1FNLA

Crystal structure of the extracellular domain of a human fcgriii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
173
structure length
173
Chain Sequence
EDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system receptor
molecule keywords LOW AFFINITY IMMUNOGLOBULIN GAMMA FC REGION RECEPTOR III-B
publication title Crystal structure of the extracellular domain of a human Fc gamma RIII.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnlA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnlA02
4H26B 1HSAA 3DVGA 4L4TB 3FQTA 4HBQA 4X6DB 4KKLD 4XX1E 3CMOH 4QOKE 3VA6A 3IVKA 1PYWB 1S9WB 4G80B 4NKOA 1IFHH 4L3CB 3BDXA 1S7TA 3KDMA 3MLZH 1QPXA 3QRGH 1I85A 2W65A 4LLVA 1G9NL 5C0IB 1U9KA 5HBBA 5I73B 1OWRM 3FQXB 1ES0B 1A6AB 2PO6C 2IMMA 2NY5L 3DECA 1HHIA 5C0RL 3BPLB 4HS8L 2YPKB 3GJFK 4R8WH 1A3LL 2WINB 3ZTJG 3VWJA 4N5UA 4WFED 2HTLC 1AXTH 4XNYL 3WN5C 3MRMA 1EEUA 3H3KA 5F7WC 4LCUA 4NM8H 3F7QA 1BHGA 3CDGA 3MZTA 3KYMA 4PRIB 1PY4A 3NZ8A 3NABH 3TIDA 1QQDB 4PB0L 4X9BA 2ZNWA 4U1MB 3P9MA 4Z0XA 2DBLL 5CJ5A 1EEYB 2PTUA 4PJ7A 1RSFA 4L3ED 3MLYH 1JF1B 4DFIA 3P4NB 3MYZA 4JFDA 3DIFA 3H6JA 4TTDD 4P46A 1UM4L 1T7VA 1WEJL 2ATKA 4TN9A 4YHNA 5D6CB 2GSGA 2OS7A 2OSLA 2BSTA 1ZVSB 4LSVL 1FL3B 1PKQB 2NNAB 1AE6H 3UYRL 2NR6C 2YUVA 4Y4HB 5DRNB 5IB3B 4X6CA 4GAJL 2IANE 4JO4L 1IGFL 1F6AB 5L2JA 3LCYA 2XTJE 5D93C 5CSZA 4F3FB 5T5FH 3B2VH 2X44D 2XZZA 3MOQA 4ONOA 2H3NB 5EPMA 5CEYA 1MHCA 2YD1A 1C7TA 4PJ9A 4KROC 5BZWB 3NZHH 5ADOL 2OM5A 5MENA 3MACL 4K7FA 3UYPA 1AR1C 3PF2A 3QXVA 5A40E 3VXUE 2WAHA 1R3LA 1LEGA 1MHEA 2VN7A 3RWHA 4Y16C 5JIIA 1FVDA 4JFYA 4EDXA 3SE3C 3VG0L 3RX7A 3MMEA 3L3HB 2AGJH 4GBXA 4M1DH 1TJHL 3JXAA 5BS0B 1GHFL 2X7LA 3KPTA 4K8RH 5F1KC 3VH8G 3OB8A 4MHHI 1VFMA 3FT3B 4NYLB 3CFJA 4APQB 4NFBA 2F53B 43C9A 2A9NL 3ET9F 1CGVA 2EC9T 3PQYE 2IADB 3MA7A 3NCYS 2VJXA 2AEQL 1WWCA 3DXAA 4JFQA 4FXGA 1EK3A 2CMRH 3GSVB 4EN3A 1QRNB 4AIXA 1NGPH 2DMKA 4WNQA 2VZUA 1PZ5B 1RI8A 4PV9A 4LSRH 1BREA 4CDHA 4WWID 1MCOH 2ERJB 4XCNB 4LARH 3W0WE 3FO0H 4F9PC 4Q74A 1ZLVK 4MA1B 2Q76A 4C56D 3GUTB 4HGMA 3UBXB 4O58H 5L8LB 2J8UF 5J57B 2DYPD 3TO4A 2HG5A 2YR3A 1HINH 4NOBA 1J1XL 1DUYA 4BSVA 4WV1B 1GCFA 4FQXD 2OR7A 2MNUA 1OLLA 4MXWL 5CHNB 4Y19B 1KIPA 4UIKH 4BFIB 1OTTD 3DX8A 1MCRA 1FNHA 4QXGL 2V9QA 1XGYH 4PV8B 3O3BA 4Z0BL 1JZ3A 4DZ8B 2IH1B 5E99H 2VERN 3FL7A 4JM2C 4PJHA 3WO4B 2V7HB 2XFXB 1CDBA 2XZQL 4FQIH 1ZS8A 4NZUH 2VR5A 1KPRA 2G2RB 3T8XB 5J11B 5IBTL 2C4XA 12E8L 1N0XL 1AXSA 2DMBA 1EFXD 2BSRB 3VWKC 5I1CH 2L7JA 1P6AB 2IFGA 3HN3A 4X0KB 3ZKXC 4XNZB 3OG4B 4JQIH 5KVDL 3NFPB 2OJZL 2VDOL 4LLDB 2GTWA 2V2XB 5TE6H 5GRVL 3TEUA 2X70A 5ANMA 2ITCA 4U0RB 1ZLUH 4M5YL 4NRYA 3WD5L 4M48L 1NBVL 3DRTA 5D1XD 3VJ6A 4AY0A 4OFYA 4JFFD 4ZMAT 3ZYZA 2NTFA 3P4OB 4OFIA 2AJXH 1NJ9A 4I13B 3VFSB 4OV5B 3LZFH 4JREB 3AM8A 4LVOC 4ZOCA 4DUXA 2GK2A 3GRWA 5HHXH 1MJ8H 1A6TB 5DURB 2ICCA 5IHBA 3ZT6A 3MRLB 2VSDA 4XPAH 5GGRY 1GGBL 4W4OC 1OSZB 7CGTA 3HNVL 5ETUB 2P5ED 4P2QD 4HFUL 4QY8B 1N6VA 5F6HI 4QXUL 3DMMC 4FG6C 1V05A 1QBMH 4OZHF 3FRUA 5HHOD 1G7JA 5CD5C 4L4TE 4A6YH 3DGGB 4HQQH 4M7LT 3L7EA 4P3DB 3E8UL 5DZNA 2EECA 1X5FA 3L5HA 1TQCC 2FYYA 4RQQB 3GSQB 3WNMA 1CIUA 1OP3H 1QHPA 4XWOD 1EV2E 1R5IA 4LAJH 1RJLA 3FFCE 3X11B 4M93C 4TSAL 3C5ZB 2WMPA 1ORSA 3C5JA 1U93A 1QFWM 5LXGH 2A77L 1RZJH 1A64A 1YPZE 2FR4B 1XT5A 2IBBA 5HTSA 3OF6A 3SDDB 2X4PB 2IFFH 3MNZB 4JY5L 5FOBB 5F7NC 1DQLH 4FQHA 5ECJE 3RVWD 2IG2H 1U8JA 1R3HB 1NLBH 3CFBA 3V6ZA 3O45A 4YDJA 3O2VH 5DC4B 3KPQB 3STLB 2CLZA 4PGEB 2BNRB 4MCZB 1LNUB 2MHAA 5DEFA 4KK5C 3QUYA 2D7MA 4NHCH 1KLUA 5GS0L 5M7QA 4J7RA 5DFVD 5B8CA 1YECL 1A14H 1MJ7H 3TO2A 2R2CA 3LDBC 1OGAE 3HZYB 2ZOKB 2DQGL 5IEHA 4KPHL 3G04B 2QTEA 3QIUD 2CUMA 1ACYL 1PKQE 5I8CB 3IXTA 4TVPH 5D7SH 3UMTA 1CU4L 2Z92A 4PTUB 4N5EC 4RFEB 4E9LA 1S7RB 3ZHDA 5LAXB 1T5XA 1JHLL 3KGRA 1EHLH 3EOBA 3GNML 4M7ZB 3STZB 1G1CA 2Q8AL 5IW1A 4KMQA 1JYVA 3HE6D 4HJ0C 3RGVC 4KHXL 3EO0B 1XIWC 5JUEH 4RX4D 1J8HE 4X6FB 5T1LB 2PYEB 3GO1H 4DVRL 4Q9QL 1L7TL 1GGTA 1SM3H 3LRSB 4LGRB 4XCYB 1RUAH 3FO2A 4TPRL 3HTLX 4HUWA 4CN6A 3G5ZB 3QDJA 1MWAL 4XCEA 1KTKE 2YD9A 3HE7B 5IMLB 1SMAA 3ESUF 2DQHL 4V1DE 1OAZH 3RWDB 3VXTA 2ED8A 5TDPA 3CJJA 2G60H 1KG0A 4JG1H 1S5HB 2I27N 4OZFH 1KPVB 2F53E 1CFTB 1AD9A 3HC3L 5GSVB 1NAMH 5EZOH 2KZWA 2ESVE 2AJ3A 2VXSL 1JPSL 4N0CC 2JKXA 4JPKL 5DHVB 1IT9L 3O6FC 2EIDA 4LHUG 4LCWB 1KT2A 2ZCLH 1NPUA 4KK6C 4J4PA 4PJIF 4OGAC 3KPOB 3BMVA 3HCVA 1N6QH 3G6AA 4OAWA 1DBMH 3WIHL 3QT2A 3RZCB 4O9HL 2I07B 3GBNL 1T4KA 3ALXA 4KI5F 3GMPA 5D72H 5DVLA 3NCMA 1I1AD 2GCYB 2AEWA 3DX7A 3W11C 1ZEAL 2FL5A 3SKMA 4O02H 1I8LA 2JIXA 2Q7YA 1G7IB 2Y5EA 4U1SB 4O5LL 3PGCA 4YXKL 5FYKH 1JWMB 4NNPL 3SDCB 1EH9A 3QPQD 3ZKND 3UO1L 3N85L 3ZE1E 4BZ2H 3WKMH 1MRFL 3CNKA 5GRJH 4R4FH 4XRCA 2VLRD 4XGZA 4EUPH 2CUHA 2J88L 2EDBA 3DURB 3MV8A 4FTVB 4Z95H 1MI5B 2VDQH 4Q58C 4TSBL 5E6ZA 1QVOB 4IHOB 2F5AL 5I1LA 3ARDA 2H6PB 3D85D 5GS1C 5IQ7H 5HYJD 2NY7L 1VADB 2AAVA 3TA3D 3VFUA 4F37K 1KGCD 1J7VR 3D69A 1JP5A 1OB1A 5E95B 2NY6C 5HGHA 1DBBH 4LSTH 1JPGB 3QFDB 3F7PC 4WO4A 3ARZA 3SDXA 4JRWA 1F4XH 3CD4A 4L9DA 4ZXBD 4K07A 1CL7I 