4MS8D

42f3 tcr pcpb9/h-2ld complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
AVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 42F3 alpha
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
total genus 61
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8D02
3UTSB 1DUZA 4UDTA 1ADQH 3TWCH 3F65A 1OAQH 1UFUA 4S11A 5E2UH 5FUOL 3K8MA 1U6AH 2HFEB 4KK6C 3HCVB 5INCA 1CFTA 1KTLA 5LQBL 2D0FA 4TSCL 5IHUL 3V5KA 1YEDA 1WBYA 3ZE2E 5E4EB 2WANA 2Z8WC 3UPAA 1H3WM 1CE1L 3T0EA 4L3EB 1JMXA 3PV6B 1CBVH 3K2UH 1K6QH 5LCVL 4Y5YB 1XF5B 4M48L 2PXYA 3X13B 5IEHB 5KSAB 4F2MB 3ARFB 3PDGA 5J1AA 2CKBB 1ORQA 3QIWB 1DEEB 5E95B 1RZKC 2D9CA 3BAEL 4J3UA 4KTEL 4JFFE 1QQDA 1DBAH 3LS5L 1QFUL 1KN4H 4LEXH 1E4XI 5J6GB 2P5EA 3AREA 3GNML 1D5IH 4LF3A 2BVPB 3CPLB 2QHRL 3VXME 3FT2B 3UBXA 1H3UA 4FXGB 5C0RH 2XG4A 2JJTA 4NO5B 3QDGB 4KK6D 1ZMYA 2FH6A 4O58L 5F93C 5DJYA 3ZTJG 5IGXL 5ILTH 3CLEH 4WNQB 2J7LA 4G80A 4I4WB 2K7QA 4LRIA 5C0BB 5F3BA 4Y4HA 1BD2A 5DJAA 5BOPA 4ZFGL 4JPVL 4HJJH 3C5JA 2R2HB 4V2BA 2A6KB 8FABA 1T66C 1G9NH 3QQNA 4Y89A 3U0TB 3DBXB 1LEIB 5F1NB 3P0YL 1DVFC 1BVKA 4M5ZL 5I8EB 3TLRA 4BZ1L 2LTQC 4LSUH 2FX7H 1J87A 1C12A 3RIAK 1KB5H 1LMKA 3SO5A 5EA0L 4WO4A 1XF4A 4OZ4B 3ETBF 4N9OB 2ESVA 4MAYA 1X5IA 1GOHA 3VG9B 2BVOA 1BQHA 2EIBA 3CVHB 3MO1B 4BKLA 1YPZF 4R3SB 5B38G 4G8GA 4MLSA 3G08B 3BPOC 3WLBB 1KB9K 4YXLH 1DQLH 1BAFH 5HPMB 4H20L 3V6ZB 1R3KB 4BQ6A 1F3JB 3MRKB 5FOBB 3IFNH 4IRSC 1LO4L 2Y5TA 4XAWL 1E4WH 4XBGA 3JWOH 4NHUB 1CZ8L 1M6OA 3ZKQD 2CIKB 2QLVB 1X5JA 2LAGB 1VA9A 2E6QA 1T66D 1MSPA 2CJUL 2H1PL 2YEZA 1AGEA 4M6OL 2NPLX 4Y16C 4DZBB 1GPOH 3I3BA 3HMXL 4G7VL 1O7SA 3BKJL 5DD5L 5F88A 1DVFD 4YDVB 3MOAH 1LO5B 3VWJB 2NW3B 1HI6B 4LAJH 3MLSL 4JO3H 4XNMA 4JFPB 2VDLL 3DV4B 4X9FA 3O3EB 3U36B 2EC9U 4PD4J 2W60A 4JAMB 1OARL 2IAMB 4UDUB 4RNRB 5IVXB 7FABH 4K23H 4TNVK 4XPAH 4JRXB 3WJJA 4P23B 5IBUG 2V5RA 2PO6C 2IPUK 3G6DH 4HMCA 5TDOA 5DSCB 1OP5H 5BS0B 4HJ0C 5INDA 1H3XA 4OLWL 1Q94A 1V3KA 3KPSD 4I18C 3QIBC 3EYVA 3FL7A 4IRSD 4UT7H 3WCYA 3PWNA 1VEOA 4PG9A 2PYED 4Y5YA 1XF5A 2MNUA 4IJ3C 4F2MA 1OGAB 1KOAA 2FHBA 3TA3C 2VDNL 3SY0A 1RJZB 2XWJA 5JIKA 1IQDA 3O4LA 4XNZB 3NFSL 3QIWA 1OQXA 2HLFC 4DUXA 3V6OA 4Y16D 2GY7B 1M71B 1U95B 3ARUA 3S8WA 3GGWB 4JFYB 1EBAA 3ZDZF 4D9QD 3M1BA 1AGDA 5IB2A 3GHBL 3FTGA 1UGNA 4GKSB 4PRNA 1NGQL 4YPGB 5ACZB 2P45B 1A1NA 2AP2A 1NCWL 1OF2B 1BF2A 1B0GB 4FZ8L 1I7RB 3LPGA 3P73A 4A6YH 2CRZA 3KPSE 4CVXA 2QADB 5E1AB 4NRXB 1X44A 3QO1A 3OB0K 4Y7MA 2AK1H 3AXLB 5JXAL 2PO6D 2B1AH 2PYEE 2NY3B 3HPJA 4PJBE 4HJ0D 3DNKA 3GMNA 1MFAL 3HE7C 3D25B 4P5MA 1D9KA 1A21A 1MFBH 3KWWA 4Q6IA 5DC0A 1QSFB 1UZ8A 3QIBD 4HS8L 1EEYA 2IEPA 5HJ3B 1YEIH 2DLFL 3QUXA 4JR9H 4ZYKA 1BIIA 3HRZA 3VH8B 3IU4L 2MSPA 3BP7B 4C58B 4D9QE 3QDME 2E8YA 3UTTB 1OAUL 4S0SD 1U8PA 3TA3D 3U0TA 2AJSH 4Z0BH 4LGSB 5HDBF 2HRLA 1ND0A 2HLFD 1TJIH 2F74A 1S5IL 3RBGA 4W81A 4PJXB 2EKJA 3S3PA 1Q72L 1PD6A 4FTVD 3NAAH 1I8MB 2DBLL 1UM6L 2APWA 1AI1L 3IF1A 5F1OB 1LK2A 4KRNA 4WUKL 3P9LA 1MFEL 1HH9A 1K5NA 4P9HL 5BRZA 1IVLA 2AABH 3TZVA 2AJXH 4YHZH 3QXTA 3CVHA 3ET9F 4OZGA 3MO1A 4XVTH 5FHBH 2HVKA 1MCWM 4WI9A 4ONHB 5D4QA 3PWPB 3IDJB 4FZEL 3VRLE 1E4KA 1CFQA 2V2XB 2VXVL 1I9EA 3HE7D 2VN4A 1DUYA 2K7PA 4Q9BA 4YDJB 5D5MA 1IEAB 4IM8A 2A77L 1VPOL 1NEZB 5ADPH 4FTVE 1UWGL 3EFDL 4S10A 3H7BA 4X83A 2QJDA 3WN5B 2YPLB 3U1SL 3KPOB 5IF0A 1KJMA 1NC4D 2NLJA 5IQ9A 2WINB 3FFCD 4Z5RA 1R3LB 2HWZL 1EJ6A 1RUAL 5D1QB 3VWJA 2OK0L 3O9WB 1H8NA 5I71C 3DPBA 3CFDB 3C60B 3DV4A 2ARJA 4OFYD 3U36A 5HHQA 3BEWB 1DQQA 4JKLA 2E3VA 1PVHA 4Y4FA 4F57H 3BH9A 4U2YA 5IVXA 4RSVA 4TRPH 4JRXA 3QDJD 3MODH 4WEBL 4KQ3L 2E7CA 4L29B 1RZKL 2X70B 3C09B 2ZG3A 5IMOA 4I0PA 4Z95H 3JWDH 1IEHA 2UYLB 2PW1A 2R56H 3Q1SH 4LQFH 3RFZC 3FT4A 3MRCB 4UTBH 4XGZB 1S7TA 3NIDF 4WFFD 3FO9B 3F7QA 3P0GB 3EAKA 3FFCE 4U3CA 5FK9B 1JWUB 3BEVA 3VGAB 2ADFH 3ARVA 2Q87A 4WV1B 5FYJD 3C6LB 3QO0B 1BQUA 2VL4A 5T3ZD 1D6VL 5ENWB 5D6DA 3I85A 3FRPA 4G8EA 1EZVY 2YXFA 1OT2A 4WHCA 4QF1A 4NKQB 4AIZA 5JNYB 4S1QL 4YHYC 2HKHH 2P8LB 4FXLA 2FZ3A 1YYML 1B0GA 2VLLB 4LEOB 4YHOL 2Y5EA 3DUSB 2DF3A 4ELME 4R4BB 2AGJL 4WFFE 4WUUA 5JHLH 4FQ2L 4JZOB 5SX5K 4X98B 1CFBA 2HG5A 1YY8A 4QNPF 3SJVE 2EEAA 2CK0L 5FYJE 4L4TD 3EO9H 4PGBA 5CJ8A 1JGUL 5C07D 5T3ZE 1XH3B 3EOBA 5ALBL 3MLYH 4IOFC 3WBDA 4OLZH 2ITCB 4NQEB 3MV9D 5LJYH 4M7LH 1FVCA 3MCKB 2R8SL 2NY2C 5DHVH 3QEQB 4HF5H 1G7MB 5E2WL 3BZEA 4QHUB 3ELAT 3KGRA 3O6KL 5FV1L 1UENA 3MUJA 4CU6A 4JO4H 2HT3C 1HE7A 4P49A 4U0RC 1I9IH 5HGBB 4DGYL 2EE6A 4Z7VF 1WC7B 1F6AA 5MI0C 2XXCB 4L4TE 1KIRB 4JKWA 4GLRI 2PYFB 5C07E 5CEYA 4EDWH 1JZ2A 3PL6C 3HUJF 2YD8A 1JNLH 3HI1B 1J05B 5JQHC 4GG8A 3MV9E 3I2CL 4Y5XA 4NQCB 3PWPA 3SCMA 3CAFA 4XNXH 1N3NA 4HIHB 5ECJE 1U8NA 1UJTA 5I6XC 2GK2A 5F8RC 4N1HB 5TDNB 4JDVB 2FO4A 3C2AL 1HHIA 5I18H 3VFWB 1AD9A 1IGTA 4IOFD 4HIIA 1IEAA 2J6EL 5EC2A 1YEGH 5I17B 3WJLC 2NY2D 2Y36H 1F4YH 5ANMB 2P8MA 1A6TB 4CBPA 5LGJA 5D1ZC 1GIGH 1F8TL 1NBYB 2Y72A 4GXVH 2WINA 3VA2C 4ZNEA 1EPFA 2R4SH 2YUZA 4RRPG 2WP3O 4RMVA 2HT3D 1SVZA 2AXJA 3O9WA 1WJ3A 4HULB 5IQ7L 2C1OA 3MC0A 4M5YL 5E70A 3MREB 5EN2B 