1TZHB

Crystal structure of the fab yads1 complexed with h-vegf
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFDIYDDDIHWVRQAPGKGLEWVAYIAPSYGYTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRSSDASYSYSAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Vascular endothelial growth factor A
publication title Synthetic antibodies from a four-amino-acid code: A dominant role for tyrosine in antigen recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tzhB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tzhB01
3HR5A 3WHXA 1H8OA 3D3VE 2VLME 3BKCL 1TTFA 3UTZA 1NEZG 1D9KD 4ZO7A 4CVWA 4G8IB 4X4XB 5IW3A 2J4WL 5EORH 3MX0A 4RQQB 2IGFH 3MRJB 2Y6SC 2ATKA 4I4WB 3ULUF 1SM3H 5F7DA 1NGZA 5IGXH 3RPKA 1OPGH 1SYSA 5HHOD 2XXCB 3SQBA 3HAEA 4L8DA 1CD0A 1S7XB 4OZ4A 5CGMA 4G6MH 3KPRB 3SKJL 5HXMA 1P1ZB 4LOUD 1QA9B 3HCVB 4WW1A 3DUSB 4QHUB 1UVQB 3GI9H 2VLJB 2DQEH 5DZNA 2VITA 4OLUH 1J5OH 1IC4L 1TVHB 2H2PD 4XNUH 4DEPB 2AI0H 4JZOA 5ICYA 3PQYA 1LO0H 3NVQA 35C8L 1TQBB 2Q8AL 3BT2L 4PJ8D 5IJVA 5MEQB 2R4RH 4JN2B 5TE6L 3TT1H 3UZVB 1NGXB 4APQB 4NO0B 4YDLC 2ERJC 3BI9X 4U7KA 4HXAL 5ERWB 1T20B 1K4DB 2WBJD 3MQIA 4E42A 3MLSH 4PRIE 5DURB 2MQ3A 4O51B 5HGHA 4Z7UB 4LIQE 4YPGA 1VA9A 4PJHE 4I0PD 2MPAH 3M8OL 4M7LL 4YDIL 4OV5B 2IWGA 4FQIL 5LWYH 4JFQB 4WTWA 1B6UA 4QHMA 3P40A 1T2QL 1AGDA 5KZCB 5I8KH 3EO9H 4F7MA 1QBAA 3FJTA 1HINH 2AQ1A 4ZS6C 2EEDA 3BDXA 3QDMA 3Q2CA 4FA8A 5C09A 3NCMA 1QRNB 5I17B 2XN9D 4JAMB 3TO2B 4RFOH 4X9BA 1FLRH 2QR0A 1MJJA 3PF2A 4WO4C 1U0QA 4X6FA 5EBWA 2A2QT 1MJUH 4NJ9L 5I1KL 3WS3B 4NBYB 3JTSA 5EN2B 2VH5H 1E4KC 1ZEAH 3LIZH 3SQOL 1EEUA 1EO8H 5JW3H 4U6TA 1CVSC 2OI9C 4JFPA 3C6LD 4MD4B 4NQUA 4QNPE 2XZCH 3DIFB 5I16A 1AI1H 4MX7B 5F89A 5AAWA 4PGBA 2XPGB 3QIUD 5F21B 3VXMB 1JPFA 4KKCC 1I7UA 2ZPKL 3U83A 2VE6B 3BN9D 5ESAA 2VISB 3ETBF 3X12A 4EN3B 3G08B 4XPGH 3FN3A 4PD4K 1QTYT 5F9JA 4KKBC 4YHIB 3DSFL 4XX1G 1UB6B 4A6YB 2A9ML 1G7QB 1Q9OA 2JIXD 3PWJA 5D96C 5LJYH 1NBVL 4JFXB 4D8PA 5E2UL 2BNUB 2XRAL 4P3DA 3W82A 4KU1A 2FEEI 5TQ0L 2VR9A 3VGAC 3V4PL 3CH1B 1IILE 1QKZL 2VL5B 4NWUH 2YZ1A 5IP4A 1XF3A 3MMEB 4FQHB 1X7QB 4MJIA 3B9KD 4HUMB 4CU6A 4ORZC 4Y2OA 4UAOB 4EXPX 1MHCA 4YHLL 1IAKA 4ODXB 4PR5A 1XH3A 4UUJA 1RZKL 1QLFB 2DOCA 4ZUSA 4AY0A 4TULL 4MA3A 2OXGA 4YHNA 3EOYG 1DN0B 4KJPD 3TA3A 3OKDA 3RY4A 1XMWA 4FS0A 5JA9A 4XI5C 3D3VB 1ZTXL 3HUJB 5ENWB 4MJIE 3ZKNC 4YQXH 2VDPH 5E99H 1T1ZA 5DEZA 1AGFB 1KIRA 3KYOB 1BAFH 4NQSA 1A6VH 3OKNA 5J7CC 3FOLA 5JIIA 3M1BA 3RU8L 2JJVA 3QXAA 4N8CL 4GKNB 3WHE1 4OZIA 4DZBB 5FV1L 3X11B 2ICWJ 3S88L 1H0DB 1Q0YH 4MSWB 4WIQA 4Q9RL 3GSNL 3VGEA 4NC1E 5IMLB 3WEXA 1A3RH 1YJDL 4GRMA 1OAUH 2ATPA 3OAZK 1IZJA 3IFOB 4WFGD 3NFPA 2QHLA 2RHEA 3O8XB 1G9NC 1WCBB 4ZFZB 1LO5A 4YXKL 1SHMA 3CX5K 1DVFA 3ULVE 4FFZH 3I3DA 2UWEB 3VDCA 2P45B 3Q5TA 4DGYH 3TCXA 4O2CA 3MFGB 4U1NA 4LLDA 3VRIA 5BS0D 3ZDYE 4LSQH 3F58H 3VCLB 4BQ6A 3WE6B 5E7BA 2H3NA 3IKCB 3QUZD 4I3SH 3INUL 4KRPD 4GW4B 4JQXC 4WHDA 4PRIB 5TGBA 5EZLA 4NQEE 4HKJA 4PJHB 3U1SH 4OM0H 1VFAA 1HQRA 3BHBA 3NCJH 4P2QA 4X7FC 2NY2B 3X14A 1CE1L 4R7DB 4JM4L 3DUHA 1BQHG 5D7SH 5DS8A 2OZ4L 2FB4L 5KVEH 4QXUL 2HVKB 5GGRA 3WLWC 3NCYS 4OD1L 3RWJA 1LEKA 2BNRA 1L0XA 4DUXA 4X6DA 3FO0H 1FV1B 4ZUUA 3CJJA 5JHDB 5HDBF 3WFHA 2DTMH 1CDHA 1XGRA 3B5HA 3EFDL 4P9HC 3LPFA 4PJIA 5HD8C 3PWVA 3Q48A 1SJHB 5HHNB 1ACZA 1GRWA 2YPLB 3ARGA 1EPFA 1MELA 3G9AB 4N1EA 3BZEB 4JRYE 5AAMA 3F7QA 3BP7A 1XR8B 4JFFD 4HW6A 4M1CC 5SWQA 2ZCHL 4MWFA 4I5BA 4Z7QE 2R0LL 2WIIA 1HQ4A 3B5TA 1T4KB 4EUPB 1LDPL 3HC4H 1YEGL 4E5XB 4GKZA 4LU5H 3QUYA 2V7NB 3TN0B 2BC4B 2DBLL 2X10A 4DVBB 4LCYA 5KG9B 5JNYA 5TF0A 1CTOA 2NY1D 2WWKO 1U8NA 4Z7OE 4XVJH 1A7OL 4MNGE 5GS0C 5J9PB 1YQVL 4OZIF 3FRUB 5DUBA 3MRHA 3ARVA 1JZ3A 3AXLA 1FG9C 3VG9C 4NNXA 4ONHA 4JM2A 5FM8A 2IAMA 4NDMB 3RVTC 4N0UA 5D71L 1YPZA 4DKFH 5IMMA 4WEBH 2R2HA 4NNYB 3VRJB 5D7LB 2OK0L 3GJFH 4F8TA 3G5XB 3DNKA 5GRVL 5CSGA 3L3OA 3TYFA 1C5DB 3EJZD 3FO1B 4O4YH 1N8ZB 1PG7H 4HKXB 3S7GA 2X4OA 1RUKL 4ONFL 4Q58C 4ZPTA 5GGUB 2QBWA 3O6FC 1GGIH 1HHIA 4RNRA 3P73B 3RVWD 3H2WA 1ZK9A 2F54B 2QJDA 3OXRA 4QRUA 1RJLA 4UT7L 4K3DL 4H8WC 3WJJA 5I0ZA 3R8BB 4NO3A 1CYGA 3OKKA 4GOSA 4LBEB 1YECL 2DB8A 1T2XA 4XRCB 1HH9A 2DWEA 4M7KH 2J5LC 3FQXA 4Y5YB 4WCYH 4NOBA 1YMMD 3HFML 4ZODA 4WI3A 1NCAL 1KNOB 1UFUA 3GK8L 3GZKA 4IRZL 5LGHH 4G9FE 4X6DF 4YHMH 5C0DA 3T4YB 3MODH 4MQ7B 3UYPA 3PWPD 3V6FA 1D9KA 3CZJA 5DQDH 2VOTA 2YD4A 3CH8A 3MZTA 3MUJA 1QVOB 1FL5B 2UZXB 1MRFL 4J1UB 1FQ9C 5D72H 5F72S 5E2VL 3QPXH 2PYEE 4MNHA 1R3HA 4PJIF 1C16A 2WINA 3QBTB 3ZT6A 3ALXA 3TNNB 2JF1A 4BQBA 1RZGB 4LSUL 1NCTA 1IGJB 4FQCH 2ZOLB 1I3RA 4P5TD 2DS4A 1Q94A 2VLKB 5DD3L 2R39A 5ICXB 1QLRB 5IW6A 4XPAL 3TBVA 5EC2A 1UEMA 4HS3B 1D3CA 1JN6A 1MJ8L 3BD3A 3QAZC 3QXWA 2EH8L 4RIRB 3BAEL 5A40E 1RZFL 2AV7B 1FZJA 3FT2A 2CLRB 2N56A 1DDHB 1N2RA 4HJ0C 4JY4A 4GKOA 4L4TB 2F5AH 3CFJB 3HRZB 1DUYA 1KJ3L 5HHOE 1CLYL 5KSUB 5EU3B 4EEEA 4UV4H 3ZT5A 2D7PA 3E6HA 1CFNA 3QUMB 4N9GB 4OF0A 3CSYA 3P0VL 1LWRA 3EW3B 2NY7H 3O45B 4O5LL 3V6OE 4JO1L 1MCNA 2VNCA 4Z7VB 4QYOA 1A14L 2I9LB 1FNSH 4WU5A 4ZG1A 4LLVA 4J8RB 2Q1EA 4MNQB 3PGCB 5MEPB 