5IJKA 5I17B 5I30L 1M6OA 3TJEH 4RIRA 4P5KA 3WFZA 2WIMA 3MC0A 1I7UA 1TZHB 4DAGL 5JW3L 2AABH 2NY4C 1S3KH 4LCCA 5CEZD 4JJ5B 7FABL 1TTGA 3ME0A 3LKPA 5J7CC 5A43C 1MIML 3QYCA 4EIGB 1I75A 3CDFA 2Y7QB 4RGMC 4PGDB 4PJFF 2V2TB 2VZVA 1MCJA 2A0LC 3NIDF 3QIBA 3CFIC 3I6LD 3TBYB 1KCSH 1TETH 1S7XA 4Y4KA 4ZS7L 2R1YB 1OLZA 4MDIB 1U8LA 4AH2B 1FIGL 3H3BC 3NGBC 1JRHI 5HSFA 1ZHKB 3K74B 5CJQL 1XGUB 4DGIH 1GH7A 5IV2B 2NY0C 1BECA 2BP3A 4PUBL 4OCXL 4PRAA 5GGTA 2YC1A 4IS6A 1TZGH 3BWUC 3U0PB 4PGCB 4LVHB 1WIUA 1UJ3C 4GAYB 4C55A 3FT4B 3C60D 4J2XA 3FB8A 3K2UL 2WBKA 3MFFB 4JN1L 1K8IA 4NQSA 1XGTA 4XNQA 2W07A 3K8KA 1M05B 4RWYH 5GZOD 3HC0A 1U8QA 3D5OF 1EGJL 4QCIA 4ZS6D 25C8H 3CFKB 1EZVX 3MNWA 1SEBA 5JORB 2FJFB 4XVSL 3UXFA 3T4YA 3GM0A 3F62A 1YEJH 4Z8FL 2WQ8A 2DQFB 5IK3A 3QIWB 4U1IB 1U3ZA 3EOTH 2FIKA 1JGVH 1J5OL 5AD0A 5L8JB 2F8OA 3AGVA 4L8CA 3T1FB 3CCHA 1QSED 2OX5A 4ELKA 4Z7QF 4ZUTA 3SOBH 2MOVA 2VXTL 1I7ZA 1XF5B 3S97C 1RZGA 3MLVL 3K4AA 5L2KA 3T4AA 4LQFH 4HH9B 4PGJA 4L1HA 1MWAB 3HI6H 1S7VA 3RVTD 5A2IH 4GJTB 4G6MH 2P49B 3B9KC 3RL1B 4LP4A 1HH9B 1NFIB 4WEBL 5DRZA 2IQAA 4J8RB 4JDZA 1TNNA 5D5MB 2CK0L 5HYEA 4OTXL 2MCG1 4CVZA 1AGBB 1HHKA 1H5BB 1A0QL 1T20A 5BO1L 1ERNA 1WICA 4RGNB 4BSJA 1AJ7H 4JGJA 4A2MA 2E6PA 4PJXA 4AENA 1KB5A 1NBYA 2BVOB 2X89A 3S3JA 1VEPA 2D7PA 3O9WB 5DWUH 3N1FC 1PG7L 5BOZG 4Y2DC 5HI5C 1R24A 1JNNL 2XI9A 4HXBH 2UYLB 1KLFA 2ZSVB 4QRTA 4XAKD 3MLTB 4QTIL 4YHLH 2YSSA 5F44A 3HLAB 5C3LD 1XFPA 3TBTB 2CK2A 1J18A 4H1LA 1OAQH 5AG8A 1FZMA 4LCWE 3AROA 3MRQB 3UJJH 4M9OA 5IM7A 3Q6GH 3TLRA 4M7KH 4RZCA 2VTFA 5FIEA 4LF3A 3F7YB 4M00A 1U3HB 3QZWG 3WCYA 2EC8A 2HH0H 4DN4H 5CWSB 3LKQA 3T0EA 3GK8L 1LO2H 1EAJA 4W6XB 2XNAA 5BVPH 4JB9L 2ZNXA 3LPWA 1DVFD 3DV6B 5T3XD 2BVEA 4U6HB 1Q8MA 5DK0A 1TCMA 3P73B 3E0GA 3S4SG 4WUUD 2ZUYA 1MCDA 1FFPA 1GZQA 1P9MA 1K5NA 5EC1A 1RJYA 5FKAA 5LBSH 4P9HC 2EO1A 1QO3A 1ZKAA 1I4FA 4HFWA 4PJIB 4POZC 3RIFK 1BZQK 4Q9RH 4EXKA 4KHTL 3VXSE 5C0JB 1H3TA 4HJGA 2H1PH 4OIAA 1HDMB 3NA9H 2R0ZL 4MVBD 4KQ3H 1MLBA 1MI5E 5KSAB 2RBLA 4EVNA 2J8UE 3W39B 2VZOA 1FP5A 1T89C 1TXKA 1XF2A 3R1GL 4F15B 5C0AA 5EFIA 4RFNB 3MREA 1U58A 4U1LB 1CZ8L 4HUUB 5H35A 3VW3L 4MAYA 2YPLD 1YDPA 1U2HA 1FNAA 4WFFD 1HEZB 1C5DA 2APFA 2EH8H 4H8WL 4IDJL 2CO7B 3ARGD 1VKXB 4I48A 1A6ZB 3OAUH 5I66B 2H32B 4WU7B 4B41A 1IGIL 3ZL4H 5FHBL 1I7TB 2R0KL 1T21B 1XCTB 3U0TA 2X9WA 5JTWA 4LCYA 4RISL 5EOQH 4NO0A 3LAFA 4JFZH 5ITBL 1H3VA 4I5BA 3C6LC 1WISA 2HJLB 3MCLH 3WLBB 1WFUA 5DD1H 1D9KD 3P0YL 5LGHL 4RGOH 3UP1A 4BQ8A 2FWOA 1J05A 2OXGA 4P4KA 2MJWA 3EYOA 5GGRA 3MRIA 4I8DA 3KPLA 2BVUA 5ALBL 2IAMB 1NDMB 2IC2A 3BXNA 4X9IA 3KXFD 2X4UA 1JN6B 3F6LA 4NJAL 4R97C 1OP3K 5EO0A 4HPOL 2B1HL 4HGWB 4LIQL 2DN7A 4OZFG 3BVNB 2HFEA 5IOPA 1TVBB 4QHMB 1AXIB 1G0DA 2CIIB 3DUSA 1F00I 4G6JH 5EOCL 5FO7A 4HF5H 2HLAA 4OT1L 4Y1AD 1I8IB 3L3DB 5D1ZB 4XX1G 4KRLB 4PJFB 4ZFGH 5KOMC 5F7EL 1MREH 3AS1A 4YHZH 4OZHE 5SWZB 1P4IH 4NKDB 1P84K 2DQCL 3IGAB 5AYQA 2FH8A 4F33A 4NUJA 5EU3B 1DE4B 3C8KB 4X6EA 3DARA 1A1OA 2F9BT 4O2FA 3VRIB 4JFHD 3ROLB 4RMUA 4JY6A 4LSPL 5EU4B 2GI7A 1YQ2A 2BXZA 4KFZC 3MRFA 4D0DB 3ELAT 4HIEA 2NZ9C 5IT2H 3FQUB 4PJ8C 1R5WB 2VL5A 1CLOH 3EYVB 5JHDD 4GMSL 1NEZG 2AV7A 1PW3A 3M45A 4MNGB 5IFJA 5EA0H 1CL7H 1L0XA 3MLUL 1E4KA 1U8PB 3ZTNH 3EFDH 1KTDB 4PBVC 5JZ7C 1LP9F 1CFQB 2UV3A 4BQBA 4Y0GA 5DSCB 4CNIA 3BH9B 3GIVA 4EUPG 5C08B 4XPGL 5DJDB 2YEZA 3BUTA 4WW1B 1INQA 5ITFA 1XR8A 1CXIA 3LVEA 5FFLA 2W0FB 3QQ3A 3ES6B 3QQ9D 3BGFB 1Z3GL 3KYNA 4C83B 3BFOA 3SKUD 5LWYH 5HPMB 1RU9H 5D5ME 4U6VL 4NHUA 1MQ8A 1RHHA 1KIQB 1NGYA 3IU3A 1FZKA 4HMCA 1C5CL 4Y4FA 3D2UB 5KVGL 5J6HA 4RGNE 5T1KD 4JKLA 1JRHH 3IS0X 4N8CH 1J1OL 4MHHG 4UILL 1B2WH 1JIBA 1UB6A 1JNJA 1DFBH 4MCYB 2HMIC 5F7FA 5IROA 3IRPX 5FYJL 2J8HA 4X7TA 1KUMA 1NDGB 3E3QE 2NY5H 4UT6H 1A47A 1Q72H 3UTZB 4DVBA 4H8WC 4HS8H 3DVGB 1WCQA 1G9MC 1TTUA 1MAML 3BD4A 3BH8A 3FQTB 1MFBH 4P2OD 4UTAL 2Z91B 3S3SA 1GAFL 3S8WA 2H41A 2RHEA 3GRWL 1NLDH 5ILTH 3IVKB 3MNVA 1BQHG 1L0YA 3X3GL 1HQ4A 1S7TB 5TFSL 2W65B 3GJEA 1KIUA 4NNYB 3QG6A 1ROWA 3BUYA 1GGUA 2XZCL 3W2DH 4KZDH 2QQQA 4KUZH 2NYYD 3JWNC 1NGQH 2AV1B 5F6IB 1MCPL 1DCLA 5DD5H 4LGSB 32C2B 4U6XB 2D7NA 1U8HA 5SWSA 2F58H 4CMHC 3DUHA 3MR9B 3MRMB 3QG7H 5DLML 2AI0L 4MJ5B 4OUUB 5CEXA 4PJGF 1QYGL 3UYRH 2EIBA 1YC8A 4HWBH 4OGXL 3PWPA 4GAJH 3GHEH 3BRGC 3NZ8B 4QT5A 3ALWA 2EXYD 1IGFH 3WFEL 3TZVA 4Z0XB 4PJ7B 4PJIE 5L7XL 3QO0A 4GBXC 2NY3C 3BEWB 4XCFH 1HHJA 2JJSA 1DQDH 3C9NA 4XPBL 5ACLA 3FQWB 4JFDB 3DIFB 2E8ZA 3KPSB 3TPUA 4P46B 3RNQA 1Y0LA 2ATKB 2DIAA 5T1DH 4YHNB 4KI5E 2V5TA 2GSGB 4R2GD 2OSLB 5CMAA 1IEHA 3Q0HA 5E00A 2F54A 4X6CB 5L2JB 1LE9A 1CI5A 4I0KA 1HYRC 1KJ3H 4HUMB 1RUQH 1A9EB 1AQKL 5EPMB 5IB4A 5CEYB 1MHCB 2CR3A 4PJ9B 1VERA 2A9NH 4DKEL 1O0VA 3UX9B 3MV7A 3QDHA 5GRWA 1ORQB 4B0MM 3PWJA 3KR3H 2YHGA 5HD8C 1GSMA 3CSYB 4PB9L 4NN7C 1R3LB 1UCBL 2IGFH 1AKJA 1LEGB 1MHEB 3QHTC 3RWHB 1A4JA 1J87A 1FVDB 3BKYL 1IRAY 4JFYB 4EDXB 5F93C 3I9GL 4S0TD 3MMEB 5ESVB 3EAKA 3TV3H 2X7LB 2F8VA 1N7MH 1D5XA 3VXMD 1IAMA 1QBLH 43C9B 2M26A 5TDOB 3MA7B 1O7SA 2BY1A 3PWVA 1NMBL 1U41A 1OPGH 1BM3L 1FNGA 4NWTH 3BKML 3DXAB 4JFQB 1LGVA 4FXGB 