4MWFA 5JW4M 1CGSH 3BD3A 5D70L 2AV1B 4Q74A 3WKNA 5AD0B 3F7VB 1U8KB 4OUOA 5LWYH 3BESR 3MRIB 3PL6D 3P40A 4ZFZA 2XPGB 5D8JH 1GVIA 1V7ML 4G6KH 4YEFA 3DETC 5C08B 2Z4QA 1WZKA 1CGVA 3QDAA 5HYJB 3MRCA 2CDGA 5ID1B 2YPKB 4MA1B 2OTUB 3AS2A 3TPUA 1NLBH 3EYOA 4WGVB 1I1AC 4P46B 4A2MA 3GMOA 4TULH 2H6PB 1QP1A 1RI8A 2MTPA 4P2QA 4U1IB 4DOHB 2GK0A 1RIHH 4D3CL 3MLVH 2EH8H 4Q9QH 5EBGA 1AJ7L 5I1GL 1KENL 5D1ZD 2X7LB 3SQBA 1DQTA 4E9LA 3RVXC 1YUHB 2HRPL 4X0KA 1PG7H 3UDWA 5I1IH 1KIPB 4OF0A 3RZCC 5L0QB 5TE7L 1TCRA 4U3HA 4Z7UE 5C2UB 4AT6B 1KBGH 5ISZB 2VLLA 1FZMA 2A9MH 2IAND 2YSSB 1H5BB 1UA6L 4X98A 1J10A 1MCSA 2C1PA 4IHOB 1IGJB 4ZPVB 5FO7A 3DETD 4OI7A 3D69A 4ONGH 1NFDF 1X7QB 4NYLB 5IK3A 3MV8B 5CJQH 3PHOB 5JHDB 3GIZL 4NQXB 4PFEA 3MRNB 4LMQE 1YEEL 2APVA 3BGAA 2ZCLH 2M2DA 1UJ3A 1I1AD 1K8IB 1ZAGA 3MRJB 2FBJL 1B2WH 1T0PB 4H5SB 3RWIB 2FR4B 5GHWL 2LU7A 1KG0A 3U9PL 4EUPA 4NHCH 1NGXA 3RWGB 1AGBB 5ICXB 1R24B 1Y6NR 3VXSD 5HVHC 2VC2H 2NMSA 1Y0LB 1Z2KA 4U1LB 5HHVL 3RVXD 2IANE 4M6NH 5HGBA 1KUMA 3RAJH 1WFNA 4GMSL 1FNLA 1TJHL 1IC4L 1PKQA 3RZCD 3KJ6L 4GMTH 5GS0C 3REVB 1NMAH 1T0MB 3BMWA 2VDKH 3JUYA 4WI6A 1GZPB 1U41A 4H8WH 1ZV5A 5B38B 4GRWE 1SM3H 2E7LA 1A9BA 2HYMA 5BOZG 3BFOA 3STLB 3V52L 3N1MC 3KYOA 1ZT7B 2D31B 4HW6A 3ARDA 1MIEH 1DLFL 1OAKH 2Y07H 4NC1C 3QUML 4U2ZA 4G9FB 4FXKB 3ES6B 1IGYB 4P48A 3VXSE 3N06B 3F12B 2IMNA 4P2OA 4EN3B 5J57B 1T03L 4RMTA 3LRGA 2X1WL 3MZGB 3IVKA 5TE4H 5JMRA 3NCYP 1I85C 1TZIA 5M95B 4QLRA 2IBGA 3V0WL 4FABL 1CFNB 1V7NH 4M6MH 5I15L 1INEL 3FN9A 5EBWA 4WW2B 5D6CB 1F4XL 1ZT1A 3KXFE 4U31A 1NAMB 1A6VL 3PDOB 4MNHA 4Q0XH 5H37H 3QJFA 5J8OA 5GS0D 4JGUA 1TVBB 4UIMA 1U8KA 5HTSA 4X6CA 4YXKH 2FJGA 5IV2B 4L5FH 1IFHL 5C09D 3W5MA 2XPGA 2A9NH 2CRMA 5DMKB 3CZFB 3JV6B 4O02H 1A14H 5TF1H 5SV3A 5J12B 3ULVH 4NKDA 2X1XR 2CKNA 3R0MA 1Q8MA 3TBSA 5HYJA 3AUVA 2GCYB 2O5YL 2CD0A 1CTNA 4ZUSA 1HINH 1LILA 2UY6A 5MHSE 3GSRA 4ZQKB 3SE4A 4H1LG 4RBPK 1H3TA 3BZ4B 5TQ2L 3CU7A 1M7XA 3RJDA 2MOVA 1IC5H 3ARYA 4Y1AE 4K8RL 1EO5A 3EOAA 3QIUC 3I3EA 3NTCL 3VXUB 2B4CH 1QBBA 3LHPL 3LKQB 5DVKA 1INQB 4PRDB 2VXSH 3MLTA 1RIUL 5C09E 1HZHL 4GAFB 1YMMA 2CMRL 4OV5B 5F9JA 2EDFA 4QRPA 3HZVA 4AT6A 1P7KB 2GAZB 4HLZG 1JTTA 4XVUC 4KAQH 4PUBL 4WTZG 5JW5B 1UH3A 2XA3A 4R0LB 4J3WA 4NC1E 5GIRB 4Y19E 3QRFM 3V8CA 3SO3C 4R4FL 1EGJA 1P9MA 4QRTB 3HC0B 4OAWB 3QUMA 2A6IB 1X7QA 2ZZUT 4G7YH 1J0KA 3JTTA 4XP5H 2G9HB 3RWEB 5MEQB 3QCTH 4HWNA 1J8HD 4K9EL 2YD7A 2X9WA 1K8IA 1CTOA 1G9NC 4ODXB 4OGXH 4F7MA 1EAPB 4HGWB 3LEXA 5CLWA 3IFPA 1P4IL 3VFMA 3QIUD 1UACH 5A3IC 2XRAL 3EDJA 4PJCB 1C7TA 1Q0XH 3GEWB 3VD3A 4U1LA 4G9DB 3S9DB 4X5XB 3VFGH 4LCYB 1FL3B 3LRSB 1VGKA 5IT2L 2V17L 4KPHL 1RK1B 5E03A 5EU6B 1CDCA 2P8PA 2Y9RT 4J2XA 4XVUD 1T1YB 3VCLA 5K9OB 4NJ9L 5MP6L 1GZPA 1A6ZB 3MV7B 1WAAA 3BKCH 5DDHB 1J8HE 4YC2C 1NGYA 4MVBC 5GGRA 1WEJL 5F3HB 3T4AB 3JWOC 1HHHB 4FXKA 3UO1H 1QOKA 3MCLL 1NBZA 1ZVYA 5ESAA 3VXRD 1RZIA 1KACB 1N5YH 4AQOA 5CP7A 1JZ5A 4QXTB 5D72L 4E41E 3VFTB 3KS0J 1M7IB 3IYLW 3LCYA 5T3XE 4U33A 1I8KB 1MCNA 3P9MB 3WFEH 2F8OA 5E5MB 5A3ID 4NRZB 1IT9H 1BJ1H 1Z9LA 5IJKC 3DX9A 3WEXA 1CFNA 4JRWA 5FIEA 2AAVA 1T89A 4YHIA 1NGWB 4MXQC 3RU8L 2R0WL 2VDMH 3X17A 3DX6A 1BBJA 4NZTH 4LNRA 1XGUB 1MI5B 2XWTB 1G7JA 3IDYC 1SVCP 3SKJH 3H6JA 1Y18A 4RISL 3R0NA 1G7IB 4PR5A 4OCWL 3LQZA 2FL5B 3MGOA 2H2PC 1KYOJ 1N6QH 4MVBD 4DWHA 5KSBA 3LN4A 5IVNA 4JKKA 4Y2OA 1PLGH 2NY1C 3KPTA 3HFMH 1B0WA 4AEEA 2A2QT 4LCWB 1T4KA 2HFTA 4ZTPL 2VXTH 1FGVL 4OF6A 3BZ4A 2CLVA 1CGUA 4TOYL 5HI3D 1JIBA 4U1JB 3MRRA 3TH2T 4OZIB 3QYCA 5IVZA 3DUHA 3K7UA 1OSPL 3WXVH 5JO5A 4HS3B 4NM8H 3B8YA 3VXUA 5JTWA 1QR4A 2NY0B 3L3DB 3VRJA 4K7PH 3FB6B 3FAWA 2A74B 4J23A 4UQ3A 4MSWB 4XCYA 3DVNA 4PJ8A 1UG9A 1E28A 1JFQH 5DD1H 1QNZL 4DKEH 4JFDA 2CO6B 3IJYB 4MXQD 3OGOE 5C0CA 2CUMA 4KKNA 1KLUB 5FUZH 5ETUB 3OB0H 3PE9A 3ZSSA 4L8SB 4O51A 3UROR 3DO7B 4YAQB 1NCAL 1P84J 2ZUQB 2QQLH 3ILQC 4QRTA 1OWWA 2H2PD 4ODVL 1JI1A 5JQ6L 2A1WH 4TN9A 3LKPA 2NY1D 3AC0A 4OZGF 4LK4A 2BFVL 4LCUB 3NBNA 4GOSA 4YHMH 5DUBA 1MWAB 1EAPA 5IFJB 1CDBA 1PAMA 3G6JB 1A7PH 1TXKA 3EO1A 1SHMA 5DFVC 4DFIA 5F7DB 1S9YB 4O9HH 1YQ2A 3QNXB 4JGJA 5D5MF 4BSVB 5HSFA 1FFNB 1U8OB 3U6RA 4BUGA 4L9LC 1G6RH 3FQWA 4CNIA 2XQYK 3OGCA 2JB6A 3TO4A 4G3YH 4TQEH 1WT5A 1FL6A 4TTGA 4DW2L 5HYIA 1KXTB 5K9OA 4RA3A 4P4KA 3DXAB 5HHMB 3BI9X 3BJ91 2GSGB 3TJEL 2PW2A 3QHFH 1SMAA 2IBZX 3BP6B 3MRLA 3E6FB 3IS0X 3MBEC 5C6WH 1P2CA 3ILQD 1TZHB 3B9KB 4ZS6C 5JUEL 2OZ4L 1A64A 4U7SA 5IVXF 4MNGE 1UADC 4NO0A 1I3GH 2Z91B 4R7DB 4D9RE 4UBDC 3V4UH 4NQVB 4TSAH 1J1XH 3PWVB 5D7IA 3NIFF 1ADQL 5GSRA 2ATKB 3VFPB 1QFWL 5C0EB 1OAQL 1F6FB 2UWEE 3VFTA 1K4CB 5DFVD 1U6AL 3P9MA 1R3JB 2G5RA 2MWCA 2AERT 4NRZA 5E6YA 2KUTA 1QHOA 3QUZC 5I1LA 4M61B 1BFSA 3WS3B 4ALAH 1S7VB 1QSEA 5DEZA 1JHTA 1ZTXL 5F89A 5IG7B 2QSQA 3LS4H 3V0VB 4NRYB 3VA6A 3ZT7A 4DGIL 3K2UL 2R0ZL 4NM4L 3TPKA 3QFJA 5CLTA 2W07A 1P6FA 5EU7C 3U4EB 1PZ5A 1INDH 1AY1L 2XWTA 3JV4A 4PJIE 4E5XA 5H94A 4Z7NE 5EWIL 3LMJH 3JWDC 1DN0B 4PY8J 1E6OL 4CADB 5GPRA 4UQ2A 1MHCB 4EDXA 5E24E 2D9QB 3MBED 3OR7B 4ZS6D 4N5EC 5CWSB 1OAZH 2VLRB 1A9EB 4R8WL 4YR6A 1CDJA 