1IGYB 3T8XA 1C12A 5B38G 5IVXB 4YLQT 1MIEH 1WZ1L 4JRXD 1ZK9A 3RNKB 1FFPA 2ATPA 4OCRH 3UTQA 3EGSB 3MX0A 2N4IA 1CFVH 3QZWG 2FX9L 5JZ7D 3O4OC 2R56H 3BIAX 5FHAL 3AM8C 3MV11 3V0WL 1NFDF 1XGPB 1KC5L 3WNPA 1Y0LB 2ZOLA 1I9RH 1FVEB 4K94L 4NT6B 4TSBH 1V7NH 1EFQA 1OL0A 4M6NH 3NH7H 3VXUA 1UADC 2BFVL 3QPXH 1NGPH 5D6CA 1T1ZA 3AREB 1U95B 5D2LE 5TF1H 2VXQH 4NYLA 1S7XB 1BM3L 5F9WB 5IJVB 3LEXA 2BNUB 4GG6A 3UXFA 5JTWA 5HVWA 4MDIB 4Y4HB 2V2XB 3L7EB 2VZTA 4ODVH 5DMYA 3P11H 5K9OA 1R24A 3ZDYE 4U6VH 5F88A 4NC2B 3C5ZA 2ERJB 4ZS7H 4Y1AD 4JZNA 3LQAC 4MNGB 3DI3B 1G7QB 4ZFZA 1MFNA 3ARRA 1AJ7H 2Q86B 2Z8RA 4HAFA 4DW2L 4PJGF 5F1SA 1LEKB 4TTGA 4UT7L 2DQUL 3OR7A 1I1YA 4S11A 1B3JA 3N85L 1DBJH 1JGEB 5F8QC 5I17B 2IALA 1A7RH 5FO8B 4Q58C 3TH3T 1CFVL 3D3VA 5C0RH 4X6CF 4GMSL 1HNGA 3D1MC 4HZLB 1EBPA 4P9MH 4X5LA 2D7PA 2XT1B 3STBA 3UROR 2P5WE 1ZHBB 2YHGA 5FHBH 4U1IA 4LU5H 5A2FA 2FIKA 1HZHL 4APQA 1A9EA 3K0WA 3E2HC 3VRLF 4XNZC 3W5MA 1Z2KA 1WBZA 1CFSB 5E8EB 3QEQA 4ORGB 3RVUC 3LRHA 2C1OB 3CCHA 1NBYB 3RWIA 3BVNA 3MMEB 4Y88A 2ICWB 5DK0A 3EAKA 2ADIA 2QV2A 4WWKB 3BP4B 4JFPB 4YHLH 1A22B 1KIPA 4PJIE 3RVTD 3P9LA 4NWTH 5ID1A 2J1KA 2Z9TA 1OGAB 1WCBB 4J3WA 3MLWH 4YHOL 4UT7H 5FUCC 2AEQH 2RJMA 1DBJL 1ZLWH 2DLGA 4YIQA 4X7DC 5T3ZD 5FGBC 1IKNA 1ES0A 5TH2A 1DEEA 4OLXL 2P8LB 1IAIH 5IMKB 2DDQL 2NYYD 4P2QB 1I3RB 1UZ8A 1LMKA 3V0AC 2GSGB 2Z8WC 3BWAB 1IT9H 3GMNA 2V5RA 4QY8B 1C08B 1AGCB 1M7DB 5DLML 4AM0B 2RFXB 5DQ9B 3KS0H 1JUFB 3WFHB 3ULVC 1JI1A 4M5YH 5L2JB 3QQ4B 2D4FA 3VA2C 2DLIA 4LAQH 1DQJA 1FGVL 2VDKL 3IFPA 4IDLA 3ZE0E 5EC1B 4K3DH 1N0XH 3V4UH 4NKDB 2XQYK 1BZ7A 4KKAD 2VUOA 5A16A 1PZ5A 1KTRL 1UEYA 3HFML 3UO1H 4HC1A 4Y5VC 1U3JA 2X4NA 4LNVA 4PLJD 4NT6A 5FYJH 1MCEA 3MRLA 3TN0B 3RY6A 2Z35B 1KUMA 4NQEE 4P4KB 2Q76B 5EU7E 4E9LA 2EH8H 4X4XB 2UVFA 1CE6A 1Z6JT 1H3VA 3EGSA 5HTSA 4APQD 3O4OB 1OP3K 4UDUA 3D0VB 5L6YL 3TT1H 2VDPL 4U1JA 3LCYA 3MACL 4FQHB 3GSNL 2W65A 3EYVB 3U7YL 5ISZA 1GGTA 2F9BT 1X5XA 1P9MA 5JQ6L 2GJZB 1I7UB 5IQ9B 4FQJL 2UUDK 4R7DB 4HCRH 3T09A 3L1OL 1WFOA 2W0FB 4LVHC 4NO3A 3L3HA 2EDNA 3O6KL 4Y4HC 2K7QA 1MLCB 3QUXA 5EDXA 2YPKA 5CCKL 1OVZA 3BZFB 2J12B 2WV3A 4KDWA 4OCSL 2IALB 3K4DA 3P9MA 3QUXC 1JHTA 3K1DA 1ZS8B 3FN0L 1MREH 5GGTH 2XZZA 4G3YH 4K9EL 3RWGA 3BYTA 4XB8A 4Z7OF 5HD8C 5TQ2H 3FONB 2I25N 1NAML 3ULVH 2JCCF 2NX5B 3KPOB 4AMKL 4BKLA 1LP9E 3SDXA 4YHZL 4GS7B 3FMGL 4KROC 4OJFL 3HE6D 3H0TA 3QQ9D 4JM4L 2IAMC 3IDMB 3HCVA 3OPZH 3PABB 4XP4L 4Z77A 5EBGA 4LL9A 5B3JF 2XPGB 1P2CA 2PTVA 1HIML 3NIGE 2MQCA 