3U9PL

Crystal structure of murine siderocalin in complex with an fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
DILMTQSPLSLSASLGDKVTITCQASQIIYNYIAWYQQKPGKAPRLLIRYTSTLESGTPSRFSGSGSGRDYSFSISNVESEDIASYYCLQYDNLPYMFGAGTKLELKRADAAPTVSIFPPSSEQLATGGASVVCFVNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKVDYERHNLYTCEVVHKTSSSPVVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 212
sequence length 212
chains with identical sequence M
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pL01
1A0QH 3BHBA 3OXRB 1T5XA 2W9EH 4JDVA 4KH2A 1J18A 3GM0A 4OLWH 3V4VH 4KUCF 5DRNB 3MGOA 4TSBL 1INDH 4WTZA 3KYNA 4Y4KA 4M48H 3HMXH 4DOHE 5MENE 4PFEA 1MFEH 3QCTH 1J0HA 3ARPA 1KJVB 4NJAH 3U6RA 2P8PB 1FDLH 2EDHA 3LAFA 5C0BD 3FZUC 1BVLB 2APVA 3EO0A 3IKKA 4NKOA 4D94A 1IC1A 3BHBB 1T5XB 4JDVB 2J8UA 3V7MA 5ISZE 3MGOB 2VDRH 3KYNB 3LSOA 1WCBA 1M05A 3PP3H 4W70A 4J3UA 1QSFA 3MQIA 1TQBB 2X4NA 3U6RB 3H7BA 4JKLA 5D1XD 3GJFH 4TVPD 5FUZL 3EO0B 4AEFA 3AS0A 2NY1D 4TYUA 4ZTOH 5D6CA 1DCLA 1L7IH 3LSOB 1WCBB 4KTDL 5JZ7D 3KLHC 1QSFB 3IDGA 1BGXL 4NWTH 5HVHB 4KK6D 4YJZL 4JFEE 2X4NB 1T83C 3H7BB 1T7VA 4NBXB 5HGDA 4APQC 3CDFA 4M3JA 4PB9H 5DD3L 3HFMH 2GI7A 5EU7C 5F8QC 1UKTA 4P9MH 1DQQA 3BVNA 1JPTL 5D6CB 2X41A 1II4E 5AYUH 1DP0A 3NCYS 5FM5O 5KVGH 1CGTA 4I77H 1BEYH 4JKMA 3ILPA 1U93A 4KI5E 3P0YH 4TVPH 5D7JC 1KEGL 2E8YA 3VFTA 3L3GA 3STZA 5IW1A 5MEND 1XF5A 2VJXA 3BVNB 2BSED 1L7TL 5F9AC 4LFHG 3TBYA 4C56D 4OZFG 5LVEA 3ILPB 1U93B 4FQ2H 1NPUA 5LXGH 1NC2A 1CN4A 1MAJA 5DDHA 4Z7VE 5ISZD 1M7DB 1HHKB 1YEFL 4LSSL 4F9PA 4JHBA 2H2PD 3VFTB 4X9IA 3L3GB 2A6DA 1RZJL 2C7UB 5IW1B 3STZB 4XNYL 1XF5B 3LS5L 3TBWA 3TBYB 3K1KC 1UH3A 1YJDC 3WDIA 1KSRA 1KLFA 4O2EA 1F8TL 2CRMA 3STBA 2ORBL 2VZ1A 1NC2B 2A9NL 4P0DA 5DDHB 4LPXA 4D0DA 3U83A 3Q5OA 3IXTA 1S3KH 4PJEF 2A6DB 1BREA 4NQUA 4DK3A 3TBWB 4GW4B 4RGOH 5GS2D 5DVNA 4QHLB 1DVFD 2EYTA 4S1SL 2DMCA 4O2EB 5ENWB 1OAXL 5I66A 2HVJA 4NP4L 3VFMB 4NNPL 4WTZG 4D0DB 4HKBA 4GBXD 2NXYC 3B8YA 4WI4A 3C6SA 4PJGE 3KHOA 3IXTB 4UNUA 5JUEH 4KJPD 1RUQL 4YHOH 3LQAH 2P24B 3NFNA 4Q9RL 5HYEA 5DFVD 2EYTB 4KI5D 4MD0A 3PGCA 3GB7B 4ZD3L 4NZRL 5IM7A 4LIQL 1OTSD 1PAMA 25C8H 4HKBB 4WCYL 4C54A 4QGTA 4B50A 4J3WA 2R0WL 4JO1H 2WK2A 5KS9F 3VI4E 3TIEA 2BXZA 3T4YA 2Z91B 5IMOA 3NFNB 3QJHA 4S1QH 1KBGL 5F93C 2MQ3A 2V5SA 2AK4A 2NR6C 4MD0B 3PGCB 1GGIL 5IM7B 3PL6C 2Q1EA 1MRDH 1XEDA 5CJQL 2F8VA 1PZ5A 1HILA 4H1LA 4OUUA 3SCMA 3TIEB 2YKLL 3T4YB 3G6DH 4A2LA 1FZKA 5E7FA 1OSZA 5IMOB 4PR5A 1ZLVK 4L9LA 4JO2H 2GSIA 1VB9A 4N0YL 5I8EA 1W0VB 5I17A 2AK4B 2DICA 5ILTH 3EO9L 4OLXL 3OPZL 4OM1L 4R97C 3WNPA 3KPPA 5CBAA 2OQJA 3ME0A 3OAYH 1IGFH 4OJFL 43C9A 3MCLL 3L1OL 5EU5A 1QBAA 2OL3L 1UQSA 5CEZH 1HILB 2JB5H 4H1LB 4OUUB 3SCMB 1QFWI 2EDEA 4LASH 1FZKB 1OSZB 4PR5B 3JWNC 4PS4H 4J12A 4L9LB 2GSIB 3B2UC 2AV1A 5I8EB 5I17B 1Q0XL 2AEWA 4GH7B 5E6ID 4UNVA 1NJ9A 3KPPB 5CBAB 2OQJB 5AZEL 4PGBB 5SWQA 3TIDA 43C9B 1MQKL 4DW2L 1CGYA 2VL4A 2VOTA 4TSCH 5DJ6A 5J1AA 3X11A 3IU3A 4KRPD 5IB5A 4MD4A 1K9TA 1OM3H 4CADB 5F7EH 4MAYC 1HIMH 2DKMA 2EE9A 3EDFA 1YECL 2AV1B 2ZSWB 5DUBA 1X5KA 3K80A 4PJ9B 2X2YA 5TDNA 1ONQA 1NJ9B 5JQ6L 3NABH 1AD0A 3MRMA 4IOFC 4XAWH 4Z7UE 3WO4C 4DTGH 5SWQB 3TIDB 2HRPL 5E2VL 5F70A 4XXCA 5FYJE 3X11B 5J1AB 3IU3B 5A3ID 4OZIE 1I8MB 5IB5B 4MD4B 4PJAE 5F3HA 4OCNC 3FOLA 5DUBB 2D9CA 5TDNB 5IB1A 1NCCL 1FNHA 4AJ0A 4MQ7A 1AD0B 3MRMB 5HI5C 1A02N 3AGVA 2VDKH 4U7KA 1OP9A 1WICA 4XNXL 5L88L 1I8IB 1SYVA 5F3HB 2J4WL 4QTHA 2IG2H 4K23H 3FOLB 2BHUA 4ZXBD 1F4YL 5IB1B 1MSPA 4TN9A 1G7QA 1A6VH 4MQ7B 5JHLL 4XC1H 1KNOB 2OR9L 4KK9C 1JL8A 3N1FC 4TUKH 2OK0H 1X5AA 4QTHB 3LPGA 1IJ9A 1JGVL 4OF3A 1YEDA 4JZJC 5E95B 2IQ9L 4R90H 3TJHD 1G7QB 3MRKA 4JZNA 1C5BH 4R4FL 4UAOB 1A5FL 1QG3A 1MRCL 1NANI 4EN3A 4L3EE 2AJSL 3SKMB 4JM4L 1CBVL 4PRHA 4P99A 5A2FA 4EI5C 4ZYKA 1Y18A 1H15B 1U8LA 5GGTA 4TUJA 4H1LG 3GDBA 1YNKH 3MRKB 4JZNB 5FYJD 3VH8G 1BQLH 4JG1H 3UZVB 3VGFA 4EN3B 2BDNH 4FFVC 4U1GC 2CKBL 3SO3C 4I18A 1KXQE 1CVRA 1TETH 4PRHB 3H3PL 4ODTH 2DS4A 4ODSH 2XG4A 5INCA 1X5HA 1Y18B 4PJHF 1U8LB 5JOEA 4TUJB 2FH6A 2VLJE 4I9WE 12E8H 1MREH 1X5FA 3QEGL 2I25N 1FLRL 1HKLH 4FZEH 1HK6A 4OZGA 4LSPH 1JTOA 2XTLA 4I18B 2XKUA 5CD5D 4KPHL 2QJDA 3SGDI 4KDVA 4IRSD 3MRNA 3OKMA 5INCB 2VXUL 2R2CA 5FYJH 1IAKA 2Q87A 2D4DA 4KFZC 2F54E 1CGWA 5DJ2A 2VISA 1S5IL 4GFTB 1FRGL 5DRZA 3CSPA 1QRKA 4UOW0 4OZGB 1NGWA 1H9VA 3C8KA 3RGVD 3L5WA 2W9DL 5DFTA 1NGYB 4F33A 3QCVH 4YAQA 2ZOLA 1LE9A 1TZIA 2F19H 2ITCA 3H9SE 3MRNB 3OKMB 15C8L 4X9FA 2X42A 3HG1E 1IAKB 1TPXC 3QPQD 4L3ED 1YC7A 5KSAA 3N85H 2OMBA 4MHHG 1I7UA 5DJ2B 2VISB 4FXKB 2Z0BA 5DRZB 3G5ZA 3U46B 5C0CA 3HNVL 3QIWD 2X89D 1NGWB 2V17L 4HGWA 3C8KB 3L5WB 4EQ2A 5C0RL 4F33B 5IWLA 2DQCH 5IG7A 1AGFB 2VH5L 4YAQB 1CE6A 2ZOLB 4LDEB 1LE9B 2ITCB 2XYCA 3KR3H 4Y5YA 1UEYA 2BERA 5KSAB 4YHIA 1I7UB 4YBQD 2O5ZL 5FV2A 3G5ZB 3T65B 3WKML 4YE4L 5C0CB 4WGVB 4TQEH 4M7KL 1W2KT 3W9DB 4HGWB 2FJHA 1MFDL 5TF1H 3B9VA 5IG7B 4NCDA 1CE6B 4HULB 5BW7C 5KJRL 4I9WD 1Y6KR 1OARH 2OR7A 4TTDC 2Z93A 4Y5YB 4Y5XC 4NPYA 3GSOA 1MFAH 3DMMA 3RY5A 1ZHNA 1FC2D 4IIQB 4JCLA 2D2OA 2FJHB 3C09C 2MMXA 2EDRA 1IEBB 