1F4AA 4UBDD 4GO6B 1T2XA 1A7OH 5E5UB 5E00B 3L5WA 3QEHB 4LL9A 1Q1JL 4RZCB 5AYUH 2X2YA 2FX8L 2Z8SA 3T3PF 1TTUA 3H8NA 3HI6H 2J5LB 4GW4A 1KYOK 3GSQA 4ZUUB 4MCYA 4G6AC 2A74A 4NBYB 3RWHA 1T1XA 3QUZD 4JY6B 3DROA 1VB9A 2PR4H 4FFVC 4R96A 5DJCB 5A16B 3P4NB 3OB8A 4GKOA 5CMAA 4OF8A 5ETUA 4HJGA 1QRND 3GSWA 3MRFB 4J8RA 1A4KB 1BIHA 5DD3H 1QFOA 4ODUB 2OZ4A 3PUCA 2G2RA 5MERB 1J5OH 1RZJH 1SYVA 4F9LC 3DSFH 1H15B 1IEBB 4FQXB 1FZKB 2DYPA 1RIVL 1ZHNB 3EYFA 4N5ED 2EECA 3KYMB 3IAQA 4XMLH 1HXYB 4ZNCD 4ZXBC 4MJIA 5EOCL 4PRBB 4PRIB 4RGOH 4IMLB 1HIMH 2PKDA 2V7NB 3BN3B 4P3DB 1BAFL 1QPPA 4IRJB 2G75A 5F7DA 4HPOL 4XPBH 3QXDA 3QNXA 2DQTH 1CQYA 1U8OA 4HKBB 2HP4A 4X7FC 4BH7B 3GMPB 3GMQA 4G6AD 2NY7L 4QRRE 5GGQL 2Z31B 2L7JA 3O2VH 4NC0B 5CILH 4S1SL 1P7QB 2NY6B 3JWOL 4JFED 3ISWA 4DKAA 4FFVD 5EZIH 4JFZH 3X3FH 1OVZA 3DI2B 3D6GA 1I7UA 2QKIA 2XIDA 3FFDA 5CUSL 4V1DD 5DQJB 5DS8B 4E0RB 5A2KH 1TPXB 1MREH 2XFXA 4GG6A 3B9KA 2EDYA 1A6UL 3QUKA 1MIML 4P2RB 4AEHH 1S9KC 1X6NA 3QNYB 2AJVL 1F4WH 5GJTH 3WFDH 3CFCL 3CFJA 3PWVA 4JG1L 3UX9B 1FYTB 2DWDA 2ATKA 3BZFA 4ZXBD 1J0ZA 1QO3A 3R06A 1MEXL 4WW1A 4JFEE 1KCUH 2NY5H 4ZO9A 1IAKB 2BVEA 5E9DA 1QUNA 3QJHA 4RRPA 5GZOC 5ERWA 3TCLA 1AE6H 5LGHH 3W39A 2R0KL 5E4IA 5IFHH 3NABL 1X4YA 3D3VD 5FHAL 3VFUA 3CX5K 3NCJL 3V5HA 5DRXA 4JO2H 3KYKH 1L7IH 5FGBC 1FSKB 3CSPA 1MH5B 3QWQB 1JGDA 5D1XC 3JBG7 5AZEH 1IZKA 1NUGA 1AXSB 4G8IB 1YDPB 3PHQA 3QI9B 1IZJA 1BJMA 3GM0A 1PG7W 3OX8B 4GSDH 5L7XL 1DLHB 4A2LA 1KSRA 2FYYA 5K59F 2RAMA 4LAQL 4P9ML 3LKSA 3MJ7A 4LSPH 5CWSA 3WHXB 3BQUA 5EPMA 3E0GA 1A9EA 3BPNC 1A7RL 1Y6KR 5BW7A 1ZHLB 4LHUB 2BXZA 1F3RB 2IJ0C 5MENE 5E00A 3K8KA 4ZDHA 1IAIL 4FQQB 4BSJA 4YPJA 2FBOJ 4X6DA 5E6IA 4JQVC 5E94B 1E6JH 3CSYB 1KLGA 4F7TB 4JRYD 4RAUA 1C1EL 5E08L 3PDDA 4K3EH 5GZOD 1MQKH 3L95B 2YA2A 3QUYA 1M7DB 3QRGL 3CLFH 1YEIL 4JR9L 3REWB 1DANT 1RUQL 5LAXA 3P4MB 3P4NA 4KDTA 2DRUA 4MA3A 2WUCH 4RFNB 3LDBC 2AJSL 3Q2CA 4JFHD 5D1XD 3CMOH 4CVWA 1S9WB 2DIAA 3VFRA 2B7DT 2XQBH 1GL4B 1GGIL 4GAYB 1H15A 1ZT4B 1F90L 3PWJA 4Z7WA 5D7JB 3FB7A 3FN3A 4YUEL 3MRQB 3AGVA 4PRIA 3BHBA 4KTDH 5I8OL 4JFFB 3EZJB 3KYNB 2V7NA 4P57A 5CEXA 2EDOA 3I50L 2X4UB 4XP9L 3SDDA 5J13B 3SDXE 2XKUA 3NCBB 3ULSB 2AEPL 4PJFA 3GMPA 5E2VH 3EYQC 1TZGL 5ITFB 4JFHE 1MFCH 3RGVC 4K3HA 2R1WB 4HIJB 5I9QB 1RU9H 4Y8AA 3S3JA 2DKMA 2JF1A 3ZDYF 2GJZB 3KLAA 5IMMB 4H8WC 5HGDA 1OM3H 2AQ3A 1W72L 3AU1B 4GH7B 4JE4B 1P4LA 4JHAH 2DQHH 4HFWA 3FHQA 4U1NA 4L3CB 5KAQG 4NKIH 3L3IA 1VSCA 5LBSH 1AD0B 4GUPA 2VKXA 3QAZB 1ZVSA 3F58L 4MA8L 2CDFA 4UILH 4X6CF 5C92A 4HC1L 5IB3A 2KPNA 3HNSH 3G04A 1EX0A 5FKAB 4I9WD 4MNQA 2BSTB 4C55A 4QOKA 1MHPL 2HKFL 3SDAC 4LARH 1UVQA 3U2SA 1FYTA 4C56D 5L8JB 1AHWC 5M94B 1DBKL 4OQ1A 1CLOH 2ADIB 3HHRB 3S98A 1T22B 2HAZA 5J9PB 5JXED 2MPAL 5BMFH 1WGOA 2R56L 3VFOA 3T65A 3CXHJ 2VLJD 5KN5B 3EYQD 5FGCE 1A6WH 4EBQL 1HN1A 3K80A 4TUOA 3V5DB 2ADFL 3RGVD 4PLKC 4HUXB 4EEEA 4YHNB 3SKOA 3MROA 1ZOXA 5D7LE 1CI5A 4F8QA 1A2YB 1MH5A 3V4PH 4ZO8A 2X44D 4GXUN 2AQ1A 5AEAA 4CN1A 4G43B 2DQDH 4KI5E 2HFFA 1ORSA 3WFHA 2DQCH 1L4IA 1G9EA 5CZKA 4Q7DA 3IAPA 5J0BA 1BZ9A 2W65A 3IU3A 4H1LA 1ZHLA 2CLZA 4WY7L 4MAUH 2ID5A 5AWNL 3SDAD 4NSKB 2IFFL 4PGDA 4J3OC 1JZ8A 2B4CC 1JGVH 2J3SA 3QH3A 1WTGT 2GJ6A 4APQC 3NGBC 4D2NA 3OWEA 1HCVA 1VKXB 5F9AC 4YXHH 2AK4D 3SGJA 1U93B 3MJ9H 2GHWB 3L95A 3MA7A 3QXWA 3CDGB 1NCBH 2DMCA 2EDJA 1U3JA 3REWA 4HSQA 2O5ZL 3RVTC 3C9NB 1VFMA 2V2TA 4ETQB 4PLKD 2A83A 4WTZA 2V9QA 2VZ1A 4HH9B 4CVZA 4PJEA 1GGBL 1EEZB 4XP6H 2DMKA 5A2LH 3GSUB 1F4HA 5AYQA 4HH8A 5FCUL 1WQVT 4LHJB 3NZHH 4NP4H 3DTXA 1I9IL 4HS6B 2JCCA 1MPAH 1MRFH 4HC1A 3P0VH 3U83A 1DVFB 1VFAB 1WAAF 2VL5A 1T5XB 4KHXL 2LTQB 3PP4H 2HVJA 2YC1B 1KELH 4EDWL 2EIZA 3MRQA 2AK4E 3S34H 4BZ2H 3FOLA 3OAUH 2VDQH 2X40A 3RI5F 3MR9A 3KYNA 4Y4KA 1ACZA 4O2EB 4X8JA 2AJYH 4JG0L 4JREC 2XNAB 4JVUA 3BP4A 2BOBB 4NKOB 4APQD 3BPOB 3R8QA 1KJVB 2AXFA 4ZUVB 3QWOB 5GGVH 5HHPA 5ITFA 2D7MA 3VXMA 3KPSB 3WMSA 5DJ8A 4HIJA 3RVTD 4YZFF 4IRSB 4DZ8A 3FQXB 4NFBA 3TBTA 3V4VH 1LP9B 2VO5A 2XKSA 2PYEB 4WIQA 2IG2L 1DSFL 4L3CA 4EJ1C 4LIQH 2MHAB 2R4SL 4MXVF 1AD0A 1DL7H 5HBBA 3SGDI 4Y16B 5FO8A 4GKNB 5BVPL 1FC1A 1T7WA 2B2XL 3GI9L 4PJ7B 1FZJA 2X42A 1FP5A 3D5OF 5KSUA 5F96H 5CKAA 4WHDA 3Q48A 5KSBF 3C8KA 1FNSH 2JK5B 1PY9A 3GBMH 5C9JA 2BCKB 4OF3A 1ZLUH 1CDUA 5T1KA 5J7CC 1T22A 5J9PA 3D85B 4PJGB 2PO6B 3I6KB 4U49A 1RVFL 4UV7L 3KPRE 4U1KB 4JDTL 3STBA 1D5MB 3T0DA 1MOEA 3ULUF 3V0AC 5F7EH 4I18B 1Q9KA 4TULL 4ZUTB 4HUXA 5HY9A 3QIBB 4YHNA 2CRYA 1MJJB 1RIHL 3MLVL 2EH8L 1DDHB 3W9DB 3CK0H 1DEDA 5KTEL 2JIXA 1ED3B 4IJ3B 2ARJQ 2NX5D 2XN9A 3TA3B 2VZ3A 4UT9L 1NH6A 2XY2A 5I19H 3SGDH 1XIWC 5I1IL 1FG9C 1U9KA 3L3OA 1XZ0A 2OJEB 3T77B 3QDGD 2R9HC 2ZKHH 4FTVB 2BSRB 5HDQH 3GUTA 3AB0C 3S37H 5DD6A 4KTYA 2MQ3A 4ZFFA 2VSDA 2EE3A 1UB5A 1YJDL 2FIKB 4UIKL 1BP3B 5HDOA 3E3QC 4OZFB 4G6JH 4U1GC 3TH3T 1XCQA 3HE7B 4E42B 3G5YA 3ZKMC 1RZGB 1QBLH 1T04B 3MJ8B 1FG2A 5AZ2L 1A6AB 2ARWA 1U91B 1NUFA 3IJHA 3O81A 1MAML 4HUVB 1Q38A 3FT3B 4Y8DC 3QDGE 4NHCL 1NBVH 4QTIH 4OQTA 1MCPL 4N0UB 4NOBA 1NC4B 3RAJL 4WFGE 3FFCB 1CLYH 1P7HL 1NEUA 4PJ9A 4WDIA 4DAGH 