2UY7A 5IHBA 1EH9A 4Y8AA 2YEZA 3PDDA 4LVNC 5DI8A 3BT2H 5J6GA 1KELH 3P9MB 4JY6B 5MI0C 2EDJA 3KYAA 3L5WA 4A6YL 1OP3H 4Y4KD 3GSOA 4NKIL 1D3CA 4WU7A 1J1XL 4QTIL 3AGVA 4FXKA 3SGJC 4PB9H 2X4PB 4I0PA 3P4NB 4O00A 4JHZA 1OHQA 1CI5A 3TV3L 1JGLH 4PRHE 5J12C 4EN3B 2J6EH 3NAAH 3EJZC 5K59F 4NSKA 4RGOH 2VE6A 1M71A 4KC3B 4G7VH 5HHOD 3LZFL 4UUJA 1OGTB 2ESVE 2UZXB 4X6FB 5CSBA 2X1WL 1SYVB 1E4JA 4X98A 4TVPE 4HUNB 1TVHA 5DUPL 4QEGA 1QBLH 1U92A 3EO1A 1LE5A 2B0SH 4JQXA 1LP9F 4JZOA 43CAA 2AXGA 1YPZE 4JFHD 3WD5H 2XWBB 2CGRH 3I9GL 4WY7H 3BH9A 1FJ1B 3PHOB 1NFDE 4MDJA 2YRPA 5CIPH 4W4NA 4PUBL 1ZV5A 2CXGA 2VLJE 2FBJH 1A6VH 5EFIA 4HJJH 3H9HA 3FT4A 3DHMA 4MJ6B 3FQRA 5LWYH 4KI5D 1TIUA 1A7NH 4MD0A 5DXWA 3AB0B 1YEDB 3EUUA 4M7LT 4NO0D 5AZEH 5LGJA 4A6YH 4OCMC 4NN5B 4ZUWA 3STZB 5IB4B 5I1IL 3RTQD 2PYEB 1TITA 5EZIL 4XBEH 4TVPH 1K85A 1PW3A 4NNYB 2G2RA 3FFCD 1XR9B 4MAYA 4ZOCA 1VCAA 3QDMB 4M5ZH 4N8VB 3TPUA 4NC1C 5C6PB 1D7FA 1UJ3C 1IRAY 3GIZL 1AXSB 5JW3L 4KUCD 1JV5A 1A1NB 4ZXBA 4HPYL 1Y6NR 1U58B 3X3FL 5ESQA 4M7JH 5F3HB 3JVGA 4MQSB 4Y7MA 2EIDA 1MPAH 3BP7B 5B38B 4FMFA 4OB5L 5C09B 5FGBA 3QEGL 4P2RE 4YDIL 4PRNB 2BY1A 3FO9A 5GGQL 1MHPL 2J7LA 3F8UB 3TC9A 3GI9L 3LEYL 3LH2H 3UPRB 3UJJH 2OXHA 3VFVA 3MNVB 5FGCB 3SY0A 5C0CA 5AWNL 4ZAKC 1MCLA 4C57C 2BXYA 3SQOL 1AXSA 4M9OA 2DF3A 5J11C 2C1OA 1ORSB 4K7PH 5DGRA 4Y5YB 1EO5A 1MJUH 5KZCB 1NCNA 2XNAA 2LVEA 2NY4C 4JFFB 4YFLF 6FABH 3HZVB 4NZUL 12E8H 4EVNA 4MXWL 1NQBA 2ITCA 4NWUL 3DO7B 4PJDF 4RIRA 3VMOA 5ADOL 5ESVB 1IAKB 4H26B 5HSFA 2NY0D 1XCQB 3FONA 3BGFB 2F5AH 3Q3GA 4F7EB 1JYWA 1XIWC 1HYSC 4JJHA 5C6WH 1I1CA 1DJSA 2DYPA 4IMKA 5FOBB 2ADFL 4HKZA 4DEPB 4KJPD 1I8MB 2V9RA 2AV1B 3ZE0F 3V5DB 4OIBA 4E42B 1MRFL 4JFFE 3IDIA 4HPOL 3MV8D 4JFDD 4Q9RH 3C6LC 1D5MA 3HG1B 4OFYA 5HVHC 1MCOH 3JWOH 4NUGH 2LTQB 4NP4H 4HWUA 1CFTB 1H8OA 4KJYA 5ALBL 4RISL 1M6OB 1J86A 1YJDL 2WBKA 4WO4D 1DANU 5DVKA 4CVXB 3QHZL 5HYSB 2AJ3B 5JW4R 1Q9KA 5KVFL 4PJXB 2JJSC 4HV8B 4M8QA 5E2WL 4NZJA 2GUOB 1RIVH 4L3CA 4TOYL 3RL1B 4WUKH 5BQ7A 5FO9B 3INUL 4NQCE 3TVMA 3KXFB 1UB5A 1PBYA 1WAAA 4K7FA 3RBGA 2OS7A 3KYNA 2BOCB 4L5FL 3G6JF 5L88L 3VD4A 4LLDB 1WWAX 3C60B 4FTVD 3HC4H 3TBVA 4OLVH 4TULH 5T1KD 1WVZA 5C07E 1RZKC 1JNNH 4U6HA 3CH8A 3KLAB 1EUTA 1TLKA 3EYQD 3HE7B 4JGJA 5GGVH 4P2QE 1M6OA 4WFGE 3BEVA 1A7QH 3OKMB 1SJHA 1LO2H 4DN4H 5EBMA 5A3IC 3G6JB 5KN5B 1IC5L 5BOPA 2IBGA 5C0CE 4F15C 3FHQA 2B1AH 3QUMA 1HHHB 4YH6A 1MH5B 3UJIL 3ZKMC 4YHML 4LLMB 2DKSA 3CXDL 4LKXB 1DFBH 3MXWH 4DGVL 3D25A 1A14H 