4I1NB 2QQNL 3AREA 3VD7A 4JM2F 3ULSB 4U1HA 2FEDC 1J8HB 1YPZF 4J3XA 4NQCA 4QHNA 4YX2L 2BJML 1UYWL 4GXUM 3J7HA 3BP4B 2FSEA 3UXFA 4JRYB 5MERA 5JO5B 1IBGL 2ICWB 2MKLC 2ZOKA 5FYKL 4ZSOE 3IFLL 4RMRA 1FGNL 5E2JA 1OCWH 2GT9B 5AWNL 4DFIA 3IXTB 4ZNCD 2VKXA 3LY6A 3SGDH 4QXGL 4Z78B 3OG4B 3SE9H 1CDGA 2QADD 4MAUH 4F58H 3PHQB 3REWB 5F9OH 2CH8A 1A6TA 2QQLL 4F57L 1R3KA 2Q8BH 3MYJB 1MCCA 2DI7A 3IB4A 4FQJH 2JB5L 4IMKC 3JWDH 2XN9E 3JWOL 4K3JL 1BD2B 1A2YB 4P2OD 5IMKA 3FCTA 3V52H 4B41A 5CKGA 2XZZA 3KYMA 5HGDA 4M9OA 4OUUA 2HH0L 1EGJA 4M5YL 2GJ6A 3DRTA 3SGJC 1XF2A 3BXNB 1A7RH 5JQ6L 1KJVB 4O9HL 5DC0A 1KTRL 4XP9H 2ITDB 1IGYA 1I9JL 3NFNA 1IGFH 1NUDA 2Z8VC 1SY6L 5HYSA 3MRNB 1P7QB 5I1HL 4X98A 4KXZH 1I9RH 2W38A 4KK9D 1IAIH 5D7IA 5DGRA 1UQSA 3KDMA 5J6GA 1WAAE 1EIBA 1J7VR 2P5WD 3A67L 3JUZA 3G6JE 3VI4E 5KOVC 2ZG2A 4KHTL 2GAZA 4Y16B 2KDGA 5IHUL 4K9EL 5C0RL 3TH4T 4LFHG 1AGCB 4OGYL 3O9WB 2IAND 3MFFA 1T03L 4S1DD 3CFEB 3B9KA 1IQDB 1ZA6A 2H41A 4PYHA 1P84K 3PWNB 4K23H 3PP4H 4EDWL 3V5KB 1OGAB 1G1CA 3ARDB 3B9AA 4YHZH 1VACA 1HE7A 4K07A 3P4MA 4M7JH 4OLWH 5D1XD 3NTCL 2K3TA 1LE9A 2XACC 3FTGA 5FYKD 4JQIH 1I3VA 4P4KB 1ZLVK 4I9WD 4ZFFB 4ESKA 1OP9A 2AEPH 5CZXC 5DHVA 5LKNA 3GMOA 5ALCH 5DMKA 3ZYJA 1XFPA 4QTIL 4TUKL 5HDQH 1WWCA 1J1OL 4YE4H 4G9FB 1G7JB 3V0WL 2DWDB 2W0LA 1VFOA 1HXMB 1ULVA 5IR1B 3T2NL 4NRXB 4CADA 1QO3A 2WWKT 2Z31B 3CFBA 4HPOH 4LHUA 4CNIA 3WKML 1XAUA 2H9GB 2GK0B 1FH5L 4PJEA 3WNOA 1UCBL 4I13B 3T0XA 4ODUB 4MA8L 5IEKB 4ELKA 4TNVK 2EYTA 3LKQA 3CSPA 3MA9H 3KPPB 4MLSA 5I74B 4GAJL 1TFHA 3RVUD 2D2OA 4MAYC 4RA0C 1QFUH 3O2DA 2E8ZA 1S5HB 1S7WB 2XFXA 1QP1A 3L5WB 3I84A 3QB7C 1FDLH 4KTEH 4YEFA 1KEGH 1LE5A 2D31A 2D0GA 3VXQA 2BXYA 4PJEE 3SDYL 5CIPB 5HHXL 2GY5A 1TNNA 5DVOA 1OVZA 4WW2C 5J1AB 5DJDB 3ZDXE 4QWWD 5DYOB 3D18B 5GISH 5HHOB 4DUWA 1NAMH 1ZGLA 4JN1L 2J88L 4P48A 3C8DA 5EO9A 1KG0A 4LPUA 5E6ID 3T0DA 4KXZI 1X5IA 3ARFA 1IAII 2DAVA 4P2RB 4K7FB 5LG1A 4D0BB 4GMSL 2DMCA 4P23C 3NPSC 1CGYA 5D2LA 2CR3A 3CLFL 2UVEA 1BFTA 3QUZA 4PJ5D 4WFGE 4H25A 4M48L 4RFNC 4JJ5B 4EBQL 4Y4HA 2AJVH 4F3FA 3EYFB 4XPTL 4PJ8B 5GRUL 5T33H 4X8XA 3MOAL 1XIWD 1NUFA 5DFWH 3KPTA 3NABL 1OD7A 1T21A 4HUWA 4Q2ZA 5BS0E 2DD8H 1RU9L 4GAYB 1RZ7L 3D1MC 3LAFA 4MVBD 5DJAB 3HG1D 4ZSOB 1HOCA 3NAAL 4JG1H 5D7IF 1O5DT 2WBJB 3FB7A 1JHLL 3LRHA 4M6MH 3DROA 5D2NC 4KDTA 5BVPL 1BP3B 1Q0XH 3MXVH 2O5XL 1RJZB 4I0PB 4A2LA 1HHKB 3WV0A 2DLFH 3DWTA 3BIKA 5CEZH 4KK8C 1EERB 2YSSB 4XAWH 4XVTL 5HTSA 1CLZL 3S5LA 5ESVB 4KGJA 4UIKH 3BRGC 4QLRA 2P43B 4HFUL 4P9MH 4MJ5B 3QHTC 3GSNA 2V9QA 4JR9L 4MA1B 2XN9B 4XCCH 4GBXD 3RUGA 1ED3B 2PO6A 3QIWA 3K8MA 3EJYC 3QWRD 8CGTA 4PGJA 3CFIC 1FO0L 4NYLB 2BVOA 3BOVA 4L3CB 5DTFA 3UBXI 1U3JA 2BY2A 3MV8D 4LGPB 2X4TB 3DYMA 5DD1H 2R2CA 1U3HC 5KSAB 1MAML 1DL7L 4PJEF 2FLBT 1YN7B 3DMMC 3S3SA 4HFWB 4QTHB 1Y0LB 3VXSD 4DUVA 4WTZG 5F6HJ 3ZDXF 3DECA 4Z18A 1R3IH 2BCKB 1BVKA 1MY5A 3C6LB 1CICC 2IBZX 5DHYA 4PJXE 2ZUYA 4F7EA 2FR4B 3QIUB 3S3JA 4JFFE 4NGHL 3G5YB 5KOMC 2V17L 2OTPA 3MRBA 3P0YH 4FFVD 5JZ7C 1KJMA 3MLPA 4X83A 4WHYG 1BIIB 3Q1SL 3UC0L 1Z0NA 1R5WA 3U30C 3C09B 1XGQA 3BE1L 4PLOB 4WJ5B 4XVSH 4OLYH 5IKCA 2JIXB 1Y6MR 4S1RH 1A1NA 2HT3D 4H88L 1G9NH 1QQDA 1SQ2N 5I6XC 1QR1A 2R15A 5FXCH 4FXLA 3IS0X 4X99A 4XP1H 1DBAH 5E6ZA 4OZGA 2J8UB 4PS4H 1ERNA 2C7UB 5FHBH 4N0RA 3S4SA 5ADOL 2AJZA 2DMBA 4LKCB 1DBJH 5T1LD 3V0VA 2XTJD 3NZHH 4Y88A 4RX4A 1H3XA 3V2AR 1ZLUH 4PY8I 4R9HA 3HC3L 5D2LF 3VG0H 4POZC 3GBML 1KN2H 2IALB 5F1SA 3EYVA 3IFNH 3BJ91 4JVPA 2HKFL 1QSEA 4BKLA 5T3XH 3HE6D 5IB1A 2DQTL 3QQ3A 5DQJB 4OLXL 2QSCL 3E3QC 4NJAH 5EBLA 4Y4KC 5KW9L 5JXED 3U0WL 5DI8B 4UDTA 4RGOH 5IT2H 4HWEH 3DYOA 1ADQH 3FRPG 3QDAA 1FIEA 1MIML 2FHFA 5HI3D 3VXUA 3QRGH 5GZND 1IL1B 2ED9A 4GO6B 3OF6D 1KBGL 4I18C 2K9UA 5I9QC 4GW5B 2H32H 4OQTA 1XZ0A 1ND0B 1NBYA 3NZ8B 4RGNC 4KQ3L 1NAKL 3QXDB 5HYJA 3EYSH 4DFHA 3DX9B 1IC7H 3TBYA 3FFDA 1K3ZA 2EIDA 3B9EA 4KK5D 1I1CA 1NFDB 2XYCA 3QI9B 1A4JB 4ZAKC 2R9HC 2P8PA 1G9MC 5BJTA 1KN4L 5ICZB 3AU1A 1YMME 2ZUQC 2ITCA 4M7ZC 4NC2B 4TNVF 3MTRA 2OL3H 4JO4H 4P5TA 5HHMB 3E0GA 3KYKL 3RUGF 1UEYA 3BH9A 3PWPE 2F58H 3LH2L 1U8OA 5FUCC 3WBDA 4J6RH 3ET9F 5BS0B 4O58H 3EOAA 2F74A 4HH9B 1BIHA 4CL7A 5DFVD 1JFQL 1PQZA 3BIBX 3MRIA 4KRPB 4L3ED 4NHUA 3BEVA 1VADA 4QGTA 5ID1A 4MJ6B 1JHTA 5C0IB 3VXOA 2BFVH 3T8XA 4X6EB 2XY1A 1T22B 1DEDA 3GIVA 4M02A 1K8IB 1NFKA 4RRPG 3ILPB 12E8H 1T0MB 2DQIL 3P77B 4N0YH 2FH6A 4OCLC 3JV4A 1LO4H 1WC7B 1P7KA 4LLWA 1FFNA 3LKPB 5I71B 4MB3A 1P9MC 2NXYC 4J12A 5J13C 2C3VA 4OZGF 4HAFA 4WWKB 5EU6A 1XGUB 3KAAA 1CGTA 1M71A 1ZHBA 2AKRA 1MIEH 3AUVA 1K4CB 4ENEC 5TDNB 5F9DC 3HS0B 4X8JA 3KR3L 3LN5A 3QUKA 1E4JA 4PLKD 1A7QL 3NIDE 2MCPL 4L8CB 4N1HB 2ADJB 4PGCA 4LDOB 4H8WH 4XNYL 4HGMA 1C12B 4AG4L 4C56B 1FL6B 2D7QA 3JTTA 3UBXG 2CLZB 5EUOE 4PJDB 1A6UH 4PJXB 3K7UA 5FM4A 5IVZB 3IDNA 4OAWB 2HJKA 3STBA 3HI6L 5DMIL 3I2CH 1BEYL 4GXVL 2VB5A 4R90H 3H9HB 4NPYA 1JHKL 5D1QC 4AIZB 1CQYA 3C2SA 4HK0A 4DCQB 1B0RA 2VDNL 2DQJL 4ALAL 2P5EB 4HUUA 1KXTB 1KCRL 3MNZB 5CGYC 5B39B 1I9IH 4L9LB 4QRRD 4MMZC 5DD6A 1X4XA 1DLFH 3VXNA 1WWBX 4JDTL 1S7SA 3C60C 1AIFB 2WWMD 1QSVA 3GI8L 4R0LC 4BJLA 1ZT7A 