5M7QA 1KXVC 1XIWD 1OHQA 2R69L 4K2UL 4PRAB 1K85A 4NQSA 2R9HD 3ESVF 1B88A 1ES0B 3GIVA 2YC1A 2KDGA 5EDXA 4QCIB 4QY8B 2H32H 3R4DA 4RAVB 3SQOH 3ZHLA 3ZE0F 2NR6C 1OSZB 3IFLL 4WFHD 3OKOA 3OKKB 4LCCC 1R0AH 3S6CA 2X4RB 3GHEH 1EXUB 4U6HA 2ZG1A 4HK0B 3QDJB 1SJVA 4NN5C 4UMGA 4RWYH 4KGJA 5KJRL 3V7AE 1BZ7A 5FKPB 1BLNB 4M8QA 4HXBL 12E8H 1KJ3L 1N0XH 4ZUVA 1RZ8B 3LSOA 5CINL 4PY7A 3RX8A 3P77A 4ELMB 4GW1A 3FMGH 4ZAKC 3EYUL 3ZKMD 2ZUVA 5IROA 3FQXA 5T1DL 4PP1C 3NN8B 1JTPA 2PYEA 5FGRA 4PJBA 3L1OH 3ZDXE 3VE0A 1DFBH 4PGEB 2XWBA 2B0SH 2ZSVA 3KNBB 5JOFB 3BE1H 2X10A 15C8L 1V7NL 4GKNA 4HPYH 4WFHE 4M7ZC 4U6YA 3MNWB 4XRCB 5BS0D 2EKSA 2I07A 3QDMA 1VFBA 5CCKH 2DL9A 2H26B 1EHAA 2IH1A 2OL3B 2BDNL 3GZKA 5I1EL 3O3BB 1PG7X 5EG6C 3D39A 4C57C 1AP2A 1EMTL 3E3QE 5TH2B 2X4QA 4JLRB 5DHYB 2NR6D 4HXAH 3DVGA 1AQDA 1HWHB 3BDYL 3GMMA 4P3CH 5HYQA 3ULVL 1JPFB 1DQDL 4OTXH 4I2XB 3HTLX 2DQJL 3RPIB 4LLQB 1KCKA 1J1OH 1RULL 3TF7C 2PO6A 3I6KA 4HWBA 2PN5A 1F3DJ 1WBZB 4L4TB 4Y88A 3VW3H 4OZIF 3MLUH 4OZHB 4U1KA 5C07B 1XGRA 1D5MA 1F58H 2MMXA 3OHXB 3F5WA 1DANU 2UZYB 4ZAKD 4TVPD 1U8JA 1ETZA 4KGLA 3MV9B 3W9DA 2EICA 1IC5L 3QULA 5BS0E 2ERJC 4PP1D 4K3DH 2FCBA 3O11B 1JHLL 3DLQR 2VXSL 1KN2H 1Q9WB 5E7BA 2OJEA 1J88A 4LKXB 4YDIL 4XCFL 5KW9L 4YHYB 5LGKA 4YHKH 2ZJSL 3PIQA 5IEKA 3L7EA 3UYRH 4DKFL 5DRZA 5C3TA 1WZ1H 3CFBB 2CLRA 1LQSR 5D2LE 1FDLH 5IMKB 4TVPE 4ZUWB 4HKJA 2N7AA 4G6ML 5HXMA 1WITA 1I3VA 1QLFB 2Q8AL 3G6JF 2DQIH 3CH1B 1IGCL 3D0LA 3MJ8A 1GAFL 2MQCA 2BNQA 2X5PA 2X4OB 4JVPA 3CUPA 2PCPB 4M8VA 1L9NA 4AH2A 2VQ1B 1NDMB 1UACL 2NY2B 35C8L 3GKWH 5ITBL 1RZJC 1Q0XL 2D0HA 1QSFE 1QLRB 4L8BB 1CICA 4JCLA 2VQTA 3GI8H 3O3DA 2CGRL 3P4LA 5DJDB 5BV7L 1FZOA 4GQPH 3UTTE 1KPRB 4UTAL 3HZMA 4HDIA 5E8EA 5MI0B 5JDSB 4GG6F 3TNNB 4N8CL 4QCIA 4X4XB 2M26A 4TSCH 5IHUH 1UH2A 1H9VA 3EDDA 2I9LB 4DUWA 3OKKA 2C7UB 3P9WB 3PL6B 1JN6A 1CE1H 4PJXE 3VFNA 5CD3B 4HK0A 3LOWA 3RI5K 5LCVH 1CK0H 3CC5B 4M48H 5FKPA 3X12A 4F3FA 4Z7UB 1RY7B 4OSUL 4ELMA 3QXUA 5I6XB 1CD1B 4Y5VC 3BAEH 3FRUB 4KTEH 2OP4L 3OBAA 2ICEB 1A1OB 3H9ZA 3SJVA 3LS5H 1II4E 1QFUH 1T2JA 5EU3B 4QT5A 3GNMH 3KPNB 4JY4B 5HYSB 2F8VA 2COQA 4AM0B 2YPVL 5D1ZB 3FO0L 1ZANL 1TVHA 1P53A 4OM1L 2VOTA 2EH7L 1UZ6F 5BXFA 3QG7L 5B39B 3HAEH 3BPCB 2YPLE 4NZTL 2VISB 4O58H 1FCCA 5IGXH 4FQCL 4ZFOB 2ADGA 2YWZA 1KJ2L 3FO1A 4JANB 2AJ3A 4CU7A 2NY5C 2DQEH 1QTYT 2IANB 1N6QL 1LO2L 3OMZA 2X4PA 3I75B 3ROOB 5E8NA 3GSVA 2FWOA 4JQXC 4ZFGH 2YRLA 4XNQA 1I4FB 2XOTA 3OKEB 4L4TA 4YGVA 4IIQB 4U7KA 2WBJC 1U8MB 5C07A 4X6DF 3AY4A 3CNKA 3OHXA 4U1MA 1EHLL 1FO0L 4XMPL 3P0YH 4XVSH 3L5JA 4WHTB 5DI8A 1I1AB 5T5FL 4ODTL 3NPZB 2MCPL 6CGTA 4QRUA 5EA0H 2AV7B 1X5HA 4MD0A 3L5XL 1SJXA 4G8FA 5CBAA 2X05A 3PWLB 3VXSB 1JGEA 2Q86A 4MQSB 1MJUL 4H20H 1HEZA 5DTFA 2EYTB 5FUZL 3RZCB 3EKCA 4LLWA 3GKZA 1IAOA 4HIEB 3CFBA 4HLJA 4H0GA 4WRLA 1LO4H 4Z7WF 4XAWH 4Z8FL 1T1ZB 2RFXA 2D4DA 4JPWL 1SYSB 2H9GA 3F62A 1LNUA 2ZPKH 4JM2A 5KANI 5F7NC 2IQAA 1J11A 2CJUH 3SKUD 2WBJD 1CDIA 1ITCA 1RV6X 1FH5L 5C71A 3CDYA 3HMXH 3FB8B 4G7VH 3BKJH 4UUJA 5DD5H 4PJFF 1LEGA 3VXQA 1I7TB 4X7EC 2ICWB 5IB5B 4O9HL 2VQ1A 2VDLH 3IDGA 3K4AA 1BVZA 5HHOD 1OARH 4NQEE 5GISH 4GQ9H 1EJOH 1XGQA 3DARA 5C7XL 2QQQA 5EH1A 3IGAB 3SKNB 1JTOA 1QEWA 4PGCB 1KPRA 2W0FA 5EUOB 5CJ5A 3EOYG 3TBYB 2XZAL 4M1DH 4HUKB 4JFOB 5JDSA 4B53A 3RTQA 4PG2C 1CIUA 1KNOA 4OLWH 4NN6C 4P46C 1U3HC 4J4PA 2VXQH 1S7SA 5C0JA 4OCRL 3S5LB 3UAJC 2LV4A 3ZYJA 3PL6A 3S35L 5C09B 2GKIA 5IJVA 4YQXH 4KWUA 4KC3B 4OGZA 3WNOA 3GB7A 3VRIB 2VDNH 3QG6B 4R2GC 4N8VG 1FO0A 2GTWB 4PLJC 3NFSH 3RWJB 5HHOE 3FRUA 4JPKL 3ZL4L 3IS1X 3MYJB 5DK2B 4U6VL 4N8PA 5E99H 43C9A 1F5WA 1LGVA 3GHBH 3GJFB 4NJAL 1NGQH 4CDGC 1CG9B 3UPCA 1NCWH 4FZ8H 4OM0L 4J1UB 4S1RL 1TQBB 1BECA 5C08D 3F6LA 4K7PX 5ANME 5JXAH 1BHGA 2DIBA 3OKDA 4OUUA 3T0VA 2VISA 3AROA 3ZHDA 1MFAH 2YUVA 5E1HB 4BK4A 4ZFOA 2A73A 4P46D 1U3HD 3VI3F 4M7JL 4OCXL 1B4JL 1D5ZB 4HS8H 3UAJD 3I9GL 3RVVC 2YN5A 2DLFH 2HJKB 5GQBA 4P4RA 5JPMB 3QFDA 1R6VA 1W0YT 3IU4H 3NH7L 3OKEA 1A1MA 3U0WL 5KSVA 1OAUH 3RWCA 1WUNT 3WIFB 1N2RB 1NDGB 4OCSL 4R2GD 1CL7L 4PLJD 1O0VA 1JNNH 2XG5A 5I1AA 1S7XB 1J8HB 5HI5C 1S5IH 1ULVA 3GRWL 1F97A 5C08E 1Q72H 4MJ6B 2EDNA 3X11B 5DRNB 2IPKA 1UM6H 3RIFF 1AI1H 4CL7A 5IR1B 1RUPL 4WUKH 1KTDA 4OCYL 1MFEH 2ZNXA 1RZ7L 2Z35B 4P9HH 3QIUB 5GGSB 4LASL 3OR6B 2PR4L 4P5TC 4PJEF 3G5ZB 1BJ8A 5SWSD 5EORH 4P2YA 3RWFB 5HDBE 3ZE2F 1X5KA 4NWTL 2DLEA 4FZEH 2JCCF 3LZFL 3T2NL 4WU5B 2VXVH 5DD3L 5F7HA 4DVBB 4Y2DC 5JORA 1G9ML 1S8DA 3RVVD 2FEDC 4UAOC 3DSFL 3SO3B 3KXFA 1GGYA 1CXEA 1VPOH 5DQ9B 4BH8B 1UWGH 1ZKAA 3EFDH 2J4WL 5ISZE 3U1SH 5ALCH 1EUTA 4MDJB 1W0WA 3FHAA 2HWZH 4GBXA 2JE8A 3S4SA 5JLZA 1RUAH 3MRHB 3BSZH 4LVNC 3VXRB 2OK0H 1JK8A 1LWRA 2YBRA 3HNVL 3GJEB 5HI5D 2AXGA 1QA9B 1IM9A 5SWSE 4XPBL 2DM3A 2DQTL 3J8F7 5KZCD 3WSQL 2WAHA 1M4KA 1FVDA 2HT4C 1S7RA 5J12C 1U8IA 2M8XA 3MNVA 1RZFL 4X99B 2X1PA 4P5TD 2FIRT 4MQ7B 5A1AA 3SKNA 1KB5B 4PGCA 4WEBH 3IETA 4WU7A 1OLZA 3VXPB 3TBYA 2R2EB 4Y1AA 3W0WA 4JFOA 4D9LL 1JNHB 3LQAL 1NC2A 3B9DA 1AGFB 1OTUC 3O6FB 3OSKA 4TUKL 4Y2DD 5SWZD 3QPXL 2AKRA 5DEFB 1WWCA 4HGKC 4XZUA 