3O2DH 4EN3B 2I9LA 4GRWF 4NQDB 3EYFA 1VB9A 3Q48A 4WNQB 2FZ3B 4K8RD 5EG6C 1NC4A 3RIAK 3MROA 4ENED 4JPIB 4HAGA 4K71B 3U1SH 3RGHA 4HK3J 5DC9B 4M43H 4UI2A 5D96C 4F7MA 3ILPA 5KW9H 5DHXB 5MEQA 3DLQR 4PJFE 1LEIA 1P4LA 2XZQH 4OD3H 3TO4B 2HG5B 3NIDE 1ZTXH 1HHGA 1JWUB 5EU5A 5SWZE 3S37X 4I0CC 1HH6A 2DB8A 5J12C 5A16A 1CLYL 1G7MA 3MRHA 1KIPB 4ZPVA 1RZKC 4LLMA 3DX8B 3RNKB 4UQ3A 4I0PA 2IPTH 5KVDH 1W0VB 1T80A 3O3BB 5DR5L 4PJHB 2Q7NA 3DI2B 4UDUA 1U3JA 1ZS8B 3PL6A 4IRJD 3WJJC 1GYAA 2F5BL 2R23A 5C07D 4Q9CA 3VFMA 2MFNA 3MLXL 4UINL 3S34L 1F02I 1HHHA 5BRZA 5L6YH 4MXQC 3DROA 2DWEA 1LHZA 3Q5OA 1WWAX 3H7LA 1DQJA 1YEFL 3K1KC 1SJXA 35C8H 2QQNH 3JV4A 5C08E 3VD5A 2XYCA 5ANMB 1MFCH 2ITCB 2JELL 4OGZA 3ARRA 4NRYB 3DRTB 3E1F1 3ZDXF 3OXSA 3VJ6B 1DDHB 5E94A 5D7JA 1S9VA 3RPIA 1EO8H 3HA0A 4BFEA 5J6GA 4RMWA 4ZUVB 3T08A 2NTFB 4KJWD 4Z7QE 3UYOD 1CICA 3TN0D 4ZFZA 2L0DA 4EBQL 3HAEA 2K1MA 3MSPA 4XZUB 4JZJC 4JFXA 2MQCA 2HFFB 5LKNA 1AO7D 5IGXH 5JIKA 4KKAD 4ODHH 2CPCA 3QUYC 3VFGH 2R0LL 3CLFL 2D0HA 1XCQB 1N8ZB 5B3NA 2JB6A 3FRUB 5JPNA 4YC2C 5FOJA 1G7JB 5T1MA 5D1QA 4N8VB 4QRRD 5I2IB 5BJTB 3L7EB 4YHKL 3QUXA 4Y88A 3Q2CA 5HGAB 1B4JL 2FYYB 2N4IA 1OSPL 1R3JA 1XAUA 4MA7L 1N4XL 3AY4C 3S37H 4X7FC 3NIGF 4YBHA 4NN5C 1R5IB 1URLA 4QEGA 1NUGA 1RJLB 2DICA 1RUPH 2D31A 3LPFA 2R2EA 1ORSB 3C5JB 3CH8A 3JTSB 3VGBA 2AQ1A 1T66C 2C1OB 4YDKH 2YMXL 5D7IB 1W72A 3T3PF 5CIPH 1BF2A 3U9PH 1TLKA 4PREA 1OHQA 2B1AH 5JDSA 1E6JH 1KXVC 4EI5D 1KB9J 2N1KA 5EUKA 4NSKA 5D93B 4KPHH 1A7RL 4GXUN 1U8JB 2IJ0C 5F7YC 2BRQA 5D8JL 2YD4A 3IDJA 3CFBB 3V6ZB 1RUKH 1FLRL 3UEZA 3BZFA 5GGTL 2Q86A 2CLZB 3MJ9A 1VFBB 3QHFL 1T2JA 1VFOA 3KJ4C 2GT9A 3BSZH 4PJ7E 1KLUB 4Z6AT 2FNBA 2Q8AH 5B8CB 4WTZG 4FQXC 3HS0A 1QHOA 4KHXH 4JFDE 4I2XE 1OTTC 1MJUH 1MEXH 4DVRH 5IEHB 1L7TH 5F9JA 3X13A 1CT8A 3EDJA 3LS5L 4EQ2A 5I1AA 5EZIH 1EPFA 3OJ2C 3IXTB 4G8EA 3AU1A 2Z92B 5IVZB 2A73A 5GRUH 3RAJL 1T5XB 4G7VL 4MS8D 3EOBB 1A6WL 5FK9A 4V2BA 3OKOA 4JFEA 1GOHA 1G7LA 2MCPL 1AHWA 4RWHA 4BUGA 5J56B 4C4KO 1S7UA 1LMKA 3WBDA 4DCQA 5MENE 3HC3H 3DO7A 4POUB 3FO2B 3A6OA 4KKBD 5HHPA 3TVMA 1VGKA 4HUWB 1U6AL 4WTXA 3F12A 5D1XC 3QUMA 1IT9H 5HI3D 2Y5TA 4LIQE 4JO1H 5TDPB 3QDMA 4LLUA 3CFCL 2WW8A 5DJZA 3CUPB 4D9QD 4O9HH 3SGKA 2KL6A 1AD9B 5F72S 1BFTA 5KVFL 4NKIH 3LMJL 4MA3B 3RWIA 3OHXA 2RIKA 3DXAE 4XC3H 3QA3A 5DRWA 4GG6A 1KT2B 5CP7A 5FAAA 3BP7B 4K3GA 5H37H 5IEKA 4NP4L 5FA3A 2Q20A 3HCVB 3ARFD 4NNPH 4OI7A 2AXFA 4OAWB 5CS7A 4GFTB 3RKDD 2AK1H 3ARVA 2NPLX 3OGCA 3MV9A 3N85H 2QHRL 2D03L 4TULH 3HNTH 4GXVL 1MRFH 4WFGD 4WO4C 3GMPB 4XP4H 1PX3A 3D6GA 4TOYH 4XWOC 5D6DA 3T0VA 3V52L 4AL8L 5C7XH 1YEHL 2FL5B 4KTDH 3SKMB 4QOKD 3IYLW 4ZD3H 3RRQA 4KAQL 5IJKC 3U36A 3U0WH 2JIXB 5IHZB 4TSBH 3MRBA 5MP6H 3S36X 2DJUA 2HKHH 3PGCB 5KSVA 2CR6A 2NY7H 4M7LL 4FZEL 5IBUB 1SVCP 3WE6B 1G0YR 1VDGA 2EH7L 4U7KA 3RVWC 1T03H 1BOGB 2E3VA 3WHE0 4I3RL 4XRCB 4ODVL 3EFFA 5E8PA 4XGZB 5GGQL 1CBVH 4Z7WA 4P9MH 1IBGL 3PP4L 2DDQH 1IM9D 1NGWA 2DWDB 3MA9H 3J7HA 4TQEL 3CXDH 4K7PY 1VFUA 5DFVC 3ARDB 4TNWK 3OZ9H 1UM6L 5LVEA 1PEZA 3SCMD 5IHUL 5KN5A 5DEZA 5DMIH 2GYSA 1FQ9C 2BC4A 4P23D 3CC5A 5FGBC 4HDIB 1OB1B 3QIUC 1JNLH 3HUJA 5HGHB 4FFVD 2AKRA 3ZYIA 1JNHA 1R3IH 1CDJA 3GMOA 4PG9A 5FYJE 3SDXB 4FP8L 1MIMH 1DN2A 3TM6A 1TQCB 5KS9A 1A2YA 3PE9A 1E6OL 4TSCH 5E8OA 3WNOA 5IB5A 5C0FA 1M6OB 3HE6C 5T3ZL 4RIRB 1F3DH 4P5KB 3IAGC 4FZ8L 4I1NB 1UH3A 3PV6A 3RKPA 5D71L 2IAND 1MVUA 4G8GB 5HY9A 3NBNA 1IGTA 4P5MA 1I7UB 1A7BA 2XTJD 4P2RB 4WFEE 5F6HJ 2G5RA 4LCCB 3TT1L 1FO0B 5CJQH 5EN2A 4P9HH 1TJGL 2BHYA 4XXDA 3SKOB 3LKPB 5ICZA 1UVQA 3S96A 2ZUQC 5GRZA 2VE6B 1LEKA 1MFAL 4DKFH 2RR3A 3B3IA 4HS6A 3RL2A 5CUSH 2Y36L 4EJ1C 1NGZA 1A3QA 5IFAL 3QIBB 4XP1H 4R0LB 3D9AH 4Y4KB 1S7XB 3K2UH 3VXUD 4OLVH 2DIJA 2YN5A 1QKZH 3MBEA 2AQ2A 1ZHLA 3U6RA 4BZ1L 1KPUB 4UTBH 4PP2A 1U8LB 4JGUA 5CILL 3WFDH 3TCLA 2XY2A 3CDCA 2D3VA 4IMKC 4PRAB 4LU5H 3BPOC 1K8DA 3S36H 1JE6A 3FONA 2Q8BH 4MGXA 4IS6B 4HHAA 4JZNA 3MO1A 3PQYD 2HT4D 5E4EB 1J5OH 3GB7A 5A3IC 1KELH 3FB8B 3WSQL 4XXCC 5F7UA 3I2CL 1K8IB 2M8XA 4NQSB 4OM0L 1XGTB 1YC7A 3HR5A 3QI9D 1MCEA 5E7FA 4YHMH 2OZ4A 1U8QB 1X4ZA 4TUKL 4QCIB 1QFPA 3QEUA 3MXWL 4JANA 5EC2B 5BCAA 3MNWB 3SE9L 1BGXH 2EKSB 4X4YA 5IG7A 3LS4H 3T4YB 2H8PA 1EO7A 1FVCA 1YEIL 3DO3A 5IK3B 4ZNEE 3W0WD 4M62L 3N06B 3RWFA 4ERSL 5AD0B 1OF2A 4Y5XA 4L8CB 4LVNB 1TVHA 4ELKB 1A3RH 4ZUTB 3L3JB 1I7ZB 4N90E 1DL7L 3ZKNC 3MX0A 2G75A 1QBBA 2GJJA 1RZGB 3HPLA 4NQUA 2CK0H 5L2KB 3T4AB 2FO4A 2L4OA 2YK1L 2F19L 4OTXH 5I9QB 1FBIL 2YD6A 4X7DC 1CWVA 2EEDA 1A6VL 1S7VB 3KLDA 4EKXA 5CZXD 1OM3H 4IM8A 1WIPA 4PJEB 1RIVH 5GGVH 1UADC 1K2DB 2ZCHH 1AP2A 4RMTA 1QNZL 3TA3C 5I15L 4KWUA 1T1ZB 2X6MA 1JNNH 1TPXB 1EX0A 4JDZB 5DRZB 3ULUF 3JVGC 4L8BA 4L9LA 2F8XC 3H42L 2QR0B 4MJIB 3LQAC 5CBEA 5HYSB 2YPVH 3DSFL 5L0QC 2HWZL 4CVZB 5K9JL 1IE5A 3IJHA 1T20B 3QDJE 3LIZL 1N3NA 4ZXBC 2PR4L 2ENYA 4E41A 2CIKA 3O4LB 3ARTA 1Q9OB 4XAWL 4PJXB 1WZ1L 1ZSDA 2NXZC 1T1YB 3NPZB 3IB4A 2BHUA 4HKZA 5TQ2L 1I9IL 4E5XA 1R24B 1WWWX 2E7LA 4IOIA 4QRTB 3GK8H 4OGYL 3P0GB 4UMGA 1BFOA 4XNUH 3B6SA 1GGCL 3GZKA 1CG9A 3VFRA 2VXVH 4N0RA 1RIHL 1BBDL 1IEAA 3U2SA 1FZMB 