3U9PL

Crystal structure of murine siderocalin in complex with an fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
b'DILMTQSPLSLSASLGDKVTITCQASQIIYNYIAWYQQKPGKAPRLLIRYTSTLESGTPSRFSGSGSGRDYSFSISNVESEDIASYYCLQYDNLPYMFGAGTKLELKRADAAPTVSIFPPSSEQLATGGASVVCFVNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKVDYERHNLYTCEVVHKTSSSPVVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 212
sequence length 212
chains with identical sequence M
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pL01
1A4JA 4K55A 4DKFL 4IOIB 1UC6A 4PJ5E 4X7DC 5EBMB 2N7BA 4MDJA 4KZDH 3UC0L 1P7KB 4NQEE 1YA5A 3SGEI 3AB0C 1G0DA 2DQCL 3X3FL 1XH3A 1DJSA 3BT2H 1Q9OA 4P2QB 1MJ7L 1H5BC 1H5BA 1UM4H 2QKIA 3U7YH 3Q3GB 3U30B 3VXUD 3LKOA 1QLEL 1SM3H 5DRZA 2KBGA 2R4RH 3UROR 4ONOA 1TDQA 5E00A 1N0LA 4GRLC 4RSVA 3QXVA 2HT2D 4N5EC 1VADB 2ARJA 3PGCB 1OHQA 1K2DB 2JJUA 3MV9E 2P5EE 3MLVL 4JM2C 5M95B 3SDXB 3K2MC 3RUGB 4RGMB 4M02A 1KENL 1GSMA 3O3EB 5LBSL 4N0FA 5F88B 4HIEA 2AERT 3INUH 3P9WB 5K9OB 5I0DA 4RGOL 4NNXB 4UU9B 5IEHB 4WO4D 1CGXA 3NCJH 1U8PB 3QXTA 2VRAA 3JVGC 2NCMA 2HT4D 2H3NA 4XI5C 5ACZA 5L2KE 4YDVA 3P0YL 4NO2B 2X4TA 3HS0B 1VFBB 1A21A 1AHWB 1X4XA 4GKSA 3L5HA 3UPRA 4Y4HD 3WUWA 5E2JA 1IT9H 5AYQA 1QLEH 2BVPA 3RJQB 4LSQH 4YBLC 2OJZL 2ZCLL 4Y4KB 4LARL 5B3NA 2VH5L 2NW2A 3VFGL 1L0QA 4U6XB 3PQYB 3MLVH 3QDMB 1HHHA 3MV11 3AROA 2X4UB 4FN0A 1I3VA 3EFFB 4U6YA 2X4QB 4L4JA 5FOBA 2FEDD 5D7KD 4LHJB 2JB6A 2NTFB 2UUDH 3D0LB 4XPAL 3WKNA 2IEPA 2X42A 2JELH 1A6UL 2EECA 2KQMA 2D0HA 4OCYL 2FX9L 1I9IL 2Y5EA 1H15B 4ONFH 4HG4K 3FB8A 3IF1A 5IBTL 1J0YA 1RZJH 2CKBL 5CUSH 1KG0A 1X5YA 3AMLA 3NMEA 3MNVA 4NOBA 2Q6WB 3DX6B 1CD9B 1IKNA 4KTEH 3W11C 1FL3B 1JFQH 1UA6H 4YGVB 4KJPC 4G7VH 4R90H 4YGAB 4LASL 4M48H 5BXFB 1NFIA 3KPPB 3HPJB 1I4FA 2ICCA 2ZPKH 5B39B 3VXTA 3L3JB 1ZHBB 3CUPA 1CICD 4X9FA 1XGPA 3DNKA 1DQDH 1GJIA 2HFGL 4L3EB 4LF3A 5JHLL 2J88L 5BW7C 1EEQA 2LE9A 1DQML 5BW7A 3O6FB 3M1BA 3QFJD 4UV4H 5KS9F 1FORL 3MRRA 4BKLA 3HPLB 3FQRB 4G7YL 2IBGA 4WU5B 3SDDB 4G6ML 3PDGA 3WN5C 1LVEA 4Z8FH 3A6BH 4O5LH 1A7NL 4YWGH 1N59B 1YY9D 1UT9A 1JNNL 4HS6B 5DRWA 4OD3L 3R0NA 4I3SL 1C16A 5HYIA 3WFDH 4TNWF 4M4PA 3IAGC 2CLZA 5FK9A 2LABA 2NY5L 1X4YA 2OI9C 5F7NC 2BRRH 5DSCA 1AR1C 4F7MA 1F6AB 4M5ZL 5AAWA 5GGQL 3VXSE 2P8PB 4OLYL 4ZSOB 5E6IB 2Q7YA 3TPKA 3RGVC 4K2UL 2XN9E 3NCCB 3OG4B 4ODUB 2D7NA 4JVPA 1UM5L 3OHXB 4FG6C 4OGZA 4RNRB 3V5DB 2CIKB 2APXA 3RAJL 2ED8A 1ZOXA 4N0UB 1KN2L 2EYRA 4NGHH 3BP6B 3T0BA 1KXQE 1NKOA 3EYFB 4HKXB 7FABL 3HZMA 3RPIB 1J18A 4MMXC 5FOJA 2DQIH 4UOW0 2VISB 3ZKMD 1NCWL 4F8QA 2OM5A 4FZEL 4LL9A 4M7LL 3NPSB 4Y16C 5EBLA 1J12A 2NY5H 2DM4A 5FF6A 3X11B 5JNYA 1CD1A 5CP7A 4N5UA 3OKDA 4PJHF 4YHZH 5GGQH 1NUGA 3LEYH 4KQ4L 3U7WL 4OI8A 1K4DA 4L4VA 2ZP0T 4OZFB 4EBQH 5LQBH 4KPHH 3T2PA 1VGEL 1A2YA 5FKAA 1LWRA 2QADC 4MJ4A 5DGRA 4TRPH 2VXUH 1B0GA 4ESKA 3B5TA 2R1YA 1MAMH 2H9GA 4X5WB 3DURB 1KN2H 1MJ8H 1OARH 5SX5K 2OR7A 3QDGB 4M5YL 1BFVL 5GGSA 5FYLH 3ULVF 1V7NH 4GJTB 1T2XA 4M7LH 3BSZL 2Q86B 4YHLH 1U36A 3MTRA 2VLKE 4Z7WA 2B1AL 3OGCB 3X12B 1HHJB 3QRGL 4Y4FC 3WL9A 4Y4FA 5IGXL 2I26N 5EOQH 3SOBL 4W81A 4FXKA 4MVBD 2XY1A 3ARYA 4AMKH 3SBWC 1I7ZA 5C3LD 2NY7L 1WBZB 3EOAB 1U6AH 4LDLB 5DWUH 1SY6L 3MOAH 4F9LC 2LVEA 4F9LA 2NY0D 1QHPA 4LRNH 4OFDA 4RGNE 5A2IH 4QRRB 2H8PA 3T0EE 3HA0A 5E5RB 2ZOLB 3UTTA 5B8CB 2E7BA 1NCTA 3G6AB 3CK0H 2EIZA 3DVNB 1F3JA 3LPWA 1NGZA 1HEZB 2HWZL 5F7HA 1A9EB 3IETA 4EXKA 1UM6H 5ICZA 1BOYA 4MGXA 1HIML 4GW5A 3BD5A 4YBQD 2VUOA 3BSZH 1NJ9A 1KF9B 1FIGH 4LLQB 4Y19B 5EO1B 3T4YB 3RNKA 