4ISVB 4PJ5A 2FEDD 4YC2B 3W9EA 3KLDA 1VERA 2X89A 4IOIA 2W9DL 2BOCA 4KXZI 4GRLC 3C6SA 4LP5A 4DJMA 1D6VH 2FJHA 4UB0L 1ZVHA 4Y19A 5DC4B 1LO0H 3GRWA 2ATPA 4PRHD 5DK2A 2Z93A 4XH2B 3VXTA 5CHNB 4S1QH 1GZQA 1DP0A 5E2TL 3NIDE 2NY5L 3GJFA 3OJDB 1WFOA 1R3IL 1IC1A 4H25A 1JYVA 4G9FE 1CG9A 3WIHL 1YYMH 3V6FA 3K1KC 4YHOH 2HT4D 5LGHL 4EVNB 5IFHL 4PV8A 4FQ2H 4LBEB 5SWZE 1CVSC 3MNZA 4NNPL 4JO2L 1AH1A 3KYKL 1UM4L 1TDQA 1JGUH 1QPXA 2VYRE 5AZEL 4D0DB 5ALBH 4F7EB 2ZNWA 4F9PC 4XCNA 1OTUD 3VGHA 4YNYB 4QKXB 3IDYB 3OZ9L 3LPFA 4PRHE 3QA3A 2Z92B 2R8SH 4PGZA 1Z3GL 2VAAA 5E2WH 1V3MA 3WIFA 2NY1B 4GRLD 1NDGA 3PGDB 3O6KH 1EFQA 1JRHL 1I9JL 1FN4A 1S7XA 3KG5A 1J8HA 4DGYH 5ICYB 1S3KL 1H0DA 4NKMB 3NOIA 3AM8C 4MJ6A 1T21B 3L3JA 3DV6B 1S7UA 2Z35A 4BA8A 1CXLA 2YMXL 2ZOKB 3BPLC 3BMVA 3OR6A 3QIUA 5GGSA 3WNLA 1X5XA 2BSSA 1HSAA 3T4YB 3CLFL 3WNKA 4AIXA 2EDLA 3T0WA 1SEBA 3OXSB 5HGGS 3U7WL 3I2CH 2YRZA 1D5XA 3AFLA 4RFOL 4WJ5B 4E41A 4D0CA 3CGTA 4JY5H 3TT1L 3RP1A 2OSLB 4A6YB 4RIRB 3C2AH 3QWRA 3FQRA 5BQ7A 5GRWA 4G42B 2J6EH 2YHGA 4XBPA 5DQ9A 4BH8A 2Q7YB 4OIBA 5DJ2B 3UPRA 1F8TH 5CD5C 4LDEB 4PJIB 5IW6A 4HUUA 4EUPH 2VWEC 2NNAB 3HPLB 2CUHA 3MRHA 3QQ4B 1MVUB 2FEEL 3QISA 5IQ7H 2GUOB 4M5YH 5IHZB 3D0VA 5D70H 2R23A 5DJXB 1N59A 3G5XB 3ZKXC 5I16B 4JFXB 4U1HB 1RU9L 3NZ8A 4PJBF 3T0BA 1AO7A 4L9LB 4XC3L 5EOTA 3O41A 2DB8A 3VXPA 1CXHA 2R2EA 3MRBA 3GSXA 4JHAL 1G7QB 2DQHL 4WGWB 4PJCE 2EXWC 1U8HB 2C4FT 1AGFA 4DTGH 1JPST 1JYWA 25C8H 5EU6E 3MBEB 4D3CH 1QBAA 3BT2L 1AJ7H 2WIIB 1KENH 5I1GH 3QXVA 3MV7E 4X4MA 4OLXH 5CD5D 1MCEA 2DI9A 1MHEB 3S36X 5EO9B 2XKNB 3QCUL 4YE4L 5J06A 3BW9A 2XA8L 3UJJH 1JCKA 4AK1A 3OJDA 5TE7H 3RY5A 6FABH 3PGFL 3UJIL 1KPVB 3TVMA 2AJZB 5KOVC 1KGCD 2DM2A 3ZKNC 3U0PA 1FE8H 2QR0B 1UA6H 3QUZB 2ED8A 3M17B 3VRLF 3DSNA 3UTQB 5DYOA 3Q3GB 2HN7B 5IBTL 3GBNL 4QGTA 4KMQA 1FVEB 2OYPA 4D0DA 2EXWD 5IB4B 2DQDL 3GIZH 1CE6B 2FX9L 1YEEH 5MEPB 3B5TA 3V7AG 4DCQB 1QRNB 3T0EC 3HLAA 3VGEA 2VWEE 4LVOC 3D48R 2FBJH 4PTTA 3G5VB 3F7YB 4JN2A 1A47A 5GHWH 2VZOA 1U58B 3MOBH 1X5LA 3U9PH 1MI5E 4NDMB 1NGZB 2UUDK 3TT3H 1KGCE 5HHVH 4MGXA 2WWKO 5BZWA 4NCDA 1FNGB 4M7KL 5KVMC 1RSFA 5E0QA 4R90L 1T7VA 4MNGA 3KJ6H 3DV6A 3VG0H 4LU5L 4LCWE 1NKRA 3MJ9L 4JPIB 5GGUB 5IW1B 3ZKND 5IKCA 3RIFK 1B90A 3IDIA 4N0FB 3OXSA 2BRQA 5C0AD 2JJSC 3V52H 4JFEB 4KK9C 2UWEA 1UM5H 5BJTA 3MTRA 5KVDH 1J0YA 3A6CL 4XP6L 3QUMH 4K7FA 4CJ0A 3LKRA 1NFIB 1QG3A 4OLUL 3X14B 3DX8A 4V1DB 4Y4HC 2HJLA 1AKJA 3NA9L 1BOYA 3T0ED 4OGAC 1T03H 4W68A 3PP4L 1TMCB 5GRUL 3K8LA 5F44A 2EIEA 3TH4T 5F1KC 4BZ2L 3QBTB 3OAUL 2C3XA 4FRWA 1I8IB 3FONA 2Q8BH 2JLLA 1BPVA 5EZLB 2AJYL 1T2QL 5DHVB 4FABH 2VUYA 4ZXBB 1OGTB 3BUYA 3K4ZA 3MRGB 5GRVL 2VAJA 1INEH 3P2TA 5I15H 1F4XH 5C0AE 4BQ8A 2P5ED 4WO4C 4ELMF 1N5AB 4ODHL 3H3BC 1UWXK 4LKCA 4I8DA 3WD5L 5I16A 4JFXA 1CXFA 1IFHH 5IUSA 4LLDB 4XPFL 3GSNL 3CU1A 3D3VB 3V4VL 4KK9D 3QEUA 2GITA 3CCHB 2OS7A 4I3SL 4ONOA 3VFSB 4KUCF 1L7TL 4LFHD 2I9TB 4LIQL 2EC9T 2C3WA 1CD8A 1EFXD 4NNXB 3B6SA 1D5BB 2ZCKL 1I7ZA 5FO9A 1JWMB 5TQ2H 4F7CB 5MEOA 4Y4HD 4M9OA 1IBGL 2B5IC 4YX2L 4OGAD 3HG1A 1UB6B 3E6HA 5CSZA 3LKNA 4K8RH 2VE6B 5F96L 3DXAE 1OT1A 3CD4A 1HQRA 1TITA 1MHEA 3HR5B 3H0TB 1U8QA 2DQUH 2JJVA 1RIUH 4AZ8A 1HZHH 4LPUA 4U6XB 2GW5A 2NY4C 2X4NA 2CMRH 3O8XA 4WO4D 4Q9RH 3VH8G 1NCTA 2H3NB 2D7TL 4KJYA 4PUBH 4XNYL 1HHKB 2ESVD 5D2NC 3T3ME 4DKDC 4JRYB 2QR0A 3VGBA 5F7EL 1ZS8B 3WJJC 2E9JA 3M17A 1A0QH 4G8GD 4FQXC 4Q58C 4WWKC 3TYFB 2ICES 3JUZA 4Q6YA 4QHLB 4N0RA 2W91A 3H9HB 3GMRA 1GOGA 5SWQB 1IE5A 5TGBB 4NT6B 1F11B 3SDXB 2VKWA 1KT2B 3TN0A 3L7FB 2EDTA 5CIPA 4QRRA 4DCQA 4K9EH 1TCMA 2WQRA 5D1XB 3QHTC 4FP8L 3BO8A 4M43L 2AEQH 1P4IH 3S96A 2R1XB 1LD9B 5HDQL 2Z31C 3WE6B 1QR1B 2XRAH 3KPPB 3V6OC 1K8DA 3T0AA 3ULUH 1UEYA 1X5AA 3OG4B 3BPNB 4AG4H 4Z9KB 4JM2F 4C83A 5HGHA 2G60H 5IT2H 4X6BB 2N7BA 2V17H 4KPHH 5FYKH 2NY4D 5E5RB 5F9WC 2KKQA 3UZVB 3RWDB 1NEZG 1QKZH 4G6JL 5GGUA 5IW1A 1YEKL 4NJ9H 5MP6H 1UXWA 3VXOB 1T0NA 3GSNA 4FFZL 1WBXB 2GTZA 2VMFA 1DTUA 5JDJA 3TEUA 3WHE0 3DMMB 1WEJH 4WWKD 3I6LD 1HILA 2X4SB 4KKCC 4X9GA 3DRQB 5IIEB 1I1YB 1UCBH 4QTIL 4WI3A 1D9KC 1NFIA 4Q6IC 1OOAA 3A67H 4JHZA 5FGCB 3MCLH 2ITDA 3QUXC 1HOCA 4PV9B 3NMEA 3B5GA 1SJEB 5D72H 2EXYC 5EC1A 4NO2A 3O4LD 2Z31D 4FNLL 2NZ9C 3HKFA 4MDIB 3ARGB 5D2NE 1S5HB 1C08A 2V5SA 4POZC 1R0AL 4Z7UF 5EZLA 5DHVA 3DIFA 3TP4A 4C56B 3I02A 4I3GA 1IJ9A 3I6LE 4CAGA 3RU8H 2R0WH 2ICWI 3FO2B 12E8L 1H8OA 3BVNA 2HLAB 3TZVC 1LE9B 2J8UE 1ZA6B 2K3TA 5KAQF 2VLJB 4RISH 5MENA 4LLDA 4OCWH 3BIAX 1C5BL 2BC4A 4TPRH 3RGVB 2VITB 4MX7A 4KKCD 4RMWA 1K3IA 1U2HA 1E4KC 4Z77B 4UNVA 4N68A 5HHNA 2V5TA 1D9KD 1L6XA 1MLCB 1FGVH 4YWGL 4QHNA 3V6OE 2AEIT 3QUXD 4LP4A 4TOYH 3BWAA 5FM5M 5EUKA 1Z5LB 1K2DB 5I1DA 4N8VA 1OSPH 4OD2B 2H2SC 2EXYD 4PRPA 4H26B 1KC5L 2NZ9D 3IJSB 3MUY1 4NCC2 4QYOB 1JV5A 3TJHC 3EGSA 5T1LB 2P7TA 3SGKA 4POZD 4P3CL 1V8HA 3SDAB 5C9KA 3IRZA 5GRJL 1AHWB 1QNZH 1JHKL 3IFOA 3ROLB 3LB6C 3S37X 2OXHA 2EYRB 2Z8RA 4GRWF 4AMKL 2P5WA 1WCBB 1HHKA 3ECBA 5FEBA 5BRZD 4Y4FC 3CJJA 4CDHA 3KLHC 1ZGLB 1G84A 4GAGH 3TZVD 2AK4B 1NCAH 1T83C 4OCNC 3TYFA 1AGCA 4ODVH 4I0PC 1ZSDB 