1EHLH 3SDXB 1DUZB 3ZKMD 2ICCA 4XBPB 5H2BA 3RA7H 1I1FB 1JK8B 1UB5B 2R1YB 1BBJA 4HZLA 2P5WA 1HHHB 1HYSC 1DFBL 3O41A 4S1SL 2H26A 4LLMB 3D85A 4AEIL 4ZXBD 2BVEA 3ZMRA 4KGLA 4DZ8A 1M7IB 2EE6A 5H94A 1S9VA 1UA6L 1DBMH 1U8IA 2NCMA 4MQSB 2IANA 4KI5D 1T04A 2I60L 3QCVL 3L95B 4G43B 4UDUA 3Q6FA 1HSAA 4UT6L 4D94A 3I3EA 4E41A 2BP3A 5IW1B 1XGPB 1ZT4B 2X4RB 1FZMB 5GGRY 3PHOB 4TTGA 3O6MH 1KC5L 3SDAB 4M5ZH 5D1XA 1SMAA 2LV4A 2CDEB 3Q3GA 3BDBA 3O0RL 2P5WE 3WSQL 3BSZH 4XNXH 3MJGX 2C3XA 1VENA 1FN4B 1VERA 5FHAH 1Q38A 3C08L 3DO3A 2EH7H 2X89A 2DL9A 2IANE 5IIEB 1PVHA 4DKDC 3WO4C 2RQ8A 4J4PD 4G5ZH 4RZCB 3QDJA 5B38A 3U0PB 3PABA 4EQ3A 4G6AD 2X70B 5I73C 4XNQB 3WNLA 2VDRL 1F3DJ 1CLOH 4XWOD 5KSVA 1G84A 3CXHJ 2NZ9C 5SX5H 5FYKE 1HZHL 1NGPL 4I9WE 4QOKD 3TZVC 3RJDA 3JVGA 1YMMB 1NLBH 3A0OA 3MRMA 1B0GB 2V5YA 1X5YA 2WQ8A 2Z0BA 5L9DL 1FFPB 1KB5B 3VFPB 1W72H 4QY8A 1D5XA 2FX8L 2R0ZH 1RURL 1IM3B 1QNZL 1CFVL 3C5JA 5BMFL 5DJ6B 3SKNB 4GRWB 1RY7B 3NA9L 4PJ9B 2APTA 4OCYH 5DK0A 2P7TB 3EO1A 1OQXA 4Y4FA 3ARWA 3MA7B 2DM3A 4HJGB 3B83A 4X4MA 1NCBL 2CMRL 1C7SA 3GSQA 5I2IA 2Q6WB 5DMGC 1J0ZA 4OF5A 5D7JD 3M07A 1IKNA 5GHWH 2I5YL 2W9EL 3HE7D 4KJYB 4HIEA 7FABH 3QIBC 3DXAD 1NMAL 3I6GA 2CO7B 1MLBB 2ARWA 2HJFB 4JHBA 4RMWA 4KTDH 1VFMA 5GGTH 1IE5A 2AJSH 3LDBB 4HIIB 4ZDHB 4Y5XC 3ZO0A 4LCWA 1IFHH 5LXGL 1A3LL 1EAPB 3HB3D 4HUVA 1LP9A 1TZGL 5DZLA 1DQDL 2A6JA 1E0OB 5E6YA 2XWTB 4JDVA 2AEQH 2JB6A 5K9KA 3BQUA 1HKLH 4CVZB 1T7VA 1S7RA 3IETA 1P2CA 3SGEI 5IHZB 1MAKA 2EC9U 3S37H 1HWGB 4O2EB 4PJ5E 5FA4B 2NW3A 2C5DC 3ARZA 3BGMA 1FYTD 3HMXL 5SV3A 2W60B 5I0DA 3FOMB 1UWEL 3VXRD 1OQOA 4RWHA 2XKNB 3MNVA 4BK4A 4B53A 4XT1C 5GIRB 2O5ZL 5EUOB 5JXAH 2NLJB 1QFPA 4H1LA 4X9IA 1YY9D 3WN5B 3HG1E 4GQ9L 3W2DH 2YUZA 4HDIA 2GTWB 3T0BA 3RIAK 1E4XL 1XEDA 3CDGA 4NHCH 2WAHA 3P2TA 2GJZA 3T4AB 3I50L 4FQ1H 4PJGA 3STLA 43CAA 4JDZA 3G04B 5EIQA 3QULB 3QWRA 3TO4D 4LSVL 5GSVB 3UTPD 2J6EL 5A2KH 3VXTA 2ZSVA 4P57B 4Q9QL 1NCWL 5KVMC 2QSQA 5C0GB 4HMDA 4XNZB 5LGJA 2BRRL 4XNMA 3IYLW 4LCUA 1OAQH 3SOBL 3QO1B 1V7ML 5DD0L 1R3JA 2Z35A 4HH8A 1S78D 2E6JA 4KI1A 2NR6D 4WHCA 4P2OB 4BUHA 4LNVA 4JKMA 1TQBC 5JPNB 4UTAH 5F9WC 4ZPVB 4LSTH 2Y5EA 1V7NL 3MLZL 1M05A 4JKKA 2R1WB 4OD2A 3KHQA 1ODAA 1AFVL 3MV8E 4PGEA 3RY5A 5ISZD 4WDIB 3OKMA 2JELL 1YDPA 5DJ8A 2IPUG 4JJHA 1A21A 4JANB 4NP4L 3OL2A 4F7TB 3QWOA 3RPIB 5DRNA 4PRPB 1CFBA 3VXSE 2AGJH 5T1MA 1KCKA 4OIIH 5F7EH 1JWSA 3X13A 1ES0A 1H8SA 1JCKA 1N5YH 1TJIH 4F15B 2R23A 1G7LB 4KMTH 2AXGB 4Y2DB 5I1CL 1OSZA 4LCCA 4LPXA 2EC9T 2YA0A 5TFSH 1BF8A 1IGMH 5GRYA 4DVRL 4KVCL 3CVIL 2XZQH 1T1XB 3CVHA 1RK1A 1S7TA 1XCQB 3V4UL 1A9EA 2E27L 2VLRA 3HR5B 3WHXB 1NCCH 2OR7A 2DQHH 4WNQB 1IQWL 2YC1A 1J86A 4RAUB 2DQEL 1TJHH 3OHXB 3UTZB 2NX5A 4OLUL 1J5OL 3VWJC 5D1ZD 2Y06L 5JXEA 3TWCL 1U8QB 3AROA 3SDCC 2XTJE 1LP9F 2AI0L 2V5TA 3BIAX 3BVNA 3EDFA 4NRZB 2NXZC 4O2FA 1X5GA 1M7XA 4U6VH 5AD0B 4ONOA 2IPTL 2R4RL 2X9XA 2X7LA 3QFDA 3JUYA 3LMJH 3TT1L 4IS6A 3DHJA 3G6DH 4U0RC 3HAEB 2WUCH 4N0FA 2FEEL 3GMLB 3ES6B 3UJJL 3W0WD 3K0WA 4Z5RA 1WT5C 2F9BT 3FQNA 1H3VA 3AMLA 3UX9B 3T0VA 2ICWI 4UIMA 1XF1A 4XHJD 2V7HB 4JRXA 4FQXD 3MLSL 1UJ3B 2VITB 3ARBD 5CCKL 4HKBB 3B2VH 4UV7H 1CFQA 4M6AA 3RNQB 2Z92B 4X7TA 3L5IA 3C5ZD 3WIHH 2E7MA 5LWYL 4JZOB 1ZWIB 5ICYB 2DYPD 3CLEH 3MXWH 1H5BB 4HPYL 1VGEH 3CX5J 5F7WC 1UZ8A 4PJGF 1NCDH 1HINL 5IFJA 3CDFA 3IFPA 4LRIC 5CWSB 2DQDH 4EUPG 3TGXA 4P46C 1C5CL 1ETZB 5E6IB 1L7IH 5EH1A 5IJKC 2K7QA 3L3IB 2EKSB 2PR4L 4H0HB 4YFLF 2YD5A 4UAOC 3OX8B 4AYFA 1NL0L 3GSUA 4OIBA 4G3YH 4YPGB 2PTUA 4PJ5B 1WFTA 4L3EA 2CLVB 3HMWH 4JEGB 1HKFA 1N64H 3MR9A 1AR1D 5JOFA 2YPVH 1FVDA 1ZEAL 4HS6B 3ROLB 2YR3A 5DGQA 1NGWA 1XIWB 4F7MB 5JW3L 4NKIL 4U1GB 1YNKH 1IEAB 2ADGB 3RZCC 2IH1A 1FORH 2YD1A 2DQUH 1OAKH 5C09B 4OCXH 4GMTH 3HG1B 3FHAA 1CFTB 5GGSY 2DKMA 1FZKB 5L2JA 1IMHC 1IGCL 3MRFB 5FGCB 3CK0L 3PUCA 3IVKA 4X6FB 3MC0A 4NZTL 1BHGA 2HP4A 4WO4A 4L3EE 4XPGL 4DN4H 3WFCH 4MB4A 3L3GB 4YNYB 3L3DB 5IEHB 5ACMA 5E94B 5CZVL 1EJOL 1NAMA 2BVTA 1VDGA 2YWYA 3OMZA 5F1IB 5JW4Q 3RKDC 4NQXB 1JZ8A 5T5FL 4V1DD 2G2RA 5FDWA 4IM8A 5DVKA 2CGRH 1MWAH 3KPLA 4JFPB 3MJ8A 5E56A 3LKRA 1B4JH 1JWMB 5IK3A 4ZUTB 3B9DA 4Q9CA 3UPRB 3GGWA 2EDHA 1RZ8B 3HZVB 5F9JB 1Y6NR 3L3JA 1NFIA 4UZGA 4YBQC 3VFVA 1Q9OB 3WXVH 4X7CC 1KACB 4L4VD 2WW8A 4XBGB 3RIAF 1RIHL 5FOBA 4RMVA 4IEFB 5KS9A 2CKBB 3LB6D 1ZLUK 4AEEA 2B4CC 4JVWA 3VXSB 2ICES 3QEUB 4JKWA 2XQBH 3HNTL 4ZMAT 3GNML 5LAXA 1KV3A 1KXQE 2IPKA 5I8OH 5F8RC 3H7BB 1A7NL 2OTWA 5GZOC 2IF7A 2A83B 1OAYH 3QO0B 2VDOL 1G9MH 3F7VB 1MHCB 3O4LD 1BQLH 2YXMA 4QRPD 1GC1C 3PDOA 3OB0H 1NEZA 4PR5B 1NANI 1XH3B 4NQVB 4LPCA 2A74B 2P4AB 5KS9E 1KPVA 1ORSB 4QRRE 3HC0A 5TQ2L 1OGTA 2AK4B 5JA8B 4YHNB 2A6DB 3QG7L 3OKDB 4X6BA 1A3RL 1ZV5A 1FJ1A 3TT3H 3GSRA 2WK2A 1XCTB 4ELMA 2HJLA 3ZL4H 5T1LB 4Z0XA 1CDBA 4GAGH 1NPUA 5EUKA 4HG4K 4NQSB 1YN6B 2ARJA 3U7AA 4LNRB 2HTKC 4K94C 2Z93A 5LGKA 4Y19A 5E8PB 4KJWC 1LK3H 3DV4B 1LD9A 5EZIL 4KI5E 4J4PA 2ID5A 3F58L 4YK4C 3RI5K 3WYRA 3HE6B 5DVMA 3UTSA 3MZGB 3CGTA 6FABL 4OKDA 4NZRL 4ELME 4FTVD 1MCOL 1GGCL 4I3SL 2QLVB 3UROR 4MD0A 4KZEL 4R97B 2ATPB 3SEPA 1LGVA 1I8MA 2EE2A 5B4MC 1FO0B 