3KPRE 2WV3A 4OB5H 4OZGA 3H3PH 2B1AH 4Z7OE 4YX2L 1LEKA 2WP3T 4DZBA 3O2DA 4S2SA 5IGXH 1S7QB 4MLIA 3ARDC 3SE3C 3ARDA 2A74B 1UENA 5JOFB 1CDBA 3TFKC 4G9FE 3RKDC 5KS9A 4Z5RA 1N64H 4LAJH 2BHUA 4J6RH 1XCTB 2UVFA 2GW5A 4HV8A 5DDHA 4KRMB 3ZYJA 3SDCA 1R3IH 1ITCA 2BOBA 1A22B 4WHYH 3UBXA 2ZCKL 3E6HB 4Q2ZB 2BNRB 5MP6H 1X5XA 4V1DE 3LN4A 1NBVL 1GOFA 2B8OT 4RX4A 5DLML 2E7CA 3G5YB 4KKAC 1IM9A 5GZOC 2COQA 2WIIA 3FO2A 4M1GH 5EC2A 1P7HL 3IS1X 3S35X 1TQBB 1P7QD 2P42B 1EEZB 4I77L 4NFBA 3KNBB 1AKJD 2YR3A 4P23D 1SYVA 1KNOB 5IG7B 3UX9B 3MV7B 2VLJD 3QIUB 1KIQB 5FV2A 3BH9B 2C3GA 3FMGH 1FYHB 2DQGL 3H7BA 2R9HC 4OIIH 3RDTD 5ID1B 5LCVH 4OGXL 5T1DH 1S78C 3WD5L 3EDDA 1PEWA 3H9SB 5JXEC 1MCKA 3H9ZA 4Z7QF 5A16B 4LGRB 2R0LL 2ZUYA 4FP8L 1G9NH 5F97E 3TVMC 1RVFH 3TVMA 2HFFA 2R1WB 3DARA 5IB4A 4NNYA 4GSDH 3IDGB 2ZCKH 1G7JA 1OAQH 1KPRA 1WAAA 4YDIL 4OIAA 1C1EH 2X4SB 1GAFL 5DA0B 5TH2A 3VH8B 8FABA 2XA8H 3KHOA 3X14A 5FA4B 5MENE 4JFHD 4LAQL 4UOJA 4R7DA 4V2CB 2NW3B 1DUZB 4JDZB 1AFVL 5C09B 2IFGA 3TBTB 5F1OB 4YHOL 3MBEC 4FABH 3MBEA 1CLOL 1XR9B 4XVTL 1QSFB 3O4OB 2DAVA 5AZ2L 3GSQA 1RULH 1S5IL 5F6HJ 2YPLB 4HIHA 2GJZB 3BWAB 1OT1A 1PQZB 3S3JA 3HG1B 4HLZH 5F9AC 3WD5H 1MWAL 3OKKA 3QDJD 4EI5C 4I3GA 4HF5L 4EI5A 4Y8DC 4Y0GA 5JOPE 1ZGLB 4TVPH 1XIWA 1YEFL 1MHCB 3RZCC 3RZCA 1S7WA 4GW4A 4M43L 3KYNA 3M07A 2F53D 5TGBA 5D70H 3U0TB 5FO8B 5F8RC 4ZPVA 2JJTC 2JJTA 1ED3B 1G7PB 1JIBA 3MXVL 4ODTL 4Y2DB 3EOTH 3ULUF 5HJ3B 1ROWA 2CRZA 4G43A 3RL1B 4I18B 1AFVH 4DKEH 1QNZH 1K8IA 1FL6B 5HHPA 3HC3L 1CBVH 1D5IH 2PR4H 1NC2B 2Z92A 4LPXA 5EOCH 4XVTH 1LE5A 3EYQD 2IWGA 4ZUUA 1F8TL 4NC2B 3O3DB 5AZ2H 1A6WL 1LK2B 5JHDA 3RWJB 2ZNWA 3UJJH 4KQ3H 4PRIE 1VGKB 4DJMA 4JKPL 3V52L 2EDBA 1HYRC 2SEBB 3BE1L 4LSRL 4JCLA 4OT1H 4U6VL 1MWAH 3GRWH 2F9BT 3MRKB 2EEBA 4NWTH 1MIEH 1H0DA 5HHXL 3QIBC 3QIBA 2ENSA 1UZ6F 3EOBA 5I19L 4H8WC 4FXGA 2JIXD 4YE4L 3MXVH 4ODTH 4X6CB 1DN0B 4WTWA 3V95A 3QDHA 3W5MA 3OJVC 5ESVB 1INQA 4JG0L 3WNOA 2IBBA 3HC3H 5EORL 4GBXC 1N2RB 5B4MD 1MFNA 3T04D 3FO9B 3AAZA 5CGYD 4UDTB 4K3JH 4M93B 4JFXB 2RIKA 3KGRA 3RVXC 3SDXE 3ESUF 3IJYA 3RUGE 1AI1L 1AGEB 1WWAX 1HK6A 2IGFH 3PWJA 1R5VB 5C0FA 2DOCA 3V52H 2GUOA 4Y89A 3V7MA 3MXWL 4G8IA 4NRYA 5FGRA 1EAJA 4ZOBA 4C58B 1C12B 1FZKB 1AE6H 3IJHB 2ERJC 3O9WC 4WTZG 3O9WA 4ELMF 4YXHH 3PDOA 5HHXH 4K07A 3FB7B 4BFGA 5GSVA 1RQ5A 4XHQA 5BRZB 5I1JL 1R0AH 5IQ9B 5I19H 1GH7A 5D7JD 1WIPA 4WIQA 1CLYL 4MJ6A 3QWRD 3FRPA 5GJTL 5CJQL 1ZGLP 2D7OA 5T1KD 4DZ8A 2W38A 4U1SB 4PRAB 2ITCA 4JG0H 5CIPB 4BSWA 3K80A 5DZOA 2ID5A 3FQTB 4HULB 3HLAB 4N0YL 5KZCB 3B9KA 2UV3A 5IR1B 2YUXA 3PHOB 4NKIH 2EDFA 3W39A 5DMGC 2ZSWA 1JWSA 1G1YA 3PQYE 3QDME 1CE6A 4OCNC 1AI1H 1V3LA 2G9HA 3RWIB 1I9RL 1TZIA 5IMLA 4KY1H 3S8WA 3P11L 5GS3A 1JF1A 4QRQB 4CNIB 4HS8H 3UTPE 4Y88A 3KLHD 5C6TL 4NM4L 4HXAL 1SJEB 4HIXH 35C8H 2BCKB 3HMXA 3PV7A 1QLRA 4JFEE 5I1JH 4HH9A 2RCSH 1NUNB 3S4SB 3SO3C 1BLNA 4NBYB 4ORZC 5HGAA 1CLYH 5TE7H 5IOPB 5CJQH 4OM0L 2FJHA 1DBJH 3HRZB 3P40A 4O02L 4G3YL 4LLWA 2PYFA 3VG0H 5FO7B 3L5XH 4I5BA 4L4TB 3BP4B 5GZNC 4ZS6C 4K71B 1IQWH 4JFOA 4L3AA 1UKSA 5C9JB 4MLSA 2GI7A 4JN2A 5HBBA 4L3EE 5I2IB 1I9RH 1NCDL 2ADGB 2OTWB 4UB0L 3UJIH 4ZMAT 4PB0L 3OXSA 4U1KA 4O2FB 3FB5A 1FGVL 3E8UH 2EH8L 4PP2A 3WHE0 1A7PL 4M00A 3QI9C 3JWDH 1BP3B 1I7UA 1H3WM 2ICWJ 3HAEA 2J1KA 1VPOH 4P9HL 1NGYA 2HT3C 4CRPA 4Z7VA 4E5XB 3HUJA 3D2UB 5DT1H 2X7LA 4HPYH 2OSLB 1PYWB 1JHKL 4QEGA 4P2OC 5GRVL 4MAYC 3K8KA 2VTFA 1UGNA 1J0JA 3G5ZA 5F9JA 5BS0D 5INCB 4WV1A 4ZFZA 1CXFA 2CLVA 3L7EB 4X99A 1BQHB 2R29L 3ZE2E 1OTTC 4XGZA 4L9LB 5GHWL 