1LEGB 2DQTH 1MQ8A 3MOBL 4YHML 1MI5A 4NWUL 1P7QA 3TNMA 4WWKA 4NPYB 3GSOB 3X3GH 3C08L 1S5HA 4QRSB 3DMMB 2IC2A 4XVSL 2VERN 5GJTL 3TN0D 2F53A 1ZGLA 3H9SD 2JIXA 2LAGB 1T5WB 4FS0A 3UJJL 4EUPA 3GIZL 3U4BH 2OZ4A 5BV7L 3HG1D 3FOMA 1X44A 1MI5B 4YXHH 5DD1L 1P7QB 3CX5K 4R26L 4WWKB 3TNMB 3O3BB 4Q6IA 1S5HB 3I6LE 3N06B 3NPSB 3HZVA 3BE1L 5K93A 5CZXC 1OCWL 3TBTA 5IJKC 2KPNA 1IGML 1ZGLB 3MLUH 4EUPB 3NZHL 3FOMB 3BUTA 4NUJA 4LCWA 4POZD 5D7LA 4Q6IB 2FHBA 3SKJL 4DFIA 3HZVB 2BFVH 1CS6A 4AENA 1CLOH 4KJYB 5C6TH 3RJQB 4LSTL 5GRWA 3TBTB 1HYRC 4YHPA 3RHWF 3I2CL 1CGSH 2R8SL 1NFDA 4A6YL 3NACL 2R9HD 1WCQA 1NEUA 5FYKU 4LCWB 3BP4B 3EHBD 2KUTA 4Y16B 5FUCC 3CX2A 4GKNA 4OLUH 2IPKA 4JDTH 3JZ7A 2VXSH 4PJIF 3QDJE 4G6KL 3J7HA 4KHTH 1T66D 4YHPB 1BQUA 3KJ6L 5MEPA 4HH8A 4LGSB 4M6AA 1J05A 2DDQH 2EDWA 1NFDB 5D1ZA 3L3HA 3ULUF 2DQJH 4P23C 3O6LL 3ORJA 4PREA 4PUBL 1IVLA 4CN4A 1F5WA 1FO0L 4LLVA 4LSQL 1WZ1L 4YWGH 4KAQL 2A38A 2HTLD 2DI9A 5MEQA 3MRQA 2IPKB 3RWJA 1CG9A 2GJJA 2BCKA 5D7IF 1BOGA 1MVUB 1ADQL 5CILH 4KGJA 1MFBH 1G7JA 3ARGD 1WFOA 1J05B 1F4WL 5D1ZB 3L3HB 2BJMH 4PREB 3QHTC 3AREA 3I6LD 1IGIL 4HUUA 2I5YL 4LLVB 3LMJL 3BAEL 3CUPA 1U91A 4JHZA 3MRQB 3RWJB 1CG9B 1FAKT 2BCKB 4ENED 4EUPH 2OZ4H 1BOGB 2ADIA 2R69H 2VXVH 3T0WA 3QIUA 1G7JB 1X6LA 5CGTA 2FBJH 2C3WA 2JJSA 3MLXL 3MYJA 3GI9H 3ARFC 1R3IL 3UPRA 3AREB 4RBPH 3QP3A 3CUPB 1U91B 2WAHA 2ED8A 4OT1H 5I0ZA 1CDGA 3MBEC 2ADIB 3T3MF 4YXKL 1HINL 3QIUB 2HG5A 2AJYH 2I60L 3I02A 4LVOC 4KQ3L 1RURH 4DGVH 3MYJB 4R4ND 4HJ0C 3QPXH 3UPRB 3WJJA 5JW4M 3MSPA 3QDJD 3QI9C 4TNVF 1OSPH 2PW1A 3KYOA 1N8ZA 5IFHH 4NN6B 4BM7A 3MROA 4KXZI 2YD9A 4GW5A 2CR6A 2HG5B 4JGJA 1UZ8A 3LN5A 3JTTA 3ES6A 2WWMD 4ODBD 5EORH 3V6BR 3EAKA 3VU2A 5BMFL 1IC7H 5CEXB 2CXGA 5DJZA 3CJJA 2PW1B 3KYOB 1N8ZB 3L3OA 4HWUA 3KS0J 3MROB 2F15A 3BD5A 4ONFL 2DOCA 4FABL 4GW5B 4NQEA 1GC1H 3RIAK 2X9YA 1UZ8B 3LN5B 3Q2CA 3ES6B 2PO6A 3BKYH 4HT1H 4NRZA 4LLDA 4LNVA 1QYGH 1FVEB 1QFUH 4QTIH 5DJZB 4N0CD 3RWDA 5KZCD 3L3OB 4Q6YA 1J88A 1NSNH 2QQKL 1W8OA 3S35X 4S1RL 1T89A 3DECA 4Z76A 4NQEB 2KZ1B 4MQXC 2PW2A 2AXGA 4I3RL 2DI8A 5C0AD 3U1SL 2RB8A 3FN9A 4XGZA 3V7AE 2I24N 3QDHA 4NRZB 4LLDB 1M4KA 4WHCA 1XF3A 1C7SA 5JIHA 3RWDB 4QWWD 5B8CA 5BZWA 3FL7A 3QUYA 4JHWH 4Z76B 4QHMA 1FH5L 3LPFA 1SY6H 2XQYG 1RV6X 4RWYH 2PW2B 3NVQA 1E4JA 1IM9A 5D70L 2AXGB 1TJHH 4XGZB 1FBIL 1UA6H 4FQXA 4MHHI 4YPGA 3PWJA 4OSUL 1XF3B 4K8RD 1AXTH 5B8CB 5BZWB 4D9QE 1BMGA 3VXNA 3QUYB 3JWOC 4QHMB 3TYGH 3HC4H 3BEWA 3ZL4L 3WFEH 5F44A 3MJGX 4DN4H 3DRQA 1IM9B 2E27L 4RFOH 2AJ3A 3AB0C 5EC1A 2J6EA 5I1IH 4YPGB 1I4FA 4OF6A 1JPSL 1YEEL 1QR4A 4JFDA 1PZUB 2LABA 2ATPA 1X4XA 3VGEA 4PJ5A 3U2SA 3VXNB 2CO6B 3F6IA 3P11L 3BEWB 2P48B 4HXAL 4YGAB 3B9KD 3DRQB 1DSFL 3CVHL 2V5RA 3ILQD 3EZ8A 2AJ3B 2QHRL 5GGRY 1JYXA 5EC1B 1A6AA 1E6OL 1ZHBA 5FCUL 5GRZA 1I4FB 2BY3A 1YEGL 1OGAA 5BXFA 4GXUN 2B0SH 4JFDB 1OW0A 1GSMA 2ATPB 4IRZL 4TULL 4WUUE 4BFGA 5DC4B 4PJ5B 3U2SB 4G5ZH 4RMSA 2ZCHL 4PJ8C 3E1F1 4I5BA 5DXWA 4ZFOL 4X7SH 2X44D 1K8DA 4YO0B 4ZNEA 2JELL 4S10A 3VWJD 2BY0A 3DGGA 4RX4D 1A7RH 1T0MB 2OJZH 1A6AB 2ZJSL 1HZHH 1AP2A 1CU4H 1MPAH 3KYKH 4TTGA 2V9TA 4D3CH 1K5NA 5HHNA 4XVTL 2K7PA 2DLEA 2VC2L 3K4AA 5A2JH 4MA8H 3HLAA 3SGEI 4I5BB 5D71H 2ZCKL 2WLZA 2A77H 4DUWA 1K8DB 1RUAH 5BVPH 1DBMH 3TO4C 3MLVL 2FX8L 3CXDH 3DGGB 3S88H 1AP2B 1T80A 2PXYB 4D9QD 3QT2A 3IAPA 2QQNH 1KN4L 4XMPH 5C6PB 5EH1A 5BS0E 4R96B 1K5NB 1F4XL 3GHEL 3VRJA 3ZKQD 2JCCF 4JKPH 5I2IA 5JXAH 5KN5B 3MGAA 1J87A 1A0QL 3V4VL 2W9EL 4OLWL 5E94A 4TSAH 4WU5A 4OGAD 1EIBA 1INDL 4M48L 3HMXL 1PGRB 1HCFX 5HDQH 2AV7A 1MFEL 3QCTL 2FX9H 1E4KA 3RVVC 3OV6A 4L29A 1JZ8A 1LO5A 2CKNA 5T1LD 4HWEH 5J0BA 2GY5A 3VRJB 3J8F7 2YPLE 3EJYC 5I2IB 4ZNCD 4MDIA 1T0NA 1F3JB 2NY3B 4MNGA 5E94B 1YYMH 2X05A 2J6EH 1QACA 3Q48A 4OLYH 4PJEA 2VDRL 4N1HB 2DLIA 1UWEH 1CD8A 2G2RA 3WLBA 2AV7B 4YDKH 2LFGA 1DUYA 4WUUD 4L29B 1LO5B 2LTQB 4S0SD 2CUIA 5C3TA 3O9WA 3JTSA 5L8JB 2GQHA 4MDIB 1T0NB 3SKOA 3BT2L 1EVUA 4WIQA 4MNGB 5F7LB 1CFVH 3VMPA 2VDQL 4ZTOL 4PJEB 5FGBA 1NLBH 3WIHH 3GBMH 5FYKE 4I2XE 5F9JA 2FLRT 1WWAX 3RAJH 3T0AA 4M61B 2G2RB 3WLBB 4L8BA 4NWTL 4WVRA 3F12A 1DUYB 3GBLA 3VFOA 3BWAA 5I1GH 3L6FA 3VD3A 4RWHA 3JTSB 2F8OA 4PB9L 4HJGA 4K94H 1CFSA 4P59H 1D5MA 3SKOB 3DX9A 4BH8A 2EC9U 1AD9A 3QA3A 4P9ML 4XWGH 5KS9A 3O4OC 5AYUL 3QIBC 5KVGL 5F9JB 5JIIA 4LSDA 1BEYL 2YHGA 3UPAA 4L8BB 2ENYA 5BS0D 3F12B 1PKOA 3P0YL 3VG9C 3TFKC 4TVPL 3S7GA 3K2UH 4UQ3A 1J5OL 4HJGB 1D5MB 4BH8B 3DX9B 4X99A 4KJQD 1AD9B 3UAJC 1AKJA 1KC5H 1N0XL 1MWAL 5DRWA 4JFYA 2DJSA 3C6LC 5GPRA 4IJ3C 5FYLE 1ZLUH 4BFEA 2YPLD 2YD5A 5LXGL 1YMME 1G0XA 5F9DC 3EYQD 3IFLH 3VXMD 4NQDA 4P4KB 4UQ3B 2VLLB 4U0RB 4O4YH 4X99B 4U2YA 1AKJB 4PIRF 4DK6A 2L7JA 1FFQA 5DRWB 5IEHA 4JFYB 4LDLB 5F71A 1IKNA 5HI3C 2DN7A 3S35H 4MMXC 2NQCA 2DJ4A 4J2XA 4NQDB 1P5VA 1S3KL 3FTGA 4LSUL 5FYKD 3LKSA 3MOAL 5I74B 1Z2KA 4ZDHA 1Q9LB 4ISVA 2VWEC 1MHPH 4RGOL 1TQBC 4DUXA 5IEHB 1X4YA 3IFNL 2XICA 3M8OH 1KJ3H 3O3UN 5DSCA 1U3YA 4H26A 2KDGA 1RIUH 1NUFA 3ARVA 3RNKA 2AJUH 5I16A 4K2UH 3QSKB 4XWOC 3FTGB 3MJ8A 3LKSB 4NQVA 1X5ZA 4JPVH 4ZDHB 4YHOL 5HVHC 3LQAL 4YK4B 1Z0MA 4L3CA 5ALCH 3O2VH 