4UQ3A 1BECA 1R5VB 2YPKB 5A1AA 2H1PH 1L0QA 5J11C 2DQFA 2AV1A 3BZDA 3VFSA 1RUAL 3TFKD 4JZJA 3V6BR 4PTUB 3RGVD 1EBPA 3D25A 4CN1A 1D6VL 2JTDA 4OCRL 4FQ2L 5E00A 3GMPB 4QOKE 4S11A 2XI9A 3P0GB 1OTSC 4P49A 1G6RL 2OS7A 4MXVE 5BV7C 3U9PH 3N85H 1OT1A 2E9IA 2IH3B 1JRHH 4JQXA 4XVUD 3SCMD 3GMQA 4AH2A 1FG2A 1HQRB 2FIKA 3L9RB 4F33B 2EDNA 2V5SA 5C0AD 1RZJC 2G9HB 3HNVL 4BZ2L 1TVBA 3HE7A 4BA8A 1F3JA 3DXAA 3KS0H 4GS7C 4DKEL 2X4UB 4NO5B 5KS9F 2D0FA 1UM5H 4X6DB 4EDXB 1FNEA 3U2SA 3WL9A 3QJFB 4RDQF 2OSLB 3WFHB 3U82B 3RRQA 1BGXL 3A6CL 1UH2A 3DBXB 2VN7A 2YEZB 3PGFH 4OGAD 2UUDH 3TA3C 3BW9A 3ZE2E 4PJIB 1KTLA 1KEML 3SKOB 2BHYA 3DXAE 3N9GH 1HIML 1FYTA 4HWUA 4NC1C 3VXRA 2FYYB 4HIHB 2UV3A 4Y5YC 4BFBD 5A2FA 2BHZA 1OP5K 1ZVSA 4Z76A 2XWBB 1EVTC 3KXFD 3P4OA 4MWFB 3S96A 4KROB 4U1KA 2YD8A 4BYHA 1HQ4B 1K3IA 1JPSL 4ELMF 3ULVC 1VESA 3L7EA 5M94B 2ZWLT 2A9NH 4KMQA 1BZ7B 1DJSA 4YPJA 3OKOB 4ZD3H 1FYTE 4O02L 4Y0GA 4HGKC 4YDVA 2VL4A 3VXRE 3K4ZA 4EI6B 3KYNA 4XX1E 5HVHC 5DUBB 4EVNA 3H42H 4XXCC 3QH3A 4EXKA 3AXLB 1TVDA 3G9VA 4JG0H 4WUUA 1IC5H 4CBPA 1DVFC 4JM2B 4DQOL 1P4LA 5IMMB 3EOTH 5I1IH 4P59L 1YNTA 2GW5A 4ZS7L 4W68A 1VKXB 3HPJB 3L3OB 5EO0A 3UTPE 1FVCB 1JMZA 4Z7WA 4ONGH 3KPQA 1ZHNB 1BQUA 5H37H 3WFDH 2OBGA 4OM1H 3FQRA 4ZPTB 5JORA 1JJUA 1JUFA 1HHIB 3KYAA 2FO1A 3JV6A 1L6ZA 4AMKH 2FJGA 1LK2A 5DQDL 1AQDB 2EXWC 3HPLB 4W81A 1RJLB 3K8LA 5SX5K 1P84J 1T1YA 5D72L 5TE7H 3UCRA 1YY8B 2NW2B 3MRCB 1WQVT 5ISZE 1AO7A 3OKKB 2Y7QA 2CDFB 4YHPA 3ZE1E 2NTFA 5HJ3B 2PTTB 1V3JA 4FZ8H 1KB9K 1NBQA 3ILQC 5BO1H 3W39B 2UZIL 1YMHA 5INDB 1E6OH 2WQRA 3U46A 3IJYA 4MQTB 1NJ9A 1CU4H 4YAQA 4OFVA 3BZFB 5T1KA 3C2AH 1OW0C 1YUHB 2GY7B 1BFVH 1KJ2L 2A38A 1MPAH 3VDAA 1DQLH 1PBYA 2CRMA 3B5GA 1WBZA 4X7SL 5E9DA 4AJ0A 1REIA 3AC0A 5EOQL 1OLZA 4FXKB 5D5ME 3O11A 4UOW1 3VRLF 1B2WH 4QOKB 3QUYC 1BQHA 5BOZG 4KHXH 2QHRL 1FNSL 4G6KL 2BXZA 3PWUA 3A6BH 3KPSA 3T3MF 4HCRA 3TBVB 1EH9A 2IEPA 5E4EB 1X5KA 2BZDA 5HYQB 4UI2A 3QXVA 3LRSA 3PWLB 3ARBA 2HFTA 1NC4D 3VGGA 5ADPL 3C5ZA 2GYSA 1A1MA 5F3HB 2YKLH 1FZJB 1N3NB 1FRGL 4UMGA 4OZFB 3PIQB 4ISVA 4TVPL 4KK6D 1PDKA 1A5FH 2Q87A 4YUEH 2VQ1B 3W0WE 3JWNC 1YEDB 5J12C 2I27N 1HILB 1ZAGA 3FT4A 4Y16C 5DSCA 1NUGA 3NN8A 4JHWL 2RJMA 3O3EB 5EULV 1R0AH 4HC1H 3E1F1 3VD4A 2Q3AA 4K3HA 3O9WC 4LLVB 4OKVB 2R0WL 25C8H 4PG9A 4R96A 2XG5A 5EU4A 3LEXA 1RSFA 4KUCF 4U1HB 5D7JB 5F9OL 3BGFC 3FAXA 2O5YH 1FL3B 2HFGL 4QHNB 3FMGH 3IDJB 4NKMA 3DVIA 4H5SA 2RBLA 4AENA 5MERB 4HD9A 3TLRA 1J1PH 3T77B 1MI5A 3DX8A 4Z7WF 1PKQA 4OT1H 1N6QH 4PB9H 4IRSD 1INEL 2Z31C 5E1HB 2HKHH 4XMPH 5GGQL 3U4AA 4BM7A 4U1SB 2KKQA 3FT3B 3LQZA 3WNPA 1KF9B 3RVXC 4M62H 3MV11 2C4FT 2O61B 1IGFL 1TLKA 1IGTA 3QNZA 1AKJB 1R3KB 3QPQC 5I1EH 1JGDA 4WI6A 2BDNL 1I9RL 5I74C 1IAIL 1AY1L 1Q9LB 3N0PB 1JGEB 5TDPA 2Z4QA 5GGVL 3PV6A 3IDGA 1N7MH 2ILLA 4V1DA 4WY7H 4DGIL 2VUOA 3D0LA 3AB0B 1D9KC 5HY9A 3VGBA 2DM7A 2EIZB 5IMKB 1U92A 3ULUH 3UDWC 3UTTD 3KYMB 5HGDB 5I75B 5IHLB 4ZTOL 4XZUB 5DJYB 2GJ6B 3EBAA 4FN0A 4TRPH 5ETUB 4K23L 3SGJA 3PP4L 4Z95H 3SGKC 5ID0B 5GGTA 2Y1VA 3TO4B 4LGRB 4NWTH 4OLVL 4TVPD 1IGYB 4OLWL 1VFUA 2VAAA 3NFNB 1GCFA 5EG6C 4JQIL 3SY0A 3MCLH 4V1DE 1D5BA 4LOUC 4YH6A 5ALCL 1A6AA 3V6OC 3KDMB 5J6GB 2R1XA 5DFTA 5CP7B 3CPLA 4JO2H 5F1NA 4YE4L 4CW1A 2H2PC 1DCLA 2GAZB 4WU7B 4K2UL 5F6HI 2NY3B 4ETQB 3GMNB 4PB0H 4E0RA 7CGTA 2CDGA 4PJ8C 1BBDH 4XCYB 2OR8A 5D7KD 5KANG 2AJYH 3O4LA 3SN6N 5ISZB 1KT2B 1HNFA 4QRPA 1NMBL 4L4VE 1OB1B 2ADIA 5JHLH 1LE9B 1MF2H 3NPZB 4HLZG 5L7XH 1EO5A 5EBMA 2WBJC 3FN9A 5IB4A 3RGHA 2A6IB 4XP6H 2L0DA 4U1LA 1FDLL 5GGSB 2FWOB 5BRZB 4RAVB 3MYZA 5KVGH 4I0PC 4YIQA 1MVUA 5SWSB 4CADB 2R29L 2KBGA 3O4LE 5KN5A 4QRPE 5EIVA 2Y72A 3REVA 3DLQR 5FB8B 1YC8A 1F13A 1IRAY 2EE3A 2VZOA 2CJUH 4JPVH 4BH7B 5LCVH 3QFJA 2XICA 2F5BL 3GMRA 3BWAB 1EX0A 4MXQD 4MAYA 4ZQKA 3ZZ1A 1YEEH 4FNLH 4ZUWB 5JLZB 5C7XH 1IT9L 2PXYD 3EDJA 3LS5L 4KY1L 4XPFH 5D1ZB 2BHUA 4D0DA 2VN4A 1JPTL 1LE5B 3LN4A 1KXVC 2DRUA 3VXQB 3VJ6A 4BSWA 4ORGA 2R8SH 3DV6A 1GJIA 5HHPB 3I6KA 1K6QH 2Z9TA 3FO2A 4WW2A 1D5ZA 4WV1B 3PJSB 4LK4A 5L8LB 1ZGLB 1J05B 4OCWH 5ACZA 3UYOD 1Y6KR 1AD9A 3C6LC 2Q7YA 4LEXL 3U6RB 3QIUC 3RGVA 2UVFA 1LNUA 2YMXL 4FTVE 2JK5B 3U0TA 3BN9C 1J0YA 1JF6A 4FQXB 3BPNC 5D2LB 3SDDD 3MXVL 1EFXD 3QT2A 4OZHE 4H25B 2DLFL 4IRJD 3EYQD 3CU7A 1TTUA 3ZTJG 5CEZL 4PRDB 3EGSB 2HN7A 4LSRH 5FO8A 3M45A 4XAWL 3DI3B 4NUGL 3SJVA 5CJ5A 1Q72H 4KKNA 3S36H 3MLRH 1T21B 5J1SC 3WS6C 3X3GL 5BQ7A 4XCCL 5CJQH 2DQCL 1HOCB 3LOWA 3B9KC 5B39G 3RWGA 3BEWA 2B4CH 3DROB 3F8UB 3QCUL 1Q1JH 4JB9H 1D5MB 1CG9A 4KDWA 1FC1A 2FNBA 2F15A 1TQCB 5DD1L 1VGKA 3GSVA 5HYIA 4YR6B 3S5LB 4TPRL 1W0WB 5C0AE 4RFEA 1GC1H 4W6XB 1UZ6F 1R3IL 2GI7A 3L1OH 1RQ5A 4JKPH 3RX8A 1TJGH 4DW2H 1X9QA 4D9QD 5EIIA 3WIHA 4HWBH 4NZUH 3C5SA 5F1KC 1MFNA 4G6FD 3GRWH 4B7LA 2DF3A 2GSGA 1LMKA 1C08A 1E28A 4ZTPL 4J7RA 2BMKB 4UT9H 4LASL 1C1EH 1OARH 2BNQD 4XVSL 4KKAD 3BWUC 2PW2A 4OI8A 5C86A 5HVWA 4LEOA 4ODSL 2D03L 2APFA 3WD5L 1U3HA 4HUNB 1GOGA 2JJTC 3VWKB 3DETD 4PS4L 5FA3B 3GBNH 2K7PA 4KAQH 3OB0K 2JLLA 4JCMA 4M1DH 3VFRA 1CFSB 3VFUB 43C9A 3KXFE 2HLAB 3QDGA 2DN7A 4F8QA 5CEXB 3GHEH 1UKTA 4MZ2A 4X0KB 2BSRA 