4WY7L 2I9TB 1MCEA 1X7QA 5ISZD 2W9LA 4M6NH 4ZSOE 4KRPB 5DD6A 1EJ6A 4XBGA 1BZQK 3NA9H 5I30L 2OTPA 4K3GA 4KDWA 5D6DA 4Y5YC 4Y5YA 1H8OA 4PRBA 4XPFL 3RHWF 5AD0A 1E4XH 3UPCA 2OQJA 4D8PB 2CUHA 3VXPB 5SWSB 2FX7H 4N0UE 4F3FA 5GRUL 2ESVB 4Y2OA 4I8DA 4DUXA 4WCYL 2ICWA 2VDNL 3AVEA 5LG1A 1HQ4B 1MAJA 32C2A 1KJ2B 3VGBA 2AJUH 4IRJD 3NCYS 1MPAL 1EUTA 4FQJL 3LB6D 4XAWH 4WFGE 2DBLL 2B39A 5E4EC 3VGAC 4KI5F 3ZT7A 3W2DH 1Q8MA 1RFDL 5DD3L 1ZVHA 1UFUA 2I07A 2IQ9L 5E1AA 5DS8B 4FQIL 4S1SH 3D3VB 4UOW1 4WY7H 4UZGA 5DD0L 5EFIA 4RMQA 4POZD 2XG5A 1IM3A 1Q94A 2X1QA 4L8DA 1IRAY 4X9GA 3LIZL 3MLUL 4G8GD 1IL1B 1EHLH 4H0IA 1BIHA 1EFXD 4F2MB 4UAOB 1YNTA 5I6XB 1T04B 4Q58C 4KTDL 4LSTL 1QBLH 1YPZA 3FRPG 4Z9KB 3BIAX 1ZHLB 1VFAA 2NY6C 4F7TA 5INDA 1YN6B 4HFUH 2UZIH 2J8UF 4NDMA 1KN4L 5BZWA 4KZEH 4UT7H 3S5LB 2W0FB 4QYOB 1OGAA 2I5YH 1F58H 4YXKH 2ICEB 2DWEA 1HNGA 2PXYB 4P5TB 2E27L 3QDGE 5EU5A 1KSRA 2CIIA 1MPAH 3BUYB 4FQJH 2DLFH 4DEPC 4DGIH 1B0RB 3NCEB 3GNML 1FN4A 4PFEA 4AEIL 4F15B 1ZHNA 3DUSB 3REWA 1B0WA 4ISVA 3BH8B 4ZXBD 3OKOB 1J86A 3QZWB 4FQIH 2OJEA 1UXSA 1DEEB 2VE6A 4G6JH 5KTEL 2F74A 1Q0XH 2ZNXA 1NQBA 1CXLA 5KG9A 1WCQA 3HI1B 2XZAH 4YHIA 2DLGA 1QKZH 3V2AR 4P46A 3WIFA 3UTZB 4MNHA 3PHQA 4KTDH 2O5YL 4E9LA 2QHLA 3WDIA 1KUMA 5C0RL 2D4FA 4QRRE 3CFEA 4QXUH 1EJOH 3DRTA 3KLAB 3IAQA 5CBEA 5C0JB 4E41A 1SQ2N 5DYOA 2DYPA 4YAQA 1A0QL 1FAKT 3EGSB 3EW3B 4PGEA 1BFOA 2FR4B 4JQIL 5B22A 3MJ8B 4AM0A 2C3XA 3MLYH 2ZUQB 1NDMB 1TCMA 4PJAE 2GY5A 3QG7L 3VRJA 4U0RC 4Y19E 3T0DA 3JSSA 5D7LD 3GHBH 3MLZH 3TF7C 4G6FD 1N5AA 5C0IB 4I4WB 1DDHB 3KDMB 4PGCB 4H88H 3KAAA 4ZO6A 4JRXD 3U0WL 2VWEE 4WI8A 2NR6D 2XNAB 4QGTA 2H2PD 1WUNT 2UY7A 5FIEA 5IW1A 2XQYG 2I24N 1S7SA 3T65B 2YD6A 3CC5A 4C83B 3ARBB 3TO4A 1JWMA 4HK3N 3CXHJ 2EXYC 5I75C 1NMBL 3E0GA 1XF5B 1O5DT 1RZ7L 3VFMA 1XCQB 4M8QA 2G5RA 3VFUB 3QJFA 1FNFA 2PW2A 3IDMB 3LOWA 3CXDH 2OL3L 4UIKL 2X70B 4RMTA 1BEYL 1GC1C 1U58B 4PLKD 3MV7E 1TTGA 4DUVA 4PJ7A 2PTUA 2BVQB 1EA9C 3I02A 5ILTL 3DRQB 4MCZB 5JTWA 1T5WA 1LO3H 4L4VE 1A1MA 5DQ9B 5I1GH 1A6TA 3LSOB 4UDUA 1PKQB 3H9SE 1PX4A 3BPOB 4JN1L 3CSGA 4ELMB 1J9CT 3WIIH 3MRMA 3D85A 3VFWB 5I1EL 5ID0A 1KLUA 4PY8J 3WLBB 1Y0LA 4FQHA 4P4KA 1KB9K 3PUCA 5CAYB 4HEME 4M1DL 5BVJA 4HBCH 4N8VB 5C6PB 1Q9WA 2Q8AL 2HLFC 1F5WA 2YN3A 5I8OL 4HUKB 1EHXA 4AYFA 1RZ7H 1BVKA 1NH6A 1DQTA 1TVBA 2W0KA 4KROC 4TPRH 4QO1A 3TIDA 5C09E 5T1MB 1A02N 3ARFD 4IOIA 1U3ZA 4MJID 1LK3H 2IPUK 4OGAD 5IHLB 4HJ0D 1KGCD 1WBYB 1OAUL 2OL3H 4GRWF 1MEXH 1P7KA 1PVHA 1QSFE 3LKQA 4NQXB 3T2QA 2BHZA 5F7KC 3BGMB 4PJEA 3VXRA 2XZCL 3C2AL 2DQFA 5ILTH 3HG1E 5IVXA 3VXOA 1U8MB 3MMEA 1ZSDB 4PJ5D 1IFHL 2MNUA 4XMLL 1U3YA 3GJFB 4XC3L 4OFPA 4A6YL 3ZDXF 5KOMC 3WFCH 3GBNL 4D3CL 4CU8A 5F89B 4TYUA 1QFOA 2GJ6B 2YRZA 1JMZA 2QQKH 3I6GB 2FDBP 4IBLT 1PLGL 1DBKL 2E9WA 5IV2B 2Z4QB 4HIIB 5DF0A 1WTLA 5I8OH 5HHQB 5K9KB 5J89A 2XYCA 4JFDA 4MQSB 1YEIL 5KVDL 5JPNB 1NAML 3SDAB 3FHAA 4LMQE 5IEHA 3FT4B 2IPKB 5EWIL 5T1LA 5ITFA 4F58H 5D2NB 4NO2A 4IMLB 2LTQB 1DTUA 2BSRB 2FZ3A 4NQDB 1SEBA 5JORA 1AHWC 3F5WB 1F4HA 2A77H 1T6WA 4K94L 5EG6C 4HKZA 1WWCA 5C7XL 5KS9E 3GO1L 1R3JA 1LDPH 2AI0L 1ZEAL 3M17B 4OI9A 2O61B 1SJXA 4WI6A 3EZJB 4Y4KC 1YYML 4Y4KA 5L2KD 3GBNH 1WITA 4D3CH 4R97B 2Z31D 1MJUL 5CKGA 1FE8L 1OAKH 4BFBD 2XXCB 3BRFA 2EIEA 4LSPH 4U1MB 4PJ9D 2A38A 3TEUA 3SE8H 1WFTA 3FHQA 4XZUB 3DIFB 5HYQA 4XCYA 1YEIH 4GMTL 2RBLA 4YIQB 4ZUVB 2HKHL 1R5WA 1NAMH 4WVRA 3ARXA 3MRJB 5DFWH 5T5FL 1L7TL 2AXGA 5BMFH 4EVNA 3MRCB 4AEEA 2W60B 3NCBB 3S34L 1ZLSH 2AS5M 5I1KL 1OPGL 3FN9A 1A3QA 4WI7A 1HQRA 2C26A 4R0LC 