4LLMB 1EA9C 4X7DC 5JQ6H 4OD1L 4QHMB 4XPGH 3SDXA 4QEGA 5FGBA 3L7FA 4HAGA 2BFVH 3MRDB 5DD0L 1EAJA 4GRMA 3G9AB 5FA3A 1NFDA 1FRGH 1N6VA 1YZZA 5ID0B 1K9TA 4M62L 3IDMA 3UCRA 2KH2B 3JV0A 3BXNA 4XCEB 3DX7B 4EI6B 1LD9A 5EBLB 1T6WA 4KJPC 1Q9OA 4NGHH 2H2SD 4NO3A 4P5KB 4NPYA 1WZ1L 3KJ4C 3QDHA 2D7NA 2GSIB 3TJHD 3CFIC 2GT9B 1WZLA 1FDLL 4OZGE 2WLZA 3L3HA 1Q9LA 4P9HC 4EIGB 3LB6D 3NA4A 4DW2H 3DURA 4YHLL 1EEUA 3NGBB 4APQB 3VXOA 5DURD 1I1FA 4Y4FD 3KLHD 4V2CB 3TJEH 1A4JB 4OJFL 2X4SA 5CSGA 3FZUC 2QSCH 4I0PD 2OZ4H 5A2FA 5JUEH 2Y7QB 1BWMA 4PTUB 3IDNB 5EIIB 1T1WB 4MD5A 2C4FU 5LVEA 1RMFH 4MQTB 4PV9A 4AY0A 1QFWH 3CFEB 5E8PB 3GMLB 4PJDA 1JF1A 1KIQB 4QXUL 2F54D 4I48B 5HGAB 3B9VA 5D7LA 3MFFB 5ICZB 1B0RB 4KJPD 5IM7B 1ACYL 1S5HA 1HDMA 4NN7C 4POUB 2BHUA 1ZTXH 3BJLA 3ILPB 4QRQA 4DGIH 2R0ZH 4IMKA 4NM4H 1CK0L 1O7VA 3BGMA 4O2CB 4JREB 2OQJB 3GO1L 1AY1H 1WICA 2IMMA 2WV3A 3D2UA 3DUUB 4WUUD 4OF7A 5DRWA 5EWIH 3OKNA 1IAMA 4LLUA 3Q6FB 1E6OH 3SKMB 3SCMC 2VITA 2G5BA 2CIIA 3FZUD 5T1MB 2F54E 3TM6A 5EZJB 3LEYH 3INUL 3BOVA 3U46B 4N9GB 4R8WH 4P0DA 1JUFB 1JWSA 1KPUA 2H41A 2NX5B 3T8XA 1E27B 2QQNL 1Q1JH 3IXTB 2FX8H 5BVJA 5E8OB 4OD2A 3MGTB 4L1HA 1KCLA 1MCRA 1BM3L 5KG9B 3IJSA 1NJ9B 5EFIA 1RHHA 2DQEL 4WUUE 1T7YA 4WFED 2XTLA 1DBBL 3N0PB 2OI9C 1I8LA 5I8KL 3GSOA 4X4YA 4ONFH 2P24B 4QHKI 5GS2H 3M8OL 4OFDA 3TC9A 3T3PE 2CKBL 4XVSL 5K9QI 3HN3A 3BRDA 2D2OA 3U30C 3N1QC 2EDDA 4C4KT 5AUMB 4B5EA 3K3QA 3SCMD 2QSTA 4LLMA 3MUZ1 1RIVH 4BFIB 2I60H 2CSPA 5TF0A 5EO0A 3ALXA 3RQ3A 2XTJC 2Y23A 4I5BA 5EOCH 2UVFA 5GGRY 2P42B 2VLMD 3RL1B 4WFEE 1UEMA 3DX7A 3W81A 3K4DA 1XIWB 4EI6A 4BFGA 4HPOH 2IADB 3KPLB 4HUWB 3L6FA 4PJAB 5FXCH 3VGGA 3WIIL 3IXAB 5DZOA 3HZYB 2ICWJ 4YHPA 4MQXC 2X4TB 2NY7H 4XMKL 5GGQH 2GT9A 3AB0B 4S1SH 3UDWC 4QTHB 1RJYA 2ZPKL 4XXDB 4ZO6A 2PTUA 3CFKA 4X6FA 3RNKB 2XV6B 1G7LB 4Z7QE 3N1GC 4DVRH 1C5CL 4XWGH 4JZNA 1VCAA 1TTFA 1S9XB 5CUSH 1A4JA 2R2CA 4U1GB 2AS5M 5JPNA 4RWHA 2VLME 1A6UH 1NFKA 4KKLC 1MIMH 3IDNA 2A6DA 1T80A 4GS7C 4UU9A 3SDYL 1XF3B 2AJVH 3KPRA 4CW1A 4KH2A 1UJ3C 5GISL 3CFCH 3UTSA 5I30H 2EYSB 4JG1H 2XTJD 4GQ9L 4PLOB 1EJOL 1M05B 1MEXH 2D4FA 3MOQA 3QCVL 3SEPA 4P2QD 3CVHL 1KIQA 3TIDB 1BX2B 2HFEA 4M1DL 3UP1A 5ICZA 3HCVA 3MJGX 5BO1L 3MLXL 2MKWA 4OIIL 1A8JH 1B3JA 2VXQL 4MQXD 4HBCL 2R0KH 2V5MA 2W0PA 3NABH 4L3EA 3PV6A 5HHXH 4ETYA 5FHAH 4YQXL 3NCJH 3MRPB 4LCCB 5IEHA 5KSAA 3X13A 3ARFA 1GH7A 3NCMA 4NN5B 4YIQB 2CKBA 4Z7OE 1G6RB 1DEEA 3BIBX 3ORJA 2E7LC 4RQQB 5SX4I 2XTJE 3HS0B 5D2LB 5E99L 2W0KA 3ARDC 4ZAKB 1J1PL 5L7XH 5J6GA 2BJML 4LAQH 4KKLD 4P9MH 2BVPA 4LVEA 3CPLA 1A7RH 1YQVL 3WS6A 3FT2A 4P2OC 1IAIH 3D85D 4FXGA 3MQIA 1LP9E 2MQ0A 4M7ZB 1PYWB 1I3RB 4NO5A 2QTEA 3QDGA 3QEGL 3C5ZC 5I1CH 1C1EH 5E08H 4WNQA 1FLRL 5K59E 4I4WA 5C0BA 3QRGH 2ZUWA 4PJ7E 1RUQH 2AW2A 3EJJX 3CX2A 2R2HA 2A6KA 1PJ9A 5I66B 2P24A 3N1FC 5IW3A 4L8DB 1N8ZB 3DBXA 1LEIA 4X5LA 3ABZA 5F1NA 1R5WB 1JNNL 1OP3K 4RGMC 3SPVB 5SX4H 5I8EA 3L3GB 3ZSTA 4TSBL 5AUMA 4L1DA 1GGIH 3ARDD 5CZXC 4ORGB 1OP9A 4FFWC 1EV2E 5ESVB 2E8ZA 1AXTL 4PJGE 1F90H 1YEFL 3STZB 4OZ4A 5J4MA 1OWRM 2P43B 2ERJB 4ODBD 3SE4C 1RJLB 2N56A 2HJFB 4YUEH 1YNTB 2UWEF 4H1LH 4R3SA 4P2OD 5I8OH 3G08A 5EORL 2UUDH 3WLBA 3QXAB 4KQ4L 5HPMA 3I50H 1PKQE 4P59L 2ZWLT 3V6ZA 3LN5B 4XP9H 4OD3L 4OFVA 1R3KA 3U4AA 1HWGB 1F3JA 3HZYA 3C5ZD 5GGTL 3U48A 2AEPH 3MRKA 5FOBA 4RDQG 2MCG1 5DEGB 1TZGH 3EO0B 4NHUA 5FUCC 2F5BL 4QRSB 2CIKA 3T1WA 4PYHA 1G7LA 2C4XA 1G6VK 1W72H 5EU5B 5C0FB 4DZBA 5ALCL 5F1IB 4MHHI 4PB0L 4KVNL 1YC7A 4YDVA 4JQIL 1WWWX 3BSZL 1LO5A 4FQLL 4NOFA 5EOCJ 2NW3A 1U8LB 1HI6A 3F58H 4MA8H 1FGNH 4JFPA 5CZXD 3O3EA 4FFWD 3WHE1 4HC1H 4G6FD 4I0KA 4JAMA 2DICA 1CCZA 3C5SB 1AIFB 2IAMA 4UDUA 3HE6C 2AXHA 5H35B 1MHPH 2HKFH 1OAYH 4RNRA 1DBKH 1T20B 4P23A 3TIDA 4KY1L 5DSCA 5BS0A 5JW4R 3Q5YA 3SOBH 5I75C 2MPAH 5FDWB 4OBRA 1E4JA 1FNHA 4N0UE 3FJTA 4EBQH 5F7LB 2DTSA 1J18A 1UWXH 4PD4K 2NQCA 1SJHB 1YMMD 3SE3A 5A43C 4ZTOL 4QRPD 1OGAA 4EOWL 1RJZA 4MB4A 1VFUA 2I5YH 1XFPA 2E9IA 2H45A 3RVUC 1LO0L 1M71A 1U95A 4M1CC 4PP2B 3GGWA 4JFYA 3RPKA 5D2LA 2LVCA 4Y5VB 1OD9A 3PGCB 3QDJE 1IC7H 5B4MC 3GJFK 3BH8B 4QGYA 4GKSA 3S97C 1IGIL 1MELA 1C5DB 1T5WB 4YPGA 2Y6SC 4JKPH 5ACZA 1F45A 2Y06L 2YD4A 1OF2A 3M07A 4HHAB 1DQJB 1YPZB 3DYMA 1I7RA 4WY7H 3TFKC 3HE6D 3W82A 5AWNH 5E1AA 4FN0A 4NRXA 2E6JA 4K8RC 2IFFH 2VZTA 3AXLA 1YMME 3MZTA 5F7MC 5L2JB 5GGTA 5FUCE 5I1KL 1FFRA 3ALWA 4FQHB 4FA8A 1XF2B 2YD3A 3D25A 4JHWL 1QSFA 4ZD3L 5HJ3A 1T89C 2O5ZH 3VH8A 3BP7A 4UV4L 2BY1A 3F7PC 3UTTA 4NQDD 3EDFA 3NIGF 4DN4L 1GGBH 2WBKA 2QQKL 4UNUA 5FCUH 5D7SH 3RVUD 2WBJB 4CUCA 4M1CD 4I2XE 2B1HH 4PJXA 3NFNB 4BSWB 5F70A 1I8MA 5B4MD 4M4PA 4K9EC 4KHXH 1YN6B 2Y6SD 3HMWH 4OZHE 2HJFA 5FA4B 3TFKD 5HHOB 1ZK9A 4K8RD 3VXNB 2GI7A 1GCFA 4ONHA 3P30L 4JG0H 4JY5L 3ULUC 5F97E 3IDJA 4X9IA 3LAFA 4NQDE 3RX7A 2V2XA 4NIKB 3DYPA 1NANH 1EBPA 4HGMA 4PJ8C 3O6LL 4H88L 4YDJA 3WXWH 3FQNB 1FIGH 1NEZA 2E7HA 5EU5A 1XF1A 1KXQE 3WN5A 2YPLA 4B7IA 4X7TB 3KPOA 2IG2H 1DSFH 4PREB 4FOMA 5F6IC 2BY0A 1R3LA 1YECL 2C9AA 5D1QA 1DBJL 2O93L 2J2ZA 3CFDA 5BVPH 1YC8A 3C60A 5L88L 2B2XH 2P44B 3GI9H 1RJCA 