1CFNA 5KG9A 5IM7B 4W4NA 3HMWH 4RZCB 1XEDA 4LF3B 2H2PD 4XBEH 1IKFH 3SE8H 3L3KA 1AC0A 1EJ6A 2P8PB 3T0EB 2VWEE 4OQTA 4HCRA 4L4TD 1IQWH 3ULUL 2XT1B 1T2XA 3EJJX 3GSXB 5JR1H 5DK0B 3MLPA 4KK9D 1CIDA 4EOWL 3HMXA 4MB4A 5CD3A 3WFBH 1NMCB 1KJVB 4PJBA 4GRWE 4YPJA 5BQ7B 3FFCD 1GZQB 3EZ8A 4LK4A 1K3ZA 1H15B 1K5NB 4M6OL 4ZUSA 4PRHA 5GZOC 4Z7VA 2WWMD 4HFWB 5DQDL 1I4FB 3O8XD 4JM4H 4M03A 5JW4N 1EHNA 1BVKB 2Z31A 5IMMB 4ZS6C 5HYIA 3HG1A 4HJGB 1U8NA 5IF0B 4J3XA 4H8WH 3Q1SL 5FM4A 1G9MH 4H20H 1A4KA 3CU1A 4P4KC 5EU6B 2FSEA 3MV8E 1MLBB 2VRAA 3NFNA 3IDXH 4L29A 3C6SA 4OIIL 4EVNB 4UV7L 5HVGB 4F7PA 3KJ6H 4BH7A 1VGEL 3IXAA 4PYHA 1XF2B 4LMQE 4RGMB 5C0AB 2ADFL 4KRNA 1NMAL 4OLYL 5EFIB 2AEPH 1UGNA 1U58B 4RISH 1CFSA 4XVUC 2VLLA 4MAYB 3DJ9A 1YDPB 4BH8A 2WK2A 4R4BA 3GEWB 4JRYB 1C5DB 3C08L 5IFHH 5LGHH 3QUZA 4PJ5B 1ZT4A 3SDXE 4YHPB 3WHXB 5GRYA 4I48B 3RVTC 4N1HB 1BQLL 4IRSA 2H2SD 5JQHC 2QL1A 5I6XB 4Y4HD 1GOFA 1FV1A 2ZZUT 1X4YA 1RULL 5FA4A 4Z7OF 4CKVX 1WAAF 4LMQI 1UXSA 3B5GA 3CZFA 4N9GA 3U0TB 1Q9WA 2EDNA 4NO0B 2IBZX 4XMLL 2UUDH 4I5BB 3WIIH 4YK4C 1Q0YH 3FB5A 1KEGL 4PLKD 3AAZA 1H3WM 1J8HD 4TVSa 2BNQB 4MLSA 2ZUWA 3ZDZF 3VGDA 1SEQL 1MCNA 1Z9OA 4OT1H 2FEEL 3EYOB 2OR9H 3AREA 5DK3A 1Y6MR 5EIIA 3S5LG 1REIA 1YEGL 4OCSL 4NQCA 2BJML 2HTKC 3BXNB 4Q6IB 1J0YA 2X4UB 3VXQA 2ZPKH 2DQCH 1E4KC 4Y5YA 1HCFX 3UDWC 2R39A 2J2ZA 3A6CH 4D9RE 5IOPB 2HFEB 4YXHL 4P5TA 4NZRH 5DJCA 1DUZA 1UKQA 3DUSB 2HRLA 3AB0B 3L1OH 4KV5F 3QEQA 1OTSD 5FO7B 2HLAB 4APQD 2F53D 3L5XL 2CDFA 1BBJA 3GJFA 3EIFA 4U3HA 5KZCB 2ESVD 1ITCA 4NO3A 3V0WL 1WVZA 1I9EA 4GH7B 2VC2L 1WUNT 3BN9D 3RPKA 4XPTL 2A9ML 1C8PA 4NUJB 1DSFH 4X6EB 1A1OB 2XG5A 1YMMA 2LVEA 3OPZH 4DJMA 2W9EL 3RUGA 4YAQA 4JY6B 1DVFC 1U92A 4GW4A 3VA2C 4KROD 3VD7A 1H0DA 4HIEB 3MRNA 2VL5B 2QSQA 1SBSH 3FQRA 1D5MA 2O5ZH 2AV7B 3T3PE 5IFJB 4MJ4A 1DLFH 4LASL 2BHZA 5FV1L 2YOCA 4LL9A 4I18C 3VI3F 1FH5H 4KKNA 4QNPF 3FMGL 4ODXA 4Y19D 3FTGA 4K23H 2W9DL 4KUCD 2BMKA 5IIEA 3SKNB 1C5CH 1ZT1A 5FUZL 3HNSH 5DRXA 3GIVB 3BJLA 4PD4J 3PHQB 4UILH 1J1OH 2YEZB 1INQB 2EYRA 4ZQKA 2OMNA 1IGML 2Z8VC 2ZJSL 1BWWA 1IL1A 3GSUA 3KYNB 3JWOL 1F8TH 2AQ3A 5F96L 4HC1A 3MZGB 3BGMA 3MTRA 4QWWD 4H26A 3UTSA 3GSNA 4NHUB 1Y6NR 2OP4L 4UT9H 2WBWB 4X6DA 1RZKH 5J6HB 2R15A 3RY4A 3QAZB 4F2MA 4K3DL 1LDSA 2DAVA 1PYWA 1S9WA 1AY1L 3AMKA 4JO2H 4PJXE 5TFSH 3NPSB 4OKVA 5GPRA 2IQ9L 1PJ9A 3U82B 3LKSA 2JJSC 4WUKL 1NCBH 2AVGA 3FQXA 1A6AA 4DVBB 2GY5A 5TE4H 2IF7A 3CK0L 4QF1A 1A02N 1GZPA 3MCG1 4H0HB 1D9KC 3LKRA 2OI9C 3TYFA 3A67H 4KU1A 4N1EA 5HHMB 2DQEL 3VDAA 3IKCB 4WU5A 3MNVB 5DURD 4X5WB 1F5WA 2A2QT 4U2ZA 5E4IA 5I74B 3RBSA 3RX5A 1Q0XH 1HQ4B 4N0YH 4RCAA 3VD3A 1CLZL 4HGKC 3BUYB 2VDKL 4PRIA 4X9HA 1QQDA 3P30H 4S2SA 1KJMA 1T83C 3R0MA 2UZIH 3T0EE 5JXED 1MFDH 1EAPB 4ONGH 4S1QL 1JF1A 3VWKD 1LK2A 5SWSB 3O6ML 3P4NA 4YO0A 4ONFH 1G7PB 1T5WA 4GMTH 5CEXB 2J8OA 5KSBF 3P0VH 1XGQA 2E7HA 1FL3A 5FYLL 1E4XL 3NN8B 1D6VH 2BNUA 4NN6B 1EVUA 4IDLA 4QT5B 3C5SA 3SQOH 5F7DB 1MNUH 2NLJA 4DGYL 3QO0B 1F6AA 5FXCH 2X1WL 1HHJB 3SDDD 3C9NB 4F3FA 1W72L 1AQKH 1Y0LB 3THML 3IF1A 3VI4E 1A7PL 3CVHA 4PJCF 1HIML 2H3NA 3B9AA 4DKEH 1JCKA 1NCAL 3BHBA 5BZWA 2F54B 1PKOA 2XA8L 4PB9H 3O6LH 5J0BA 2C4FT 3MJ9L 4O2EA 1KYOJ 5ENWA 2O5XL 1MPAL 1XF1A 1VPOH 5T5NF 1IILE 2VDPH 2ORBH 3GBMH 5DDHA 1W8OA 1MCQA 2VO5A 3L3HA 4MB5A 3BQUA 5BS0A 4IOSD 2HRPH 4YXLH 5IB4B 2YRLA 2JJTA 3GMRA 3KPRA 3VH8A 4ZUWA 2R29H 5C6TH 4ZTOL 3FT3A 5BW7A 3VGFA 5I75C 4U1GB 3U30C 5C0BA 3CVIL 1MF2H 2DL9A 1I3UA 3H9YA 3I02B 1AKJB 1YY9D 2QQLL 4JN2A 3QQ9C 5I1IH 3HC4L 4W6WB 3MV11 3DSNA 3JV0A 4HMDA 1CK0L 3ZSSA 2BVPA 5EWIL 4H88L 1QRNA 1LVEA 3MYJA 5IESH 1I1FA 4OB5H 4RDQG 1PZ5A 3EO9H 3DVNA 3K1DA 2PYED 3QWOB 4YHOL 2HP4A 5HHNB 1U2CA 1X6NA 2NY2B 1WSST 4JPVH 4OLXH 4NQXA 1KCVH 1PLGL 3BZ4A 1IAOA 2ZG3A 3S3PA 1FNGB 2ED9A 3GUTA 4DKDC 2I9LB 3QUML 4X8JA 3UBXA 4ZPTB 3HE7D 1FCGA 3EYFB 3LQZB 1S9XA 1RV6X 3FRPG 4ODWA 2CH8A 4WV1A 1NC4B 1G7HA 1WZMA 3QXAB 1YNKL 4P2OC 5CHNA 4ETQA 4AG4L 3NTCL 3JUYA 2DLFH 3GIZL 2YUXA 2XOTA 5DR5H 4I77H 2XN9A 3ILPB 1H3GA 3QCUH 2IH1A 5CBAB 2XQBH 1P4LB 2ZUXA 4D9LH 5D7JC 3Q5TA 1HHGB 4Z77A 5EU5B 2YUWA 1HH6B 2NYYC 2G2RA 4LCWD 4AQOA 4X4MA 4G6FB 4ZO6A 5A16B 1G7MB 3IFNH 4HXAL 4GRWH 4ZPVB 1KV3A 3RGVD 3KG5A 5ADPH 4UQ3B 4I0PB 2GFBA 5LQBL 3CZJA 1UXWA 3RZCD 5B39A 1TNMA 4LLDA 1FFNA 1V5JA 1KCKA 2DIBA 3B8YA 3PL6B 4IRZH 2X4NA 2YKLL 4NRZA 2EDTA 3VFMB 4JO3H 3EUUA 1OQOA 4NZDA 4M6NL 1LDPL 2LVCA 5BRZB 3QUXC 3P4OA 4OV5A 5IR1A 4XI5D 4KQ4L 3SDCD 4NQTA 1KCUL 3V8CA 4R2GC 1DQJB 3JV4B 1A6TA 1B6DA 4OZGA 3VXSD 5E08H 3D39A 3I75B 3DGCR 3MRLA 2W1NA 1OAUH 1OSZA 3OXSB 4N0CD 5E94B 4FTVD 3UC0L 1MI5D 1FFRA 1S9VB 3CSGA 3RPIB 5SX4I 5J6GB 5IJVB 3O4OC 1KN4L 1QA9A 4I3SL 2CO6B 1CICB 4UQ2B 2P5WA 3WXWL 4ZFZB 4YHKH 3HAEB 3DGGA 2I5YH 5GZND 5IMKA 6CGTA 3WL9A 2ZP0T 4QRPB 4RQQA 2B8OT 1OAXL 4NO2A 5J89A 2DLHA 4OD1L 2OTUB 3QQ4A 4MA8L 1C12A 4OCMC 4WCYH 2ICWB 3WMSA 3C5ZA 3ORJA 2W59A 2X41A 5IVNA 3S88L 5ESAA 3OKMB 3W81A 5JPNB 3VGAC 2NY1B 4JQVC 3BO8A 5T1MB 5D1QB 2FR4A 2ARWA 8CGTA 1A7QL 1TITA 3ULUE 4FFZL 4D0CA 1FGNH 5EORH 1MHPL 5HHME 2XKNA 5E6ID 1S78C 4URTB 5D70H 4S1DD 1NFDA 