4R0LA 1OOAA 1ZEAH 3G6DH 3O8XD 4WNQB 1K4CB 3MZGB 4YGVA 4UNUA 5JPMB 2VIRB 2WWMC 3QEQA 3KPMA 1YYMH 3QUXB 3SCMA 5LGJA 4LPWA 5EA0H 5BRZE 2CJUH 5KN5B 2UZXB 1BREA 1FE8H 3IS0X 3VWKD 1ZE3C 1U3HA 1CU4L 1A6AB 3T1WA 5FYJE 3U83A 1AGFB 2W65B 2NZ9C 4LBEB 4PJHE 3L3KA 2HKHH 1DANU 1ZWIB 3LQAC 4OZ4A 3SDDC 4JREB 2FSEA 3LKSA 1JL8A 4GQ9L 1U95A 3K3QA 1N4XL 3DV6A 3MNZB 2F8VA 5BV7B 3K1KC 2GK2A 4R4BA 4LK4A 4RMRA 3VFNB 3Q5TA 2EE2A 4LU5H 3FT3A 2Y6SC 4AJ0A 2NY2D 3TV3H 2J8UB 5M94B 2WUBH 1IGIH 4HWEH 4ODXB 3W0WD 1JWUA 2OZ4L 5I1LA 5JA8B 3UCRA 3VWJD 4PIRF 1J10A 1ADQL 2MPAH 2EIDA 1UKTA 3CX5K 2GTWA 3BIKA 3PF2A 3ULVE 3X13B 3JTTB 4HK0A 3MRHA 4ODUA 3EYOB 4YZFF 1K5NA 2AK1L 4U6TA 4OFVA 2OK0H 2BNQD 3CLFH 4PJCF 5DC9B 2HJFA 3IKCA 3T0XA 3PWLB 3HNTL 4G6KH 2Z8VC 3BP7A 3G5VA 1JZ3A 3KS0J 1N8ZB 3WIHL 1P4BL 5CHNB 3BP6A 4AG4H 4KVCH 2VDRH 4RISL 1XGTB 5JHDE 2XPGB 4JFFB 4BZ1L 3SKMB 1FFNB 5TE4H 5IVZA 4LCWA 3V7AG 3S36H 1HHGB 3OJDA 1RU9L 1DQLH 1RJLA 3WNMA 3P4OB 2V7HB 3CSPA 4WW1B 4S0TD 4NZTL 3VFSA 5I9QB 3WHE1 4MX7A 4OZFA 4XVUC 4AT6B 5D4QA 2Z35B 3GI8H 2EDYA 4M62L 4NO0A 5D72L 1V3MA 4H8WH 2RQ8A 4LLMA 3NACL 1B2WL 1EX0A 5DJXA 5TFSL 1NGWA 2WSKA 3PL6D 1G6RB 5LWYL 3LV3B 3VXNA 1XR8B 1MLBA 2YD3A 3ZHDA 4NCC1 5IEKB 3WNKA 4XCNA 4FFYH 1T1WB 1PG7L 1R5IA 4WENB 1IGFH 1QZ1A 1BECA 3O0RL 1WCBB 5SWZB 1IEBB 4JVWA 3QCTH 5SWSE 2DI9A 4ZODA 1UYWL 2EEDA 4G9DB 3X12A 2ESVE 3QEHB 4K8RC 3NFPB 4OQTL 1Q1JL 1U2CA 2WINB 3IFPB 2CKNA 1AXSB 4JZNB 2NXYC 3ZSSA 4XP6H 3MV8B 3OZ9L 3FOLB 2VLKD 3F58L 4PGZA 3VGGA 5D8JH 3O11B 1XZ0A 4XAKE 3D3VE 4K7FB 5CKAA 1F3DJ 3G6AA 1MQKL 2W9DL 1A6PA 3KWWB 3VXMA 1HH6A 5L2JA 3VD5A 1W72B 4XMPH 5BOPA 2XWJA 4LLUA 2UUDK 3F7PC 5GRWA 2LVCA 1M71B 3C6LC 1C7TA 3C6LA 5B39G 4Z7QE 3P4NB 3ZKNC 4OLXH 1FGNL 1KYOJ 2L7JA 5GGSY 2DQDL 2AK4B 5FYKE 3TN0D 4ZD3H 1PG7H 1YEGL 4RFEA 5DHYA 4MD5A 3V6OE 3T0ED 4LCIL 5F9DC 4LKCB 3BHBA 3C5JB 1IEAB 1DN2A 1KIPB 5CMAB 5D7SL 4L8BA 1VEPA 1CDUA 5T3XD 5IBLC 4IRSC 3DX7B 4IRSA 3KPTA 1Q1JH 5EDXA 1S9WB 1QO3A 4WFHE 3RWFA 3OAYH 4GRWB 1A3LL 4QY8A 3KPRD 3OZ9H 5EO9A 2WLZA 3RTQB 4PUBH 5SX4H 4D0BA 4JHZA 4CVXB 2FX8L 1TLKA 1CGSL 3ZZ1A 1MQKH 2IH1A 2VXQH 5B21A 5GGUA 4AH2A 4WWKD 1D5ZA 3SY0B 3OKEB 5IFJB 4H25B 2VDOH 2NY3D 1KCSL 5GJSH 4LSSL 3G6JA 1WZ1L 3KPOB 3OX8B 1TQBC 4LP4A 2FGWL 4TTDC 5D1ZA 5JIKA 3F7YA 4APQD 4DW2L 3P3YA 2VLME 4G8FA 1MRFH 1IC7H 3IDIB 4U1GC 1FNGA 4V1DD 1VA9A 1RZ8B 2W0LA 3VXUB 3SDYH 3VG9B 3GMOA 2CKBB 3QIUC 4Z7VE 3QIUA 3MGTB 5HGHB 3BH9A 1ZHKA 1F11A 2BRQA 4OTXL 2CD0A 1IAIH 2BVEA 4GKNA 2YD9A 4H20H 4NJAL 4XNQA 1CS6A 3HNSL 1OCWL 2ZUSA 3FQWB 4M8VA 5IJKC 1BBJA 5A16A 5IJKA 1A6ZB 4HUNB 4OSUH 4ZAKA 1J11A 2DM2A 5DK3A 1JPST 1W0YT 4EUPA 5IHBA 1NCBH 2MQCA 3H42L 5DTFA 1CGSH 1YECH 5JMOC 5DMKA 4HWBL 4JPIA 3FN0L 5EPMB 4NN6B 1B6UA 1I9JL 1KCSH 4WO4B 4LLDA 2ZOKA 4J3XA 1I8KA 3C5ZD 3MLSL 4JDZA 1DQQB 3CGTA 4OZFG 3EHBC 4G5ZH 5I18L 1RUKL 5JMRA 4KJYB 1UZ6E 1XR9A 1VESA 5I1AB 3GSWB 4W6YB 4NQTA 1DSFL 2YPLA 5MEND 5C08A 3BWAA 1UQSA 3SJVE 4D9RE 2E9BA 4OTXH 3VRIB 1SBSL 3PDDA 3B43A 4NJAH 1ACYH 2BSSB 5F1NB 3DECA 3LY6A 4TVSa 4XCEA 4ERSL 3QQ4A 5K9QG 5KSBA 3F8UB 3V5KA 5H35A 4LHQB 2QLVB 1G7LA 1JF5A 1PW3A 5HDBF 1J8HB 4D0DB 4BFIB 5CILH 1QR1A 3HZVB 4TVPD 4KJWC 1G9MC 4XP5H 1R6VA 3LH2H 1G7PA 1U8NA 3WV0A 3MLWL 3SPVB 2EZ0C 4QT5A 5TDNB 4HWBH 5SX4I 2ZUTA 3RWGA 2DTML 4GXUN 1FO0A 5BCAA 1K3ZA 4I18C 4I18A 5IW6B 2EYTB 3V4UH 1FRGH 5DHVA 4ELME 1AP2B 1MF2L 3D0VB 1FNLA 1JK8A 1FZJA 2R2HA 1FYTA 1RJYA 1R3LA 3BP5A 3PWNA 3O3DA 5CEZE 4ORGA 4RIRA 1NEZB 5CD3B 1ZA6B 4YHPA 1CDIA 1IBGL 4AQ1B 1GZPB 3BFOA 1YEDB 