2H6PB 1DQQB 3RWGB 1MHHA 4WNQA 4KDTC 4FQHA 1DE4B 3MYZA 2V2XA 1XR9A 4MAYB 5KSAB 4JFZH 2I60H 3VFRB 4OZHA 2ESVB 3D85B 4HIXH 5HHNB 2W0KA 5GIRA 4MJIB 4MMZC 1T66C 4EUPG 5FEBA 4QCIA 4M93B 2C7UA 1CDHA 4LEOB 2JJTA 3BPCB 4WHTB 1FNLA 3WXVL 3BIBX 5FFLA 1B4JL 5IMOA 4LLYB 3PV6A 1A7QL 1CIDA 3SE9L 2CJUH 5IBTL 1JTTA 4KRPB 3BJ91 4L1HA 4YUEH 1NGXA 3CFJB 3PG2A 3H7BA 5ETUB 3MLZH 3TN0D 4R4BB 1MI5A 4TSAH 4EZMA 1RMFH 3CVHH 4NJ9H 5FA3B 5JHDB 1A6TA 3PWJA 1DBKL 5IW3A 1INEH 4CDGC 3IKCA 2P1YA 1ZHBA 3VXRA 1VKXB 1ZEAL 2F54E 3WE6A 1T2QL 3G5YA 1SY6H 2HJFA 3HRZA 3PP3K 5J11B 4JFPA 3MR9A 1UACL 3QO0A 4MCZB 1GZQB 2YSSA 3G04B 4GLRI 4OI9A 5GS3A 1UGNA 4HH9B 2EDWA 2EXYC 4JQIH 2FO1A 4P23C 2WWKT 3IJSA 3UYPA 3AM8A 2JB6B 2NX5E 5D7KD 3ZE1E 1YYLH 4PJCE 1RUKL 2FH8A 4Z9KB 4ETQB 5HHMD 4WHYG 3QNZA 3KPNA 1ETZB 3NPZB 2AABL 3GO1H 2ZCLL 3L5IA 4WTZA 4LRIC 5JLZB 3GUTA 2P5ED 2HLAB 5AZ2L 3EYFB 4G8EA 4PYHA 1MNUH 1TJGH 2Z93B 4MNQE 3QHFL 4DKEH 2XTLA 5EB9A 5T3ZL 1NMBL 4KMLB 3NCFB 1E27B 4HBQA 5C0ND 3VD3A 2D31A 1U2CA 5GZNC 5JIHA 1TJHL 2NY1D 2VTFA 4GG8A 3TA3B 3BRGC 5KVEL 1CK0H 3MRMA 2ITDA 5DQDL 1Z5LB 5F6HJ 3O45B 3FT2A 5HHPB 3ULSB 4M00A 1NGQL 2J8UB 2YPLB 1JP5A 3PWNB 3EYSL 2EH7L 1SBSH 5ID1B 5B39G 3L5JA 5GJTL 4HWEH 1NLDL 4XPBL 2G5BA 5BV7H 4I13B 3BEVB 4CAGA 1BGXH 5DHYA 2OR7A 4HFUL 1OM3L 3P4LA 4DVBB 3U4AA 1BVLB 5HHOA 1CE6B 3TNNB 5EO9A 5MENE 2NY0C 5JDJA 5CINH 2P5EA 1V3KA 1BX2B 3C60A 3IDXL 1OD7A 5BOZG 3SJVE 3TN0A 3QYCA 2O5XL 2JLLA 1KYOJ 4PGCA 4NDMB 1AFVL 5D5MB 2Q8BL 2DTSA 1UM5H 1QFWH 2VDQL 1BVKB 1CICB 4Z5RB 5L7XH 4FXGA 5D96C 1OY3B 1JPFB 1KYOK 1E6JH 3C87A 1IGFL 1S5IH 5ERWB 3QQ4A 1K3ZA 3MLWL 4YHOH 4FQQB 5BS0D 4F7CB 3IU3B 2RCSL 3WLWD 2Y1VA 3BGMB 4JDVB 2XA3A 3OAZK 1G9EA 4JN2A 3JWNC 3B5HA 3MRJB 1EHXA 1QFHA 1DSFL 5DTFB 5JW4N 4QHLA 3HC3H 4TPRH 3BQUC 4XZUB 4TUOB 1D5IH 1A1MB 3OZ9L 5IOPA 5C0FA 2WBJB 3DSFL 1BIIA 1G0XA 1T3FA 3RPKA 3RY4A 3S35X 3V5DA 4I3RL 3O4LB 4EXPX 1AR1D 3P0YL 5HYQA 2AS5M 5I74B 4OI8A 1NCAH 1T7WA 3MROB 3IDXH 3EO9H 5CP7A 5BVJB 5EUKB 2QADC 2Q8BH 2ZNWA 3BUTA 5L7XL 3RNQA 3HPLA 4P5KA 2VC2H 3RTQC 6CGTA 2VR5A 2BNRE 2EYSB 1RURH 4JFYA 4WHCA 4HLZG 3BEWA 1KN2L 1QPXA 3QCTH 1KNOA 3BN9C 2B4CL 4AIZB 1MJJA 5BS0E 3K74B 5D72L 5D1QD 4QXTB 1MCQA 5BZDA 4JO1H 3PL6C 4WU7B 1A9EB 3BP6A 3WFZA 4M1CD 3SE3C 3T0BA 5HGHB 1CWVA 1JHLL 4FQXB 4O51A 5D7JC 2OTPA 1U8IA 2DQGL 1NUFA 3ARWA 2VXSL 4E41A 2J6EA 2F5BL 1HKFA 4ZOAA 2GIYA 2DMBA 3SE4C 1ORQB 1W72H 5DEFA 5IW6A 1E4WH 1S9WB 4S1DC 3S34L 3EOYG 4U1SA 4X4YB 1KJMB 2FX9H 5JUEH 2EZ0D 