4PREA 5C0CA 2L7JA 3F12B 5CEZD 4GT7A 1GGTA 4M6NH 1A7PL 4A6YL 1R5WB 4APQD 3CDYA 1ZS8B 4DJMA 4Z8FH 4R4BA 2HRPH 4FABL 4OJFL 4YXHH 1MREH 1PJ9A 1A1NB 5I1DA 2P8MB 3CZFA 3DUUB 3U9UA 4WW2F 2I9TA 1QR1B 1YEJH 5EA0H 5F7LB 5BZDA 2VXUH 4X99B 2I25N 1J0KA 4NSKA 1A6WH 4OZGB 4RGOL 5E70A 5IT2L 1KTDB 4L8SB 1TZIA 1ADQL 3QUZC 1EUTA 4KRPC 1VPOH 3QRGL 5I30H 3BZ4B 3CXDL 4WGWB 1T5XA 4L1HA 3GJEB 4TUJA 1RZKC 1KELH 2V2XB 1MRCH 5BV7H 1GHFH 2SEBA 4HHAB 4GAFB 4EI5D 3CFKA 1QRND 1IC7L 5I71C 4PY7A 2P8LB 5SWZA 3WDHA 5IMOA 1CE6B 4KDTC 1MEXL 5L8JB 2X41A 2B1HH 1U2CA 2GFBB 5B3NA 4CVXA 4Y4KA 1KCSL 4WWKC 2FGZA 2BY3A 2OL3L 4JO4L 1E27A 1NBZB 3RWEA 2A0LD 3VXUB 1I8KA 3FB8A 5IB2B 4Z7NE 2F8XC 5DRXA 3GIZH 1ZVYA 3F7YA 3KLAB 3MCKB 4AT6A 2AJ3B 2R4SL 2ZKHL 1AP2A 1NGQL 4I18A 2VABA 1SEBB 3C6SA 1AQKL 1XZ0B 3DTXB 2ZJSL 4J6RL 5HYJB 4LCIL 1NDMA 1RJYA 1YJDC 1CR9H 3FFDB 2H2SD 1AHWB 4FTVB 1I8LA 5BJTB 3S8WA 1S9YB 4ZAKA 4EN3D 1LHZA 4DK6A 1DQJA 2ITCB 2BFVL 3QHFH 1F58H 4TYUA 1QRKA 2NY1C 3U7WL 1DANT 1U6AH 4U0QB 2D7OA 3BH9B 12E8L 5L88H 4L9LC 1BZQK 4PGDB 5GS1B 3GEWB 3J8F7 1S9WB 2FL5A 3ULVH 2IQAA 4PJ7A 1LO4L 1NC4A 3UMTA 3IGAB 3EAKA 3MROA 3KJ4C 2X4PA 2AXFA 2DDQL 2UUDK 2WUBH 4R3SA 3TNMA 1HI6B 3VW3L 1ZT1B 5IQ9A 4D0CA 5JDSB 1G1YA 4HIJA 3D48R 4KRLB 4NHUB 4XMLH 5HDOA 1DQQA 4NCDA 5GJTH 1JHTB 1N6VA 4OGXL 1CBVH 4PJFA 5L2KA 2BSED 4OSUL 3GIVB 1AGEB 3V9FA 4DN3L 1MCKA 4XB7A 3IRZA 4PJ7E 4U1MA 1W0YT 3EJZC 3MRDA 1FAIH 3V4VH 5K9JH 1TPXB 1YYLH 5F88B 5C0AB 1ZHLA 4X6CA 2FRGP 3IJSA 2GITA 3GHBL 1A6UL 1RZIB 4PGZA 1E6JH 2LABA 2YHGA 3QEHB 1JZ6A 2B5IB 4U7SA 2QKIB 4H20H 3P4NA 5I66B 1FLTX 4Q6YA 4MZ3A 3RVWC 1ZXQA 3I2CL 4CMMB 1EXUB 4WTZA 5FF6B 5TDOA 1M71B 4HT1H 1IARB 4U1IB 3MRGA 1HCVA 3BKML 4LSDA 1C8PA 3R06A 2VZSA 3HNSL 2RCSL 3U4BH 2AW2A 1N6UA 3LKOA 4Z7NF 3L7FA 1KJ2A 2Q76A 5K9OA 1EHLL 3F7PC 1FHGA 2OTUA 1II4E 1F4YL 3O8XD 4JY6A 4BSVA 4JGUA 4P3CL 4F7CB 5HGAA 4NPYB 3BDYH 4YC2C 4GG6E 4YHYC 4N8VB 2VXSL 2CIKA 1IVLA 5ANME 2A6KB 4ZUVA 3LZFH 5D6CB 1TXKA 1UWGL 1SYVA 3ZKQD 5KAQG 4JO3H 3DGCR 3KPNA 3TBSA 3VXNB 3PNWA 4Q6IB 5C9JA 3O6ML 3C60A 1KPUA 1P6AB 4M5ZL 2B0SH 5CS7A 4P5TC 2PYFA 3OBAA 5C0EA 3R1GH 4ODWB 2NY2D 1BM3H 5FHAL 4NNPH 3HAEG 4HF5H 4LL9A 3OAZH 1S7VA 3UTTE 2VTFA 5C3TA 4MGXA 1T83C 4I3RH 2OCFD 3TH3T 3TJHD 2Y07H 2F8VA 1CLOL 4XBEL 3LDBC 4TVPE 4P5MB 3T0AA 4NBZB 2F53D 4PJ7F 4PJCE 5JHDD 1T7WA 4JPWL 3WLBB 4D9LL 1QYGH 3Q3GB 4JPIA 1A6ZB 1G6VK 3D39B 5K59F 4LARH 3DURB 5I1JH 3ZE0F 4XPHH 1KCUH 2XY2A 1AD0B 2EZ0D 1RHHA 1G7MB 1QSFA 2YPLD 4AK1A 2ZUVA 4R8WH 4PJFF 3QDJB 2NYYD 4DOHE 5D7KE 1XF5A 3OAUL 1MQ8A 3BISA 3K74B 3F65A 5ITBL 5EZOH 3KNBA 3G5VB 1U91B 4OCYL 3WN5C 4X6CF 1NDGA 3FB6B 1JPGB 3TN0D 5EZJA 3TZVA 5JTWA 1SEQH 5F7NC 5TH2A 4GRLB 1Q9KA 5I1LA 2IFFH 5KTEL 3V5HB 2BVQB 3GJFB 4HK3N 2PXYA 2EO1A 3VFMB 5I76B 4MCYA 4QY8B 2QADC 4WTXA 7FABL 2Y9RT 1BREA 1DTUA 1KGCD 5DR5H 3MRLA 4PV8A 2AQ2A 4UTBL 2FJHB 4IOIB 4XNZC 1HH6A 2AJSL 4MDJB 3ZKSD 4JFZL 2C3GA 5DEGA 2EDOA 2X1WL 2R56H 1GGYA 4RRPA 3MRPB 3VFWA 4MCZB 4P2OC 5HYEA 3HI1A 5D7LD 1A1OA 4FG6D 5I8CA 4NZDA 4Q9BA 5I2IB 3DSNA 3M17A 4S1QL 5KSBE 3SDDA 3KPOB 4OFYD 4YHOH 2IG2H 3BPLB 1FNGA 3P9MB 4HIEB 5CIPH 4FFYH 1MFEH 2AABH 1PFCA 3I6GB 5DJ2B 3QIBA 3TYGH 4KK9C 4BQCA 2Z91B 3DVNB 3QUML 1RIUH 3WIIH 3WFBH 2P44B 4LCWB 4Y5XA 3P3YA 2F54D 2R2EB 1LP9B 1GIGH 3NFSL 4HBCL 3WIFB 5I1GL 1CXLA 3BQUB 4NHCL 1Z9OA 4Z9KB 4FQ1L 4S1DC 3UBXA 1PX3A 1WBYB 3STZB 3IETB 3WFEH 1A8JH 3CSGA 5AZ2H 1ZGLM 2YD9A 4R2GD 2Z8SA 5AZEH 2R0KH 3HZMB 4URTB 5D1XC 1HHJB 1ROWA 2BSTB 2GSIB 4UBDD 3MNVB 5FM5M 4X80L 1Z5LB 4PV9B 5E2WH 3VGHA 4UILH 4XWGL 3BX7C 5MP6H 5JPMB 3UYRL 2VXTH 3IDUA 3TV3H 5TE4H 1QOKA 3ESVF 1T3FB 4UTAL 5DMYA 4GG6B 1TDQA 4RQQA 2AK1L 4S2SA 4WFHD 3MRJA 3CD4A 4GLRI 5F6IC 4BZ1L 1FFQA 3MACH 1WCQA 1H3PL 3QQNA 3VE0B 4F9PA 3EZ8A 3VXTB 2ZSVB 1MY7A 5K93A 1L4IA 1S7XA 1U93B 5FDYA 4Y8AA 3RVUC 3KPRA 5F7HA 3JWOC 2E9WA 4D3CH 2MSPA 2VLKD 4J23A 1DEEA 4LKXB 2VC2H 1P1ZA 4K3EL 1WITA 5I15H 1QA9A 3HCVA 3DUSA 4N90D 4QHUA 2E9JA 3RWDB 1UVQA 2Z35B 1UJ3C 2VLJA 3BKCH 4D9QE 3B9VA 1TVHA 5J6HA 1H5BC 2CRYA 2BOCA 1NGYA 5TFSL 2MQCA 4RGMB 4L4TD 2HLFD 1A7BA 1B6DA 4QWWC 5MEQA 2BNQE 4W6WB 4EQ2A 3B2UD 3O6LH 1I1YA 2X1PA 4APQA 1AR2A 5E6IC 4NO0A 4R4FL 5ERWA 3D2UB 1S7QB 1NCCL 4PJCB 1T20A 4BFGA 2E5EA 3SKJH 1K4DA 1PG7W 1CDIA 3MBEB 1B0WA 4K9EC 1MHEA 1TJHL 4MNQD 2JKXA 3X13B 5HI4D 1IKNC 4KV5E 4O51A 1J8HD 1MCDA 1MQKH 4LCCB 1IC4H 4U6VL 2NY4D 1EGJH 4OV5A 5CEZE 4TSCL 4JFQA 3LMJL 3DO7A 4LMQI 5E2TH 35C8H 2IBGA 2Q8AH 3HI5L 1XIWC 3WMSA 4DOHB 1P6FA 4U1GC 1F4XL 3IDMB 3VI3E 3WXWH 2DIAA 2CPCA 3ZYOA 5IFHH 1JZ2A 2X2YA 1DLHA 2IBBA 4MVBC 5E8EB 4NQDB 2KZ1B 4HXAH 3SE8L 2FIRT 1QRNA 1WBXA 5I17A 1W0VB 4JAMA 3TO2A 1JF1A 4OB5L 4Z7UE 2PCPB 3B2VL 4UV7L 2W65B 4ZOCA 4HG4J 4JQVC 3SDCA 1VGEL 2MFNA 4O2FB 3WS3A 5EN2A 4YDIH 4FQIH 3I9GL 1QR4A 1IZKA 5ESQB 1NCDL 3KHOA 1A0QL 5FYJL 1WEJL 3MOBL 5DDHB 5FUZH 3D0VB 1QRNE 1NMCB 2IPUK 2P46B 4Z5RB 1BD2D 3DIFA 1WT5A 4MX7A 5DHVH 2PF6A 1X5FA 2XPGA 3VXMA 1MFDH 4IBLT 4GBXC 3V7MA 4L29B 3ARXA 2P42B 4U2YA 3LCYA 2C1PB 2VE6A 4OBSA 1NEUA 2VISA 1U3YA 5JDJA 3QEQB 3AAZA 4G80B 5IVNA 3VFOB 1EFQA 5KSBB 3IU4L 