1R3HA 4BSWA 1NSNL 5I8KL 4R7NB 5IW3A 1D7FA 4S1SL 2XG4A 1BEYL 2D31B 2R2EB 3KPQA 1KFAL 2UVFA 1BZ9B 2BNRA 3JWDL 4KXZI 1EHXA 1W72B 3H9SA 4GW1B 5GJTH 5D2NA 1NAKH 3FOMB 3FN3A 2DF3A 5SWSE 4ENEC 5JDSB 3TF7C 4XBGB 4Z9KB 5EUKB 4NSKB 5C0EA 2V5SA 3HZYA 4OZIB 2LU3A 1MFEL 4MZ2A 3FHQA 3IDJB 4CW1A 2FRGP 3U7YL 4QTHA 1NL0L 4I9WE 1U8KA 3I50H 3PWPE 4K3JL 2Q86B 1KULA 5I8OH 4GQ9L 5K33A 3S98A 2GT9B 2GHWB 1CFVL 3O0RH 4WEMB 3STZA 1BVLA 2R4RL 1JZ5A 3PWNA 4HJJL 2DRUA 1M7DB 4EDWL 3H8NA 3X13B 2BRRL 1HQRA 4ZODA 2ZUSA 5F9JB 2VITB 4X6FA 2OZ4L 4LOUD 5T1LA 5I1AB 3LSOB 3VGGA 1QSFB 2NY4D 2KQMA 2F54E 2OQJB 4G8EB 3AU1B 3EOAA 2LTQB 2ZKHL 3FCTB 3KLSA 1NANI 2Q3AA 4IRJC 1F4WH 4YQXH 2OXHA 3QIWD 1X44A 3CGTA 2VDNH 4NM4L 2EDWA 1QFWI 5IMLA 4KY1L 2PKDA 3QR2A 1G7LB 1CGSL 1FDLH 3BDYL 1V7MH 3RWDA 1NCWL 1AHWB 3MJ6A 1S7UB 5J13B 4UB0H 2BOBB 1PBYA 3VG9C 2DMCA 5DVOA 5C3TA 4DCQB 3MV7E 3GI9L 1RVFH 5F7MC 3DO7B 5HHPB 5D6DC 1IARB 3TVMB 2NY0D 1VGKB 2VQUA 3F12B 4O4YH 2VOTA 1CXFA 2RGSA 4JKPH 1ZT7A 3QUMB 2UUDK 2Y5TB 4HKXA 4YBLC 1RMFH 2BSED 4G9FA 5GS3A 1F3DJ 4KJWC 4LHUA 1WJ3A 4KVNH 1KB5H 4LRNH 3TN0C 2FHFA 3CXHK 1IGCL 4HK0A 1ZXQA 3MLRH 4FXLA 2FEEI 2YRPA 1CVRA 1KTRL 1WBXA 4N1CA 4GXVH 2DD8L 2I07A 1OD7A 4KKAC 1UACL 4JPWH 3OHXB 2GCYA 3FAXA 4RGND 4J3UA 2P24A 4PJBF 4H1LH 4GG6B 5CP7B 5I18H 5IEKB 4F9LC 4Z7VF 4KJYA 3DYOA 3X17A 5EH1A 3WEXB 3OGCB 3R8QA 3MV9B 4L3EB 4FRWA 5DA0B 1JYXA 1YJDC 4F58H 4XC1L 1FSKB 3ZDZE 4WY7L 3QHZL 5A2LH 2X1PA 2Z0BA 3FB6B 3LQAH 4CN4A 3Q6FA 4IIQC 5CGYD 2I24N 1P7HL 5HYFA 4YE4L 4K2UH 4CU8A 3DETD 3MRBB 4HZLB 3QB7C 2FX9H 3BYYA 5KSVB 1JFQL 1N5AA 3RWJA 3OAYH 4GRLA 3V4UH 1NCDH 1BAFL 4MYWB 4EI5C 4G5ZL 5C0DB 1VADA 4XTRD 2RCSL 3DOSA 4FQ1L 3P9LA 3SDYL 5CEZH 4HCRL 5K9OA 2CGRL 4Z7WB 1NGWB 3UTQA 2XXMB 1HK6A 1PY9A 5AEAA 5E2WH 2P8LA 5FUCC 5DEGB 3HMXL 4FZ8H 4FQPA 5BRZE 5KN5B 4PYGA 2WUCH 4X80L 1L7IL 5F1NA 1OT2A 1YYLL 1TZHA 3HUJB 2X4RB 3LEVH 3UTPE 3TWCH 3MGAA 2AKRB 3LH2L 3KS0H 1JNHB 1FG2B 3GMOB 4POYA 1DBJH 4KI5D 5BVJA 5KS9B 1A2YB 1N0LA 4OJFL 4MS8C 4XVTH 5E8OB 5EUOA 3BPNC 5C0FB 3C8DA 2Y36H 5KSAD 2E27H 3KPMA 2V2TA 1EDQA 5DUPL 1GOGA 1VACA 1UC6A 3PV6B 5DT1H 3LD8C 4F7TA 4JVUA 4OSUL 4WHYH 4QNPE 1GIGL 5B22A 4CJ0A 4JG0H 4KKBC 4ZSOA 2ZUUA 1K85A 5ICZB 1UVQB 4P57A 2R2HA 3S96B 2FLBT 1LEKB 3OWEA 3B3IB 1U8MA 4HS6B 4U7MA 3RL2B 4XWGL 1DBAL 5HI3C 1NGZB 4PGCA 3ULVL 4B5EA 4C56B 1QFUL 4MZ3A 3MBEB 1ZHLB 3U6RB 4OM0H 3RFZC 2E7MA 5AYUH 4PP2B 4M4PA 1FFQA 2OBGA 4RMRA 1JL8A 2UY6A 3TCLB 1M05A 4POZD 4HUVA 1YEDA 3PDDA 1K8DB 1RUMH 4OLEA 4FNLL 3CFKA 1WFNA 4PJDA 3F65A 2B5IC 2X9YA 3R0NA 4JZNB 5I1GH 5I1HL 3MO1B 2DS4A 3LN9A 4D8PA 2AK4A 4N68A 4HEPG 4ODSH 3GB7B 1Q9LB 2IAMD 3ARFC 1A5FL 1HZHL 3HR5B 1AFVL 3RKDC 3T1FA 3ZDYE 3MJGX 4YX2H 4LCIL 3NCJL 3QEUB 5CKGA 4JANB 1F4YH 5EO9A 1JHTA 4ZAKD 3V5HA 1MVFA 4XNMA 2F19H 5IG7B 4DGVL 3SE4A 2EE6A 1UA6L 1VEMA 1YYMH 1KEMH 1P7KB 3RI5K 4GAFB 5C1MB 1D5ZA 5D1ZD 1J0KA 1OF2B 4Y5XB 1TVHB 3BT2L 4HS3A 5DS8B 2O61A 3SGDI 1QNZH 5SWZD 4JFFB 5HHQB 3HZKB 2E7LC 4GRMA 4IMLA 2XZAH 5SX5K 4AEHL 1TTFA 2G75B 3BPCA 5E2UH 5IBUG 4X6DF 3OXRA 3NACL 2FO4B 3DSFH 3HFMH 1TCRB 3C6LD 1ZGLA 1JZ4A 5KOVC 1SYSA 3E2HC 3RDTA 2I26N 3O6KL 2E9BA 3H3PH 4L1DA 3RVVD 1C08A 4JFEE 2P5EB 3G9VA 5D9SA 3SCMC 4C57C 2PW1B 3O9WA 1AR2A 5F71A 1TJIL 4WI8A 4UBDC 4P23C 1YEKL 4L8BB 1JUFA 2NX5A 4L9LB 2WLYA 2IPUG 3G6JB 4FFVC 2YD8A 1MLCB 5CBEB 2UYLA 2ZSVA 4KGJA 3ZLQC 3E6FA 1N3NB 4O00A 4HKJA 4CDGC 4E41B 2XACC 2YA0A 5FYJU 5C08D 2OTWA 5T3XH 1BVZA 1ZSDB 3FN9A 5BV7C 4HIJA 5DYOA 4XCCL 1MRCL 3MRQA 1ZA6A 3QDME 3C2AL 3CX2A 2Y06L 1DJSA 4TRPL 4E5XB 2HN7A 1E0OB 1KCRL 2XTJC 1LO4L 1C1EL 3QCVL 5CLTA 1U3HA 4IOIB 4YDLC 1TMCB 1SVZA 4GKZA 4HC1L 2AERT 1BFOB 1FAIH 4A6YA 1TZIA 1UENA 2RFXA 3GSNL 2CKBH 3ULUH 5JMOC 3UTTA 1LD9B 3I85A 5I19H 3D2UD 3CXHJ 5EOCJ 1IEAB 3U2SB 5KG9B 2B4CC 2UY7A 3P73A 1LK3L 2NZ9D 5DUMH 3P11L 5IUSA 2DLGA 4LPXA 1A7NH 3AC0A 4M6OH 5LGKA 2ZOLA 5B38B 3WYRA 3MV9E 1I9RL 1M7IB 3SO3C 3QXUA 2FGWL 4H5SB 3PHOA 2ADIB 4FXKA 5F3HA 2J4WL 5C0JA 3G6DL 4WI9A 1HDMA 5E8DH 3QIUB 2ICES 2YN3A 5CD3B 1UM5L 5CCKL 2AJYH 4IJ3B 4Z7UA 2D0GA 1RZFL 3QEHA 4P0DA 1H8OA 4OLYH 1I8MA 3MOBH 5HDQH 4ELMA 2X4SA 2Z31B 1RPQA 1FLTX 3DHMA 3GMQA 5C2BH 3HG1B 4PJAA 5CJXA 1QFWH 4BK5A 1U8NB 3VWJD 5I76A 1HEZA 1A4KB 4Z7WE 5FCUL 1D5IL 2FSEB 3NFNB 5HGGS 2QSCL 2AJUL 1BQLH 1FPTL 4L29B 4NQEA 4WWKA 2A6IA 3C6SB 5CSGA 1U8OB 1A6ZA 5K93A 5HI4C 1RZIA 4F7PB 2H32A 3V4VL 3IXAB 4CVUA 4WHTB 2BY3A 5HVHC 3GHBH 2YS4A 2ZUQB 2WBJA 3MJ7A 5AZEL 1I7TA 2B2XH 1J0IA 3H9HB 2VLLB 4P3CL 3HUJE 4MNQA 3VXRA 3QP3A 4UOW0 3CFEA 1INDL 1F11A 5LG1A 4JFDD 2R0WL 3QCTL 1T7ZA 2HJLA 4P46D 3QUZB 3CVHL 1SEQH 4G6KL 1YY8A 4KZEL 2WUBH 4L5FH 3BJ91 5JQ6H 1JZ8A 1E4WL 5CZXC 4IRSB 5FO8A 4QO1A 4ZTPH 2VMFA 1FV1B 3T2NH 3HZMB 5FA4B 5FDWB 5CINH 2PUQT 1UXSB 3D87B 3CZFB 4N9GB 3T2OA 1Q9WB 4GOSA 1EMTL 2X05A 2HVKA 5FEBA 1IGJA 1EGJA 1IGYB 4WW2A 2DTSA 3FB5B 3AAZB 2GW5A 5F9WC 1I9JL 4YXHH 1TVBA 3CLEH 2CIIA 4IOFD 4LSSL 4OZFA 4PJ9D 3G9AB 1IC5L 3D48R 3AREB 1RURL 5E9DA 5EIIB 1NAMA 5FF6B 5MEND 1I8IA 1FJ1A 1I1AB 4NQCB 1DBKH 5FUCE 3ARBC 4AMKH 1EUTA 4JFPB 1RIUH 3VXQB 2LU7A 2HJKA 1QLEL 2A9MH 