4PY8J 5DRNB 2K3TA 1EHAA 2AJUH 3I02B 5EOCL 3RZCB 1NEZB 3FQTB 3O6FC 4S1QH 1N6QH 4HK3N 4PRHA 4YR6A 2OBGA 5KVGL 5C7XH 5EN2A 4U1LB 3EO1B 1J0JA 1MJ8L 3SDCB 1YNKH 4J1UA 1BM3H 4BSVB 5LCVH 3VXQB 4M48H 1BWWA 3REWA 1MCWM 2HKHH 2UVEA 1IC1A 3NA9H 5TH2B 2NY3C 4L4TB 5FGRA 4WNQB 1MFDL 4JY4A 4JRWA 4NBYB 4U6HB 5L8KB 3LIZH 3ARDC 4FQXD 4PYGA 4DGYL 4ORZC 3SKUD 1HN1A 1G7QA 4HZAA 4XHJC 4JE4B 1CDGA 2RB8A 1RZ7H 5C92A 2BERA 1C7SA 3FZUC 2Q87A 5IQ7L 1RZGB 4S1RH 3GSVA 2AXFB 4QXGH 4WTXA 4FNLL 1G7LB 5IR1A 1HXYA 1TCRA 3U46B 3PWLA 1OTSC 1RU9H 3BAEL 3GMQA 4DFHA 3MJ9H 3A6OA 3B9AA 3HI6H 4QHUB 3O3UN 3BPCA 5FAAA 2DOCA 5M94B 5E6ZA 5D2LF 4U2ZA 3CK0H 3SDCD 4M9PA 4PJIF 2DWDB 2PR4H 4OKVB 4KPHL 1FIEA 3CFEA 2HVKA 1CGTA 4JN1H 1IC4H 4G8GD 3C8HA 4QWWC 1N4XH 1S78D 4QRQB 4M4PA 5T3XD 4YHLL 4HWBH 1S7UB 1K2DB 4NPYA 1U8KA 5C0BD 3DO7A 3N1FC 2PYFB 4NWTL 4DGYH 3W39A 4H1LH 5C2BH 1A8JH 2VXUL 3LV3B 2BSRB 3LQZB 1YN7B 3LKRA 5EIQA 3WS3B 2OMBA 1GOHA 1P7HL 1C16B 1VGKB 3UJTL 3IGAB 1A9BA 4KVNH 4OGZA 4YXLH 4LGSB 5C0EA 2VH5L 3R8BB 3MUGB 3QXAA 1CDUA 1QA9B 1MCRA 1YQ2A 2ZCHL 2VITA 3K2UL 4IOIB 3QR2A 4F7PA 3G9VA 4NUJA 4DZBB 1EEYA 5CS7A 4HGWA 1IL1B 3V79C 3D2UB 1OAXH 2ZSWB 4YHPA 4PGJA 3QZWA 1AY1L 7FABL 5HHXH 3HI1A 2FRGP 4GG6F 2VDOL 3PXHA 1BOGA 1Q9OB 3SGEI 3P0GB 1T80A 3ES6B 4QRSA 1NDGB 4LVOB 3CD4A 5C2BL 5F7HA 2HJLA 1MCDA 3K81A 4AQ1B 3L5HA 2IG2L 2X09A 4JRXA 1DN0A 3B5GA 4N68A 3S97C 4W6XB 1YY9D 2FHBA 5HYJB 3O6LL 3BDYL 4HC1H 3U48A 2Z91B 4XWOD 5C0BE 3FB8B 3V0VB 5GGVY 3VFSA 2CUHA 4KVNL 4ZO7A 5K9KB 3NGBB 5E8PA 5D1QC 2Z35A 2O61A 3RY6C 1T7ZA 3HNTL 4NZUH 3U9PL 3IU4H 1MRDH 3WO3B 5KSBE 1LWRA 1CICC 4XX1E 3SO3B 3QUMH 2HT3D 4EDWL 1XEDA 4DGIL 5I2IB 4O9HH 2JJUA 4U0RB 5C0AB 1YECH 3P40A 3Q5TA 5JPNB 1OTUC 2Q7YA 3IETA 5IP4A 4Y1AA 4LASL 2VZOA 5DJ8B 3D18A 3L7EA 1FG2A 1U8PB 2YD4A 1JTPA 3BE1L 4GAJL 3PGFH 1IBGL 5ILTH 4BZ1L 2GTZA 1S7XA 4DN3H 5LQBH 1YEDA 1U3ZA 5DJXA 3WFBH 1MCJA 3RP1A 5I8CB 1FNEB 3MLTB 1PD6A 5E4EB 1IGTB 1AC6A 2E8ZA 3BQUB 4JRYA 1DUZB 5DK2A 4XCNA 2F15A 5F70A 4JPVH 3DUHA 3U4BL 1WZ1H 2AK4B 3MUY1 1FNHA 2DM4A 4FOMA 2LU3A 3FAXA 4FFVC 3VWKD 3VFRA 4CVUA 1NCDL 1NBVH 2DLFL 4LHJB 1I9RL 3EW3B 1NGXB 3BD5A 1JPSH 3C5ZD 4L8CB 4AIZA 3MCLH 3TBSB 4ODTL 5I1GH 5TE4H 1C5DB 2EYSA 3H42L 1MVUB 4RGMB 1NL0H 1RULH 4M7LH 4TRPL 5C07B 4RGNB 3LN4A 1Q9LA 2VQ1B 1IAOA 1AO7A 4TULL 2ZCKH 3TV3H 5IVXF 3VFGL 3KJ4C 2DJUA 4FQ1L 4WGVB 4XX1G 4YHIA 3MYJB 4RAUB 1A6AB 4NPYB 4IM8A 4WW2F 1QA9A 4PGEA 1E0OB 1R3HA 3OR7B 5MEOB 1KEGH 3MJ6A 2NY5C 1LK2B 2I9TB 