4YHIA 4XCEB 1EMTH 5I1KH 1P7QD 1FVEA 3BMVA 3DARA 1UB6A 4A6YA 1G7QA 1MHPL 3E6FA 5C07B 3O2WH 4JFXA 3SQOH 5IFJB 1YEIL 3C8KB 5DA0B 3BYTA 5DJZB 1S5IH 4FZEL 5C08D 1MCWM 4LRIA 2DQUL 2IQ9H 4PBXA 4HJJL 4OCXL 3GB7B 1IEBB 4GMTL 4P3WA 4YDLB 4WI2A 2AXJA 3CH1A 5IJKA 3O2DH 3BP5A 4PUBL 3MMEA 4FQHA 4AL8H 1X7QA 4FFVC 5FKAB 2ZPKH 3CX2A 1OOAA 4WGVB 1KIPB 1EFXB 1JI2A 1J11A 4PRHA 5DUMH 3SO3B 15C8H 1OGAD 3ARDD 4RISL 5IB3A 5MEND 1OTTD 5JOFB 3DSFH 4KV5F 1QLFA 4P4KD 2HT3C 1TMCB 2A9MH 1UXSB 3MUY1 2CGRL 2RGSA 1MWAL 4XMKL 5E2UH 3SBWC 1XR9B 3MGAA 4U3HA 3D3VA 3FQWB 5B8CB 3RZCA 4PLJD 1I8IB 2XRAH 3RDTD 5ENWA 3DYPA 1X44A 5TQ0H 4I2XE 3VI3F 2XTJC 3V4PH 5JIPA 5L2JB 1CF8L 1QKZH 2NNAB 1AGFA 2WSKA 4HWNA 4YHKL 3KYOA 1G7IB 1J10A 2WBKA 2CIIA 4LVNB 2FATL 4YHLH 5FYJD 5C1MB 1NAMB 4GKNA 4DZBA 3X11A 5BOPA 5CINL 3L3KB 3HE6C 1RZKH 3SKMB 1H0DA 4TULH 1UM4L 4MSWA 1LO3L 3HUJE 4MXWH 5JXEC 3EDDA 1FE8L 1P4IH 3KPLB 5IMLA 3I3BA 1CL7H 1KUMA 1N0XL 3LS4H 3DOSA 4ODTL 4R97C 1DSFH 1ZTXH 3LKRB 2K1MA 5HI3C 1ZLVH 3NACL 5GZNC 3IFOA 4MS8D 2EIBA 4GUPB 4G6FB 1YNLL 1NKRA 3MLUH 3O8XA 1BQLL 5E5MB 1WCBA 4ZFZA 4KVNL 1IM9A 2ZUXA 4JGJA 2BNQB 3RU8H 1JGLL 1JZ5A 2XA3A 1BVLB 4GFTB 3WUWB 1A4KB 4P2RD 1U58B 1YEKL 1DBBL 1MCIA 2VZTA 2X40A 3S88H 4KK5C 2HWZL 3VCLA 3HZKB 1GZQB 3WE6A 3GSNH 3H8NA 5EOTB 4NM4H 3IKCA 2IPKB 4I77L 3ZL4L 3VGAB 4MLIA 4GW4A 1CGWA 4AEHH 4CDHA 4PRIA 2CXGA 3U79A 4KUZH 1UH3A 4N0CD 4RMUA 1E4XI 4PJHA 5D9SA 4G6JL 2UWEE 6CGTA 3CUPB 5T5NG 1LK3L 3PDOB 4YXKH 1NCNA 4R7DA 3IF1B 3JXAA 4EIGB 3P9LB 1KPVB 3SE3C 2CSPA 3KPMA 4M1GH 1U2HA 4HWBA 4OF7A 5DFVC 1FJ1B 3GRWA 4F80A 1U8MB 1FV1A 3U7YH 1PEZA 2M1KA 2D7MA 5FGBA 4U3XA 5I18H 5CBAB 4OZFG 1SBSL 3D9AL 4KH2A 1MH5B 3W9EA 1GZPA 3MV01 4Y19B 1MCPH 1U3ZA 3THML 3PL6D 1CE1H 1SJHA 5HHNA 2CQVA 4JM4H 3KJ6H 4EI5B 5ITFB 1LDSA 2OZ4H 5HPOA 3LQAL 5J56B 3BZEA 1JBJA 2X6MA 3TJEL 4QXUH 1XR8A 1KB9J 3EFFB 2F53E 5JHDE 4ERSL 2VLLB 3QUXD 1S9KC 3O3DB 1NQBA 2COQA 1JMXA 1HDMA 2CK2A 3N85L 2R69L 4MD0B 1NUNB 3TBTB 1JRHL 1T4KA 4EUPA 3NGBB 1P4BL 3MRQB 4PPTA 4E5XA 2V7NA 2BC4A 1U8HA 4DVBA 3FQUA 5KSAD 5KG9A 1AC0A 2DQFB 2X09A 1CXEA 4XXDB 3RTQB 4PLKC 2W92A 3BPOB 2WV3A 2YPLE 4JFYA 5J9PA 3OGCB 3CFCL 3H9SD 3W5MA 3ROOB 3BH8B 1N4XL 3R8QA 4N8PA 1WWWX 5JW4M 3MNWB 1J9CT 4G8GB 2R0LH 4J3TA 3IDXH 1GVIA 1I1AD 1LDPH 1F2XK 4NNYA 3VRJA 3MO1B 1M1SA 1FG2B 1U8KA 5E1AB 2VYRE 5D7LA 2DBLH 1DP0A 4OQTH 3N9GL 1C5DA 1KGCE 3FO1A 4RMQA 5DWUH 2WWMC 3OJDB 1N8ZA 3OWEA 3O81A 5JMOC 2ICEB 3ZKMC 1MFAL 3GSXB 1MHHB 2WM0A 4I2XB 5GGUA 1OAXL 4PTTB 2HVJA 4DAGL 4QEGA 4ZFOL 3WL9B 3P73A 3UAJD 2FBOJ 2F54A 5FFLA 4TSBL 1X5AA 2H32B 5D7LE 4LRNH 3H9YA 4G8EB 2A9NL 4ZXBC 5F70A 5D71H 2AQ3A 1U8PB 3RAJL 4PJHF 4KI5C 2OK0H 2P48B 5FM5O 1RIVL 2Y36H 4OLZL 3IU3A 1PEWA 2I07B 4JRWA 4LBEA 3QQ9D 5FCUL 1MUJB 4XRCA 3H42L 5DT1H 2ZNWA 4Y5YA 3L5JA 1L9MA 2NY5L 2OL3B 2LE9A 4JG0L 1KNOA 2XWJA 1RUKH 2YRLA 5CJ8A 1I4FB 2F54E 5C6WH 1TZHA 4HX1B 3T4YA 4MQ7A 4NFBA 5BXFB 2NMSA 4J4PC 1QVOA 4UT7H 1FL5A 3GKWL 4G6AC 4J1UA 1D5IH 3O6KH 3QI9D 4XWOC 4YDVB 2P24B 4OM1L 1YECH 2MJWA 4CKVX 1RZGA 1IGJA 3K2MC 2ZOLA 5DK3A 1RULL 4LSSL 1U8JB 5HHMD 1QPPA 4QNPF 5TF1L 4XXCA 4ODBD 2VLKA 3MV7B 32C2B 3HFMH 5ICXA 1NCAH 1QLRA 1U95B 5E4EC 3LV3B 4NQEA 3GK8H 2LQRA 4IRZH 5INCB 3VG9B 1SBBA 4JZJC 4WFHE 4RIRA 3IJHB 3MLYL 5DK2B 2CLRA 1DDHA 4LLYB 4L4TA 3IDIB 3HRZA 3NIGE 3CFJA 5EFIB 4UNUA 4GQPH 4QHLB 4U6XB 1NLDH 5KSUA 3OKLA 4PP2A 1RHFA 4GW1B 3QUMA 4N9GA 5EB9A 2VLKE 2WIMA 4PRBB 2VZ3A 2AXHA 3O45A 3I02B 3S34L 5DO2D 1H9VA 4N90E 1U42A 1U9KA 5FGSA 2VXVH 5T3ZH 3O6FB 2I9LA 1P7HL 5FV2A 4J8RA 3S35X 4MNQA 3PGCA 4XPAH 4OD3H 1WVZA 5D7JC 4BFIB 4L4TE 3ULSA 3HE7C 1J8HA 4JFOA 1IGIH 1RZFH 4U6YB 1MPAL 1DQLL 3UJIH 1KJ3H 3BP4A 1CLYH 4JRYA 1FPTL 2E3VA 4WWKD 2F53B 3HB3C 1I1RA 5JUEH 5A2JH 4Z7VE 2CUHA 4N9OB 2BSSA 2J5LB 3P0VH 4MNQE 4KTYA 4D2NA 3BO8B 1NCUA 4JO1H 2GT9A 3SPVB 3IXTA 1J8HE 4JREB 2QQNH 4XAKD 1F97A 4MNGA 5T1KB 3PHQA 3REWA 4C56D 5C92A 2W0FB 5DHXB 4GSDH 4FMFA 3MRRB 4ZNEE 1OW0A 3QEGH 2BJMH 3MYJA 5LBSL 1UYWH 5F7UA 1WBZB 1J0IA 1UM6L 2Y25A 1YY9C 3AB0C 1F90L 1IBGH 3ARRA 4HC1L 5FYKH 3TCLB 1BD2A 5MHSD 1YQ2A 1NC2D 1FGNH 25C8L 2P5ED 3MSPA 4MJ2A 3S5LG 1KB5L 5AWNH 1MSPA 3LRSB 3BXNA 2X42A 3WCYA 1KJVA 3TO4C 2ENYA 4RWYL 5E8DL 3QAZB 3LKSB 3FMGL 1PAMA 3ULVF 3AMKA 3NCEB 3MRNA 4F57H 2QQLH 3TF7C 2YUWA 4ISVB 4LAQH 1RFDL 3QYCA 5B3JE 3ZDYF 4LLQA 1BD2E 1S78C 2E8YA 4AQOA 2NR6C 5DSCB 2JB5H 1UXWB 2AEWA 3JWOH 4K3JH 4Y16A 3WNNA 1XF4B 3L5XL 3FFCB 4LPWA 4XMPL 1AGCA 3T0WA 2DQGL 3O9WA 1IAIM 3K4AA 3CFEA 1LEIA 3LEXB 1BOGB 1IQDA 4M5YH 4KJQD 4M6OL 5JQ6H 3PWNA 3UZEA 4O9HH 1OGAA 4K8RH 1IAOB 4UQ2B 2VDKL 3JV0A 3SDAD 5DUPH 5E24E 5I1HH 4LDEB 4P4KA 4ZFFA 3NH7L 4NFDA 5C08E 4WY7L 5HDLA 3LD8C 1O7VA 4XC3L 5DJCB 3FN0L 5IG7A 4XP4L 5CJXC 1K85A 3A67H 4GJTB 4G9FA 3ULUL 1K2DB 2YN5A 1W72B 2A1WL 3HLAB 2ADFH 4KHTH 2YXFA 1HXMA 2D7NA 2MHAB 4K9EH 5IHUH 2GTZB 5IR1A 4NRXA 2Z31A 4Y1AD 5C0RH 2H9GA 2ZUUA 2JCCE 2GK0A 1OGAE 1EEYB 2FGWH 2YK1L 3KWWB 5E08L 5MENE 4R2GB 2OQJB 4ODUA 2PYEA 3RWHB 5IEKA 4EDWH 5L6YH 4X4YB 1RK0A 1MCJA 2B8OT 2GKIA 2GCYA 1KIQB 5C0BD 1V3KA 3NTCH 2LU4A 3KLDA 1T6WA 3PV6B 3QWQB 