1IC4L 4RA0C 1SBBA 4NKDA 4GBXD 3SKJL 4M1GH 1Z0NA 2BDNL 2FATL 2NY3D 3IGAA 3N1GC 3PDOA 3C8KA 4P5TB 5DJCB 1DUZB 3BEVA 4G3YL 4K94L 4M6AA 3VRIA 3QEQB 5F8RC 3CFDB 5F21B 3O11A 1DANT 2CDFB 1BBJB 3GJFB 4D0DA 2BFVL 4H1LG 3VFOA 4ODTL 1FFOB 3KYKL 4AT6B 2ZG1A 3OAZH 2H2PC 3DXAD 5I71C 3SJVA 4EN3D 3EYVA 2Z93A 1S5IH 4D2NA 3VXNA 2PXYA 4MNGA 3VE0B 5IW6A 1XZ0A 1YMMB 4LSQH 3F5WA 4YAQB 3RUGB 5CFHA 2W9DH 5I1JL 1U92B 4RRPA 3MPCA 5JW5A 4JDTH 2B0SH 1CFQA 3BKCL 3BP5A 4G8FB 4KK9C 5ID1B 3MRNB 5DJDA 4EUPA 3FQRB 4RAUA 3WS6C 4DQOH 1OAYL 1D5MB 1T04A 3QJHB 2VLKA 4YR6A 3TO4D 2PNDA 5I73C 3ES6A 2WWMC 1I1YB 4ZDHB 1UT9A 2AXGB 3BPLC 4OCWH 4C83A 5DJ0A 3P2TA 2OP4H 3FTGB 3WDIA 2QQKL 5FHAL 1KIQA 2YD2A 5IIEB 1ZT1B 5DRXB 4OZ4A 3HB3D 4FS0A 5ALCL 1H9VA 4W81A 2EYRB 5TPWL 1C7SA 4ZQKB 1OCWH 4MCYA 2W0LA 3V7AG 4BQ9A 3LRHA 3IU4L 3SDAA 2DQDL 3VFPA 2X1OA 2VABB 3KNBA 1IL1B 3GSUB 3OKDA 1U95A 1ULVA 5JHLL 1OVZA 4XBPA 3BGMB 4L8SA 1Q1JH 3O2WL 3UTSB 3UTZA 2X4QB 3GSNB 3X14B 3MRKA 4WFGE 2AJZA 4X9GA 2DKUA 2DQJL 1EJOL 4YDIH 3OKLA 5FB8B 4F8TA 2Z91A 4E41E 4F2MB 2H2SC 1NUFA 4Y4HC 1CLZH 5FUOH 1BQHA 1CGUA 4HG4J 5FYJD 4OKVB 4K3EL 3VFTA 4NNYA 4OFYD 1UZ8A 4TUJA 1YQVH 1ZLWK 3LKSB 4U49A 15C8H 4M6ML 3C60B 4QF1B 2AV1A 5DMKB 3RHWK 1GZPB 4WHYG 3LKRB 4PLKC 32C2A 4U6XA 3TYFB 2HFGH 5F9DC 1R0AH 4WU5B 3MR9A 1IZJA 1CE6A 2FBJH 4Z18A 3J8F7 4MJ5A 4OUUA 4DTGL 3V6OA 2P7TB 1B0GA 2UVEA 5F9OH 3QULA 4S2SB 1KJMB 1E4JA 3PWLB 1I3GL 4OUOA 8FABA 3BEWA 1LK2B 2EC9U 1AD0B 4QHKI 3FQWA 1G1YA 4KI1A 5HHVL 3U7WL 4OLWH 4YO0B 3D25B 3KPSA 4HBCH 4MXQD 1OTSC 1T5WB 4APQC 1IAIL 1ZVHA 1XGQB 1NCAH 3OAYK 1JK8A 3ARXA 2EDQA 4LKCA 2YZ1A 4PJBE 2BNUB 1MCLA 3C5SB 3NCFB 2AJVL 3EYUH 4BYHA 4PRHE 4UIMA 2NLJB 3R06A 4Z7VE 3BN9C 3OF6D 3HG1E 4XP9H 4K94C 1F45A 1T7WA 3IF1B 3TH3T 3CVHB 2EEAA 2ERJC 1A9EA 4M02A 4AEIH 3VU2A 4X4XA 4X7SH 3BHBB 4MA1C 3STBA 1ORQA 4Y5VA 3CSYA 4D3CH 3OTTA 4O2EB 1UEYA 5ENWB 2BXYA 3QUYD 1P1ZA 5I0ZA 2EDRA 2X4OB 4H88H 3D18A 5DDHB 4F57L 4LEXH 4WV1C 4UAOB 3LPGA 4FFYH 5ESVA 2LQRA 3BQUB 5INCA 2VXUH 1MRDH 3GMRB 3KPRB 4HIXL 3VH8B 4N90D 5CP3H 4ZUWB 3HI5L 4XP5H 5H94A 2W91A 3ZKMC 4W70A 2HKFH 1B9ZA 4JFOA 5IVXB 5C0BB 2Z35A 5TDOA 1PLGH 1UWGL 3ULVE 2VZTA 3WO4C 4LRIA 3RU8L 2MPAL 1I7RA 4JN2B 1V7NH 3T0WA 5J06A 4U1HA 2EDXA 1LILA 2A1WH 1EEZA 5J11C 2BVPB 5AWNL 2ARJQ 1T66D 3MYJB 3I3BA 4NQDA 1XH3A 4QWWC 1I1FB 2J12B 2FB4L 2FZ3A 2N7AA 4NJ9H 1YNKH 2P43B 5MEOA 1UWEH 3DVNB 4XNZC 4AG4H 2MKLC 4JPIA 5CSBA 2FGZA 4K9EC 4NQXB 3BZ4B 2EICA 1IAOB 5IWLA 1EXUA 4NQCE 4U0RC 3S7GA 4HV8A 3QDJD 5GISL 5H2BA 5GQBA 4X8JB 4YNYA 5E24E 3ESVF 1JWUA 2WWKT 1S9XB 4WUUB 2QEJA 4ODWB 1G7HB 4OI9A 3LHPH 5F7HA 1DEDA 1ZHBA 4ETQB 3OKEA 1JZ7A 4JREC 3RNKA 3RTQA 1IC7L 4PTTB 3FHAA 5KTEH 1NKOA 2VISB 1W0VA 5AZ2H 1K4CB 2XN9B 1ADQA 1F58L 3B9VA 2OL3H 1G9NC 3CMOL 3EO1A 4PRDA 2HVJA 4Z77B 4ZNCD 5AG9A 2NY5C 3U4AA 4MQ7A 1IFHL 4FABH 5GXBB 3MLZL 3QRGL 4ODBD 5JXEC 4J4PD 4RNRB 1UCTA 4HIIA 1B4RA 1N2RB 1YMME 1G6RH 1D5BB 5I1EH 4KQ4H 3RUGE 2GFBB 4RBPH 1K6QH 1UXWB 2D4FA 2WQRA 2YPLB 3MLSH 5B39B 2VL4A 1FFNB 4OCLC 1PVHA 1OGAA 3ARUA 2ZUVA 3V95A 4DOHE 1HOCA 3ARGB 2HA1A 2J6EH 2X4NB 3UC0H 4NM8L 4NRZB 4UU9A 1DDHA 2JIXD 1KN4H 1P69B 3SDDC 3DVIA 4OF6A 4ZUVA 3NABL 2PTVA 5IR1B 5K9KB 2B7DT 3V8OA 3P9WB 4UNTA 3MLYL 2PO6A 3AS2A 4XZUA 3EYQC 2QKIB 5FV2A 4OZGB 3EZJB 3UJTH 3GDBA 3D39B 1YJDH 5D2LA 2HFFA 3T0BA 4MA8H 4XMPH 1BD2A 3MV8D 1GGIH 3NH7H 1AE6L 3UPCA 1XCQA 2K9UA 1JGDA 1N8ZA 1QA9B 2ENSA 3ARDD 4JY4B 3UTSE 2P5WB 4YH6A 3KXFB 3NVQA 2VH5L 4N8VA 5I2IA 4CVWA 5BJTA 1WBZA 1ED3A 4X6DE 3VRLE 2VQ1B 5IMKB 5T5FL 5HXMA 5HGAA 4FMKA 3WL9B 3B2VL 5ICYB 1FNSH 4V1DA 1W0WB 4U3XA 4KMTH 4NO2B 1NSNH 4WO4D 3QQ4B 1BEYH 1YY9C 1C12B 4Y1AB 3NZHL 2CDEA 5ESAB 4M7ZC 3JTSA 4YFLI 1OARH 3BO8B 1TQBB 1CF8H 2C1OA 4UT7H 4WFHE 3IRZA 5D7IA 1S8DA 2CJUL 1MCBA 4D0CB 4Q7DA 1CE1H 1X5HA 4XMKL 2XKNB 1ZANH 2AGJL 4M1DL 1NFDB 5LCVL 4BSWB 4K3JH 3RIFF 3O41A 1RK0B 4PRIE 1U36A 1CDYA 2JK5B 1VFBA 3OMZA 3HE7C 1WTLA 3UPRA 3H9SB 3QIBD 5D2NB 1ZHNA 2R9HD 3MRCB 4Y4KD 3SPVA 5FO9B 2Y72A 2R69H 1DLHA 4WTZA 1QRKA 2I9TA 3MBXH 2CMRL 3CIQA 2BRRH 4PG2C 5C0EB 5D5MF 3SY0A 4Y16A 3L5IA 4CW1B 3SE3A 3MUHL 4QTHB 4D9RD 1U8KB 4LSRL 5C2UB 1X5ZA 1UZ6E 1MCOL 1S7SA 5T33H 4LARL 5IVZA 4YHYB 5I75B 4PP1D 4HH8A 3RP1A 3WXVL 3FO0L 2FCBA 3NAAH 3U30B 1BVLB 3K81A 3ROOA 3PWNB 4O58L 4DW2L 4GG8B 5CJOH 1HQRB 5JDJA 1HINL 2BOCA 3L6FA 4UV4L 1UJTA 5FM5O 4XNXH 1HE7A 3RZCC 3VRJA 1KN2L 1U8IA 1CD8A 5DMGD 2VDLH 4JRXA 3INUH 3QPXH 4UIKL 3EOAB 1SJEA 3K7UA 3KYOB 4HX1B 3DHJA 4RFOH 1XGYL 2DTMH 5E99L 4GS7B 2V2WA 4CMMB 4F9PA 4FQIL 5BS0E 1JPST 1LO3H 4XI5C 3SDCC 1AGCA 1P6FA 3KPRE 3CUPA 4AEFA 1KENH 3CMGA 4QRQB 5I1CL 3KS0J 5C0BE 3QH3A 5L2KD 3VFNA 1S7QA 2IMNA 4JQIL 1ZT7B 4MA3A 4JKWA 3OBAA 3H2WA 1BJ8A 4OCRH 1T2QL 5EO1A 3V4PH 4HKXB 5TE6L 4G9FB 1QRNE 4LHUB 4QRUA 4R26L 5I1KL 4JM2A 3VCLA 5A3ID 3BP7A 1KF9B 1GL4B 4HK0B 1BQUA 5GZNC 4QGYA 5F7KC 2VXQH 1WBXB 3EKCA 5TJWK 1YNLH 2AJXL 3QHZH 3WDJA 5DMJB 2Y07H 5HHXL 2XKSA 1MJ8L 2P24B 4M5ZH 4BJLA 4Z7UF 5E8EA 5IHZA 4KJYB 3EHBD 2X89D 5C6WH 4Y19E 1ZE3C 1J1PH 4G5ZH 3K4ZA 5E6IC 1QBML 3WE6A 4OCYL 2Y4SA 4S1DC 2XN9E 1BOGA 