3R1GH 2IAMD 2DQIH 2D03H 3E3QE 2GHWB 5IBLD 3UJIH 3MYZA 4F2MA 5C70A 4MSWA 5EPMB 4G6JH 4M7LH 2IQAA 1OHQA 3WIIH 3RNKB 1ZEAH 1C16A 5LJYH 4XPBL 3MJ8B 4NQVB 4L3CB 5FYLD 5DWUH 1YMMD 3G6JE 3QDGA 5ABDE 1T1YB 4F2MB 3FQXA 4MSWB 4HWBL 3QDAA 2IQAB 4CW1A 1PG7X 1D9KC 5DVKA 1C16B 1HHIA 4JRYA 5GZND 5C92A 1BQHA 1KCSH 1HOCA 2CXKA 3ZZ1A 3VMNA 2ESVA 5IW6A 1A6TA 2FBOJ 4BSJA 3QDGB 4Z6AT 3L3DB 4I3SL 3FQXB 3GKWH 1RK0A 5HDBE 1RHHA 5DO2C 4CW1B 1IGFL 2DL2A 2WBJA 4U05A 1FFPA 1MFCH 1QFWM 1S78C 2W38A 5BOZG 5CEZL 1HHIB 2Y9RT 1N0LA 2PTVA 1BQHB 3HHRB 1HOCB 3SN6N 4KVNH 4PS4L 4JHAH 2ESVB 5IW6B 1A6TB 4XNZB 3TT3L 4JAMB 3MODH 3HNSH 1EAJA 4F9PC 1RK0B 3LEVH 5GGUA 1RHHB 3GK8H 1EHLH 1N6QH 3T0EA 4GRWF 2WBJB 4WV1A 1FFPB 1GAFH 5DJYA 4TSCL 3TYFA 4HF5L 2EIDA 4NQCE 2XZQH 4G7YL 4NZDA 1OM3L 5F7EL 1HIML 3QG7H 3GMOA 3T2NH 3D3VE 3OKNA 1R5WA 2OMNA 3I9GH 2XZZA 5IUSA 3NABL 5GGUB 1S7XA 4PJHA 4XAWL 3X14A 4PG9A 4DTGL 1DBKH 5F7DA 2RCSH 3T0EB 4WV1B 5DJYB 4P2RE 3TYFB 4QCIA 3ARYA 3WDHA 4F7PA 4OLZH 5DI8A 1FC1A 1CD9B 4HK3J 4UB0L 4W4OC 5EUOF 5KOMC 1JRHH 1R5WB 5DFWH 4N8PA 4G8EA 3RL1A 3GO1H 2WZPD 1S7XB 4LHJB 4PJHB 4QHUB 4PG9B 5E2TH 5F7DB 3X14B 4ELMF 3UTQA 1TFHA 4P3CH 5I9QB 1CGUA 4QCIB 2AEPH 4F7PB 5DI8B 1CLCA 4M1CC 2IG2L 5GISH 1MJJA 1P4IH 3QUZD 1IKFH 2HLFC 1CFNA 3D0VB 4CDHA 1D5ZA 1A6VL 5C08E 1M7IA 4JFEA 1R24A 1H3VA 1PFCA 2EH7H 4XC1L 5DA4A 4QT5A 2H26A 3UTQB 1DBBH 3U7WL 1RVFH 2CH8A 2QSVA 4TUKL 4Z7WA 2VL5A 2OK0L 2W0PA 1OAUH 4HEME 4NIKB 1CICA 1MJJB 3VW3H 4Y8DC 4FQQB 4XP4L 1CFNB 1ZOXA 3SY0A 2ICCA 1RY7B 4R90L 5DK0A 4YHYB 3WMSA 1D5ZB 4NT6A 3SCMC 1M7IB 4JFEB 1R24B 3A6BH 3CNKA 4NQCD 3D6GA 4QT5B 2H26B 3V6FA 1OPGH 4L9LC 2OYPA 1ND0A 4LLUA 2Q8AH 4YQXL 1FQ9C 4Z7WB 2VL5B 1B0GA 3TF7C 5HYSA 5FO9B 2BHZA 1FNAA 1CICB 3MV8A 4PLJC 3SY0B 3VFRA 3VDCA 4QO1A 5DK0B 2YUZA 4NT6B 4P2RD 1YNKL 3BGMA 1BQHG 2R0LH 4GO6B 5IQ7H 3V6FB 4BZYA 1NDMA 4JG1L 1O7VA 1ND0B 1UENA 2BDNL 4LP4A 4LLUB 5IOPA 4BFBD 5H8DA 4PJ9C 1B0GB 4GRLD 1TETL 5MI0B 5HYSB 3MLPA 4ODTL 2BSSA 4ODSL 1AR2A 1JHKL 3LDBB 4K3JH 1RUKH 4KY1H 4PJBF 3VFRB 5LGKA 1ZT1A 1ACZA 3BGMB 12E8L 1OD9A 1MREL 2JLLA 4Z7VB 4DZBA 1KTLA 3DVGA 1NDMB 3EDDA 3HB3D 2OBGA 5FV1L 1HKLL 5IOPB 4LSPL 2DTSA 4XVUD 4ZSOA 2HFFB 5I15H 2BSSB 1OTUD 5HBBA 4IMKA 5C08D 2PNDA 3LHPL 3CPLA 1OOAA 4PTTA 4XXCC 5FYJL 1ZT1B 4MXQD 1R3KA 3QQ3A 1FSKB 1GZPA 1NFIA 4K7PL 4DZBB 1J1XH 3DVGB 4Y4FD 2AXJA 4DKFH 3RWIA 4KZDH 2Y4SA 4ZSOB 1Q94B 3BGAA 2AEIT 5CSGA 1MY5A 2F19L 4MWFA 3CPLB 1BLNB 5TQ0H 5JO5A 3UP1A 1CD1A 1IC4L 2YPVH 3RFZC 3QQ3B 1CQKA 1KPVB 2X4QA 1PD6A 4LKXA 1GZPB 1NFIB 3PDGA 4RMRA 3S5LG 2XKNA 1E4XI 1G7MA 2OR8A 1E6JH 3WFHA 3RWIB 2I07A 1RQ5A 1PQZA 4JANB 1ZA6A 5HVFB 2ZWLT 2DQCL 4UAOC 4MWFB 4N9GA 1I3VA 4LK4A 3KR3L 1HH6B 2X4QB 4M6OL 4LKXB 1KB9K 2GTWA 4J7RA 5CJ8A 3ARUA 3GUTB 3NH7H 3IDXH 1UH4A 2XKNB 2PCPA 5CGYC 1G7MB 4OFYA 3WFHB 4JO3H 4TQEL 1K8IA 2HT3C 1PQZB 1ZA6B 3D25A 2R2BA 5DEFA 5JXED 3THMH 3Q1SL 3VJ6A 3T3PE 5LGJA 4OF7A 2QHLA 4N9GB 1OARL 4EN3C 1PG7H 1RZGA 2YR3A 2QSTA 1DDHA 2E9BA 1MFAL 2GTWB 4HUMB 3P77A 3CIQA 3PWPA 4JPIA 2K1MA 2PCPB 4IOIA 3B83A 3D48R 1K8IB 5SWZA 4R8WH 2YS4A 1WISA 5D7IA 5HHOA 5E1AA 3W9EA 1A3LH 3D25B 2R2BB 2VLRD 3CAFA 2VTFA 5D8JH 2DQTL 3VJ6B 2E7HA 5LGJB 1F4AA 2NW3A 1DQLL 5D1QA 1T21A 1A64A 2IPUG 3OAZH 5CIPA 1RZGB 4I0PD 5HYSG 1DDHB 4I18C 4ZXBB 3P77B 3OJ2C 2GAZA 4JPIB 3TO2A 4LPVA 2MCPH 4IOIB 1FLTX 1F2QA 3ULVE 4QGYA 5SWZB 5D7IB 4JPKL 4JFZL 4OQTL 1TTUA 5E1AB 4P49A 3T0BA 3W9EB 3U4BL 4P2YA 1D7FA 1NBQA 3NGBB 4YXHL 3AS2A 2NW3B 5D1QB 1T21B 2G75A 1JCKA 5CIPB 5CZVH 4HIXL 4MNHA 5B3JE 4Z7UA 1JF1A 4XH2A 2GAZB 2KZWA 4WFFE 5ERWA 3TO2B 4TNWF 4UBDC 3NMEA 4HV8A 4ZOAA 2ZNXA 3CFEA 5AZ2H 2J8HA 4P5TA 2NTFA 3QXDA 1BBDH 1YY9C 3A6CH 4LU5H 1H3TA 5E56A 2R23B 1Q9WA 4UI2A 3V9FA 3FRPG 2QR0A 2G75B 1OGTA 1QQDA 4MNHB 5J7CC 4Z7UB 1JF1B 4XH2B 5ERWB 1CLOL 5MP6L 5A16B 5C6TL 1JZ4A 1AQKH 4W81A 1A7BA 4HV8B 2WW8A 3CFEB 2NX5A 1HHHA 4MD5A 4P5TB 4PP2A 4PLNC 5KSAC 1XF2A 1Q9WB 3M1BA 3V5KB 2QR0B 5E9DA 1OGTB 4LQFH 5HHME 1UXSA 4I8DA 5C07E 2VXSL 5IWLC 2O5YH 3VDBA 2X1QA 4KHTL 2XNAA 5DVLA 5DC0A 2NX5B 1HHHB 2D3VA 3C9NA 3ULUH 4Y5YC 2FL5B 4UMGA 2DDQL 3OKKA 2MOVA 4PP2B 4X6CF 5AYQA 2DQJL 3I3BA 1P2CA 3BKMH 4U6HB 5L9DH 1IILE 3M1BB 4YWGL 5FDWA 3ULVD 1UXSB 3R4DA 4IIQC 4OFDA 1AGBA 1BX2A 1WC7A 3D9AL 3WJLC 2HKFH 1T1ZA 1DLFL 1KJMA 2XNAB 3LV3B 5CILL 2BVQB 2FCBA 1DEEA 1MFBL 3KS0H 3DTXA 1RZFH 3OB8A 4M43H 5CIPH 3OKKB 2BJML 2EDJA 1P2CB 3DMMC 2X1XR 4RFNB 3SDXE 2GT9A 3BQUA 4LEOA 5I1EH 4WFFD 5FDWB 1M6OA 3DUSA 4U4BA 3CFDB 4QEGA 1INEL 4IHOB 1AGBB 3NBNA 2NYYD 1BX2B 1WC7B 3VWKA 1A8JH 1T1ZB 1AFVH 2R69L 2VXVL 1AQDA 4P3WA 3UC0H 2GW5A 3LY6A 3DTXB 4WWKC 2FBJL 3VFUA 2EZ0C 3GI9L 1LNUA 4LL9A 1N6VA 3NPSC 1J1OH 2GT9B 3BQUB 3KPSA 4LEOB 4XRCA 5E8NA 4HMEA 4Z5RA 5EO1A 3DUSB 1U8NA 2AKRB 2VLJA 4JKWA 5TGBA 5EA0H 3VWKB 4EOWH 1AGDA 1AQDB 4U2ZA 2A6KA 5FGCE 1JRHI 4ZUVA 2AJYL 1G9MC 6FABL 4N0RA 4URTB 3VFUB 4YXLL 1RURL 4XTRD 4Q6IC 5HHMD 4DGVL 1LNUB 1H8OA 4ELKA 5TE6L 3QPXL 5C07D 1IGTA 3KPSB 4XRCB 1CWVA 2ZUSA 5E8NB 5DJ8A 3FO2A 1XZ0A 1Q0YH 1NGPH 4R6UA 4UOJA 1U8NB 2VLJB 2F54A 1BBJA 1PKQA 4BUHA 5IFHL 1U8MA 5TGBB 