2G75B 1QSZA 2AJYH 2RFXB 4C4KT 2P24A 3OXRB 4JAMB 3H3KA 4JRYE 1GZQA 5F96H 5DJAA 4KJQD 4NJ9H 3DSFH 4OF3A 3BKML 4HIJA 3VJ6A 1TXKA 3QFJB 4HQQL 4L8CB 1HH9A 1DBML 3MFFA 4N90E 4X6CA 4AQOA 4YQXL 5EU6A 2CMRH 43C9B 3NZ8A 2XICA 1I1AD 1EERB 1EZVY 3BD4A 4P3WA 1XF3B 4MXVF 1FVEB 2DJUA 1YN7A 4LEXH 1QLFB 3NN8B 1MI5A 4HH8A 1BD2B 4DTGL 2GHWB 4PJCB 4HUWA 3BQUD 2C4FU 1WQVT 5DEGB 1IBGH 5E24E 2IFFH 1II4E 5F6IC 3NFNB 5DJ8A 5CJOH 4NYLA 4OLEA 3EYUH 1L9MA 4NZRH 1OB1A 3OAZK 2FD6L 4M03A 4ONHB 5D93B 5AZEL 4WU7B 3WXVH 5D2NE 4J3OC 4ODHL 2V9TA 1IZJA 2Q3AA 1QTYT 5BQ7A 43CAB 1FJ1A 3VD7A 3QUML 2PO6C 2PO6A 4D0CB 5I1IH 1D6VH 1QRNB 4PB9L 4RFNB 1EVUA 2BVTA 5CIPA 4ZFFA 3RWDA 4LHUD 3N85L 1NFKA 2FECL 4M7KL 3HLAA 3TBWB 3BZFA 4M61B 1WC7B 1WZKA 2VZ3A 4EUPG 3EJJX 5BJTA 4NQVA 3DX8B 4XPBL 3ZYIA 3HE7C 1MCBA 1GL4B 3HE7A 1KCRH 2N4IA 4FTVA 1I1YA 1LNUB 5HHOD 1MCNA 3FONA 4DOHB 2EDHA 3IFOA 1LO0H 3RVWC 4R2GD 4YUEH 5E9DA 2XACC 1X5FA 3P4MB 3ZYOA 1GGYA 3U48A 1NGQL 1LILA 5AZEH 2FD6H 1JNJA 3PQYD 3QDMD 4FQCH 4I2XB 2WBJD 3MRBB 2V2TB 3ALPA 2P8LB 5TE6H 1A14H 3W82A 3S4SA 1NBZA 2GK0A 5IHZB 4WEBL 4M3JA 2ZUUA 3ZTNH 1GC1H 5I71B 1BWMA 5I1DA 1JGLH 2HH0H 3HRZA 3S6CA 4U1JA 1FFOA 2A73A 2J4WL 1U8IB 25C8L 4M7KH 4JFED 1BBDL 4LEOB 3S97C 4C55A 4NHCL 4K71C 4Q9QL 2P8MB 4S1QL 2OR9L 1M05B 3QUYC 3QUYA 4KI5E 3DMMA 4GT7A 2HLAB 4Z7UB 1NMCB 2YPKA 1NBYB 1T5XB 5E99H 4WJ5A 4OD2A 1D9KA 3QH3A 2BX5A 2E5EA 4NFCA 1ZVSB 2OSLA 2JE8A 3VXRE 3D39A 4OV5B 4L3ED 1K85A 2NY0B 4NIKB 5L6YH 2BFVH 5FM5O 2VZ1A 5HDLA 3TYFB 2J6EH 2VAJA 4WEBH 4YNYA 3BDYH 2HTLD 5GQBA 2J8UE 1Y6NR 4OLUH 3FL7A 1FAIL 4X5XB 4L9LC 5E5MB 3QNYB 3WXWL 3EO9L 2UYLA 1TZHA 1WICA 1AJ7L 4S1QH 1PY9A 1CFSA 4URTB 2BMKB 3DX9B 1YDPB 4JLRA 1YEJL 1R3HB 2OX5A 3LRGA 4YR6A 4ZFOA 4HUUA 3CMOL 3MRPB 2AJVL 3VXPA 3TESA 3BVNB 5JR1H 3R06B 5K9JH 1HKLL 5E6ID 4N5ED 2CPCA 3IXTA 2E7MA 4P5MB 5D5MA 4M6AA 2BSTA 4E0RA 1FNHA 4MQXC 1MIML 4QXTB 1MFCL 5I73C 2DKUA 2O5ZL 1J0HA 2B2XL 2V2XB 5H94A 2HN7B 5HYJA 4LCYA 5GGTL 2IADB 5ESQB 5E95B 3BN9C 1A6VL 2A9NL 3AY4C 3AY4A 5E8PB 3B9EA 4XI5D 1S7VB 4NZDA 4OF7A 3FO0H 4KK5D 1AJ7H 1AKJB 3CD4A 1P4IL 2GT9B 4PG2C 3SKNA 4XTRD 4KDTA 5T5NF 1T66D 5B38A 3FQNA 2VLJB 3MODL 3GBLA 4PJIF 2DDQH 3V6OC 1WEJL 3RDTB 4F8TA 5FEBA 3D69A 3CMOH 1T1XA 3ALXA 2Q87A 4GKOA 4ONGH 5JW4Q 3L9RB 1XF4A 5D9SA 1F2QA 5J1AB 3MRFB 5F1KC 3FOMB 1NEUA 1Z9SA 4RA0C 3TBSB 1UWEH 1BQLH 2P5WA 4JY4B 5EIVA 3EDKA 4K23L 1H3UA 5JZ7D 2XWTA 4GMSL 2ATPB 3IU4L 3RBSA 1RHFA 2HVKB 5CEYA 3BGFC 2AV1A 3TCLB 5EU3B 1XGRB 1Z3GH 4O58L 4UTAL 4M7ZC 5L88H 2BY3A 5C0GA 3U4EB 2VERN 3S4SG 4FQLL 1RHHA 3VFVB 2C3VA 1TVDA 2F8OA 3MV8E 2HMIC 4DN4L 4KJPD 2E6QA 3GIZH 3OKLB 2YD7A 3GB7B 2NMSA 4NT6A 4GW1B 1J1PL 4PY8I 2VNCA 3ULUC 1NLDL 3EJYC 3QEGL 3DI2B 2EC9U 2X4OB 3LQAH 4WDIA 2AJXL 2F53B 2AK4E 4PREA 3MJ8A 2Z8RA 2FO4B 2ZUQC 3DVGB 2F54A 3QIWA 4CMHB 4QRRD 1A8JH 4MA8H 4TTGA 4K23H 5IFHH 3F6IA 3O6MH 1D7FA 1RJZB 1PEZA 1GGCL 3BPCA 2AW2A 3ZSTA 2NXZD 1UCBL 3KYOB 5MHSE 4I4WA 3OR6B 1CTOA 4CMMB 3KDMA 2QV2A 4FQQB 5DQJB 2VQTA 1P84J 1IC4H 4XX1G 1I3RB 3KHQA 4QHLA 5J56B 1YC8A 1LGVA 4K3DL 4FQ2L 4FQLH 4GRWE 4NC1E 5HHVH 5CEXB 1DQJB 5FGBA 2ADIB 5L9DH 1LEGA 4HUVB 1MRCH 4L1DA 3EO0B 2DWDB 4XWOD 1TQCB 3VU2A 3FB6A 1J1PH 4YHML 3JBG7 1LO2L 5J06A 1NLDH 4PGBA 4YPGB 2J5LB 3HHRB 1CK0H 1AIFB 1C5BL 4U0QB 5ADPL 2AJXH 4AIZA 2IBZY 3ZDXE 2R8SL 4ZNCD 5E8NA 3NZHL 1RUPL 4MSWA 2JIXB 3JUZA 1RUQL 3QNXA 3VXQA 4MNQA 3RWCB 1U8KB 1OAXH 2Q20A 3VXUE 5FM5M 1A9BB 1GGCH 2K7QA 5DD5H 4MD4A 1UADC 1RSFA 2R69L 4BH8A 3E6FA 3T77B 2LU4A 2A6DB 3V5HB 3CPLA 3TZVA 1EXUB 