3SDYH 4OFKA 4OQTH 4A6YL 4HCRH 3OAZK 4HQQL 4HPYH 4JR9H 3Q6FB 1BFVH 4DK6A 5LGJA 2BY0A 3UBXI 2DWDA 4HWBA 3MGOB 1QLFB 4X4ME 4MXVF 1N5AB 3RWJB 5CLWA 4GRLB 1NFKA 3NFSH 5BV7H 4U0QB 1EFQA 1CGTA 4ETYA 2E5EA 1L7IH 5LXGL 1RZJL 3DMMA 1T7XA 3T0ED 2IFFL 3P9LB 4HDIA 3LH2H 1XGPA 3HI1A 5K9OB 4YDVA 4M3KB 4AYFA 1XF4B 3UTQB 1JHKH 2IG2L 5JOFA 2P8LB 5GS0C 4LVHC 2BY2A 4LPCA 4ORGB 3SGJC 1F90L 2XWBB 2B4CH 2NXZD 1MCKA 4M7JH 4XP6H 1X9QA 4G8GA 1HILA 5F1NB 3C87A 4LOUC 4NHCL 1GIGH 4P2RA 5TE7L 5ACZA 1SHMA 4G42A 1A14L 1FO0A 1JGLH 1MJ7L 3D3VA 4OZGE 3D39E 3VXMB 1A21A 3SKOA 3BZDA 5BVJB 2GTZB 1CD1A 5EUOB 3QIWC 2VE6A 1DBAH 4XWGH 1Z9MA 4TVPL 5D7SL 2VR9A 3KPMB 5T3ZD 1VACB 3TNNA 1II4E 1QFUH 2N56A 4CGTA 4R0LA 5B21A 2P5WE 4DEPB 4QXTA 4YHIB 5C0AD 5HJ3A 4F7TB 2QBWA 1FYTA 4JHWH 1KPUA 4YUEH 4MAYD 4HWZA 1FRGH 3GSOB 4ZSOB 3M8OH 3H0TB 5JUEL 2GK0A 4P57B 3GO1L 2R2HB 5A2KH 1U8MB 1WZLA 5D7KE 1RUAL 4GSDH 4J6RH 5DJ2A 1HSBA 3ECBA 3O2DA 1JV5A 3TT3H 3SQBA 3S35X 4NO0D 5T5NG 4HUVB 1YEDB 1OGTB 1OAZL 1NFDE 3WFCH 1MJJA 1P5VA 2G60L 5EC2A 4PJDB 1XIWA 2EKSA 4JG1L 4LSUH 1H5BC 4GQPH 4DGVH 4RGNC 4P4KD 4D8PB 2AK4B 2BNRE 3UZEA 1UA6H 4C54A 1NAML 5EZOL 2FO1A 2R56H 1JWSB 5D2NE 3O9WC 3LEYL 4RDQF 3N9GH 5L88H 5C07B 1IAII 3E3QC 3L3JA 1CTOA 2ZCLL 2PW2A 4I4WA 5JXAH 2DI8A 4XVUD 3OKYA 5MI0B 3NACH 5EO9B 1JHTB 1YMHB 3V5HB 2D4DA 4XNMB 1DBML 5CGYC 2ZCKH 5FKPB 3TBWA 5B3JF 1I1CA 2OK0L 3DETC 5D7LA 1D5ZB 3MGTA 2LV4A 5D72L 1MCWW 2BVYA 3W5MA 5KZCD 4HS3B 4PJEA 2O61B 5TH2A 3KAAA 3PGFH 5EBMA 1K2DA 4GRMB 4O02L 3O6FA 1WCBA 4IMLB 3BIAX 5ELIA 2PYEE 3BPCB 4XTRC 2XIDA 1T1ZA 3OX8B 3OXRB 1R5VA 1T7YA 2FX8H 5FYKL 3L3OA 1KJ2H 2QR0A 1ZGLB 4MJIA 5HYSA 4O51B 1AI1H 1SYSB 2V7NA 4BZ2L 3RDTB 3WKML 2SEBA 4YBQD 5GRJL 5AAMA 4E0RA 1AO7B 4LEOA 4R4FL 1LO0H 3O4LA 2IH3A 1ACZA 1C08B 1Q9OA 4S1RH 5D9SB 1UQSA 5A2FA 2Y06H 1T1YA 2HTKD 2XRAH 4Z95L 2VDQL 1I1RA 1KCRH 1RY7B 3PNWA 4NCC1 1JUFB 2NX5B 5INDA 2A6JB 1JGUH 5J1AB 4PLNC 4H25A 2EYSA 1F42A 5DQ9A 3RY6C 1UG9A 3E6FB 5BMFH 4K7PX 3OJMB 4KI5C 3EYSH 1WFOA 4HKJB 1T22A 4KTEL 1UB5A 4MAUH 3RIAF 2OTWB 1DBBL 5KSAC 4LHQB 4LSTL 3IDYB 4G9FE 3S35H 4HIJB 1T0PB 5DYOB 4K55A 1ZA6B 1LK3H 3UJIL 2JCCB 5DJ6A 4PJ7F 1G84A 4RMQA 4F15C 2HN7B 4OF7A 1F6FB 3TJEL 2VNCA 4GKZB 2BVQB 2P8PA 4M9PA 4HWNA 5IBLD 4A6YB 1TZIB 2RFXB 3KLAA 5GS1A 2JF1A 4EI5B 3UTTB 1JYWA 4Y4FD 2C1PB 2QLVB 1WFTA 2AABL 1S3KL 4GKNB 3CH1B 4X6CF 3GSXA 1AGDA 3SBWC 5CCKH 3T2QA 4Q0XL 4NQVA 2ZOLB 1KJVA 1RZFH 5BQ7A 5CAYB 4TNVF 2AXJA 1H15A 5HDOA 3AMLA 3VD9A 3ARSA 5DFTA 5CIPA 1OWWA 3PHOB 1KLGB 1TETL 1BVKA 2GJ6A 2RJMA 4FXKB 2YD3A 5IMMA 3L5WA 1ZLVH 2CRYA 3BZEA 3ULUD 5F3HB 2P47B 3T77A 5IF0A 4R90L 1A1NA 5HHMD 2P45B 1D5IH 5DVNA 4DGIL 5EZLB 4MWFA 5EU6A 3PV7A 4FTVE 5KANG 4M8VA 2R1WA 3D0LA 4L8DA 3V4VH 2IAMC 3QXDB 4Z7UB 3MODL 1TZGL 4P99A 2A6DB 3QEHB 3WNLA 3QRFM 1I8MB 4ELMB 2X4SB 5CZKA 1NUDA 3GMQB 4PJAB 4ZAKC 1ZLUK 2JB5L 5I76B 5SWSD 4KRPB 5K9QI 4JRYA 3EDDA 2P44B 3CVHH 4KZEH 1OAKH 4PJ5A 1MIEH 4OCNC 4R96A 4WWKB 4YHPA 4NQEB 3WHXA 2A6IB 4KDVA 5D1ZC 1RZIB 4OD2A 4I9WD 4D0BB 3PWPD 2HLFD 2IBZY 1GXEA 2WBJB 1A6UH 3T3MF 1YEJL 3MJ7B 3LKOA 3TZVD 5C0CA 4JLRB 4JQXA 4KKCC 1P7QA 3EOTL 4K7PH 1EMTH 1JGVL 1AGEA 3K2MC 1JMZA 3F58H 4MNQB 5EU7C 3RY5A 1UJ3A 3IDIB 3VXRB 3CFEB 1F11B 1WTGT 3MUZ1 5M94B 3SOBL 3VXPA 1N26A 1SMOA 1YY8B 2BNQA 4RSVA 4P59L 3RWCA 5FO8B 1P4BH 1PZUB 4MB3A 1L9MA 5E03A 1JPTH 2F54D 4ALAH 4LQFL 3RVVC 2VZSA 2VLJA 3IFPB 3PGDA 3HI6L 3KVQA 4Q6IA 3V6FA 5E8NA 2HVKB 4G6ML 4KRMB 3T0XA 1IGJB 4WW2B 2M1KA 3SKJH 2BDNH 4ZSOE 3B5HA 2H45A 4K94H 1YUHA 1KBGH 4OZFB 1A7OH 3U83A 4PJHF 5E9DB 1NAMB 1X5AA 3MV7D 1YEEH 4Z5RB 2FD6H 1FJ1B 3GI8H 1HXMB 1AKJD 4CL7A 4ZUUA 1P53A 3BGFC 4L4VA 2LFGA 1AJ7L 2HJKB 3JUZA 1RZ7H 1FZJA 1ZLSL 4AIZA 2YRZA 3PDOB 4P3WA 5DWUL 2APWA 2X4TB 2YZ8A 3B9KA 3BEVB 1C5BH 4JDVA 3JTTB 3VMNA 4PJDE 1H3PH 3WO3B 5GS2H 4NUGH 4PY8I 4HXBL 3O11B 3BAEH 2AK4E 2NY2D 3NCEB 3VFOB 4YHLL 5IVOA 4CN1A 4OBRA 3SJVB 3U79A 2Z93B 1FE8H 3PABB 3QBTB 3VXNB 3UJJL 2PXYB 1NEZB 5IW6B 3ARWA 4LSDA 1NC4D 1XZ0B 4M7KL 1XGRB 3F5WB 3IJYA 2HH0L 4Y2DA 4P23B 5JW5B 4NWUH 1D6EA 4G43A 4NT6B 5E2JA 3SKNA 3BP5B 1INEH 1LO2L 3GKZA 4NC2B 4U1JB 3PHQA 3BOVA 3RVUD 1HN1A 4K9EH 4EUPB 1ADQL 1I85C 4RAUB 1T04B 2APVA 2VLKB 4OF8A 4YR6B 4X99A 4Y89A 5F6IC 3V79C 3KLHD 2C7UB 4G6FD 4Z78B 1T6VN 4X83A 5E70A 5DJ0B 3VWJC 4J3VA 3PWUA 5LBSL 2XTJB 4I0PD 5EZJB 2PCPA 3G5XA 4OZ4B 3LB6D 4YJZL 2EXWC 4Q9RL 5DA4A 3V6OC 3NA9L 2IALA 3SDAB 3PL6D 3VFPB 1G9NH 3KNBB 3OKDB 2XWTA 2XQYG 1U95B 5D7IF 1Z6JT 2NX5E 2QADB 3HRZA 4M6MH 4XBPB 4L8SB 4HLJA 1BOYA 5C0RH 3MRKB 2AJZB 5BRZD 2G9HA 2OCFD 1A3LH 1BJMA 4P46C 2FBOJ 3MQIA 3OKLB 1C16B 4XNYH 1T1XB 5JIPA 3UTPD 3IKCA 3RZWA 3JZ7A 4X5WA 2EH8L 1N6UA 1BQHB 5CGTA 2V17L 3VFTB 3T04D 1KB9K 3ISWA 3QXTA 1UZ8B 4PB0H 4TUJB 4WDIB 5D7JD 1KSRA 3OAUL 1HXYB 3BIBX 4WI5A 2DBLH 4H0GA 2GIYA 3TYGL 3ZL4L 3U46A 3BW9A 2X42A 4ZFOB 1CICD 5DC0A 1EAPA 2PYFA 3QI9B 4Q6YA 2EIZB 1T89A 2QSVA 3UTTE 4IOFC 4PJ9C 1UM4H 1WEJH 5EOQL 4JFZL 1IAIH 4OI8A 5I8EA 5C9JA 1CE6B 1G7PA 3IAPA 4LSVH 3MCLL 5DD1L 5DO2C 1F2XK 1B0GB 3QDGA 2RAMA 4RGOL 2EE3A 3QULB 3NN8A 3N50A 1KIRA 2AJVH 4JO4H 