1C16A 1UJ3B 5JO5A 3AS2A 4J6RH 5A2LH 2XG5A 5CIPB 3ARVA 4LLQB 4AEIH 4O5LL 1NEZA 3FQTA 3K7UA 3NFSL 4KKLD 1XGQA 3UAJD 2OL3L 2WWMD 4I8DA 1SMAA 1F3JB 3L3OB 1DLFL 1KCUH 2BNRD 3G9AB 1T4KB 4ZYKB 3B9KA 3KPMB 1UM4H 4LHUA 1TZGH 4OGAC 5EA0L 2AV7A 3MV01 3B43A 5JXAL 1OAKL 4K2UL 5IFHH 3QJFB 4UIKH 1DBMH 1KJ2B 3OHXA 2COQA 2LFGA 4G9DA 1JPST 1I7RB 5D1ZA 2ITDB 5F71A 5KVDH 3CSBA 2ZOKA 5T1LD 1PVHA 3S3PA 4NKDA 2GQHA 4PJ5D 4H20H 5IKCB 4Q0XL 5ADPL 4B50A 1U8OA 4MA3A 4HV8A 4M8QB 4G8FA 1KG0B 3CNKA 4HGMA 1IE5A 2H8PB 4FZEH 4UIMB 4TN9A 4RMSA 1KOAA 4OZ4B 4PJ9D 2WK2A 2CIKA 1G84A 2Z93A 4GW4A 3DNKA 4ZDHB 4KJWC 3UTSD 4AL8H 3WNMA 2X1PA 1N5AA 4BH7B 5IMKA 4BJLA 2Y36H 1U8JB 4U0QB 5MP6L 4Z18A 3PF2A 1IGCL 1F02I 1UQSA 1IGJB 1TTGA 2NX5A 1GC1L 4BKLB 5C2UB 4Y2DB 1MFCL 1QTYT 4PJBE 3CZFA 4ZAKD 5DC4B 4UNUA 4Y8DC 2PKDA 4P3CL 2W0PA 5F3BB 5MEPA 2BOBB 4Y19E 2P43B 2ICCA 4XGZB 3RQ3A 5CEXB 2MNUA 1HWGB 4K3DL 4OCXH 1FLRL 2NLJA 2HTKD 4M02A 3HN3A 4U1GB 2BVPB 1T0NB 5C9JA 4LLUB 3DVFA 5E5RB 1BHGA 2F5AL 4G9FE 2BCKB 1CBVH 5EPMB 4WWKD 4OLWL 4WFHD 1JTOA 1X44A 3ESUF 3BP5A 2F58L 3IFLL 5HYFA 5KVMC 1CK0L 1C5DA 3SEPA 5F97E 4FQ2L 4E5XA 3HNSL 2FSEA 1T89A 1DN2A 2VZSA 4Y5XC 4JJ5B 4X4ME 4LF3A 3C60C 2FGWL 3TT1L 1G9NH 1D9KB 2IGFL 3TH2T 4BQ8A 1I3GL 1ZANL 4N0UB 5AAMA 3DVGA 5I15H 4X99A 4G42B 2XKNB 3NACL 1IC7H 3BKJH 4JO4L 3HZYA 1V8HA 4OLZL 5GRXG 3ZDYF 2K7PA 3UZVB 5E8OB 3P30H 3GIVA 3BISA 5FM5M 4P4KD 3TNMA 4OAWB 3KPRD 4CKVX 2BHUA 2GFBA 1KC5H 4WCYH 4K94H 1W8OA 1KLUB 4O2EA 5BJTA 1T1WB 3BP5B 2PO6A 1OTUD 5CFHA 1EZVY 3BYYA 2XXCB 1BLNA 4OF7A 2NTFA 5GSVA 3RVVC 3FB5B 4KXZH 5DJ2B 1JPTH 3VXMD 4PTUB 2XRAH 4YHPB 4JQVC 5JW4M 4L3AA 3MRCA 2ERJC 2KBGA 5IB4A 4KKCC 1CTNA 4NN7B 3ZT7A 5I73C 4P2QA 4XVUD 4PREB 3VFWA 4NQSB 3VD7A 1TJIL 2PW2B 3W9DB 1LO2L 4GRLC 1GIGH 1OB1B 5CEYA 4YPGA 5ITFA 2MJWA 4WHDA 4KGLA 1WFUA 3PHOA 4MDJB 4YDJA 5DMIH 2ZOKB 1RUQH 3N85H 3G5ZA 4JFEA 3TVMB 4Q2ZA 1ODAA 1DFBL 43CAB 1S7QA 1WAAE 4UT6H 3M8OL 4JB9L 1UCBL 4ELME 4PRPA 3VGHA 3QAZC 4Z7NE 5J13C 4NKIH 3T8XB 4PRIE 2CIKB 4JLRB 2UWEB 4QTIH 4WW2B 5SWQB 5FHBL 4U1JB 2CMRL 1HKLL 3S5LB 1QBML 3AS0A 1C5BH 3C2SA 3PWNA 4PR5B 2P47B 1GCFA 4PLKD 1HOCB 3QQNA 1U2HA 3GJEB 3VXPA 2D4DA 4FA8A 1PDKA 4XPTL 1R3IH 5CUSH 2QSQA 4NN6B 2PYED 4K94C 3T2QA 3O4LD 4OQTH 4MS8D 4WHTA 4KRLB 3KYKL 1H3TA 5IVZA 4YWGH 3FRPG 4MA8H 2WBJD 5SWZB 2CLRB 3N1GC 3T0WA 2UZYB 4P49A 2DN7A 3HAEH 2HFGL 1TCRB 1TTFA 5I66B 4XMPH 2Z31B 3VXSB 2A6IB 3O2WH 2DDQH 5C0CD 1XF3A 3KXFD 3QXWA 4PP1C 4EIZC 2DQHH 1H5BA 4Z7VB 5SV3A 