3QFDA 3LSOA 4JZOB 4XNUH 5EZLB 4NZUH 3MLPA 3BPOC 1NCAL 4LKXA 4X0KA 3G9AB 4I48B 3T1FA 2GSGA 1E6OL 3U46B 3MRNB 4CGTA 4OZFH 3VI4F 4Y1AA 2WK2A 1QOKA 1W8NA 3ISWA 4IMKA 3QHFH 4L4VD 4UILL 2VXVH 3FFDA 15C8H 1LO2H 2LV4A 4JHWH 4XP1H 3O45B 6FABH 3O6KH 3NABL 3AREC 5B38G 3AREA 4KUCF 3IU3B 1MCOL 4Z7NF 1RK1A 5TQ2L 2D3VA 5ELIA 5KSVB 3HB3D 4O4YL 4OAWA 3S96A 2XT1B 4IIQC 1B4RA 4IIQA 4MDIA 4QWWD 3D9AH 2AJSL 5T1KB 3MCLL 5DR5L 3GSNA 3S5LG 1Q0YH 4BA8A 4AEHH 1U8MA 5MEOB 5DO2D 2WUCH 3P73B 1P2CB 3LS5H 3MNWB 1NCAH 4K8RH 5MEQB 3IAPA 1BIIB 2I9LB 1A3RH 1RZIA 3EDEA 4U33A 4AIXA 1E6OH 1AD9B 1J8HE 5CWSB 4Y4FD 2Q8BH 1YMMA 2VZUA 3TNNA 5D7KE 3VXME 4UMGA 4X6FA 2UZYB 4EJ1C 4DCQA 3C8KB 2F5BL 3ILQC 5CGTA 4S10A 2A1WH 2HG5A 4X7CC 4QXGH 3RX5A 2DJSA 4UBDD 2KPNA 1F13A 5JPNA 3MACL 2D7MA 3SDAC 1KTLB 3MJGX 1VEMA 3TO2B 3UTTD 5LAXA 1EBPA 2CDGB 1WV7T 2R56L 2H32B 3L1OL 4Y2DD 2AJSH 3WLWD 2BSRA 4H1LB 4NQDA 2FJGB 4Z78B 2DQJH 4LCUB 1VKXB 9CGTA 3L3HA 3H0TA 3OAUL 4OBSA 4HCRA 2CDFB 5E56A 4U1HA 1NC2D 4NSKB 3M17A 5C1MB 4JFYB 5DJYB 1EGJH 2HJLB 4KK6C 2GEEA 2OR8A 1Q9LA 2R0WH 3LKNB 4X4XA 3STBA 3ZE1E 1EEUA 4NO3A 4OCXL 5ICXA 3B9DA 2ITDB 3ARDD 3QFJE 3ZMRA 3BZ4B 4BUGA 4Z76A 3ULSA 3TFKD 4PTUA 3Q0HA 1GGBH 1LP9A 2B5IC 2IALA 4J3TA 2BC4B 4YDKH 3SDCD 1W0VA 3QULB 4PRDA 1OTUD 3O4LA 5BS0B 1A7OH 2PKDA 3WUZA 2RGSA 1ZTXL 4RX4D 4P5KB 4L5FH 2C5DC 3GMMA 4PTTA 4YZFE 3NH7H 4XPGL 2FO1A 1BD2E 1HOCA 2V7NB 4TUKL 5E7FA 1UJ3B 3DO7B 1EAPB 4O2CA 1MRDL 4PJCE 2YBRB 2E9IA 5K9QI 2MCG1 5ISZB 4F7CA 5DUPL 1AGBB 3OL2A 3MR9B 5IHUH 2MHAA 3QUXC 4O2EA 3QUXA 4OFYA 4CU6A 4PRPA 2X09A 4NKMA 1EO8L 2R9HD 2QQLH 1PG7X 1QR4A 2VOTA 1S78D 1A6AA 1AC6A 1A1NA 3CU1A 3C2SA 1QRNE 3ECBA 4EUPH 3QUZA 1PZUB 3PWPA 5ANMB 5EULV 3GUTB 4IRJB 3TVMD 4L29A 4U7KA 3RNQA 4G8EB 4F9PC 4F9PA 1WLHA 5BRZD 4JREC 3GKWH 2DQEL 4FFZL 1F00I 1FFPB 4M1CC 1JHLL 1ZLUH 4RMSA 1J0ZA 4N8VG 5BV7C 2VLLA 4YO0A 5ABDE 1WBXA 1WZMA 2BNUA 4PJIB 4FS0A 1KLGA 1IGCL 1HDMA 4TOYL 4KAQL 3O2DL 4DOHE 5EC1A 3MBED 1KIRA 5DUPH 4RMUA 4G8GB 3BRDA 1EFXB 2VDLL 5DMYA 3QCVH 2FWOB 1DFBL 4I2XE 1AGCA 1KJMB 4XBEH 5JIPA 1AY1L 5C8JB 3FKUS 3K8LA 5HI4D 2OXHA 3EYOA 3UZVB 3LQMA 3HC0B 3GJEA 1XIWD 4X6DB 1G9MH 1G7IB 1N6VA 1G7HA 4NRXA 3AS2A 4JY6A 5F3HA 2X5PA 1QVOA 2DJ4A 2J2ZA 1FO0H 4OLWL 1SVCP 3MO1A 1XGTA 5DHVH 3SKOB 1KV3A 3PV6B 4ZXBB 4Q6IC 3ZTJG 4Q6IA 4YEEA 1I8MB 4X4MA 3TH3T 1MAKA 3BKJH 1LD9B 3PWVA 2AQ2A 1T3FA 2AQ1A 2HKFL 1Q9KB 2OYPA 5JHDD 4KI1A 1DFBH 2DQHH 5FDWA 5KANG 1EEYA 2W0PA 4MB5A 5I9QC 3HZKA 5GRJL 5DFVD 5EU6E 5L7XH 3KPNA 2A9MH 5C0CA 1OWRM 5IP4A 1AO7A 3QIBD 3DVFA 3CAFA 5FYJL 2QHRL 1F4AA 3U9PL 4QRPB 4L9DA 1A7RL 4Z77A 4OLWH 5FB8A 1XR8A 3I6LE 2VAAA 4OLZL 3UTSA 3T8XB 4M6OH 3QO1A 4KK8C 1CGVA 1U93A 5D7LB 1SEQH 3I75B 4GUPA 3NTCL 1QA9B 3GSXA 4G6FB 2X4RB 1HINL 4XH2B 5E8DH 1WCBA 3VGFA 3OJMB 3DUUB 1T7ZA 4JRXB 4MAUH 1QEWA 4KRPD 4LLAA 5DURD 3RVXD 2HKFH 2Q7NA 4EDWL 2A6IA 3I6KA 3HR5B 2ZWLT 1FZMB 1TZGL 1FDLH 3TPUA 4OD1L 1JJUA 1TJHL 3PNWB 5ADOL 4P59L 5IMKA 3ULVL 4LPCA 1UB6B 5SWSD 4PJ8D 1KT2B 3L3OB 1YUHA 3SKJL 1IAKA 3IVKA 1H3TA 3O81A 5AYUH 3RY4A 2HJKB 3I50L 5IB1A 1U8QB 2FATL 5CIPH 5HYSA 5J1TC 5I15L 5FHAL 3QJHA 1JF6A 3C9NB 1HKFA 3LKRB 3RVVD 2VLJE 2A2QT 4WEUD 3AXLA 4L1HA 4LOUC 1RMFL 4XAKD 4LMQI 1E4WL 4DGYL 5IW3A 3B9KD 2FH6A 3LCYA 3QAZB 2EDNA 5DMGD 2HTKD 3QNZA 1G6VK 1MCDA 4FZ8L 4OCSH 1T20A 4L8SC 4L8SA 4OD1H 1TJHH 5ADOH 3I2CH 3QDAA 4ELKB 4D94A 3B8YA 1LE9B 2VZVA 5F3BA 3WFBH 4LLYB 5CS7A 3RTQC 5HGBB 1ZS8A 1M6OA 4JFZL 3CDGB 4P5TD 5C0AA 5IQ7L 3ARFB 5DUBB 4GG8A 4R8WH 4BK4A 3OKEA 1GPOH 2D7TL 3RI5K 1T1YA 