3BEWA 1K4DB 5EU4B 5D71L 3ARPA 1XGTB 1ZGLM 4YZFE 3THML 4I3RH 5C6PB 4LLVB 4L29A 3LY6A 1KEGL 2X70A 4IIQC 1QSZA 3ULUD 3NFPB 3OKLB 2UYLA 4UINL 4XGZA 1RVFH 1QLEL 3FQUB 1YEJL 4UV7H 3FO9A 4DTGL 5FK9A 4JDTH 4IS6B 1JWUA 4FFYL 4PJ8D 5EBMB 4NN6B 3TO4C 1U3HB 1YMHB 2WIMA 4WV1A 3D9AL 25C8L 3C6LA 3QO0A 5FM8A 1WT5C 1EEQA 4YJZL 1WWBX 1HXMB 1MCFA 1UWEH 5C0CD 4P4KC 5ENWA 5KTEH 4OLXL 2YD9A 4OLYL 4R2GB 4UT9H 3G6AB 5JNYA 2DWEB 3MMEB 4OI8A 1U36A 3UJJL 3T04D 2P8LA 4X5WB 1YEHL 6FABL 4AENB 3V2AR 1A5FL 1DQJA 2WWMC 4HZLB 4LEOA 3DUSA 2CXGA 4R4BA 5F7FA 1FE8L 2AJUL 4JZOA 3AAZB 3SDXF 4JZJC 2ZOLB 4CMMB 4PS4L 5DK0B 2W9EH 4F7PB 1YJDH 3HAEG 4UIKH 5SWSB 4ZPTB 1XH3A 3QHZL 4MD4B 4HWBH 4HK3N 2ITCA 4NQEA 3QNZB 3O2DL 3VJ6B 3TO4D 1W8OA 5CJXA 5AZ2H 3MCKA 1R3HB 3QEQA 2VDOL 4Z0XB 3OPZL 1MAMH 1G7MA 2BY3A 2N4IA 3UZEA 3MOBL 4MJ5B 4QHUA 1JF5A 4P4KD 2BSED 1FFPB 1TQCC 3A6OA 3TT3L 1MCPH 3EOTL 5J56B 5DWUL 4BSWA 1WC7A 4GW5B 2R69H 3QZWB 4K2UH 2H8PB 1YN6A 5C0GB 3VG0L 1KIRA 4NO0D 4M6AA 1DE4B 4J12A 2PYFA 5IHLB 2WWMD 1HKLH 1OLLA 2V7HB 4KRPC 5KZCB 4RX4A 5HHOA 3HI1A 1J05A 3IFLH 5FECB 4RFEB 4B41A 4UNTA 3UTPD 3O0RL 1CFSB 3H3KA 4NQCA 4P5TB 1UM5L 5KVDL 1EGJL 4RMQA 4HIHA 2IWGA 5KJRH 4TNWF 1NUDA 4HXBH 3MUGB 5TDNA 4JDVA 1KJ3H 5B21A 4PJDF 4IOSD 5CINH 3VFWA 3AS0A 2VLKB 1IILE 1CD9B 1QSED 3EYUH 1MCBA 3MXWL 3PJSB 2Q76B 4Y2DB 5SWZB 5I17A 4KI5F 5T1DH 5ANMA 3HI5L 5DMIH 3PABB 1A6TA 4UAOB 3DWTA 3GK8L 3UYPA 4X7TA 4ZOBA 1NBYA 2E27H 3DJ9A 2D03L 5FB8B 5C8JB 1TQBC 2Q8BL 1CLZL 15C8H 5D7IE 3WL9B 1LDPH 5DR5H 1OB1B 3MREA 4PRHB 5EN2A 5LXGL 4MCZB 3UTPE 1K4DA 4LVNB 3VMPA 3PNWB 3UC0H 3RNQB 5I1EH 4LLYB 2AV1A 2BDNH 5AD0A 3F7VA 1SMOA 3BWUC 3MRIA 1EMTH 4KRPD 1Z0NA 1AC6A 5IMLB 1BOGB 2DD8L 3BDYH 5JMOC 1DQDH 3IRPX 1XGYH 5C08A 2DQJH 3LRHA 3ARQA 2C26A 1RULH 1SEQL 5TFSL 5ID1A 2YPKA 2OTUA 3O2DA 2PTTB 5HI4C 4K71C 4PG2A 3D87B 1X3DA 4P46A 3W5NA 4LHUG 2H6PA 4U1IA 3TO2B 5EUOE 1FFOB 2WP3T 1P1ZB 2X7LA 5KANG 4Z7VB 4GRLB 1JHLH 4WVRA 4K3JH 1YUHA 2DQUL 3G6AA 4LGPB 3EJYC 1KEML 3KYAA 1KIPA 1TJGL 2C3GA 1UXSB 2DYPD 2HFGH 3R1GL 4HBQA 1NMBL 4XCFH 4YDIH 4HKXB 5KW9H 1IGFL 5ISZA 2C3VB 1NAML 2ZJSH 5DJ0B 1HHGB 4DKFH 1HQ4B 2GFBB 2YSSA 1R5VB 4MJID 4EI5C 1H5BA 5DFWH 2YKLL 2ZOLA 4CMMA 1A0QL 3EJZC 5FOJA 3TIEB 4IHOA 1IGJA 2ENYA 5DQDL 4ZPVA 3LV3B 1A7QL 4G6MH 4NYLA 3MV8A 3VFVB 2Q8AH 3PHOA 4ZMAT 5JHDA 4NQXA 3MRNA 4D8PB 1EK3A 3TNMB 5HI4D 2V2WB 1IGCH 1DJSA 1OW0C 1D6EB 3MRJA 4WI4A 5K9KB 5CSBA 1GAFH 3KPMB 2AEQL 4CMHC 1MQ8A 4H5SA 3RWIA 2FR4A 5DMJB 1FV1B 3OTTA 3RWGA 1AGBA 1T3FB 5ICXA 35C8H 4KVCL 1R24A 3I84A 5ITBH 4ODWB 3ULUL 1Y0LA 4NZRL 5GRVK 4AG4L 4XVJH 4XWOC 2RGSA 3EJYD 2G60L 2CGRH 1F42A 5FYKL 3OF6A 2H8PA 3TBVB 5BV7H 3BQUC 3T2PA 4M3KB 1DE4A 3REVA 1T0MA 4DGVL 4UTAH 1QKZL 3BDXA 5BW7C 3L9RB 3O6FC 1ZLWK 3U7YL 5I1HL 4N8CH 5B38A 1XGPB 2DLGA 1CF8L 4XC1L 2NZIA 3BPLB 4EI5D 4RFEA 4Z78B 5E6IC 3STLA 1HHJB 3EJZD 1CFVL 1ZT7A 2D31A 4P5TA 5JIPA 1UCBL 5E9DD 5E2JA 4G9FA 2DI8A 4P3WA 3ES6A 1IGYA 3BP5B 4EIZC 2Q6WB 3A67L 3QUYC 4OSUH 3RL2B 5HI3C 1DBML 1J0HA 3F12A 2OP4H 4EN3A 3RHWF 5SWZA 4KDTC 3FQTB 5GS2D 3H42H 2J88H 5CEZL 3HR6A 4HT1L 3KVQA 2R2BB 1C7SA 5H2BB 3UTZB 2GIYA 2YPVH 3FO0H 32C2B 5DXWA 1ZANH 3H9SD 4OM1H 4XWOD 2EH7H 2W0LA 4M03A 4WW2A 5D6CA 5CAYB 3LIZH 1NAMA 3QG7H 3PDOA 4PGJA 4WHYH 3BQUD 1BQSA 1TVBA 5FCSH 3O6FD 2R0LH 5IV2A 4FQCH 3K0WA 1KJ2H 5DMKA 3CZFA 1NCUA 3JV6A 3VXRE 1LO2H 4TPRL 5E6ID 3ZKXB 3SDDC 2GCYA 2O5XL 5CJOL 4XXCC 1H3GA 5JIIA 2H32B 1VACB 1RURL 1S7WB 4ZQKA 3QUYD 1E0OB 1QRKA 4FQIL 1NCDL 1EHLH 5GSVB 1FO0H 4XMPH 2FRGP 4LSQH 3H9SE 3ZKSD 4JEGB 4QXGH 4EQ2A 2R1YB 5T5FH 4ODTH 4M9PA 2MCPH 4KZEL 1KCSH 3LKQA 4GRLA 1INQA 3L5XH 2XI9A 4HZAA 4PRDA 3LD8C 4LSRL 1WVZA 1XR9B 1ITBB 3P4OB 5F21B 5I2IB 1MJUH 3QQ9C 4OV5A 4LHQB 4X6DE 4R97B 1UXSA 2XT1B 4YBHA 1P7KA 2GAZA 1JPGB 2VJXA 5JW5A 2ZSWB 4R0LA 1HHGA 5GIRA 3KLSA 4GAGL 2EDKA 1R5VA 1RK0B 3HC0A 4OAWA 4Z8FH 1DUZB 1L9MA 4UDTB 4JPWH 4J3VA 2A6IA 3SDDD 4XX1E 5C0AB 4XPGL 1MCOL 2G9HA 3RWEA 5MEQA 1NGPL 5INCB 3TNMA 1YNLL 1FH5H 3V5KB 4ODXA 1FRGL 1WBYB 1YEDB 4F9PA 1D3CA 3ZDXF 4HGWA 1WFTA 3T0EB 4GRWH 1OP3H 2I24N 4LVOB 1FV1A 2WZPD 4NGHL 1CLCA 4LSTL 1MCCA 2PXYB 4PJCA 4G9DA 1BEYL 5J1AB 4X5XA 1ORQB 2VR4A 4LCYA 1FL3A 3LRSA 4S1DC 3MACL 3PQYD 5C7XH 1RK1A 1NSNL 5ABDE 1QQDB 3TBVA 5EU6A 3QQ9D 2OCFD 5L2KD 2YK1L 1PY4A 2XZAH 1T1YA 2P5EB 3AREB 1A6ZA 2I25N 4MNQD 3MV7A 1KFAH 4PJFE 3LKOB 4QOKD 1LVEA 4LF3B 5DDHA 3T08A 4G5ZH 4FMKA 4OCRH 5F3HA 5TQ0L 1HHJA 3T4AA 3S35H 2QSCL 5TDPB 4OGYL 1HHHA 1RMFL 3ZE1E 3BP5A 4KRMB 1CL7I 3ZZ1A 5DJYB 4TNWK 1EFXB 4JPKH 1JE6A 3ZL4H 4G80B 4HWEL 4QXTA 1MWAL 4U6VH 5F3BB 4Y4HB 3PQYE 1BD2B 5DJAB 1M7IA 3PXJA 1I8KA 4J6RH 2OM5A 4NJAH 5E5MA 5L2KE 8FABB 2GYSA 4O5LL 4JJHA 1KB9J 1V3JA 4QOKE 4EUPG 4OM0H 4S1DD 2HTKC 1G7PB 4S1RH 2FLBT 1NGWA 1BVKB 4MZ2A 3FOMB 1C12B 5D2LF 3BKML 4HQQL 1XGUA 1MI5A 1XF4B 3KHOA 4WO4B 1U3YA 1A6PA 2CR3A 2EZ0C 5FYLL 5ACLA 1G7IA 2ESVB 4DK6A 3ZYZA 4M7JH 2FL5A 4Y4KC 3CVIL 2EC8A 1BQHB 1UYWL 4OCXH 1B4JH 3I9GH 3L5IA 1FORL 4BKLB 2GJ6D 4G8GB 1I9RH 3NH7H 3EFFB 3U0WH 1VACA 1MAJA 3LEYL 4LCWA 1GRWA 1SY6L 1CT8B 4OCSH 