1QYGH 3TJEL 2I9LB 1FN4A 2APFA 3HUJA 3MO1A 2E6QA 3CVHA 4RGNC 4YK4C 4NFDA 1C5CH 2E7BA 4N9GA 3OKDA 3FCTA 1OARH 4OD1L 5D7IF 1UKSA 3OAUH 2X7LA 4JM2C 5I1AA 2ADJB 3VFVB 4PJFE 4GXUM 3N0PB 5ESVA 3TZVD 4DOHE 3C9NB 3KYOB 4J12A 4G42A 1SQ2N 1U3HB 3NCJL 3ARBC 3W82A 1G7JA 3MLPA 2VAAA 1Q9LB 2VQ1A 1IEHA 4N8CH 4Y5VB 1L9MA 2AJYL 3C8DA 4F33B 2FSEB 2EDOA 1R3LA 2FX7L 3RWFB 3PWPA 5KBNC 3O11A 4Y1AE 3SDXF 2IBZX 1OW0A 3U9UB 1FVDA 5FDYA 3EO0B 5E56A 4YHYC 1EJ6A 4ORGA 2VLKD 2MPAL 5KVEH 1PFCA 1ZT4B 1KJ3L 1TQBB 5IMLA 1EO7A 1QSFA 1RZ8A 2WM0A 1BF8A 2VIRB 2IH1A 2LAAA 5JORB 1SEBA 3MUHL 4HWEL 3SE4A 5KJRL 1AO7D 4LSPL 4YXHH 5HYSA 1CT8B 1OARL 4JCLA 3UCRA 2NYYC 3BP6B 3D39D 1A5FL 4MXWH 2BSSB 3O3EB 4NRXB 5CBEA 4I3SH 3CFCH 4JEGB 1XF4A 2FD6H 5GGSB 5C0EB 2AAVA 2Z31D 1CR9H 3NCEB 1PY9A 5TQ2L 3T65B 4XCCH 5T33L 3SGKA 3K8KA 3ARQA 1F45A 4P23B 4UI2A 3OHXB 1RUAL 1EEQA 2F8OA 4KQ3L 4ZDHA 3L95B 4IMKC 4OIIL 5I1DA 1J8KA 4IRJC 3L5XH 3LPWA 1JPFA 5C0IA 1KN4L 4ZPVB 1IGMH 2AK1L 4NO2B 3IT8D 5C0BA 3L3GA 4X9BA 2H8PA 4XCFH 4HS8L 4EUPA 3EOBA 3FMGH 3O81A 5IHLB 3DJ9A 3B9KD 2EYRA 5D2LA 1NFDA 2ID5A 1U95A 4X8JB 2R0WH 3QIWD 1J5OH 4POZD 1JHKH 1HIMH 5CSGA 2DQFA 2V2WA 4JN2B 4FFYL 4GKNA 2ZG2A 1F13A 2IPUG 4WI6A 4BQ6A 2BP3A 4L9DA 4Z76A 1QQDA 3GSRA 2H32B 1CLZL 4KU1A 2IBBA 5LKNA 2WINB 2HH0H 5EZJB 3QEQB 5E9DE 1IM3A 1I9JL 3CVIL 5GRWA 3LAFA 4ZS6C 3EFFA 2ZUQC 5TFSL 1U3HD 5H2BA 1ND0A 4C4KT 5D2LB 3BGAA 5CJXC 2A0LC 1MJ7L 4KXZI 3DRTA 3R06B 3MRQB 4UINL 3L5XL 2R2HB 2CQVA 3I9GH 2QEJA 4RQQA 4R7NA 5E7FA 3TM6A 3PWVB 4IBLT 3FQNB 4PP2A 2P8PA 3GMQB 1PQZB 5ENWA 1QBLL 4OLYH 1A6ZA 5JLZA 4KHXL 1YEGL 4K8RC 2BNUA 4OM0H 3HNVH 3S4SG 1JHLH 1FGNH 3NA4A 3WXWL 2X89D 1S3KL 1VFMA 3DLQR 4PJEB 4OLXH 1RHHB 4KRPD 4JM2B 1BFSA 4RX4A 3SDXB 4MNQA 1EK3A 2EDTA 5DK2B 1AD0B 5HHOE 1B9ZA 3QI9A 4Y16B 3FT3B 5KTEL 4ZNEA 4K55A 4M5ZL 1IKFL 3UBXA 1UT9A 2BHYA 1MHCA 2OQJB 4HIXL 3KLHD 4DGIH 1CFNB 4PJ8B 2Q8AH 2NXZC 4TVPL 3CX5J 4RSVA 3RWJA 4NOFA 3OXSB 1PQZA 4GRLA 4PJFB 2IJ0C 2IH1B 2BZDA 2OR9L 2HVJB 4OQTA 1MELA 2JK5B 1QKZL 4Z7WE 4DUVA 3GIZH 3VXUB 5ETUA 1G6RA 4O51B 5IBTH 1Q1JL 5M7QA 4H5SA 4HPYH 5DJ2A 2VR4A 3VCLB 5C0JA 5IIEB 1K3IA 3G08B 1BX2A 2DQEH 2R0KL 1H5BC 1WIPA 4IRSC 1FPTL 4YC2B 4PJHE 4M1CC 1BQLH 1R3JA 4PJ7A 2YK1H 2A73A 4BZYA 1S3KH 5DQ9A 4O4YH 3WFHA 3D0LB 3DSNA 5D6DC 4U49A 4DVRL 5GRZA 3MGTA 3UJJL 4UILH 2CRZA 2CPCA 1FNGB 2EDRA 3QB7C 4WEMB 5EO1A 3S96A 5GS2D 5HPOA 3RU8L 4LQFL 2P7TB 3OKKA 5JPMB 4PBXA 5AWNH 4NWUH 4P2OD 1AKJD 4JVPA 3W11D 1H15B 1PZ5B 3ETBF 4PLOB 