3V0VA 3IFLL 5FYJU 5CBAB 4DGVH 5TF1L 5IKCA 2R0KH 1FQ9C 3T4AA 5EUOA 1QFUL 2DL9A 4EOWL 3OX8A 4IJ3B 5E2VL 1OAZL 4XNMB 1Q72H 5HDBE 2ADJB 5ACMA 4KMTH 3E2HB 2VSDA 3V0WL 1KIUA 4UT9H 1E4WH 3RRQA 3VG9C 4PJ5B 4GAYA 3BMWA 3VFTA 4AL8L 1IAMA 2GITB 4ZS6D 2AQ3A 5I76B 4Z95H 3FQUB 4MCYB 3NCFB 1W0WA 1BAFL 4JEGB 3TWCL 2F53E 2IQAB 4HXBH 3JWNC 1R3KB 2VLMD 5DVKA 1OTSD 1KJ2L 3P9MA 1Z5LA 1JHTB 4BELD 4ALAL 5IF0B 4ZO9A 1ES0A 5I16B 2X05A 4MXQD 3DSNA 5IQ7H 5HPMB 5FA3B 2X9WA 3ARZA 3NVQA 1OF2A 4MHHG 2A0LD 4PY7B 4WO4C 1DCLA 3PWUA 3OB8A 2HT4C 4JKMA 2F19L 1ZT4A 1JNLL 1I7TB 1QFHA 4Y5VB 2M2DA 2ZSVB 4X98A 1QSEA 4Y4HC 4PPTA 4Y4HA 5I1AA 4LVHB 5FYKL 3GMRB 3STZB 2BJMH 1EIBA 3GHEL 4OZIA 2XKNA 5F71A 1KCKA 5C0DA 1MUJB 1DE4B 5B3JF 1WIUA 5HHNB 1S8DB 3SGJC 1OSZB 1T1ZB 4HDIB 5L2KB 4WHTB 1I3GL 5EZJB 3K74B 2GAZA 1TETH 2Z31B 3BPNB 4MXVE 4HHAB 1TPXB 2EDXA 3EYSH 3ARBD 1JGDA 2YC1B 4OV6F 5DI8B 1DUYB 2Y9RT 1WT5C 2X1PA 3MRQB 1G0XA 1TFHA 1WT5A 1KTKE 1RZKL 4PJ9B 1JPGB 1P1ZB 1KCUH 4N8PA 4N0CD 2DMCA 4DAGL 1QFWM 2XZQH 2FEDC 4ZUWB 2UWEA 4FMKA 3IDNA 3SJVD 2BVOB 4D9RD 1FV1B 4PGJA 1LEIB 1J5OH 4XP4L 1KELL 3SE4C 3SE4A 2JB5L 1RUML 3U6RA 1CG9B 1LHZA 2K3TA 5FO9B 2VXSH 2ZUXA 1WFNA 2EYTA 3WKMH 4YFLI 4C59B 3KYKH 3CLEH 4KHXH 1AP2A 3HMWL 4NN5B 3WFHA 3C60C 3LS4H 4U6HB 3C60A 3LQZB 3OMZA 2E8YA 1QHOA 4NHUA 2VDPH 2XV6B 5JDSB 3O8XB 4QHUB 5EIIB 3Q1SL 4MNGA 5I1CL 1NFDF 1F4XH 1KB5B 4RAUA 5GIRA 4PV8A 1YEDA 3TBVA 4RQQB 5HY9A 1JPFA 4H5SB 3ULUL 2NY6D 1CICC 3EJZD 2P5WE 1CICA 1H8SA 2NX5A 3VWKB 1JV5B 3H9HB 1D6EA 4KU1A 1F02I 4DAGH 1J05B 3S35H 3FTGA 5F93C 4A2LA 4IRZL 2C1OB 3BMVA 3BXNA 4OUUA 2DL2A 5H8DA 3WNLA 4DVBB 1RUMH 3ALWA 5EUKA 4JRYD 1YY9C 1OAYL 1UG9A 5J7CC 3KXFA 2RHEA 1XF3A 3JV6A 2V6HA 2IG2L 4L3CB 4TUJB 3M8OL 5DRNB 5DUMH 4I1NB 4YJZL 3WS3A 4N90D 4IOFD 1CFNA 4KUZL 5C0EA 1FZOA 2O5XH 4P46D 1C7SA 5DJ6B 4HX1A 4QOKA 5IB3B 5DRXB 3W0WB 4X4YB 5FYKU 3VWJB 5E2UH 3TT1H 1FNEA 2CK0H 4R96A 3KPSA 3ULUH 4JPVH 3EFDL 3BZEB 4CAGA 4E41D 1KBGL 1QUNA 2CDEA 5K93A 3J7HA 1RZGB 2BNQB 4OKVB 4ZNEE 2BOCB 2GJJA 4P2RE 3GSVB 5FUCC 5LKNA 3QO0A 3V4PL 4F7EB 2PTVA 3MBXL 1KXTB 4OZHF 1SY6A 5F7UA 4QRSA 3IGAB 5KSAC 5IB5B 5IROC 5KSAA 4OCWH 4PLJC 4N8CH 4HFWA 5F7YC 3IKKA 1UB5B 3DX8A 3BJLA 1A1OB 4QHNA 4XP9H 4OF5A 1U92A 1RIUL 5CEZL 5FV1L 3WHXB 2AAVA 4GG6F 3X17A 1ZANL 4LPTA 4MS8C 3TO4D 5GGRA 1YEHL 3BYTA 3ROLA 4YHYC 1JGEA 2YXMA 3MYJB 2A6KA 4ZO8A 1EO7A 2YA1A 4NKQB 3TNMA 1T83C 5I8EA 1T83A 2Q76B 3VI3F 4XVJH 1QQDA 1P53A 2P8LA 3MFGB 1HZHL 1OLZA 4HW6A 1ZLVH 3F7VB 3V4PH 2X89A 2XQYK 5I71C 3LEXA 1QBML 3RWHB 5GISL 4FQXC 4FQXA 3PL6B 1XGYL 2GSIA 4PRNA 4JKLA 4HC1L 2XRAH 2YKLH 4FNLH 1U8IA 1V5JA 4Y1AE 3OKMA 2D0FA 2NTSP 2C9AA 2GCYA 4JPKL 1M05A 3ZKQD 1V05A 3UAJD 1S9XB 4X5LA 1RIUH 3OR7B 4NWUL 4ZFGL 1NMCC 1UWGH 5CEZH 5DXWA 1GHFL 3EO1B 3D85D 1JPTL 3QPXL 4MVBC 4JO4L 2AKRB 3QG6A 5GS1C 1JBJA 5GS1A 3BWUC 3GKZA 4P4KD 2VR4A 1JZ7A 3BN3B 4RDQG 2HLFD 2RR3A 1ZVSA 2VLKB 4OV5A 3IJSA 1P69B 1JN6B 4CVZA 4KROD 4YFDB 1T0NB 1H8NA 1NEZG 2Z8WC 1AQDB 4PJIE 1RURL 5DK0B 3G9VA 1AQKL 1P4LA 1QBMH 2B1HH 3MOBH 3OKNB 2AXFB 4UQ3B 3GSNH 4KHTL 1GGTA 4G8GE 1U9KA 3QNYA 4N9OB 3MCKA 2YPVH 2G2RA 1GGIH 1CIUA 1PSKL 4CADB 3BISA 1T03H 3TN0B 3VXRD 1T2JA 2IPTH 2JK5B 4YXLL 5I17A 1ZA3A 2HRPL 3PJSA 3MRIB 3GJFH 5JO5B 2DIBA 2EXWD 2B7DT 2H41A 3RPKA 3LKPA 4CJ1A 3N9GL 3THML 1CTNA 2R2BB 4H26B 2EDRA 1U8LA 4J8RB 4ENEC 4U1LA 4NWUH 5HGDA 1JPTH 4JFPB 5GGVL 3QPXH 3U7AA 3ZTJH 3MRPA 4TSCH 3BVNA 3ET9F 5BVPH 3EYVB 2LQRA 1HXYA 1S7XB 3MLTA 3MUGA 4HBQA 4Q9RL 2EC8A 3L5WA 2VXTH 3U1SH 4JFDD 1MWAA 4OF8A 