3SO5A 1S5HA 3OKEB 3RVVD 1S7WA 5D1ZC 4L4JA 5HY9B 2QQQA 3L5WA 4QTIH 4TUKH 1J1OH 4Z7QF 2M2DA 3T0ED 3V0WH 1OTUD 1WSST 3ZDZE 8FABB 5CIPA 3UDWA 3T2NH 5J1TC 2V6HA 3EYUH 5J1AA 5DJDA 3WKMH 5J57B 5FYJE 1FH5H 5DYOA 3D18A 1UCBH 3SGKA 5HHOA 3OV6A 5CUSH 4Z7OF 4PJ9D 4MA8H 3ELAT 5F7KC 3RL2A 1DQML 5FO7B 4U33A 4HGWB 4YGVB 1F4WL 4GAJH 4K7FA 5CD5D 4D0BA 4XHJC 3V6OA 3MV9E 4FQXC 4H1LH 4XP6L 5GRJL 4N68A 3ARBC 3ZTNH 1HN1A 4KRMB 4N5UA 3LEVH 5KVGL 3C5ZC 4BELD 4E0RB 4JJ5A 5DRWA 1KCVL 3SDYH 3T2OA 4W4OC 2EDFA 1BX2A 4XGZB 4PJ8A 4F2MB 1KYOK 2RB8A 3VGFA 5JR1L 4P2RE 4JN1H 2J88H 3KVQA 4LPYA 5D93B 4GAYA 3VXPB 5EU5B 2ZG3A 1JNNL 4ZSOA 1F6AB 5EBMB 1CGSL 4QRQA 3ULUD 1P5UA 2WBJA 4XPFL 1EK3A 3GSWB 4YEEA 4U1LB 5H35B 4GMSH 5E5UB 3K4DA 1G9EA 4L8BB 2FH8A 4HQQL 4DK3A 3MJ7B 1F4HA 2DLHA 2CUMA 1RAMA 1RJZA 4HUXB 4I0PA 1HHKA 2A73A 4KFZC 4M43L 1AR1C 1TQCC 2NY0D 2NY4B 1K6QL 4M48H 4EBQH 1A47A 1AXSB 4NT6B 2IADB 4M8QB 1ZSDB 4XPTH 3REVB 5GRUH 3TIDB 2YSSA 5CGTA 3UTQA 3MOAH 3W11D 3RJQB 3AY4C 4HEPG 1WTGT 5CHNA 4RMTA 3NABH 4KKLD 1RU9H 2DJ4A 2XN9A 2I24N 4ZQKB 3NCYP 1ED3A 3NAAH 5FUOL 1MRDH 1QBBA 3DVGB 2FX9H 1JHLH 4G7VL 4NYLA 4BSWB 1EHXA 2VMFA 5CJBA 3AS2A 1WIPA 2CXKA 2X4TA 4WW2B 3P11L 1QLEH 2D9CA 5KSAA 1Q72L 1RUPL 1YN7A 3CVHH 4QTHA 1Y0LA 4ZO9A 1WAAA 2BCKA 2OJEA 3C6LA 4G9DB 4HFUH 1G0YR 2FR4A 3QIUA 3HR6A 1WIOA 3G6JA 2XIDA 4JR9H 3R0NA 5IUSA 3G5YA 5HYFA 2FJFB 4IIQB 4P23B 1BIIA 4ZFGL 3KS0J 3Q6GH 5E03A 3QA3B 4WJ5A 1ZA3B 4RAHA 2Q86B 1PZUB 2JIXA 2LVCA 2R2BA 4PRPD 3H3KA 5EBGA 3LB6C 5IHBA 5EWIH 1MAMH 1DL7H 4NKDB 4PRNB 5C08B 3H9SE 5C6TL 4TOYH 4JKPL 2C7UA 2XA8L 4JZNB 4N8VG 4CVUA 4JFED 4Y2DD 5BQ7B 1JGVL 3WS6A 5CJOL 4LKCA 4YFLI 3S35L 1EZVX 4NGHH 2V17H 3K1KC 2HFFB 5D2NB 3WHE0 5BVJB 5AUMA 2JCCB 1M7DB 2IALA 2V2WB 3Q1SH 3UC0H 2E7HA 5MENB 3BE1H 5F7FA 3E2HB 1FFOB 4YZFE 5EC1B 1UADC 5DLMH 3BPCA 2J8UE 2DM2A 4RCAA 4RFEB 4Q7DA 2YUVA 4WRLA 4Y5VB 5DI8A 3RDTB 1KENH 5IVXE 5EIIB 3T1WA 4L5FL 1WF5A 2QEJA 2GSGB 4J3VA 4KRNA 3SGDI 1C08B 1HXYB 3B8YA 2O26U 4YBHA 1U8LA 4GW5A 3GBMH 3B6SA 1ND0A 1IKFL 1DQTA 2HMID 4G7YL 3QXDA 4NO2B 4HS8H 4M61B 1TTGA 2HKFH 5EA0L 4OF8A 1AGBB 1U3HB 1AHWC 2VXUL 3DX9A 2DQTH 2QQKL 3VD5A 2JJTA 3DMMB 1NFDA 4OLXH 1QUNA 2QSCH 1A4JA 4MA7L 3MV9B 3WO3B 5KW9H 4HV8B 3U0WH 1OF2B 5I30L 3LSOA 1Z9LA 1CICB 1F8TL 4Z77B 4CDGC 4YO0B 3PQYD 5B38G 5AYQA 1MIMH 1S7UB 1KELL 5C0CB 3MLXH 3TPUA 1KBGH 5GS1C 1GHFL 1JNLL 2XZAH 1QFWH 4ZO6A 3TFKC 3U30B 4QHKJ 4R4BB 2VDML 3VFGH 4EJ1C 1I3GL 3RGVC 3VU2A 4A2MA 2CKBL 1NFDE 2ZNXA 1EAJA 5DJXA 5BS0A 3O3BB 3I75B 3L3HA 1IEHA 3CFDB 1CD1B 4UU9B 3FQTA 1ZHKB 1DE4B 1WAAF 2W0KA 5HHME 1KN4H 4OBRA 4XVUC 3SCMC 4MJ6A 3RWIB 5C0IA 3G6JF 3V8OA 3VI4F 1INQB 1T5XB 4X6EA 4LF3B 1JYNA 2KPNA 1BLNA 4DGVL 3KYKH 4WFED 5HGBA 1K8IA 5DF0A 1TPXC 4TQEL 3QDMD 2YUXA 1MWAB 3R0MA 5C09D 3CFKB 1OY3B 1WC7A 2B5IC 5TPWH 5SWZB 3UO1H 2Q3ZA 1Q9WB 4KQ4L 4CVXB 3IXAB 3EUUA 1JFQH 3ISWA 4WWKA 4UINL 3QHFL 1XGUA 1E27B 4C54A 1RMFH 2VZVA 4OGAC 3SE4C 5L88L 5DRXB 3RL1B 1K4CA 5TDNA 3QJHB 3HS0A 2G75B 2ESVB 3C6SB 5C2BL 4L8CA 3X3FL 2DQIH 3PL6B 4RGNB 2ADJA 3FKUS 3N1MC 4OFKA 4PJBE 1C12A 4LVEA 1HNGA 4PRAB 2CLZA 3O3AB 2WUBL 1CT8B 4PJXA 3GUTB 3DX7B 3FB5A 4Y7MA 4JFFA 4OAWA 2XNAA 3QUXB 4R26L 1D6EB 5CEYA 4XMLL 3QNYB 4XCNB 1EBAA 4XC1L 2VR4A 3H9HA 4M7ZB 1CBVL 4AIZA 4CMHC 2P5EA 4XAKE 3MNZA 5B39A 1LEGA 2RR3A 4L9LA 3ZKXB 1YYLL 2FL5B 4C56E 3KR3H 2IQAB 1HEZB 4PJAE 1AIFA 1C5BL 4PJDE 3EO0B 5E8NB 3MCG1 3H9SB 1E6JL 1KTKE 5FO9B 4AG4H 3SDXA 1ZGLP 4XBPA 1MCHA 2LTQB 1MFCL 1I1FA 1JK8A 1NFDF 1UB5A 4D0CB 5IQ9B 2R1YA 4MHHI 5FGRA 1BZ9B 4HKZB 2G5BB 3HI6H 5MHSE 5DMIH 5GRVK 1HHHA 1DQQB 2O93L 1BEYH 2P5EE 1I1AB 4LLMA 3MGTB 1JHKH 5L2KB 2VDNH 1QHOA 3JSSA 2AK4D 4GKSB 4ALAH 4IDJL 2OZ4A 3V6ZB 4G43A 5L0QC 1J8KA 3QP3A 4JFDB 3VA2C 1HSBB 1KCRH 3F5WA 5FECB 1FGVH 1K9TA 1ZT4A 4Z0BL 1FZMA 2MKWA 3PHOA 3SDXE 1ZHLB 3IJSB 3OAYH 2ZSWB 3K80A 3GI8H 1X5JA 5IVXB 3P4NB 2V2TB 3HHRB 4HZAA 2B7DT 2ZCKH 5B21A 4AQ1B 5J13B 1PD6A 5SX4H 5TDOB 3BKYL 1DFBH 4IMLB 4S1SH 2EKJA 5IIEA 4AEIH 4RZCA 4V2CB 1TETL 3DX6A 3U0PA 1UA6H 1OAZL 2OR9L 2X70A 1I7RA 2I60H 3QCVH 4XNQA 4UT6H 3L7FB 5C0FA 3PGDB 5J8OA 1JTTA 5HVFB 1J88A 1PSKL 2OTUB 1YMMA 1B0GA 2MWCA 3TIEB 1CZ8L 2DICA 5C8JB 3WSQH 4HF5L 5CMAB 3C9NA 4FQQA 1B88A 1KB5A 3PWPA 4Y1AE 3C08H 5D1QB 5FYLL 3LKNA 5J89A 1JPST 2Y07L 4BSJA 4P9HH 2PNDA 1IM3A 1I8LC 2QSVA 3TBSB 2IMNA 2BX5A 2VDRH 5DJ6A 1IJ9A 4HWZB 3C60B 5C0BE 1OP3K 3OR6B 4R0LB 2P7TA 1HZHH 1NGPH 4H0IA 2ORBL 3MA7A 4XCFL 1J1XH 4PJXF 3HTLX 1XGTB 2FO4B 4P2QD 4LARL 1TCMA 3T0EE 5GSRB 4F7PB 5L9DH 4R7NA 4ODVL 2C9AA 3C87A 2QV2A 1T83A 2OJZH 2HJFA 2FX8H 1I3UA 4M4RA 1AJ7H 2W91A 4KK6C 2AERT 4J3UA 4GRWE 5EZOL 5GS0H 1MCSA 1QNZH 2BNRD 1CFVH 4ZDHA 1UG9A 5AYUH 1T0NB 3LRGA 1EAPA 4Q0XL 4ZFOB 1N59B 4NN7C 3NA9H 2UYLB 4QXTB 1SEQL 3MLVL 3OR7B 1X4YA 2IFFL 3EOBA 4JPIB 3SDXF 4F37F 5ACLA 1NCBH 2CMRH 4YFEA 5IHZA 5SX4I 2GEEA 5FA4A 5DR5L 1RHHB 2VIRB 3ZHLA 2W60A 5F3BB 1QSFB 3ARGD 3FOMA 2WNGA 2I5YH 3WO4B 2XKNA 4PJBB 4YWGL 4PP1D 5I73B 5GIRA 5EUOA 1G7PA 4KROD 2NLJA 1JV5B 3WJLA 1QPXA 1CDYA 3WN5A 5DEFB 5JW5B 3MLTB 5HPMA 1A3LH 5LXGH 4IRSC 2GIYA 2VERN 4LQFL 3ULUE 