5F7DA 3U9UA 2JLLA 3FAWA 4FFWD 2NY1D 1J88A 5D1QD 8FABB 3ZE0F 2BZDA 3QUXD 4U6TA 2E7BA 5F3BA 2APBA 4JHZA 1A22B 1JK8B 5ADOH 3MACH 4J12A 4LKCB 4Z7UE 2ZUTA 1J8KA 2YXFA 4G6JL 4LPYA 4UIMB 4HF5L 5LJYH 3R06B 3UZVB 4EN3C 4BKLB 2I60L 5IQ9B 4ELME 1W2KT 3VG0H 4PJAE 1TJHH 1MREL 1GHFH 4YHZL 1P4IL 2AW2A 2NXYB 1QEWA 3HI5H 4X4XB 3ZHLA 4OV6F 5DQJB 2DQUL 4NQEE 2FJHA 5DVMA 4Y5VB 2X1QA 3GBLA 2AEQH 2NQCA 3I02A 3TO4C 4IEFB 2GAZA 4MXVE 3CX5J 1P1ZB 1NGXA 2AP2A 4B53A 5AWNH 3D18B 4YEFA 4MNQE 3VDCA 3VXRE 3KHQA 4GXUM 5INCB 2FB4H 4O2CA 4LBEA 3EJYC 3HB3C 3QWOA 1CL7L 5EA0L 5H94B 4JFOB 1BQSA 1S78D 5HHNA 3MOAL 1OQXA 2Z35B 4RMSA 3ZTNL 3LV3A 3EFDL 4F80A 5F97E 1I7RB 4WJ5A 4U1HB 1EEZB 5DHVH 4ZPTA 3B5TA 1XH3B 1J1XH 3LQZA 3K46A 4GT7A 2D9QB 1V3MA 4JFED 3L3GA 4PJ8A 5MEOB 5JLZA 5I71B 4MXWH 3FRPA 1HKLL 3QXAA 4PRPA 3T2PA 1IC7H 3MRGA 1MQKL 1PSKL 4QXGH 5IKCA 5LWYL 5E9DE 1RU9L 2XICA 3QWRA 4Z0BH 4YPGB 3TVMD 1EXUB 1F58H 4BQCA 4HV8B 3DTXA 5SV4A 5ICXB 5CBAA 5H2BB 2NW2A 5IB1A 4BUHA 1JRHL 4N8CL 4YNYB 1B2WL 3F8UB 1DFBL 1KC5L 1QUNA 5IBTH 5JIHA 12E8H 1JZ2A 1L0QA 2IPKA 5EU7E 3FFCB 1N0XH 3QDMD 5C9KA 3VFVA 1ZHBB 2X1XR 3OKEB 1JVKA 3O8XB 2J5LB 1IC1A 3AM8C 3RTQB 2O5YL 1YPZB 4UT6L 1Q72L 3EJZD 1S7WA 3RJDA 2OJZH 2VDOH 3SDXF 1Y6KR 4KVCL 4LLWB 1MFBL 3EO1B 4PRDB 2HVJB 4M5YH 3ILQD 3WD5H 4M48H 5ILTL 1NLDL 1NBVH 3SJVE 4MQ7B 3UPAA 5DUBA 5IP4A 4MNGE 4TYUA 5FYKE 1IVLA 4HIIB 5F9AC 5HGDA 4NFDA 3W2DL 4KZDL 4KUZL 2WZPD 1NGQL 3MV9D 1ZMYA 1E27A 3A0OA 5DD5L 2JJWA 4L3AA 2Z4QA 1OGAB 4I2XA 2F58L 4OLZL 3LRGA 2XWJB 3I75A 4FQLL 1GGBH 1HOCB 3QG7L 3DYPA 2VLKE 3HNVH 4HFUH 4UU9B 4YZFF 4QXUH 3IFOA 4HWBL 4KK8C 3ZE2E 5IJVA 3GHEL 3GMNA 2X2YA 1LWRA 2VH5H 4UQ2A 3E8UH 3U4BL 1RAMA 1BMGA 2PO6B 4XCFL 4WIQA 1DQDL 4HW6A 4QRPA 5TGBB 1J8HB 5D2LB 4ZO9A 5B3JE 5T1DL 4LAQL 2ADJA 2FJGB 2OTUA 3WN5B 1BD2B 3OJVC 4TSAH 3BP4A 2ICWA 3ZYJA 1JGDB 2A77H 4DZBA 5ISZA 5B8CC 3OKMA 1VCAA 3PXHA 3ZSTA 2CJUH 4JY5H 5F1OB 1WBZB 1ED3B 4XMKH 4U05A 1FNEA 1KJ3L 2E9WA 1A9BA 1T6WA 4V1DB 1RUQL 5LCVH 1FO0L 4MMZC 4DN3L 1WF5A 3BISA 4R7NA 5DJYB 1BX2A 2CDEB 4BELD 3OGOE 2K3TA 1BZ9A 3KR3L 4F7EA 4LPUA 2YWYA 5GS0H 3W9EA 1MUJB 2ESVB 2IGFL 4MD5A 3QNXB 4GW1A 4X6BB 5C71A 1YECH 1S8DB 2MQ3A 3FOMA 1V3JA 1SY6A 2DQGH 4XBGA 2F74A 2FDBP 1YN6B 4OZIA 2IEPA 3FQNA 3BGAA 2PF6A 3TV3L 5C8JA 1ACYH 2D7QA 3V6OE 1CGYA 1N7ML 3O41B 4QHKJ 1NH6A 1CU4H 1QBLL 1JHLH 4KROB 4PJEF 3WXVH 3FN0L 5C09A 3K4DA 3UPRB 3GNMH 5EOTA 4XHJC 1OPGL 1ZHNB 3SPVB 3KHOA 3UBXG 5IMOB 4NWTL 1NC2A 3MBED 1DLHB 4DW2H 2I9TB 3O2DL 3KPSE 4JHBA 1M7DA 4UV4H 3SY0B 4Y16B 4Q9QH 3QFJA 1D3CA 1N5YL 1KN2H 2VITA 1W0YT 2BSSA 3LSOA 3WV0A 5TF1L 4HLZH 1QSFA 1RJZB 5J1TC 1BZ7A 3LN5A 2OQJA 1S7SB 2CSPA 4TPRH 4X6CE 2V5RA 3U1SL 2C3XA 1FORL 3FCTA 4PJXF 4M43L 1MWAH 2HJFB 5KW9L 3ROOB 4HT1L 4J4PC 2DQHH 5J9PB 4OD3L 1ZTXL 1JGEB 3K8LA 2BOCB 3L6FB 5B4MD 3KPPA 2DQIL 3VRJB 1BIHA 2VWEC 1U8IB 5TQ0L 2BOBA 3V6BR 4JRXB 2NTSP 4NDMA 1L9NA 1SJEB 3LOWA 2IPTL 5B39G 3GMLB 2VXSH 1JPSH 4JPKH 4JCMA 1I8LC 1T2QH 3FB7A 1ONQA 2V2WB 3ZKSD 4PS4L 3I84A 4R26H 1SQ2N 2EZ0D 5I1KH 3TJHC 3MUJA 1AGCB 4PLJC 3WIHH 4B7LA 4A2LA 1YZZA 3GBNH 3QH3B 1AQDB 5L6YL 3VFNB 1S7QB 2FX7L 1ZEAH 4WHDA 4U1NA 35C8L 2QQNL 5EO1B 5J8OA 4M8QB 1LP9A 4QRUB 1MFCL 3O81A 1O5DT 3ARDC 4NQDE 3T3ME 4JM2B 3VCLB 1JBJA 4P49A 3B2UC 4O5LH 3ZYOA 4YXKH 3MUGB 2NCMA 2R1XA 1NKRA 3WJJA 3WEXA 1EO8L 1L6XA 4OCYH 4KDTA 3UO1H 3VI4F 2D7OA 4L3EA 4XPHL 1KNOB 4UZGA 3VWKB 3TBSB 3ZKXB 3FB6A 5SV3A 3L95A 2J88H 4E41D 5L8KB 1QFOA 4R3SB 5E8EB 5IGXL 4HZLA 4ODHL 2F5AH 4ISVB 3VFGL 3BI9X 2P46B 4MD0B 4LCCC 5C0DA 3V5KA 1KOAA 1OOAA 4PJHE 1RZ8A 2VYRE 5HPOA 5LGJB 4LVOB 4JZJA 1SJHA 5I16A 3S37L 3FZUD 3QIBC 4R0LC 5I30H 1F90H 2R9HC 4Y4KC 5DEGA 1RUPL 4QHNA 4JZOA 4J1UA 4ZNEA 2WSKA 4EI6A 1HYSD 1ZAGA 3DMMB 2XY1A 4UBDD 5TE7H 4YDKL 4DAGH 5JW3H 3U9PL 4OLUL 1XGPB 3HI1B 1WITA 2X4RA 2ZWLT 1ZWIA 4AQ1B 2B1AL 7FABH 4YDVB 1E6JL 4CRPA 1FG2A 5ANME 3P40A 4MNHA 3MRRB 5JOFB 3FT2A 3PHSA 4PP1C 5E4EC 1QR1A 1RUKL 3AY4A 1IJ9A 4GW5A 2H32H 4PJGA 2EDJA 2DKMA 4M93B 4ZS7H 4PRHD 1IAIM 1TDQA 1HILB 1N59A 1PEWA 3BSZL 2WM0A 5ACZB 2Z31D 5DJAA 1FIGH 3IS1X 4G42B 4U1KA 5DMGC 3HG1D 2R4SL 3D3VB 3L9RA 2CLVA 4PUBH 4OF5A 4OCXH 5D2LE 1MJUL 1MEXL 1PG7X 2EDOA 1CD1B 1BD2E 5EZIL 4J3OC 2VUOA 4QYOB 3QUKB 3TNNB 5JW4M 1J11A 4LVNC 5GRUL 4C56A 3NCBB 4QXTB 4JN1H 5HJ3B 1A1MB 2MTPA 1FYTB 3NCYP 2DYPA 2ARJB 1NQBA 4HWZB 3PP3H 1EGJH 3TFKC 4G7YL 4FQXA 2GK0B 3FO1A 5I9QC 3LDBB 3QUZD 1HI6A 4XVSH 1KXTB 1CXLA 3U4EB 1F97A 4Z8FH 4IRSD 1J12A 1KCLA 3ULVD 5DJ2B 1ETZB 5I0DA 2P42B 1HSBB 2YXMA 1Q9LA 3IDUA 3B9DA 3OR7A 5D7IE 5KBNC 3ECBB 3LEYH 3W9DA 3TESA 3BRFA 1JV5B 4G8IA 1TPXC 2VXTH 1X5LA 1YN7B 5DHYA 1MAJA 4JO1L 1EFXA 1MJJB 3MLVH 3RGVB 3A6BL 1XIWB 3GKWL 3B9EA 2CKNA 2OK0H 3ARED 2CXGA 4NKIL 1U0QA 1P7KA 3EHBC 4NQCD 5HI4D 3QJFA 1FZOA 5F88A 4CVXA 4XC3L 4HULB 5DS8A 1WQVT 5D1XA 3UAJD 4PD4K 4JFFA 5GGSA 4MX7A 5HHQA 2PW2B 3HZKA 4I4WB 4WEBH 2YD7A 1BFSA 2Z9TA 4P5TD 2AK1L 1TCRA 2KUTA 3Q5YA 4LLQA 3QEQD 3CSBA 4GKSA 3TBWB 5E1AA 1NBQA 1A0QH 5BO1H 4TULL 1ZK9A 3HNTL 5K9QG 1FHGA 5D7LB 2XA3A 3MGTB 4XP4L 3VXSB 4TOYL 2GQHA 2PTTA 4R7DA 5C7XL 5TH2B 4NBZB