4U2YA 1QZ1A 4H1LG 2YPLD 3O6KH 1K4DB 3T08A 4D0DB 3T0DA 4K7PL 1WTGT 5CBAB 2NY5H 2EEAA 4L4TA 4MAUH 1OTTC 1AI1L 1LO4L 2AEPL 4ZPTA 4NQDE 5D7LE 4MHHG 2FLBT 1UWGH 2DLEA 1RZJC 4LPXA 2PYEA 1ZE3C 3CC5A 5BS0A 3VXSA 2J88L 2A6KA 4LCYA 1IC4L 5KANI 4NNYA 3LKNB 1ZWIA 5E94B 4KAQL 3MROA 4YHZH 1F4WH 4KUZL 4QRTB 4K8RD 5BMFL 1CGSL 3NTCH 4KI1A 3QDJB 2APXA 1X4XA 1NFIB 2CLRA 3RZCD 1Y6KR 4NHCH 3PWPE 2N7AA 4CU8A 1RZJL 3B4NA 2C3VA 4KZEL 3RGHA 5KVFH 1I8KA 3A67L 3JTSB 2EICA 3ZDXE 1A2YA 1CIUA 2MWCA 3D69A 3LHPL 4AG4H 4L1DA 2XA8L 4BQBA 1QFWM 3IKCB 4NJAL 2P5WA 3D85D 1B0RA 1JRHI 3FQXA 4ODHL 4LVEA 1CLOL 2HRPH 1EPFA 1LNUA 4LBEA 2YZ1A 4JVWA 4BFGA 4GKZA 4LSUH 5F9OH 1FE8H 3QIUD 4PPTA 4HHAA 5LBSL 4R4NC 2WBJA 1WICA 4FXGB 5HVFB 2AEPH 1JWUA 5GRJH 3QHTC 4IRJD 3NCCB 4P5KB 4X9GA 5IF0B 3LZFH 1PSKH 1WBYB 5IJKA 2XIDA 3GJFA 4MJIA 5HBBA 1CG9B 1FZOB 3G5VA 4DW2H 1JNNL 5CP3A 4Z7WF 1LGVA 4LIQE 3QUYC 2UZIH 5GS0D 5F9JB 4M4RA 3BKYH 1RPQA 3MXWL 3FKUS 1XT5A 2FJGB 3S36H 3BZFA 4HX1B 5EULV 2IG2H 1RZJH 5I8KL 1AIFA 1W8NA 4MWFA 4PRPE 5HY9A 2HLAA 5FB8B 3EOTL 2I26N 3I6LD 3KHQA 1LO0H 1EJOL 4LDLB 4OZGA 1R0AL 4BK5A 1F58H 5GGTA 1CLOH 2HRPL 3K4AA 1PLGL 4K3EH 4WW1B 2AJXH 1P7QA 1I1AA 3TIDB 5GRYA 1YYML 3H9SB 2OMNA 4HKBA 2BSSA 3GMPA 1VFUA 3QT2A 5F9JA 3BZDA 1NC2A 1WZLA 5B3JE 5HHVH 4Q9BA 4W68A 2V5MA 3QUZA 2FEDC 2WZPD 4M7JL 5C09D 3GKZA 2QSTA 4P23A 3MREB 4XNXL 5HJ3B 3WXVH 1U91A 1HINH 4NQXB 5BVPH 1UB5B 4MMXC 3MBEB 5HVHB 3U4EB 1OSPH 1X5AA 2DAVA 1HILB 1MHPH 3QNYB 3ARDA 1R5WA 4XTRD 1CGWA 5GRVL 3P73A 1YUHA 4LLWA 3EOTH 1MF2H 3GSXA 4YFDB 5DD0L 5L2KE 2RR3A 3MRNB 1MFEL 1ADQH 4OZFA 4MX7A 5E8NA 4KWUA 1P7QD 2Z4QB 3ZSTA 3HUJF 1A6UL 1YDPA 1G6VK 5DO2C 1J8HB 4LCCB 3Q6GH 4D8PA 3RI5K 3A6CL 1JGEA 1MNUL 5F3HA 4LNRA 1VFOA 3BPLB 4G6JH 1ZSDB 1GZPA 3FO1A 3MCG1 1QR1B 1OTSD 1VGKA 2AABH 4X8XA 3RIAK 2OM5A 4ODUB 5ELIA 3H9HB 4OUUA 5I0DA 3TYGH 1ZWIB 4NQVB 1P1ZA 3GJFK 1GHFH 1ZLVH 4WFED 3JZ7A 1MUJB 4CRPA 5T3ZH 15C8L 5E0QA 2Z92B 4DWHA 3BPOB 4TYUA 2JB5H 1AHWA 4FFVD 4Q6IA 4NKQB 2IPKA 5L9DL 1YEEL 3C6SA 2BOBA 4RRPG 3VXRE 2AW2A 3FQNA 4PP2B 5TE6L 3X3GL 4M6NL 5I9QC 2C7UB 2W9DL 3ROOB 4HCRL 4J8RA 5C71A 1GGCH 1YEFL 2YA2A 3DYPA 3LKQB 3AREC 5CGMA 1FYTE 3PGDB 3U7WH 1H0DB 4XPBH 5KSAC 3BSZH 4DZ8B 1U3HA 5E2JA 2YEZB 4ZSOE 5AYUH 4F9PA 1P4LB 1ZXQA 5IFJB 2JE8A 5FM8A 4PRAB 1A47A 5HYJA 5DRWB 2XN9B 1ZHKB 5CZVH 3QRFM 2OI9B 1VADB 4KK5C 3O0RL 5L88H 1NGZA 2R0LL 2VISB 4I48B 4OV6F 4PGBB 3G08A 2X2YA 1CE1H 5ALCL 3GMRB 3MPCA 2EIZA 4YAQB 3TO4C 1I75A 4PJGB 5FYKL 