3MPCA 3BFOA 4ZUVB 2R29L 2B20A 5T1MA 4Y16C 2C3XA 4ELKB 4J3TA 5D2LF 4CAGA 5INDA 1IGTB 4HMCA 4FN0A 1TCRA 1TIUA 5DJ8B 1IC7L 1XZ0B 4ODVH 4UINH 4G43A 2BX5A 2F54B 1BBJB 1PKQB 1MJ7H 3O3DA 4LPUA 5F7KC 4FTVE 2ADFL 2DQGL 3ZDZE 2IANE 5AG9A 5T1MB 1UZ6F 3BKYL 3GI8H 5KTEH 5INDB 3H9SB 4Y4HA 1QYGL 1TCRB 2NCMA 1QFUL 4QTIL 4G43B 2P1YA 4P4RA 4M6NH 3O3DB 1NSNL 4F7EA 3EOBA 5D1ZC 3BN3B 3DYMA 4ZOEA 3GMLA 1UH2A 1GC1C 3LS4H 3WXVH 4YHZH 1JYVA 4NC1C 5DHYA 1NGQH 1YN6A 2Z31A 3HZYB 3BP7A 5HYJA 2Y5TA 1H8NA 4I48A 4Y4HB 1V3LA 4OIIH 4MXVF 4PRDA 1UM5H 4HUNB 4KV5E 4P4RB 3S34H 4F7EB 3EOBB 1AJ7H 2ZP0T 4NOBA 4JHWL 5E24E 3GMLB 1SY6L 3AREC 3GSUA 4HS6A 4RWYL 3GGWB 3BESR 3ZE0F 4PJ7F 3VXUE 1YN6B 2E6PA 2EO9A 3VGBA 1TJHL 5J4MA 2Z31B 3BIBX 2Y5TB 3MUY1 1UA6L 4I48B 5CUSH 3QIUC 2VUYA 4PRDB 2XQYK 2XY2A 1F58H 1HHJA 4PY8I 1Q72L 2JJSC 2GSGA 1BFVL 4O5LL 4U6TA 3TYGL 5DMGC 1DBJH 3GSUB 4HS6B 3WFEL 5D2NA 2YK1H 2LU3A 4RFOL 2H32A 4U0QB 3CD4A 3KPTA 2DWDA 5JW4R 2P5WD 4NN6C 4QRQA 5I1IL 3MMEA 4WRLA 2YD4A 2IAND 1HHJB 1TITA 2GSGB 1FL6A 2F9BT 1YEIH 1QBMH 2Q8BH 2ITDA 5D2NB 2UWEF 2H32B 3G5XA 3EYVA 3LRGA 2DWDB 4BK4A 3W0WA 3HS0A 3VXRE 5JW3L 5B3NA 2VLKA 3ARGB 4QRQB 1OB1A 4V1DE 4ODHH 3MMEB 3ARZA 1UCTA 1UEMA 2B0SL 1MCIA 1F6AA 4WY7H 4G5ZL 1FL6B 2CK2A 1T03H 3AVEA 1LP9F 4XP9H 1H3UA 2WBKA 4Z7OE 4UUJB 2ITDB 4G8FA 1OAZH 2Y23A 3HR6A 4X7SL 1OF2A 4X4ZA 1G1CA 2MPAL 1FHGA 3G5XB 3EYVB 5HJ3A 3W0WB 3HS0B 2OJZL 4RRPA 2CDFA 1HZHL 1OB1B 2XZCH 1CU4L 4XNQA 1MPAL 1OP5H 2J5LB 3KYKL 1KB5A 1WITA 4L3AA 3EUUA 1F6AB 4MA8L 2OX5A 4ODWA 5D71L 3EIFA 4G8FB 5KW9H 2IH1A 4XBGA 2UUDK 1RUAL 3RIAF 1OF2B 1DBML 1QKZL 4YH6A 5FM8A 1BJ1J 3CXDL 4Q58C 2FX7H 5EO9A 1FFNA 2DWEA 3S88L 1T89C 5DUPL 5EBWA 1W72A 5HVWA 4XNQB 5GGRA 4XMPL 1KB5B 4JKPL 4P3DA 1KFAH 2AQ2A 3I3EA 1S7WA 3E8UL 1GOHA 4HQQL 4ODWB 4TSAL 2IH1B 4XBGB 5TE7H 4PJDE 1LDSA 4FP8H 3MLSH 5F1NA 3OB0H 5B8CC 3D87B 5EO9B 2DWEB 3QXTA 3FT3A 3R06A 5HDQL 2FX9L 3QUYC 5EBWB 4LRIA 1W72B 5DMKA 3TA3A 5J89A 5GGRB 1MELA 5FGRA 4HWEL 2EDYA 4YHLH 1HCVA 1U0QA 2Q3ZA 4P3DB 3U48A 2H32H 3BSZH 1AXIB 4JY6A 2FO4A 4P2OD 3VXRD 1W0YT 4OLYL 3HE7D 4V1DD 4XX1E 1ZV5A 1UWEL 5A2KH 5F1NB 4ZOCA 1TDQA 2FDBP 3FT3B 3R06B 4CVUA 4YDKL 4ZPTA 3TA3B 5DMKB 2HN7A 1D5IH 3BEVA 4AQ1B 2VIRA 4MX7A 4GXVH 4J3SA 4LDOB 3GSNA 3S8WA 4JY6B 2ADJA 4ZS7H 4ZMAT 4XCNA 5C71A 3WIHL 1NLBL 3GBML 3ECBA 4CN6A 3RX7A 3RAJL 4CGTA 3RZCD 4P9HH 3RDTA 4ZPTB 5IROA 2HN7B 5I1GL 4EDWH 3BEVB 5GXBB 3ZLQC 1C1EH 2CLRA 4K94L 4P59L 2VIRB 4MX7B 2JJVA 4HBCH 2ADJB 4LOUC 4XWGL 3D2UD 4GG6F 4XCNB 5J6HA 3ECBB 4MXWH 3QYCA 1KB5H 2Q76B 4GUPA 4WO4D 3O6FD 3RWCA 3PHQA 4FG6D 1G0YR 3RDTB 1P84K 4UV4H 3K2UL 1UWXK 1YEHH 1YC8A 2CK0L 1IZKA 4PJXE 5T3XH 1OT1A 1KC5L 4Y7MA 2PXYC 1VFOA 1L6ZA 2QV2A 3O8XA 3EFFA 5C86A 1W72H 2XN9A 1BF2A 4NDMA 3GEWB 4HLZH 4GUPB 5T5NG 3RWCB 2B7DT 4R7NA 1GJIA 5LCVH 5HHVH 3TWCH 3RUGE 3IFLL 3U9UA 1S7RA 4N5UA 2DRUA 3NIDE 5EU7E 5F7HA 4RRPG 5E1HB 3OWEA 4TVSa 4X5WA 4U1HA 2VLME 2CRYA 3O8XB 3EFFB 1ZGLM 2XN9B 3FT4A 2VDNL 1K4CA 5CP3A 5K9JH 4R7NB 3NA4A 1T83A 3S35L 2NY3C 3U9UB 2C26A 1H8SA 1S7RB 4IDJH 3WDJA 5E2UH 3ZHLA 4DJMA 2YSSB 5JR1H 1KJ2L 5FM4A 3DO3A 4RCAA 1BAFL 3JBG7 4X5WB 1MHPL 1CF8H 1DL7H 2J7LA 4OF8A 2LTQC 5EU4A 3FT4B 2V5YA 3RBSA 3M8OL 5EUOE 1KJ3L 1K4CB 5FOBB 3FZUD 5J13B 4MJIA 2J2ZA 1XFPA 4J4PA 1U8KB 4EZMA 1N64H 1RIUL 4MAUH 3GSNH 3F7YA 4HXBH 2EKSA 4K2UL 4L4TE 1QBBA 4GRWB 1FYTE 4JPVL 4UNTA 3SO5A 3QJFA 3WHE1 2Y1VA 1N5YL 8FABA 5ALCL 3O2VL 3R1GL 5EU4B 3FJTA 4NZUH 4W6XB 3UJIL 1KPUA 2F5AH 4LHUD 4G6JL 1A3QA 3OZ9H 1QLRA 4OCLC 3WIIL 3F7YB 3GMNB 2EKSB 1ZEAL 5FGBC 3KLHD 1VGKA 5AWNL 2X70A 2CRIA 3BKCL 4QOKE 1T7XA 4JQIH 8FABB 3LB6D 1WEJL 4APQD 1YMHA 1KPUB 4WENB 4G42A 4WI6A 3DBXA 5BCAA 2WWKO 3I84A 1QLRB 7FABH 2J1KA 3ZDYE 3N9GL 1G9NL 4JJHA 2VLMD 1VGKB 3PQYE 1KCSL 2X70B 1VA9A 1GGBH 1RZKC 1I1AA 1U36A 2BVPA 4GSDL 4CL7A 1YMHB 4CJ1A 4P4KC 3LH2H 4RGNE 4U0RC 4U1KA 5C8JA 5D7JD 4G42B 2JF1A 1CK0H 5IB3A 2VQUA 1MFCL 4PRPE 1OY3B 4U1IB 5B21A 3PP4H 4O02L 3MA9L 3LIZL 5JPMA 1I8KA 2EDDA 1MCWW 5CP3H 5T3ZH 2IBZY 4JHAL 4AH2A 3MV9A 1I1AB 2BVPB 2QLVB 2EDLA 3HNSL 3MODL 4LLYA 1P4BL 3S36H 4U1KB 4JKKA 3RPIA 3HAEA 3LEVL 4S11A 4GRWH 4L4TD 3EJZC 3IJYA 1DUZA 4PJBE 3GK8L 5I74C 1EHLL 5IB3B 1GAFL 1S9YA 3TH4T 4JPWH 1NL0H 1IKNC 2XZQL 2L7UA 5JPMB 5EOTA 1I8KB 3K81A 1JUFB 3QG7L 4AH2B 3MV9B 3T2NL 4M4PA 3ZYZA 4LLYB 3FB6B 3RPIB 2E8ZA 3BWUC 3HAEB 3IJYB 1DUZB 1QSEA 2CMRH 1DBKL 2RCSL 2NXZB 4YK4C 5BS0B 4QOKD 3QG6A 1J7VR 3V7AG 4OLZL 3LD8B 2DTMH 3WXWH 5EOTB 1HEZA 4X7DC 1MCEA 2KQNA 1UKSA 1YY8A 2NXYD 1J12A 4J1UA 3O2WH 3GO1L 5GGSY 1H3GA 1QSEB 5E2TL 3D1MC 5C7XH 4P3CL 5E2WH 3QG6B 1YJDH 2ATKA 3RVTC 4HIEA 1HEZB 2IWGA 4RGND 5GISL 5KVEH 4WI8A 1P4IL 1IKFL 1YY8B 4PRPD 4LRNH 3RA7L 5E99H 1K85A 1DBBL 5E5RB 1RVFL 3SDYL 1A1OA 2ATKB 3HI5H 3DXAA 4DKEL 3VI3E 2NR6D 3DUUA 4HIEB 4DZ8A 1ZANL 3BZEB 1JI1A 3IT8D 3PL6D 4F15B 3VW3L 1P53A 1WFNA 4HUXA 3IETA 2VSDA 5E8EA 2OM5A 3ZDXF 2BNUA 2EIZA 1VERA 5HVGB 1TVBA 4NKMA 3CMGA 3CZFA 4FFWC 1OPGL 1FE8H 1A47A 4XNZC 3DXAB 3K2MC 4XHJC 2C9AA 1A2YA 1ZLVH 3HAEH 4XMKL 3K8MA 3ZE1F 4CU7A 1YYLH 4HUXB 2WBJC 3IETB 5E8EB 1H3PH 2BNUB 