5HYEA 1CL7H 3BRGC 1BMGA 1BJ1J 4W6YB 1OCWL 4U1JA 3MBXL 4YBLC 4OZIA 2R1YA 4XBGB 4AEIL 3GRWH 1M6OB 4HS3A 2B5IB 2E5EA 5I74C 3RRQA 1FHGA 3L3DA 4WEMB 3FB6A 1RUPH 4OCYH 4OKDA 1RZ7H 2YEZB 1AGEB 4MSWA 1XR9A 4LASH 4OZFG 2UZIH 5IESL 4KDVA 1T7XA 2HTKD 4WTWA 5F88B 3IJYA 2F58L 2GJ6E 4ONFL 3FKUS 1ZLSH 5SX5H 1KLUA 4XNMB 2OBGA 4NWTH 2NY4B 3ZTNL 2XZQL 4L8SA 3LZFH 2W60B 4FQPA 4PJXF 4YAQA 1EZVX 3T2NH 3DO7A 3NACL 3SE9H 2VZUA 2EZ0D 5D2NB 2VDPL 4K94H 4O4YL 4Y4KD 4AL8L 1G9MH 4X80L 1MHHB 3HAEB 2RHEA 3QR2A 5C0AA 2FD6L 4WWKB 5TDOB 5ESQB 3T2OA 4LCUA 2J4WH 2I60L 4PJEE 1YY9C 1MFNA 5INDB 1G7HB 3TESA 3VXMD 1Q94B 1MWAA 2J8UB 3FB5B 2FB4L 3GFUA 5IFJA 5HPOA 3G6JA 2JCCE 3EYVB 1C16B 3VI4E 4RA0C 3HNVH 1P84K 3PWNB 1S9YA 3O45B 4PG9B 4JB9L 4BSVA 1FFNA 2XACC 5EU7E 3SY0B 2XWJB 3CIQA 3WSQH 4FQJL 1L6ZA 4YBQC 1BQLL 1QRNE 1IQDB 3O4LB 5EOQL 1RZFH 2DLIA 1NBQA 1XR8B 1NMCC 4N0YL 3BYYA 3M1BB 1AGDB 4ELKB 5IB2B 3FTGB 1B6DA 4DVRL 4D9LH 4PRNB 1BGXL 4XWGL 3DXAA 3LKOA 5F9WB 3LQAH 1A1NB 2GSGA 1WSST 5T3XH 3BP6A 4XCCH 3MFGB 3E6FA 4JCMA 3P73B 5T1KD 4TUKH 4CVXB 5KVGL 3MUHL 2DDQL 2ZUXA 1TZHA 3QPXH 2RCSL 2PF6A 1UT9A 1SY6A 3QO1B 5TDPA 2W9DH 4C54A 2JJSA 4LCIL 1IKFL 2Z91A 5HVGB 4R7DA 3HPJB 1YY9D 3GMNB 4UB0H 4NQVA 3MGAA 5I30L 1JRHI 3N1PC 2D3VA 1EFXA 4P5MB 1D9KB 3VFPA 3KWWB 4JO1H 4Q6IB 5C0EA 1UZ8B 4NBXB 1EEYB 2FLRT 3QUXB 4ZYKB 1K4CA 1BIIB 5E2TH 3HRZB 4XTRC 1R3JA 1R3IH 2JIXD 3HB3C 3RHWK 5C0NC 1U8PB 2XN9D 4K55A 3WIHH 4M61A 4S0TD 1Z9OA 3WS3A 4YBQD 1S7VA 4V1DE 1ND0B 4PJ9C 5HHXL 5IG7A 4R6UA 1G7PA 4Q9RL 4GXUM 4NRYA 3V0VA 5DGQA 3V95A 2F74B 4NNPH 3FOMA 3U4EA 3V7MA 1E4XH 1UM4H 2E7MA 1WIPA 4R26H 3IF1B 1LK2B 3P9LB 1HH9B 1K5NB 5BRZB 1DN0A 2JTDA 4IRZL 1IARB 3TZVB 4CADA 1MHCA 5FF6B 4OZGB 1BFVL 2WMPA 3OZ9H 3UEZA 1K3ZA 3OR7A 4PB9L 2HVKB 3EFFA 1Z3GH 2VLRA 4HIXL 1CT8A 3I6GB 1CFQB 3DECA 2XN9E 1JRHH 1I9JH 1SBBA 1P6AB 1DUYB 3QEHA 3C2SA 5IROC 4RZCA 5HVFB 1UKSA 1FNAA 1S3KH 2FEEI 3D3VE 5D5MB 2DJ4A 3EW3B 4XTRD 3HB3D 4ZUUA 2AI0L 5I1CL 3H7BB 5C0ND 3TYGH 5F9OH 4ESKA 2YMXH 2ZCHL 5IF0B 4JKMA 3DMMC 1KJMB 2NLJB 4JY6A 5IQ9B 4Z5RB 4PJ9D 5DJCA 5A16A 2R39A 1BZQK 3U7WH 3FCTB 2HMIC 4CN6A 2JB5L 4RFOH 1FIEA 3TT1H 2ARJB 5HHQB 1IKNC 1DQQB 2YOCA 3MRFA 1A4KA 5D2NA 1YJDC 4ODUA 5DURB 5TJWK 4Y4FB 3BH9B 5MERA 1MHHA 3HAEA 3BUTA 3O3AB 1RFDL 1IEBA 4FQXA 4WWKA 1FZKA 5DUMH 5ESQA 3ARGC 1ZHNA 5IMOB 4I0PB 1TVDA 3KYMA 1HXYA 4JRYE 1G7HA 2PW1B 1MCHA 2VRAA 1OPGL 2J8UA 3FB5A 3FT4B 4Z18A 4F15B 1PDKA 3EDEA 4OLVL 4PRBA 1S7TB 4GKZB 1RUKL 4KK8C 4IMLA 4UI2A 4P99A 1C16A 2BX5A 3BEVB 4P3DA 3O4OC 3DGCR 4IRJA 3U7AA 5JXEC 3O45A 1H8SA 3Q5OA 1EH9A 2F54B 4HKBA 4X7SL 4YGAB 3V8OA 3X3GL 3RY4A 4BH7A 1SBSH 2Z31A 5IVOA 5JW4Q 4G8EB 4CN4A 1P7QA 3DMMD 3K2MC 1JJUA 3KJ4B 1XR8A 2VZSA 4QF1B 4AIZB 4XC3H 5L8KB 3QDMD 4ELKA 2HMID 2EE9A 3AVEA 1IQWL 3D39D 2FZ3B 5C86A 5DQJA 5DS8A 1JGLL 4E0RA 4X9HA 3WDIA 4XP1H 5HYSG 3ZYOA 1C8PA 4WUUB 1FGNL 4KROC 2HG5B 5JR1H 4P2RA 3IB4A 1YY8B 3UJTL 4DN3L 3QNYA 2ILLA 3ARGD 3BT2H 3WV0A 5B39G 5ADOL 4PGBB 2WUBL 3SE8H 1OAYL 4NZUL 2ADJB 3EOBB 2OR9H 4KK8D 2DMBA 1ERNA 3QCUH 3RY6A 4YE4H 2XA8H 4R4NC 3I3DA 2HH0L 1FVCB 3SOBL 1IAKA 4M1GL 1FPTL 1L0YA 3PGFH 3UJIH 3BZEB 2MJWA 3HMXA 1MRCL 1PKOA 3D39E 5F72S 1CICC 2FNBA 1CQKA 1FNEB 1WF5A 2IBZY 1XAUA 2A6JB 4NN7B 5KVEH 3RUGE 1F6AB 3QP3A 5IBTH 3GBNH 4K3GA 2I5YL 3ULVC 4F58L 1AXSA 4G8IA 4X9BA 1YDPA 2FX9H 4I9WE 5CEYB 3QI9A 4KUZL 5GS1C 4C56E 2DTML 5FF6A 2DLHA 3KDMB 3OX8A 1IC7L 1DLHA 4GG8B 4KROD 4RBPH 4Y5XB 4JKPL 3WHXA 3SCMB 2DIJA 3U4BL 1U92B 4CJ1A 3I6GA 1N3NB 5T1LD 5J3HC 1AR1C 4LHUA 1U8NB 4IDLA 2BNUB 2VLJE 2FO4B 1HHIB 1H3PH 1AD9B 3SBWA 4FQQA 1IGTB 2BNQD 1XCTB 4HIIB 5E94A 1MAKA 1BF8A 4M7KH 5EC2B 1CXKA 4R4ND 3CSYA 4R90H 4F7TA 4LU5H 2P8MB 2VH5H 5LGJB 1M7DA 1CICD 3P4MA 3FCTA 1X5ZA 2C1OB 3DGGB 2OI9B 3A6CH 1CS6A 3B5HA 4MWFB 2DS4A 1GGCH 5D7SL 3ULVD 1DN2A 4OLUH 1S9WA 3O3AA 1TLKA 1T83A 2B1HL 3NA9H 5CIPH 4ZFZB 4GAYA 2BNQE 1ZT4A 4OIAA 5D7JA 5DA0B 3U30B 1RUML 2Z4QB 1EIBA 5GRUH 3HMWL 2NXZC 3AY4C 4BYHA 4W70A 4BJLA 5I1JL 2CDGB 5J3HD 1AR1D 4GKZA 1UKQA 3TPUB 4JFFA 1J9CT 3EYOB 2DAVA 1T2QH 2XTJB 3U79A 3SJVD 2X4UA 3S5LG 3GMOB 4P2QB 4RCAA 1YA5A 2GK0B 3ULSA 2F54A 4R7NB 4ODHH 5J1TC 5EULV 5BV7C 1NL0L 3WD5H 3ULVE 4KUCD 2R1WA 4ODSL 3WFCL 3TGXA 3WXWL 1ZLWH 4X0KB 4XPFH 2GJZA 3GSNH 1FIGL 2EIDA 5IMMA 3AU1A 4W4OA 1F13A 2IQ9L 2JKXA 4I3SH 3RA7H 1L7TH 1TCRB 1A7NL 4WW2F 4CU8A 2ZCKH 1FZMB 4OQTL 1ZHKB 1IBGH 4YX2H 2C1PB 1P5UA 4JM2C 4XBEL 5FO7B 5I73C 2IGFH 5FKAA 3D69B 2BSTA 2NXZD 2EO9A 4GS7B 5CP3A 5J89A 5IK3B 2ADJA 4I3RL 2P49B 2VDRL 4YEEA 3MSPA 1UJ3B 3NCEB 1MCIA 2ADIA 1MY5A 2SEBB 4YO0B 2YA1A 3CH8A 5KOMC 4JJ5B 4HUNB 4OBSA 2D7TH 4XNYH 1KG0B 4EUPB 5KN5A 1NGXB 2DN7A 3V5DA 1FNEA 1EHXA 4PYGA 4Q9CA 2A6JA 2OMNA 4OCLC 1EHNA 2DI7A 2IBBA 1UWEL 3OV6A 1PKQB 2APXA 1A2YA 3L5HA 3RTQC 4HEPG 3N50A 1BBDH 4J4PC 4G43A 5GGSY 4DEPC 2FGWL 5IFAL 2HTLC 2D7QA 1JBJA 4FP8H 3KDMA 3CXHK 1G1YA 5K9JL 2F8XC 1A3LL 1RHFA 1A9BB 4M43H 1IGMH 5D93C 3KYOB 5DLML 4JM2D 3ARDB 1U92A 2DKUA 2BNUA 4I77H 3O3UN 4NSKA 2VIRB 2DJSA 1XCTA 2W9EL 2VR5A 4P2OB 1N4XL 1VEPA 4FHBD 1OAXH 1VKXA 1UC6A <