4AMKH 5JNYB 1N4XL 2BVTA 2JELH 3HCVB 1W0WB 1OOAA 4RBPK 4CW1B 2JK5A 1E6JL 1GAFH 5ADPH 2YN5A 4LLQA 4L8SC 2W9EH 3X11A 1YEEH 5KN5A 1BJ8A 4AK1A 5KS9E 2B2XH 4EI5D 2ICEA 4XP9H 4AH2A 2AK4E 3O8XA 4LPTA 4DCQA 3WHXA 3G6DH 2HWZH 5EIIB 5EORL 3DUSB 4XXDB 4JO3L 4XP1L 1LP9B 2W9DH 4M61B 1X7QB 5EWIH 1YEFH 4L8DB 1I8LA 2EC9T 4XRCB 3B9EA 3MRCB 1JGUL 4XCYB 1CVSC 5EU6A 3HS0A 1L9NA 1D5IL 2NZIA 3NPSC 1U8JA 5AYUL 1LEIA 3RKDC 3IAGC 4QHMB 4LSVH 2Q6WB 5DDHA 4ENED 4ISVB 4KJQC 1SVCP 3NABH 3UBXI 1B0GA 1XIWA 2DQIL 5E1HB 3RIFK 4D9QE 1FFQA 4MXQD 4D3CH 5C0CB 1X6NA 4RCAA 4X6CE 5ISZB 4N90D 2OTUA 1JI2A 3OG4B 4HUUB 5CMAB 5F6IC 1EERB 4OCXL 3SE8H 2O5YH 4X6CB 3TFKC 5ISZE 4EUPH 3PHQB 4OGYH 1H8SA 5CILH 1BOYA 1XCTA 5K9QG 4OI7A 2NCMA 5BRZA 1EAJA 4N9OB 1UZ6E 2QQQA 1L0QA 4TUKH 1N3NB 5DRZB 3WNNA 5D7IA 3LB6C 2FBJL 4OF8A 5C0DA 3KPLA 2WINA 1INEL 2CDFA 2BNRB 1VEOA 5D7JB 3BDYH 1MRCH 3BZEB 3RBSA 3SJVB 1RUPH 2DQDH 4ONOA 4D9LH 4PJEF 5FM4A 2HJFB 4NIKB 1QLEH 3ARXA 3TA3D 3OGCB 4Y4HD 4GKZB 3CX5K 5CP7B 1LO5B 2GY5A 3VE0B 5JW5B 5DJDA 1ZOXA 4UT9L 5IT2L 3V4VH 5I76A 1Q72H 3IDMA 3IU4L 3T0EC 4NC0B 3HLAA 2O5ZH 2KPNA 4DTGH 2D0FA 1UB6A 2BY3A 3ZSSA 1CDCA 3GNML 4HXAL 5AYQA 1AGEB 1QD0A 2D0HA 8FABA 1KCRH 4HFWA 3DX8B 4QRPA 2HTLC 4XCCL 3GKWL 2CD0A 4PY7A 3S4SB 1YY8B 2R2BB 3SE8L 3K4ZA 5KG9B 2FEDD 5D96B 2VQTA 2FR4B 3VWKA 1FN4B 5CILL 2EE3A 2R2EB 4XH2A 3KPPB 2QLVB 3Q48A 1M05A 5DVNA 4LHUG 4DN3L 2D2OA 4Y19B 1ZLVK 5FO7B 3MOBH 1LE9B 5EZOL 3STLA 1FZMA 4K07A 3GI9H 4OF3A 1MIEL 4PJ8D 5I1KL 3H3PH 4AEEA 5I1CL 4EBQH 1JNHB 3IAPA 3KAAA 4HUVB 4MCZA 2R56L 1T22B 1ADQA 4XB7A 2DYPD 4OQ1A 3ULVD 4ODSL 4XVTL 4JO2H 5JQ6H 3G6AA 1OWRM 3HI6L 1ZT7B 5DUML 3FRUA 4FTVB 4MSWA 5DHVH 4MGXA 2LU4A 5FO9A 2P24B 5F7MC 3OX8B 1XZ0B 5HJ3A 5I1GL 2DQJH 3L5WB 1CLZH 3CZJA 3QULA 4HXAH 1M05B 3MNZA 1G6RH 4HAGA 2ARJA 2C26A 1BD2E 4MD0B 3Q1SL 1JPGB 2VN7A 5HDQH 2IBZY 2PR4L 2WP3O 1MRFH 1WAAF 3U4EA 1BREA 4PV8B 4MNGA 1S5IL 4A2LA 4AEFA 1FL6B 4XP5H 3DWTA 4JN1L 2ESVA 3TA3A 1JUFA 2Q86A 4LSRL 1NMCB 1SMOA 1C08A 4GOSA 4HIEA 4NZRH 5EO0A 4OSUL 4XP4H 4L8DA 1OP5H 4TNVF 1HXMB 2C1PB 3CSGA 4NCC2 3X13B 1U3HC 3MOAH 4QWWD 1QHOA 5L0QC 4HS3B 2BY2A 5T1KA 2X89A 35C8L 1F3JA 3O2WL 2X05A 4LCCC 5E2WH 3U0TB 1MIML 3HUJE 3ZYOA 5T3XL 1A1MA 4YE4H 3EZJB 1R5VB 4FFWC 3MRPB 3QUXD 4QO1A 2P5EB 4QRRD 4OKDA 5KS9B 2DD8L 2GSIB 2YBRA 4OD1H 2Y25A 4BZ2L 1S7VA 5SWSD 2EC9U 1JZ7A 2CDGB 5HGDB 1CFBA 3C5ZB 1OGAD 3FO2A 4POUB 4DJMA 1LD9B 1Q0YH 5I18H 4L8SA 4MS8C 4WWKA 1D5ZA 5MHSD 5KSVA 3RWEA 3SDXE 4WWID 4ZOEA