4IM8A 3KPOA 2EIZB 4NO3A 1N4XH 2R0LL 1TVBB 1A7OL 4NKMB 2A0LC 5IQ7L 2W65A 5GSVA 3CZFB 2XACC 3B2UD 2IH3A 4LMQE 1EGJL 1A2YB 2UY7A 2V5TA 3DI3B 3Q6FB 3C5JA 5IVNA 2M8XA 5F88A 3MUJA 3ARRA 2XFXA 4K3JL 3T0EC 1RUKL 4KY1L 4WV1C 3ZYIA 5GGVY 1CXKA 4OZHE 3KPOB 1X3DA 1LK2A 4PRAB 4J3OC 4YUEH 1YEJH 4MAYD 1JPFA 3WYRA 5GSVB 4B7IA 1CXLA 3ISWA 4GAJH 2IH3B 4LBEA 3IFOB 5J6GA 2ZUYA 3C5JB 5FUOH 4M7LT 3IDJA 4M3KB 3U82B 1VGEH 4IOFD 4QNPF 1NCAH 2XFXB 4NQTA 4M8QA 3V8OA 5I9QC 1FPTH 1LK2B 5HY9A 4LAQH 4U7MA 2N7AA 1CXHA 4LBEB 4AIZA 4DKFL 5J6GB 4KZDL 3SDAA 1J86A 3WD5L 2OTUA 3IDJB 3H0TA 2O5XL 2FEEI 2X7LA 2FRGP 5HI5D 3RVXC 5MEOA 1KT2B 2W9LA 4C83A 4JJ5A 4M8QB 2YPVL 3Q3GA 5HY9B 3ZTJH 3QHFL 3U9PH 3UO1L 1SMOA 2BNRE 1XR9A 2A6IA 1E6JL 5ACZA 4AIZB 1TJIH 3SDAB 4YHYC 2MHAA 2HJFA 1BD2A 2OTUB 3H0TB 1KEMH 4Z0XA 2X7LB 5BZDA 3MNZA 4C83B 4JJ5B 4KK9D 2FECL 1E4WH 4V2BA 1MCOH 3Q3GB 4LLWA 1EX0A 3NH7L 3IDXL 1A9BA 1PJ9A 1CICC 2A6IB 3QRGH 1JGLH 4JO3L 5ACZB 3HPJB 2MHAB 2HJFB 4JRXE 1BD2B 3MLRH 5DFVC 3L3JA 1GH7A 2IPTH 4Z0XB 5BZDB 1U8HA 1JYNA 2P5EE 3G6JB 3MNZB 5F9OH 3UBXA 2R4RH 4X6CA 4OIBA 5EU6E 2C1OB 3ZTJG 4ZS6C 3DLQR 5MI0C 5GIRA 4LLWB 3WFCH 5F89A 4NBYB 1B6UA 1KLGA 1KXVC 1S9XA 3LDBC 4GJTB 1JNNL 4R8WL 4EI5D 5LGHH 3PWLB 2D4FA 2DIJA 1R5IA 1A3LL 2YEZA 1K3IA 3L3JB 4Z7QF 5D8JL 1U8HB 3PGFH 4MJ6A 1T6VN 3VXPA 4X6CB 2VO5A 4FFVD 3QDMA 3B2VH 1JZ7A 5GIRB 4HC1A 5F89B 2OXGA 2DB8A 1S9XB 1R5IB 3F8UB 3MCG1 2IPUK 4DFHA 4Y2DA 1FSKC 4HDIA 2BRRH 3D3VA 3ARXA 3VXPB 1MCDA 1IQWH 4LCCA 3QDMB 2B1AL 4M03A 5CZVL 2BNRD 2W59A 2R1XA 1IEAA 5FFLA 4Z77A 5CEYA 4IMKC 4N8VB 2NLJA 4Y1AE 3MACH 4RGMB 1DJSA 5AZ2L 2A83A 1RFDH 3TH2T 5BW7A 4Y2DB 4UQ2B 1BBDL 1PX3A 2BK8A 3D3VB 3A6CL 4HDIB 4LU5L 1OAKH 3MJ9A 5LQBH 4LCCB 1Q9OA 1EO8H 1RIHH 3ZO0A 2GJ6A 5LBSL 3MRDB 2R1XB 2ZCLH 5EZIH 5D5MF 4M9OA 1IEAB 4Z77B 4JRXD 5CEYB 2O61A 1AQKL 4N5EC 2P5ED 3VFGH 2BY1A 2G9HA 4JFXB 3TVMA 2A83B 4H25A 5DURD 1ZLWK 5EU6D 4ODXA 5FKAA 1PW3A 4HUWB 1U6AH 4LQFL 4G9FE 5D2LA 3T4AA 5F1IA 5ADOH 4BQ8A 2AJVH 3ZKMC 4RMWA 3B9DA 4QRPA 4BQBA 2G9HB 3ULUL 3TVMB 4H25B 2NY5H 2ERJB 2BY2A 1KTRL 3BKML 4ODXB 4GAFB 5L9DL 3O11A 1SJXA 1BWMA 3TP4A 5D2LB 2DYPA 3VFPA 3T4AB 5C08B 2EECA 5F1IB 4KKAC 3B6SA 1T7ZA 1ZHKA 3G6AA 2HKFL 3D85A 1D6EA 4PLKC 5K59E 4QRPB 3ULUC 4HD9A 3HI6L 4TTDD 4M43L 3K4DA 3MR9A 1OL0A 4ZXBC 4B53A 5DR5H 5JDSB 4HC1H 3RHWK 3DI2B 5I1EL 5I8KH 1YPZF 3SDDA 2DYPB 3VFPB 1J11A 1RIVL 3SGKC 4Y1AD 5ICZA 4WFHE 2IADA 3HNTH 1ZHKB 2WUCL 3G6AB 1AFVL 3D85B 3NGBC 1D6EB 3UC0L 5D1QC 2ZUQB 5DD0H 2QL1A 4Z9KB 3ARBA 3MR9B 5CWSB 1WQVT 4X80H 1PY4A 3BPOB 4NM8H 2XTJB 3CDGA 1J1OL 3U7YH 1CZ8H 3F58L 3SDDB 3ULVL 2FZ3A 4OLEA 1FV1A 5HYIA 5D96B 5ICZB 2IADB 4UT6H 5EA0L 3PXHA 4NYLA 1DN2A 1I1RA 1YQVH 1TVDA 4MJ5A 3ARBB 2AQ1A 2CGRH 4OV6F 4P23A 4G9FD 3BPLB 3CDGB 5M95B 3WEXA 5CZXD 4N8VG 1Q0YL 1NGPL 4J8RA 4X8JA 1QLFB 1FV1B 1MCQA 4XPFL 4LSRH 1HXYA 4P5TC 4X9BA 5GHWH 43CAA 4I3GA 5ITBH 4NYLB 2DMKA 2VITA 3IJSA 2APXA 4MJ5B 3P9LA 1FG2B 3H2WA 3MJ7A 4HIJA 1KTDA 1WF5A 1KB9J 1BFOA 3DV4A 4KWUA 1BJMA 2OI9B 4G8GA 2RHEA 2UWEA 4XP6H 4OI9A 3WEXB 1JGDA 4EKXA 2EYSA 3L5HA 4ODVL 4J8RB 4UINL 3ARDD 4X8JB 1Q1JH 2HT4C 43CAB 5HI4C 1ZT7A 3NCYP 2FSEA 4RMTA 3P9LB 1LP9A 5J1SC 4HIJB 5ANMA 4O51A 1BFOB 3DV4B 1T04A 2VN7A 2UWEB 5KTEL 1WZKA 3BIAX 1JGDB 1IC5L 4WFHD 3V8CA 2E3VA 1QBLH 2FATH 4PJCF 3MBEA 4M6NL 2NY0B 1NMBH 4RFNC 3AC0A 4JFHE 3RY4A 2FSEB 1J1PH 3GJEA 3WXVL 4YHZL 3FB8B 1LP9B 1NGQL 5ANMB 4O51B 1T04B 3MNVB 4B5EA 4OIIL 4PP1C 1UM5L 3WCYA 4K3GA 3RP1A 5IBTH 2DJUA 2JKXA 2YN3A 3GRWA 3S34L 3MUZ1 2X1OA 3GJEB 3RTQA 3BQUC 3T2QA 3W5MA 1RUPL 2QTEA 3HRZA 4ZOBA 4NUGH 1VHPA 3VWKC 2JK5A 2FIKA 1BJ1H 1JHTB 4KKBC 2YXFA 2I9TA 3JV6A 2XA3A 3ARFD 2EC9T 3RTQB 4NNXA 2WBWB 2W0KA 1VFAA 2BNQA 3HRZB 2CSPA 5CLTA 3RU8L 1FGNH 4FQJH 4S2SA 1MEXL 1AO7D 3EFDH 2JK5B 2FIKB 1AR1C 3NIGE 1BFSA 1YEKH 2I9TB 4N90E 5IFJA 4N0UA 4HJ0D 5EOQH 2Q8BL 4NNXB 4WEBL 3QI9D 5D72L 3QHZH 1NEZG 1VFAB 3GHBH 2BNQB 1JTTA 4H0HB 5DT1H 5DJDA 4MLSA 4S2SB 2NW2A 4QXGH 3AMLA 4ODHL 4F58H 1BQSA 3HC0A 4JFHD 4D8PA 5CHNA 3V52H 3QO1A 5IFJB 1WK0A 1T03L 2HVKA 4XP9L 3VRLF 1OAZL 4OCSL 2AJXH 5JIKA 2DBLH 4GG6A 3W2DH 1JJUA 3OR6A 4IDLA 5DJDB 5JPNB 3EW3B 3IYLW 3WS6C 1DQDH 1ZVYA 5DEZA 2XZCL 2NW2B 3V95A 1JE6A 2EE2A 3HC0B 1EO5A 4D8PB 3O6KH 1D6VH 5CHNB 2VUOA 4Y0GA 1CXFA 5I1HH 2HVKB 3K4ZA 4UDUA 5K33A 5CLWA 4XB8A 1PEWA 4Y4HC 4KVCH 4N0FA 3I50L 2VDMH 4GG6B 1NMCB 3GRWH 4PGCA 2GFBA 4MNQE 5C07B 4MQXD 4FQHB 1LK3L 1KFAL 1B6DA 3B3IA 2Z31C 2EDFA 3CFJA 1A6WH 4UDUB 5TE7L 1MCBA 4FP8L 5H37H 3C2SA 1WBYA 4O9HH 1EH9A 4HGKC 4PGCB 3IDNB 4N90D 5F1OB 2GFBB 2A9MH 5L2KE 4R3SA 1L6XA 3DIFA 4YHLL 1JK8B 2AABL 1FN4A 4RFEA 5DUMH 2LE9A 3M45A 5KSVA 1C08A 3B3IB 5DQ9A 3BSZL 2Y5EA 3CFJB 4UIKH 3RX8A 2A1WL 3KYAA 4KROB 2BMKB 4OCYH 4L8CA 4WI9A 5HGHA 1WBYB 1QSZA 4X5LA 4G6AD 3SDXB 2HTLC 5SWSE 4D9RE 3KDMA 2DQUH 1N3NA 4HJJH 4R3SB 5D2NC 3DIFB 1D5IL 1FN4B 5KSVB 1A1NA 4NO0A 2WP3O 5DQ9B 1U3HA 1T4KA 4GXVL 3SJVE 3GNMH 3ARGC 1UACH 4WWID 5HGHB 5CP7A 3IRZA 4P9HL 2FEEL 3KDMB 1PLGL 1A14L 4EDWL 4OFIA 1C1EL 1QFWH 4NO0B 1U3HB 1T4KB 4HBCL 1JWMA 1IZJA 3IU4H 1CIDA 5FGCB 4AEEA 2J5LC 4MXWL 