5EZJB 3MJ9L 1DQDH 3H3PL 5TH2B 1Q9KB 2GTWA 2ZCLH 3DGGB 1UCTA 5FYLD 3T4AA 4YHOL 1AH1A 2IG2L 3G04A 3O2VL 5GSVA 3TYGL 3HMXH 4CGTA 1ACYH 4DWHA 3I6LD 1UWEH 4PV8B 3BP6B 4PJAB 1QFHA 4NKOB 5C0GA 1X3DA 1RIUL 3WIIL 1I7ZB 3QO1A 2O5ZH 1F11B 4QF1A 4JM2D 1GIGL 2IAMD 1WWAX 5AEAA 3VFWB 4G8FB 2W9DL 1Z3GL 4B7IA 4GQ9H 4P2OA 1NC2B 1SJXA 2LU3A 1OP5H 1A1OB 5JPNA 4M93B 2J12B 3M17B 2YBRB 1SJEA 2R1WA 2HA1A 4WDIA 4LSVH 4MHHG 3MBXL 1ORQA 5CD3B 4JANA 2HG5A 4PBVC 4RSVA 4K71C 4Q9QH 1NCWH 4F7TA 3RPIA 2XG4A 4UILL 4PRPA 5BZWA 2BRRH 5GRXG 1ONQB 5ILTL 4Y5XB 3SOBH 5TE4L 1CLCA 1T66D 4GRWF 5C6PB 3H6JA 1G7LA 3WUWG 4Y2DA 4HCRH 2EXYD 1IC1A 1F00I 4MQXD 1LVEA 3MLZH 5F8QC 4RDQG 4XP5L 5JOPD 1CN4A 1CIUA 4PRPE 1XCQA 3E8UL 2BERA 3JZ7A 3T65B 3CXHK 1PLGL 2VC2L 4NP4H 1K5NA 2X4QB 5J06A 5FK9B 4WNQA 3RP1A 4RAUA 3OHXA 4JFEE 3T08A 4E9LA 1ZANL 1U8QA 5IWLA 1LO2L 4TTDD 4NRZA 4OCSL 4X5XB 5C9KA 5F96L 4S2SB 5I1CH 1PGRB 4Y1AB 2B20A 3N06B 5AD0A 3CC5A 4IHOB 5MEOB 3A6OA 2X4NB 4DVRH 3HRPA 3O6LL 4KVCH 2D7TL 5CSZB 1CGVA 3CVIH 2IFGA 1NMCC 3GMLA 1OL0A 3ES6A 3ARSA 3NIDF 1DBKL 5C0BB 3V4UH 5GS2D 1DEEB 4MXQC 1S8DB 2E27H 2L7UA 2PXYC 2V7HA 5EUOF 1IQWH 2BVPB 2FX7L 3B3IB 1UJ3A 1AE6H 3QNXA 4HKBA 1MQKL 4HK3J 2Y06H 3RNQA 2Z92A 3TWCH 5J6HB 4U1JA 4XH2B 1EGJL 2BOCB 1NGYB 1ZWIA 1EHNA 3T0EB 2X1QA 1H5BA 2VXQH 5E2TL 5F9WB 5IBUB 2NPLX 4GH7B 1SY6A 2IPTH 3WXWL 2EDDA 1QEWA 4PG2C 5IF0B 5CWSA 5IFHL 5M95B 1I1YB 1WFUA 1ETZA 3T04D 4BH8B 5E6IA 4MYWB 3UJJH 4I48B 3IDYC 3CNKA 3BUTA 5F93C 1MHEB 3L3IA 4LLUB 5EDXA 3SDDC 3VA6A 2EKSA 4HMCA 3ARED 1WZ1H 3OX8A 1T1WA 3SO3C 3PQYE 3QQ4B 2VDLL 5CCKH 4IRJC 1MNUL 3EYQC 4NQCD 4PJ5A 2DTSA 2CLVA 1MLCB 4HPYH 1T5WB 3DO7B 4HS6A 5MI0C 3ROLA 4ODHL 5FUZL 1XIWA 4HIXL 3U36B 5B8CC 1IEAA 2ADGA 1N0LA 3ALPA 3OZ9L 1L7TL 3W9DB 1DLHB 1C5CH 1EZVY 1MFDL 1WBXB 3HG1A 1CFTA 3OTTA 1QACA 2WZPD 1FZKA 1OSPL 4GG8A 5IQ7H 1JF1B 1LILA 3MRFA 4LHQB 4LVNC 2FECI 2PR4H 3LEYL 4J3WA 3VWJB 1JTOA 1NL0H 3SDCB 1UACL 3L3GA 1EMTL 4JQVA 4YNYA 5TJWK 3L3DA 5IEHA 1AKJD 2MOVA 4JGMA 1VEPA 4UOJA 4I0KA 1FBIL 1GGBH 2NXZB 2NY0B 5E94A 5F44A 4WFEE 4FP8H 1GGUA 3O2WL 5F1IA 4NQXA 3QDME 2ZUTA 1S5IL 2IQ9L 4U0RB 5C09E 4PLNC 4NKIH 1PZ5B 3ZSTA 2A77L 3O2DL 2PW1B 5FGCE 1JWMA 3TVMB 4AL8L 5ALBH 3QCTH 4ZUTA 4GBXA 5IVOA 2GJ6D 5KJRL 1IGCH 1R24B 3UPRA 3CK0H 5DUML 4F9PC 4NQTA 4C55A 2AVGA 3AAZB 5KAQF 15C8L 4NZTH 1RZ8A 2H8PA 3CMOL 3HZVA 4NM8L 4KKAC 3MV8A 1FVEB 2GUOB 2PN5A 4N1CA 5CZVH 1M6OB 1EJOH 4CN4A 3E6FB 1YYML 5IFAL 5BW7C 1W8OA 2P49B 2W1NA 4XBGA 2CKBA 2Z8WC 3DETC 3RWFB 4IDLA 5T5FH 2RFXA 3VXSA 1H3WM 3CCHA 3HZYB 1WGOA 3QEUA 4U49A 2J8OA 4P46B 4DEPC 2NY3D 4QT5B 5I1AB 5IBLD 3F7RA 1FIGH 3BP5B 4XPBH 3H7BA 2FDBP 1JTPA 4PD4J 4P4RB 2YD2A 4X9HA 4ZYKA 2A83A 1R5IB 1MJ7L 1JE6A 3QO0A 3TBWB 3F7VA 3UJTL 2EDTA 4K7PH 1H3UA 4PRHB 3G5ZB 4APQC 1N5AB 2APVA 4Q74A 5IB3B 3ZYZA 5A16A 4NQVA 4QO1A 2A74A 1NSNL 2VQUA 1ORSA 4NFCA 2AK4A 4X9FA 4MXWL 2A6DA 3CIQA 1RIHH 1HWHB 1P4IL 1V05A 5HDBE 3OG6B 4FXGB 4K55A 4C83B 3SBWA 1CL7L 3RZCB 3LS4L 3QZWB 1DSFL 5BRZD 1HHGB 1XCTA 5I8EA 1QZ1A 5EORL 4JFEB 2IGFL 3HNTH 5KVDH 3GNMH 4FQLH 5SWSD 5IOPB 4LHUD 5T1LA 3MLUL 1SM3L 1A7NH 1YN6A 5IGXL 1OPGL 2CIIB 4LNRA 5D8JH 4QRSB 2VDOH 1EDQA 5E8PA 4G6ML 4YXLH 3DV4A 2AK4E 4EI5C 1JZ4A 3HE6A 1V5JA 3GI9L 1CI5A 5TQ2H 3QG7H 1RD6A 4NM4L 2ED7A 1BQSA 4XNUL 3KLHD 3QISA 2YD6A 4AEHL 1LO0L 2A0LC 3NGBC 4KUZL 3LHPH 1JGUH 2C3HA 1FO0A 1R5VA 2ATKB 3OF6A 5F7DB 2YPKA 1NGZB 1MFBH 1SYSB 3RTQC 4OZIE 3BPOC 1IM9B 4LVOB 4S0SD 3ZYIA 4L8DB 4OZ4B 1PG7X 4PTUA 3ARFD 5IESH 5EZIH 4M1GL 2H2SC 4WW1B 6FABH 4EN3C 3GMPA 4NZRH 3U7YL 4NOFA 1MCOH 2MPAL 1GGCH 4LLAA 2VWEE 5I18L 2IH3A 4KZEH 3PQYB 4Y4HD 5D9SB 3W81A 3R4DA 5I8KL 5IJVB 3EO9L 3L9RA 1YEFH 3ZT7A 1MCPL 4F33A 3KJ6L 1RUAH 2G9HA 1FNAA 5SV4A 4KMLB 4RFOL 3SE3A 1FLRL 1OD9A 3KPMB 4KZDH 4RA3A 1D6VH 4OCRH 4E42B 1T2JA 2X4UA 4FQ2H 1MJUL 4NO5A 5CZKA 3QG6A 4EDXA 2EO9A 5HGHB 4P0DA 3QJFA 4BFEA 1NKOA 2OSLA 2VH5L 1G6RH 1WISA 4P2YA 5GJSH 1BPVA 3NBNA 4P2QE 4XTRD 3DBXA 4QHMB 4CN6A 2YEZA 3LIZL 1AGDB 5ELIA 3W9EB 1EO8L 1BFSA 1GZPB 3D5OF 4OF6A 3SKOA 3QDMB 5FCSH 2XZCL 1AI1L 3D6GA 3HNVH 4QCIA 4BZ2H 4RBPK 4F9LA 2FYYA 4HIHA 4JCLA 4YK4B 1S3KH 2BNRE 3TH2T 4X6DE 2PO6D 2QR0B 3QIWD 3N1FC 1MJJB 2XWBA 4DKEH 5EBWB 1HDMB 1MAJA 3IDXL 2B1AH 5DA4A 3JTSB 2HT2D 2BK8A 1BOYA 2EDBA 3FZUD 1BGXH 1U8HB 3A6CH 3FQUB 4PJIE 1BZ7A 4OQTL 3OKOA 5J11B 3VWKD 2E7LC 2APWA 4JFYB 5DWUL 1KEMH 1UJTA 4EI6A 5I16B 3PG2A 1HIMH 4NWUL 5F89B 4PGBB 1CS6A 1JPFB 1I7UB 5E4IA 2H45A 5EPMA 1QBLH 3O8XC 2E6QA 5ESAB 3X12B 4LRNL 5BV7B 1GH7A 5E8OA 1JPSH 5FYLE 3PWJB 3QDHA 3OAYK 1U8KB 1RUMH 4D8PB 1VKXA 3HPJA 1EVUA 3VH8A 2Y36L 4QRRA 1FVCA 2LAAA 4P3DB 4O02H 5IBTH 3OPZH 1GPOH 3I6LE 2J7LA 4Y89A 4YQXL 1RUQH 2VDPL 1ZHNA 5E99L 5DT1L 4H26A 1G7HA 1GAFH 4AIXA 1C7TA 1BAFL 1XF3B 4RX4D 4MJIB 4GS7B 3BMWA 2HVJB 1A6VL 1VFBA 2NY2C 1A22B 2J1KA 4N0UE 1YPZE 5AG9A 2QL1A 1IAKB 4DQOH 1AQDA 3HPLA 4UUJB 1QSED 4ZUSB 4P59H 4ZXBA 5C70A 4MA3B 1Q0YL 2XV6B 1D5IL 3O6KL 3TJHC 1YY8A 4ZS7H 3TA3B 2NW2A 3MRCA 1ZOXA 4U3CA 1OAUL 5A3ID 3IU3B 2CDFA 5CLTA 1EA9C 5HJ3A 5JIHA 5FGBC 2PTTA 4WUKH 2BOBA 3W39A 3VXUD 1MCBA 1T1ZB 1TITA