2XA8H 4MNQD 3CC5A 5L8KB 4H0IA 2B5IB 2G60H 4PJ8D 4XVJH 3MOQA 2Y06H 3KXFA 4UV4L 1YEHL 2EDXA 3O2DA 4HX1A 4JN1H 4FTVA 5D7SL 1JWMB 3UTSE 4HIHB 1UM6H 4X98A 3O4LA 1W72L 5LWYL 4WHDA 2NMSA 3CC5B 5L2KD 4OCRH 3RIFK 5LCVL 3TWCL 2DF3A 1DQJA 1LVEA 3NCCB 3KXFB 2J88H 4P48A 4HX1B 3TO4D 4L4VE 4FTVB 1RZ7H 4I0CC 1JI2A 2UVEA 4X98B 1Z9LA 3O4LB 4GMTL 5E6ZA 5L0QB 4D9RD 1G1YA 1GXEA 5EN2A 4BK5A 1SJEB 4NM4H 3BPNC 2IBZX 3TV3H 1G6RA 4JR9H 1DQJB 3L7FA 3EYSH 3MFGB 4HKJA 1FNGA 5E2UL 1XAUA 1IL1B 2PYEE 3PABA 3TZVD 3SJVD 4MS8C 2Y72A 5KSUB 1D5BA 4LRIC 1CF8L 1DL7L 3RVVD 3TA3C 5EWIL 3VXUA 5EN2B 4OZFA 3RBGA 4IS6B 1AGEA 3EJYD 2D7OA 2VRAA 3BJLA 1G6RB 1JNLH 4WW2A 5CS7A 2VKWA 3L7FB 4HKJB 1N64L 2VDOL 3GSNL 1FNGB 4MAUL 5FEBA 3PABB 4PGEA 4HXBL 3SDCA 3AXLA 3FAWA 1D5BB 2ICEB 2JE8A 4M1DH 4UILH 1REIA 1S7VA 3RNQA 4KDTA 5HTSA 3VXUB 2AI0L 3ZE2F 2GK0A 1S9WA 4KKCC 1AGEB 2UVFA 3MGTB 4OBRA 2F5AL 4WW2B 5IHLB 1NANH 4QWWC 4JFQA 4H8WC 3OZ9L 4OD3L 3DSNA 3VD9A 3UTSD 2AGJH 3SDCB 3AXLB 1KELH 5I18H 1Q9KA 1MAKA 1KJVA 3RDTC 3RNQB 2X1WL 5IROC 4JQIL 1QLEL 2IJ0C 5CAYB 4OFKA 1S9WB 5EIVA 2Y36L 5GS1A 3O2DH 2ILLA 3MNWA 4Y19D 2J8UE 4XZUA 4FHBD 5DMIH 3U4EA 1LGVA 3TLRA 4JFQB 1FYHB 4L4VD 4L8SB 2CPCA 4ORZC 3KLSA 3QIBD 1QSFE 1Q9KB 4J6RH 4LFHD 4L1HA 2I26N 1IMHC 3I6KA 2B4CH 4C56E 1GGBL 1AXSB 1FORL 3TFKD 2CR3A 2YRZA 3LH2L 5GS1B 3CFKA 5CJXC 2HFTA 2PYED 3MNWB 4XZUB 1JN6A 4TOYH 3U4EB 5KVMC 1CK0L 3UAJD 3OXSA 2ZSVA 3RZCA 3PP4L 3O8XC 3MV7A 5KSBA 5BO1H 3C6LD 1CFBA 2A73B 3I6KB 3SGDH 4AEIH 5DQJA 1G6RH 2B39A 3HMWL 5CKAA 1XGQA 3UTPE 3S36L 3OR7A 3QFDA 3CFKB 5C09A 2P8LA 1JN6B 3DYOA 1I9JL 1HI6A 2DM2A 4KK5D 3OXSB 2ZSVB 3X3FL 3RZCB 4MJ2A 4NJ9H 1BZ9A 3MV7B 4H88L 5KSBB 4OZFH 4HK0A 5KVFH 4U3HA 2X5PA 5J13C 2VAAA 4PJDA 5DQJB 1XGQB 4WHTA 3OR7B 1T1WA 3QFDB 4Y4KD 5C09B 2P8LB 1HI6B 1D9KA 5F1KC 1J10A 3CVIH 1BZ9B 2DTML 2HT2C 3QR2A 2V7HA 3WXWL 3EDKA 4HK0B 4UT7H 1S8DA 2VAAB 4PJDB 1MRFL 2MWCA 4J4PC 1V3JA 1M7DA 4NGHH 1HHKA 3RJDA 4WHTB 3P4LA 1T1WB 2R15A 5K9OA 2DM4A 4XWOD 3MV01 2C7UA 3O2WL 1QSFD 4PRNA 3C2AH 1D9KB 4RISH 5CEZE 4K3DH 5C7XL 2R56H 5E2WL 1YJDL 2C4XA 4U1SA 2V7HB 4Q7DA 1S8DB 4Z95H 1CGVA 1P84J 2HLAA 5K9OB 1RU9H 4LRNL 1FNEA 4PRNB 4GW4A 4QHLA 1SM3L 5IVZA 5ENWA 3HI5L 4U1SB 3FN0H 1QSVA 3SKUD 3UTPD 2IALA 3VFMA 3PHOA 3JUYA 3VGHA 1MNUH 5JW4Q 1UFUA 1Y6NR 4FQIH 4AY0A 5T33H 3KPMA 3B5GA 2HLAB 3V6OE 1FNEB 1SMAA 4P2CG 2P24A 4F8QA 1KF9B 4KMTH 5GGSA 5IVZB 1I1AC 1LD9A 1X5GA 5TE4L 2VR5A 4PJXA 3GB7A 2IALB 4W4OA 1T7YA 3NIFF 4H0GA 3UEZA 3PHOB 3GMPA 1EV2E 5DO2D 1YYLL 4QXWA 2HFGL 3KPMB 4Z7QE 1S78D 1H3PL 2Z91A 1N4XL 4MB3A 3RWHA 3LPWA 4DVRH 2YUWA 5GGSB 1NC2D 5C9JA 3DO7A 3MRCA 1LD9B 1EJOH 5A40E 4UTBH 4KKLC 4PJXB 3FQUA 2W91A 4ZUWA 4XCYA 1CI5A 3GMPB 3V0WH 2NXZC 2QQLL 5HXMA 5CEZD 3LD8C 1I8LA 3MLZH 2P7TA 3PWUA 2SEBA 3I75A 3RUGB 3RWHB 1YEJL 2A2QT 4HFUH 1W0VA 5C9JB 3DO7B 3MRCB 1XIWA 4Z7NF 2I27N 5DK2A 3FQUB 1ULVA 3O41A 5FUOL 2F5BH 3DROA 4ZUWB 4XCYB 1VGEL 1GOFA 4AMKH 5C0GA 2HFEA 4H20L 2O93L 4PLOB 4PG2C 4PJFF 5LKNA 4DWHA 3VH8A 4WHYG 1A6ZA 2P7TB 3PWUB 2SEBB 3I75B 1CQYA 3VFVA 4LAQL 1RK1A 4DEPB 1BWWA 3FT2B 3CZJA 4L4TA 1XIWB 5IV2A 1PG7W 5DK2B 1FYTA 5TQ2H 3O41B 5CZKA 3DROB 4PGBA 3C60A 3QWOA 1KIPB 5DJXA 5C0GB 1GCFA 2HFEB 5L7XH 5E70A 3VH8B 4CADA 1I1YA 1A6ZB 4ZPVA 3DX8A 3ZKXB 4YZFF 3IDYB 4M1CD 3VFVB 3U9PL 4Q9QH 1RK1B 5JTWA 2ZSWA 1CL7I 2VAJA 2H1PL 4AEHH 1RZIA 4F15C 4L4TB 5D5MA 4PJ9A 1XCTB 5IV2B 4W6YB 1TJIL 1FYTB 1TNNA 2HKHL 3D39A 1KEML 2D0FA 3C60B 3QWOB 5DJXB 3QB7C 1RI8A 1I8MA 2JTDA 1E4WL 1MCOL 5FAAA 1I1YB 4XCCL 4ZPVB 4F57H 2AK4D 3DX8B 3FQTA 3IKCA 2XIDA 4HUVA 3FB7A 1MH5A 1NBZA 3RKDD 1V05A 1RZIB 4EXKA 1A6PA 3QRGL 5D5MB 1JGLL 1T3FA 4MYWB 4K71B 3PQYA 4JM2F 3MLRL 4MA1B 3D39B 4G3YH 2IPTL 3SCMD 3KLAA 5IBLC 3M17B 4KDWA 5F9OL 1I8IA 1EJ6A 4CBPA 4B0MM 3AM8A 3FQTB 2ARJQ 3IKCB 4HUVB 3FB7B 1MH5B 1NBZB 3WFCL 1L0XA 4KTDH 1HWGB 35C8L 2JJWA 1T3FB 2NY4B 2HTKD 2WUBL 4U3CA 4FQ1L 4J23A 3ABZA 3CCHA 4PLJD 5LGHL 3PQYB 1VFBA 1KNOA 5E4IA 3G04A 3KLAB 3PGFL 1ZWIA 5DD3H 4RGNB 3B2VL 4WU7A 4E41A 4OCMC 4EEEA 2EIEA 2VMFA 4HK3N 4KXZH 1YPZA 3AY4A 3OJDA 4HUKB 4JGUA 3T1WA 4UV7H 1JGUH 5FB8A 3CCHB 1VFBB 4H1LH 2YD1A 1GPOL 3G04B 2BRRL 1ZWIB 1A3RH 3SKMA 1WFTA 3FRUA 1KEGH 4ZODA 5IW3A 4WU7B 4E41B 1YPZB 1IFHH 3OJDB 5T1KA 5E0QA 1K2DA 2UV3A 1ZLSH 1H15A 1SHMA 2IF7A 3LZFH 5FB8B 3H42L 4B41A 1RFDL 2GIYA 1SEQH 2NPLX 1OAKL 5GGVH 1J8HA 5FHAH 4YFLF 3FRUB 1RIHL 1XMWA 5KBNC 5HSFA 1RZJH 2HAZA 3SDAC 1CLYH 5TDOA 2FH8A 3P2TA 5T1KB 1AE6H 1MOEA 1K2DB 4Y88A 3IAGC 3VFGL 5HDLA 2LQRA 1BZ7A 4JVUA 4LLMA 1HSBA 2A9NH 5T5FH 5IP4A 3L5XH 1OVZA 2EXWC 4HEPG 3MRBA 1J8HB 4OZGE 4NKIH 2LV4A 5TDOB 3SQBA 5ADOL 4DGIH 1MJUL 1VACA 2XG5A 1QFPA 2D7QA 3W39A 1BZ7B 4LLMB 5HHXH 1HSBB 3NFPA 4NP4H 1FGVL 4TNWK 3IDIA 2QSQA 4R2GD 5D93B 3U0PA 3MRBB 1NBVH 5CGYD 1RUQH 2HT3D 1NGYA 4M6ML 4JE4B 1VACB 4PJCA 1AY1L 1ZKAA 1CT8A 1T22B 4X7FC 3MXWH 4LKCB 4EN3D 1YN7A 3W39B 3NFPB 2NY5C 3EBAA 5I71B 2I9LA 4FXKA 4DN3L 3IDIB 1FIGH 2Q7NA 4PRHD 3QWQB 2GJZB 5DR5L 3U0PB 2CJUL 4HC1L 3U46A 1TVHA 5C0CE 3UMTA 2R0WH 5I8KL 3BKJL 1WAAA 4KUZL 4WEMB 2CIIB 1UB6A 5E8PA 3S3PA 1FL5A 1AGFA 4HHAA 3HNTL 4PJCB 3I85A 4XCEA 1CT8B 5JA9A 1F3DJ 1YN7B 5DD0L 32C2A 1CIUA 5A1AA 3C5ZA 5IVXA 2I9LB 3DVIA 4X80L 1L0QA 4NM8L 1KIRA 4Z7WF 3T65A 1TVHB 3U7YL 1CZ8L 3W9DA 4GKSB 4UIMA 1UB6B 2XT1B 5E8PB 1OWRM 4RGMC 1FL5B 5EOCJ 4HHAB 4N0YH 4Y2DC 4XCEB 4KI5F 4RMQA 1YQVL 3OPZH 5TFSH 1NGZB 4LCCC 4YPJA 2X4SA 32C2B 3C5ZB 1LHZA 5IVXB 3WFDH 1KIRB 1R3HA 2RR3A 4Q0XH 3SEPA 2ZUUA 4UBDD 4IIQA 2PKDA 4UIMB 3NFSH 5GGTH 3U36A 3OGCA 3WJLA 1IEBA 1LEGA 1KCRH 3SGEH 5GHWL 3L3IA 1MI5E 1UC6A 5H35A 5ITBL 1YY9D 4ZAKA 4Z7VF 1ZE3C 3OGOE 1MCNA 1YDPB 2X4SB 4KMQA 4D2NA 4QRSA 4IOSD 4BQ6A 5AZEH 4PY8J 3BW9A 3VRLE 4K7PY 1R3HB 1OP3K 1XGPA 4XP6L 1W0WA 4BZ2H 2F53E 1NC4A 4JFFA 1T5WA 1ZVHA 1Q1JL 3NCJH 3OGCB 3U36B 3TVMC 2O26U 3L3IB 2ERJC 4XVUC 5H35B 5KSAD 2NZIA 2APTA 2OTWA 4ZAKB 2PYFA 3WBDA 3O3BA 3Q0HA 4OCXH 5EBGA 4F7MA 3KGRA 4YBHA 5C0CD 1IBGH 3BW9B 2IEPA 1XGPB 4IRJA 5F7WC 3RRQA 1I9EA 1U3ZA 1W0WB 5EG6C 1NC4B 1QBLL 2FATL 4JFFB 4M62H 2E6QA 2J12B 2Q86A 1WTLA 2WSKA 1FL3A 3ARWA 2BNRB 2XRAH 5ELIA 3E0GA 4LCWE 2OTWB 1J1PL 2PYFB 5D7LE 5F96H 3OKLA 1NCCH 2OCFD 4F7MB 1MLBA 1ITCA 2X4UA 5EZOL 4IRJB 4KJYA 2D7PA 4JREB 4JB9H 5BVJA 1H3WM 1NGXA 2ZUQC 5IBTL 1NFDE 2Q86B 1FL3B 3BPOC 1U8QA 3BP4A 2XTJC 3DMMD 3KNBA 5I1DA 2YA1A 4Y16A 3OKLB 1C12A 3KPRA 4F37K 1MLBB 3SDDC 3ZKNC 1QPPA 2X4UB 3VI4F 5D96C 1H0DA 4NUGL 4L9DA 3WHXA 2Q7YA 5BVJB 5JMOC 2AXHA 5EU6B 1MI5D 1NGXB 1RD6A 2ARWA 4KQ4H 1P7QD 4WWKD 3ARBC 1JGVH 4ZFGH 3REVA 2DBJA 1IAII 1F6LL 4JG0H 1Y0LA 1U8QB 3BPLC 4U1MB 3G5YA 3KNBB 5I1DB 1C12B 3KPRB 3A67H 1UYWH 5EZLA 4R4FH 3WLWC 1J0KA 2PR4L 2F53D 2JIXD 1H0DB 1MVUA 3WHXB 2VQTA 4EQ3A 4GKZA 1J8KA 2Q7YB 3OG4B 1JZ5A 4F9LA 2E7CA 3E6FA 1YEKL 3REVB 3RI5K 1MHHA 1I7ZA 1Y0LB 2YRPA 1S7SA 2OI9C 3G5YB 5EOQL 3UROR 1KCVH 2UZIH 4MGXA 2E7LA 1FVDA 3OMZA 1Z9MA 5EZLB 2NY6B 3QHZL 4FXGA 3GHBL 1JIBA 5BRZA 2AQ3A 1J9CT 3CGTA 5FIEA 4QXGL 4GKZB 4F58L 2P4AB 5IFAH 4LCWD 5JW4N 5D7LD 3DWTA 3E6FB 1RJZA 3T0DA 3ARTA 1MHHB 1I7ZB 3SE8H 1S7SB 5FKPB 3UTZA 4Y89A 1FVDB 4XBEH 2DBLL 4HCRL 4FXGB 3MXVL 3G08A 5BRZB 4M1GH 3QEGH 3QFJA 1KPRA 2NY0C 1U9KA 1UB5A 4MQSB 3K46A 4XAKD 1G9MH 1X5YA 2HRLA 3O6KL 1D6VL 1RJZB 2A6JB 5EUKA 1FFOA 5I1HL 2C4FT 4Z7UF 1RMFH 5C0AE 3UTZB 2VDML 4UU9A 4DQOH 4RA0C 4OZIF 4HMDA 3G08B 1S5IH 4PJAF 3QFJB 1KPRB 3GRWL 5D1ZD 2H41A 3FONA 2XWBA 1UB5B 4YNYA 2GUOB 1WBXA 2HWZH 3RX5A 2HP4A 4D0CA 1TXKA 5EUKB 1FFOB 4U6VH 5CEXA 5BV7B 4UU9B 4C59B 2ADGA 4O9HL 4NFCA 3U7AA 5CFHA 5E08H 2V17H 3FONB 2XWBB 2C3VA 4NQEE 3BRGC 4YNYB 1MY7A 2A9ML 4X6DE 3RTQC 3ARED 1WBXB 4D0CB 1I9RH 3QWRA 2FHCA 3ARDB 4PRIA 4UIKL 1FVEA 4YHKL 1XGRA 4A6YA 1F00I 3NCMA 4OCYL 2ADGB 3QIUD 1OAQH 1WUNT 3WNNA 2Z8RA 4YE4H 2MQ0A 5DTFA 4M7KH 2C3VB 2DQUL 4HJJL 5DMGD 3WL9A 5AAMA 3QZWA 5TJWK 1QA9A 2H9GA 5JIPA 4PRIB 5F7YC 3GNML 5EIIA 1XGRB 1KG0A 4A6YB 3H9HA 5DTFB 4OGXL 2RGSA 3HE6A 5F3BA 3WL9B 3QZWB 2N1KA 1QFWL 1QA9B 3MOBH 2H9GB 4WUKH 1J0JA 1WZLA 3EYUH 4P5KA 5EIIB 3RWEA 1KG0B 2BVOB 3H9HB 1FZOA 3O0RH 2GK2A 3C08H 2XA8L 4Y2OA 1F42A 2E5EA 4O2FA 1MCPH 2ZZUT 4QRRA 1FO0B 1V3MA 3JWOL 4HW6A 4G8IA 1DFBH 2G60L 3HE6B 2Y06L 4GMSH 3UJJH 5F3BB 1E27A 3EOYG 4R26H 1NMCC 4P5KB 1UM6L 3RWEB 3B5TA 4ZO6A 1FZOB 5GRUL 2ICWI 4JFDE 4EDXB 4L1DA 4NQED 4O2FB 3BE1H 3FFCA 3LEYH 4KTEH 4QRRB 1IE5A 1S7TA 5IJVA 4G8IB 3T04D 1N26A 2PO6D 2GCYA 1U8PA 5DRXA 3WUWA 2J88L 1E27B 1EK3A 3SE9L 4JCMA 1RZ7L 3SOBH 4M5ZH 4TPRH 2UUDH 1ERNA 1OGAE 4MMZC 2BVYA 1I1CA 3SKJH 1KCUL 1SVZA 5IHZA 5ETUA 3FFCB 3TV3L 1CR9H 3IF1A 1S7TB 3HA0A 3RVUC 5IJVB 4N68A 4PYGA 1LDPL 2GCYB 5JNYB 1U8PB 4YO0A 5DRXB 3ZTNH 1EFXA 3CU7A 4KROC 4U1NB 3WUWB 4HIIA 4LHQB 1MVFA 1T0MA 4M7JH 3VD4A 5HGAA 1HKFA 3QXUA 1NBYA 1NKOA 3QUYD 2XQBH 4ZO9A 5IHZB 5ETUB 1MIMH 5DJCA 5ESVA 3IF1B 1IM9D 5CBEB 5SX5K 4KUCD 1JNLL 2W0FA 1VSCA 3KJ6H 3OF6A 5DJ0A 1EFXB 4FQXD 2EH8H 4HIIB 5KG9A 4M1DL 2PXYA 5HGAB 2DIAA 1NBYB 2P45B 1WV7T 1RJLA 4R96A 5F97E 5F6IB 4ZUSA 4HH9A 5DJCB 5KN5A 5ESVB 2FEDC 1WBZA 2W0FB 1U3HC 3QEQA 5DJ0B 1MLCA 2AGJL 1F4WH 2UZYB 5KG9B 3WSQH 1KELL 5I18L 1GGTA 4Q9BA 4JFDD 1ZS8A 4F7CA 1RULH 4PJ5D 2B5IC 3BAEH 1RJLB 2R2HB 4ONHA 4CMMB 4ZUSB 1AGCA 3QZWG 4HH9B 3PNWB 5FO7A 1F3JA 1WBZB 4MNGE 5DMIL 5EULV 3INUH 3QEQB 4LOUD 4PJEE 1KV3A 4LARH 5AAWA 1MLCB 1OGAD 3MA7A 1VEPA 5HGGS 2PTUA 1R3IH 1ZS8B 4F7CB 4NJAL 1FDLL 2EO1A 4QHNA 3BYTA 4X0KA 5IT2H 3QBTB 4ONHB 2K3TA 4M5YH 1AGCB 5GRVK 5FO7B 3VXME 1HINH 3QQ9C 4TOYL 1QRNA 1UWXH 4PD4J 5J8OA 3MA7B 5L0QC 4M61A 5ITFA 5BO1L 2B4CC 4HFWA 3ZYOA 1P4LA 4AEIL 5L8LB 4QHNB 4X0KB 3P4MB 2HH0H 3D69A 3FO1A 4NKDA 1I7TA 3RIFF 1T20B 1QRNB 5KS9E 2YMXH 1L7IL 4F7TA 4K3HA 5DZNA 4P2QA 5ITFB 3JWDC 4HFWB 4JDZB 5KVFL 5BMFH 1P4LB 3DETD 5T5NF 2R0KH 2COQA 3WUWG 3HFML 5J57B 3D69B 5JHDA 1LEKA 4PV8A 3FO1B 4R4BA 4DGYH 4NKDB 1G7IA 1I7TB 3ZSTA 2NY2B 2R2EB 1E4XH 4MNQB 5BJTA 4F7TB 3DUHA 3CVIL 4WNQA 1XCQA 4I77L 4P2QB 5GQBA 4YC2B 4KRNA 4UT7L 2D0HA 5IF0A 4WW2C 4NQDE 4NGHL 3JUZA 4P4KA 4LAJH 2VLLA 2QQKH 5JHDB 1LEKB 4PV8B 3SDCC 1EEYA 4R4BB 1G7IB 5SWSA 2YZ8A 4K7FA 4PJFA 2YD8A 5BJTB 4RISL 5F7FA 1L9MA 4K3DL 4U3XA 5GS0H 2R56L 4KDTC 4WFEE 4WNQB 3QEHA 1XCQB 3U1SH 4ONGH 2AK1H 4ZFOB 1HE7A 3UTTA 3O9WD 4FQ2L 3TZVA 5IKCA 5IF0B 3VRIA 3DVNA 4L8SC 1E0OB 3NPZB 1EEYB 4HPOH 2P42B 1Q9LA 2ENSA 3AROA 1FH5H 3AU1A 5SWSB 4K7FB 4PJFB 3E2HB 5DEGA 3QEHB 1OWWA 3FN0L 3UTTB 1SEBB 4GOSA 5GS1C 3TZVB 5IKCB 2QADB 1HSAA 1YA5A 2VZSA 1FP5A 1MNUL 3HMXA 3VRIB 3DVNB 2IBBA 4FQIL 5T33L 3WNLA 5GJSH 1P9MA 3AU1B 3HUJA 4XHQA 1X4ZA 2FGWH 3ZL4H 4NQSA 4JVWA 1HXMA 3MV11 4KMTL 5DEGB 2E27H 1EEZA 2XZAH 3V0AC 1JFQH 3VCLA 3TCLA 1OTTC 3K74B 1EMTH 5EPMA 1HSAB 1JPSH 3FKUS 4JM2A 1AKJD 3TC9A 1U2HA 3RZCC 3PV6A 5JUEL 4P46A 3HUJB 1F13A 2GTZA 5FECA 4NQSB 1A7PH 1HXMB 4K9EC 2A74A 4DVRL 5CGMA 1T1YA 1VADA 1EEZB 4UT9H 2QHRH 1EJOL 3VCLB 3TCLB 4NQDD 4UTBL 3QNYA 3ESUF 2WINA 1UG9A 4XP1H 3HPLA 5CCKH 3EJZD 1A7NH 3KPNB 4JM2B 25C8L 3V0WL 3L3KB 4TULH 4XPAH 4JO1L 3PV6B 3VFWA 1MCJA 2WM0A 2DKUA 4JRYE 4CVXA 2WWKT 1IM3A 4P46B 4WFED 5C0BA 3PIQA 4HS8H 3MLZL 2YUVA 2GTZB 3HI1B 5H94A 5FECB 2H45A 1WT5A 1RZKH 2A74B 3HC3H 2ESVE 5C0NC 2CO7B 2JELH 4S1QL 1VADB 3L3DA 3SE4A 3QNYB 2NY7H 2WINB 2ZJSH 1KCKA 3HPLB 4WI2A 2F5BL 1MRDL 2B8OT 4AMKL 3LKQA 3L7EA 3VFWB 5I1LA 4CVXB 1XF4B 1IM3B 5D1XA 3OAUH 5C0BB 3G6DL 4KGLA 1JWSA 3PIQB 5TPWH 5H94B 3V0VA 4JO2L 4JAMA 2W0LA 3LN9A 5ILTL 2XPGA 1ZSDA 5TQ2L 1MWAA 1UADC 5IK3A 1KIQA 4O58H 1IAOA 3T0EE 3BGFB 3IB4A 3L7EB 3LKQB 2JB5L 5I1LB 2BVTA 5D1XB 4LASL 1JWSB 3RVTD 3BDXA 3V0VB 4Q9QL 2P43B 5IR1B 4AEHL 4FFZH 2NY1B 1CVSC 2XPGB 1HH9A 1ZSDB 4HS3A 2EXYC 1MWAB 5IK3B 1KIQB 4PJHE 2ED7A 2WNGA 1GOGA 1IAOB 3S3JA 2VDPH 1CDHA 3QDGD 4F57L 3MFFA 4XPTH 2DLHA 2OS7A 4Y4KB 3FMGH 5MENA 3QUXD 5FA3A 1C5DA 1HH9B 4HS3B 4C56A 4YR6A 4JRYD 4QHUA 4G3YL 4MVBD 1G7LA 3N1GC 4FFWD 4NKOB 2ESVD 3BT2H 3MRIA 1TCMA 5ISZA 2J8UB 3MFFB 4XHJD 5ALBH 2VDQH 3S5LA 2V2WA 1Z5LA 3REWA 1M05B 3PF2A 1NCWH 3ARSA 4DOHB 5MENB 5FA3B 1UJTA 1C5DB 3BMVA 2WBJD 3D0VA 3U79A 5DS8A 4C56B 4YR6B 2VDKL 3LB6C 5M94B 3NCFB 1G7LB 2A0LD 1B4JH 1PVHA 4Z7WE 3MRIB 5ISZB 1QFHA 1LO3H 3GSVA 3S5LB 4X6EA 2V2WB 1Z5LB 4K23L 4XP5H 3REWB 4BQ9A 3CLEH 4FQQA 4UV7L 5DMYA 3IDGB 1JGUL 3T0ED 3STLA 5DS8B 2LU7A 1DVFA 1I8LC 5HGDB 2R1YA 2RAMA 1A3RL 1J5OH 4DEPC 3QNXA 4OTXH 4HWBA 5DGRA 1XIWC 4WGWB 1FCGA 4GBXA 1DQQB 5FO9A 1GRWA 3BH9A 1N0XH 3GSVB 5A2IH 1IFHL 1MWAH 4X6EB 3BP5A 4OAWA 2BHYA 3MV8E 1ZLSL 3LZFL 3STLB 2R1WA 1DVFB 1JZ3A 4EBQH 1C5BL 1SEQL 4X83A 2R1YB 3ZKXC 3IDYC 1G84A 5GGVL 1F3DH 5FHAL 3QNXB 5GZOC 3VXTA 3W11C 5CINH 4GBXB 2VXTH 1CLYL 3BH9B 2QBWA 1HDMA 1AE6L 3BP5B 3C60C 4OAWB 1CDCA 3RVXD 2AEQH 2WQ8A 3L9RA 2R1WB 4NHCH 4XPHH 3CFIC 5EOCH 1YNLH 4Z7VA 5T5FL 1BQLL 3L5XL 3MLYH 4GAGH 4XMLH 4FXLA 4NKIL 3VXTB 1U58A 4LSUH 4K7PX 3MOAH 1RZJC 2EDQA 4NKQB 4ZSOE 3ULSA 2HFFA 4K71C 1X7QA 4DGIL 4MA1C 1HDMB 3B9EA 5DHXB 3IFNH 1YUHA 2VDLH 4JFED 3L9RB 3FN3A 5IQ9A 5HHXL 3F7PC 1DTUA 2H2SC 3OKOA 4DVBA 4FZEL 5ESQA 3FRPA 1NBVL 1U58B 4XCFH 1CICD 3ULSB 2NY4C 1Q94A 3V6OA 1X7QB 2V7NA 1Z3GH 4LGRB 2OJEA 5EIQA 4LVEA 1YUHB 5F7MC 1BLNA 3MXWL 2VLRE 4YGVA 1T2XA 2X4TA 5I66B 5IQ9B 4RGNC 1KPVA 2HVJB 5E6IA 3KPLA 3AM8C 3OKOB 4DVBB 4ZS6D 1FIGL 5ESQB 5IB4A 4PJGA 1C5CH 3C6SB 4XPBH 5DZLA 5E8OA 4JANA 3MV8D 2V7NB 5GS2H 3FAXA 2DQHH 2OJEB 2D7MA 3QCVL 2BRQA 1OAYH 4YGVB 2H6PA 2X4TB 2ZG1A 2W60A 1HH6A 4OKVA 4HWBH 3H3KA 3N85L 5E6IB 3GUTA 3KPLB 3M07A 3U30B 3AY4C 4NN7B 4LVNB 5IB4B 4PJGB 4PJIE 3OX8A 1XGYH 5E8OB 4KRPB 3QJHB 3MRJA 4I0KA 1MUJA 4I3SH 3ULUE 2H6PB 5TFSL 4ZG1A 2W60B 4OKVB 3WFDL 2DAVA 3PWPE 4Q0XL 1PZ5B 3RKPA 3OX8B 5I73B 5SWZE 5D7IE 5HHOE 1JPGA 3NFSL 5TF1L 3B9AA 5GGTL 1GGYA 2CUMA 3SQOH 1KCRL 3TT3H 5HGBA 1F2XK 3MRJB 3O45A 4X7EC 1SBSH 5IBUB 1MUJB 1EZVY 1DQTA 2EKJA 1K6QH 2BSRA 4EIZC 4QXUH 4ZXBA 4L5FH 4WI7A 5EU5B 3RGHA 4HF5H 1UQSB 4BZ2L 4G7YH 1KACB 4N5ED 3SGKA 1JPGB 1IQDA 5HYQA 1K4DA 3P4NA 3K3QA 3NCJL 4LPYA 5HGBB 3O45B 1MHEA 5D93C 4EVNA 2BSRB 3MLWH 4OCXL 3X3GL 3KPQA 1ZLWH 5J56B 1IBGL 1JGEA 4QF1A 1IRAY 5DJ6B 2MFNA 3SE3A 4HZAA 3ZKMD 3QEUA 3T3ME 4M62L 3D0LA 4X9GA 1IQDB 4UB0H 5HYQB 1K4DB 1Z0NA 3P4NB 5I71C 2HMIC 1QNZH 2R23A 2XRAL 1MHEB 1ONQB 5F96L 4EVNB 3MX0A 3BN9C 5I1CH 3KPQB 4OFYD 2APBA 1JGEB 4QF1B 1NAMA 5A16A 4KKAD 5DHVA 4OZIA 3BRDA 3VXOA 5IESH 4PJAA 3RWFA 4JB9L 3QEUB 2NX5E 3D0LB 4PLKD 3MLUL 2W92A 3ULUD 2VZVA 1N6UA 2DI7A 3V5KA 3PWPD 1UWGH 5E9DE 3BO8A 1MCRA 1P6AB 5SWZD 2BFVL 5HHOD 1NAMB 3U7WH 5DHVB 4OZIB 3VXOB 3IGAA 4PJAB 3RWFB 1SYVB 4NN5B 1IAIM 3G6JF 2L4OA 3EYOA 2FL5A 4KQ4L 5D1QD 1CGSL 1GGCH 4NSKA 1CXIA 2LAAA 1AC0A 4RZCA 4ZFGL 3C5ZC 4U6HA 1NQBA 4JG0L 4XP4H 3R0MA 4B7LA 4TRPH 3BO8B 5D7KE 5LG1A 4OLUL 3A67L 1UYWL 4JDTL 4IRSA 4U31A 3LV3A 3EOAA 2BVQA 3IGAB 4YQXH 4OBSA 1A1MA 3IFPA 4R2GB 3EYOB 1KXTB 2ZOKA 2WIIA 4QXTA 4NSKB 4ERSH 4RZCB 4JEGB 3NZ8A 4XNUH 3RGVA 3CLFH 5HDBF 1YEDB 1KCVL 2UZIL 1U8OA 3WNOA 3CFDA 1XT5A 3JSSA 4IHOA 4IRSB 4C4KT 4X6BA 2HA1A 1LILA 4AG4H 3WO3B 4EI6A 4L3EA 4HPYH 5IBUG 4P5TD 3EOAB 5DQDH 4BELD 2BXYA 1AH1A 4ZAKC 1A1MB 3IFPB 5IFAL 5I0DA 5HHPA 2ZOKB 3JVGA 2WIIB 4QXTB 3QIWA 2X89A 1JHKH 3NZ8B 5CD3A 3RGVB 4ZYKB 3SE8L 3KPSE 3WUZA 4BKLA 1U8OB 5E8DH 2E7MA 2AKRA 2EE6A 1ZTXH 4XBEL 4GQ9H 4X6BB 4M1GL 2NX5D 4FQCH 2OZ4L 4L3EB 2BZDA 4EI6B 2HT4D 3Q5YA 5HI4D 1JBJA 1NLDH 5HHPB 1G9ML 3QIWB 5E9DD 2FO1A 5CD3B 4O00A 3LHPH 4OQTA 4IRJC 4R0LA 1NAMH 1MCCA 1RMFL