4OI7A 2XKSA 3LEVL 3GMPA 4P57A 4WWKB 3MRLA 1I8IA 5T1LD 2NY3B 1Z9LA 2OP4H 1YQVH 4NP4H 3HNVL 1PSKH 1P7QA 2ORBL 3DI3B 4CN4A 2OBGA 4ZTOL 4APQB 3HI5H 4P23C 1FSKC 1GIGL 4P23A 2D03L 1OT2A 4UQ2A 4V1DB 1LP9E 3THMH 3VDCA 3MV01 3U36A 5J4MA 4WUKL 4PJDA 4P4RA 1OLLA 4FHBD 3CH1A 1F90L 1C5DA 2RJMA 2VC2L 1MHHA 5FHBH 4BZ2H 3O4LE 4QRPE 3TIEB 1S9VA 4UUJA 5J1AA 2IH3A 4ZQKA 2PW1A 5D7LE 5BZDA 3ZT6A 3VD9A 5I8CB 5EH1A 4GXVH 5C2BL 4IHOB 1VDGA 4JRXE 3STLA 3IRPX 5DZLA 1YMHB 3B83A 2QL1A 4OCRH 4PG9B 2HVKA 4QHMB 2VABA 4HAFA 2X44D 5HI3C 3O6LH 1HSAA 2CGRH 3JTSA 3MJ7A 1MHPL 1KCVL 3VFVA 6CGTA 5MENB 3DPBA 4ZOCA 1IQDA 2CLRA 4DK3A 1I75A 5JLZB 4QRTB 3SCMD 1NDGA 4XPHH 3QDJA 3HE6C 4GW1A 3HE6A 5LVEA 1ZT7B 1U3HD 3PGFL 4HS3B 5LGHH 2ATKA 2V2WB 3G04A 3W9DB 3AU1B 1EHAA 2NZ9D 4GRMA 3CFCH 4CMHC 3RA7H 1K6QH 3AM8C 3OPZH 3AM8A 1X5HA 3VI4E 3DBXA 5L0QC 3MOQA 1JTOA 1MLCA 2AJ3B 5BV7H 1YJDL 5I66B 3QEUA 4I0PC 5J1SC 4ZUTB 2WBKA 4I0PA 4POYA 5KANI 3QCUL 2YSSA 2VZOA 4GLRH 1NLBL 2YRLA 4JG1H 4QTHA 1NFDB 1NSNH 2NY1B 4X7FC 1XGQA 4NPYB 4XXDB 3GBMH 4G42B 4DQOH 4Y5XB 3UYRH 4P0DA 1K8DB 4FOMA 4JZJB 1N3NB 4Z7NE 2NLJB 4JE4B 3BAEL 1F4WH 4MJ5A 1JUFB 3FT2B 1YY8A 3C6SB 3T2NL 3L3IA 3ZL4L 1V3KA 2VZSA 1KJVB 5GSRB 3ARTA 4HT1L 5CJXC 5CJXA 5FM4A 1MFAH 2DD8L 5GS0D 3GI9L 3WSQH 1IGTB 4ZDHA 3CXHK 4HGMA 1KGCE 3W9EA 4X83A 2E7LC 2E7LA 4BSVA 5F21B 4LVOB 1G6RL 1G7MA 1NCCL 2AABL 3H6JA 3CFJB 3MSPA 1FL5A 3LDBB 1A5FL 4ETQA 2DQUH 3WJJC 1VENA 3WJJA 3FN3A 3CZFA 1BJ8A 2D9QB 1L7IL 1I1AB 3GIVA 1NLBH 3GMQB 3P0VL 1S5HB 1UXWA 4P3CH 1X5IA 1ETZA 4XNYL 4X7TB 4MD0B 4W6XB 5A43C 2R4SH 1T22A 3MRDB 1I1FA 1UZ8A 4PJFF 1HE7A 1DBAL 1S9YB 4ZYKB 5T3ZH 1INDH 3S37L 5EN2B 1N6UA 3BQUB 3ZL4H 4BH7A 2FJFA 4M7JL 4MWFA 5KW9L 4GAGL 3K2UL 1QYGH 4CW1B 3VFRB 4EN3C 3K81A 1TVHB 4EN3A 4OZHB 4X9BA 4GRLA 2OTUB 3HI6L 1CFTB 4IEFB 3PGDB 4JM2A 4NO0D 1W72L 1G6RH 1E28A 4ZTPH 4P9HC 5JXAL 1ORQA 3U2SB 3LMJH 4NQCB 5D7JC 3DXAA 5D7JA 2WNGA 5JQ6L 4XBPA 4OJFL 4DKFH 3MA7A 4HGWA 4PJGA 3JV4B 2PYEA 3R1GL 2PCPA 3ESVF 4U1NB 3UC0H 4LHUB 4GG6B 3FFCB 3JVGA 3TT3L 1UEYA 3VCLB 2XTJB 2DQCH 4GLRI 4LSVL 4XRCB 3X3FH 1HXMB 1MJ7H 5GS0L 3FRUA 1I8LC 5C07E 4K8RD 1I8LA 1PJ9A 4I13B 5IMOA 5HHOB 1E27B 2DLTA 1ZT1B 1HI6B 4PBXA 3D6GA 2MSPA 1MHEA 4GXUM 4IS6B 1G84A 5ENWA 3DETC 4R2GB 4LCCB 3RWEB 2P43B 3KLHC 4Z7WF 1A4KB 5IM7A 1KPUB 5CSZA 1WF5A 3MLXL 2WBJB 5IVNA 1J8HD 4HUXA 1KENH 5LBSH 3BPLC 3V6FA 3VXMD 4OJFH 4JDVB 5FECB 3NA4A 4RGOH 4LSDA 4NUGL 5D2LA 4CUCA 1N0XL 4JO3L 1GYAA 3BW9A 1VEOA 3ZKND 3ILPB 4JFQB 4WUUA 2OXGA 4GH7B 4JFEB 4HKBB 2X4PA 3RL2A 2Z8SA 3CSYB 3P0YH 4LSUL 4LSVH 3L95B 4LRIC 3WO4C 1OQOA 3LKNA 3ES6B 5AUMB 4QXWA 5J9PB 4MHHI 1G7QA 4X8JB 3BZ4A 2OJZH 4IRSD 2ZCLH 3D18A 4O51A 4E42A 4LARH 4C56A 3WEXA 2VH5H 1B4JL 1CF8L 4OZGF 3VFGH 1U8HB 2C1PB 1JP5A 5DJ2A 5ESAB 1A4JB 5CINL 4XPAH 4MDJB 1UJ3C 4MA3A 1UJ3A 1IGML 4NUJA 1A6UH 1OL0A 1N0XH 4JO3H 1FPTL 4OCYH 2FX9H 3WN5A 1I9IH 3W0WE 3AB0B 5D1ZD 4R7NA 5IBTH 2CKBH 1XH3B 4LSUH 1D5XB 1Q9OB 1ND0A 1H5BB 2QKIB 1T0PB 2NY4C 3KG5A 3LKOB 3RJDA 4MMZC 1BD2D 5DRZB 2BNQE 4N68A 4KK9D 5F44A 3V4VL 3V6BR 4LASH 5F9WB 5E00B 1RUAL 2MMXA 2B0SL 1CF8H 2ARJB 5J6GA 1G1CA 5ICYA 2IANA 4ZAKD 2Y5TA 5E08L 3RGVA 2CXKA 2HFGH 5JHLH 2J88H 1BFTA 1DQMH 4JB9L 3LB6C 5SX5H 4N0FB 4ZUSA 4P3DA 3GK8L 3IXAA 1FORH 4G7YH 4PJFA 1QRND 4C4KO 4G6MH 5KSUA 1A7NH 4LPVA 4YDVB 1JNNH 2X4TB 3D48R 1CGYA 4OD3H 2AV7A 1L6ZA 1XGUA 2YD8A 1WAAF 1FLTX 3DTXA 4I3SH 3RI5F 1V8HA 4GKSB 3UPRB 1URLA 4Y16A 3WUWB 1OM3L 4O9HL 3QT2A 2VQUA 3ZT5A 3LHPL 4NRZA 2AP2A 2BVPB 5C08D 5KJRL 2YD5A 3BO8A 4YBLB 3V4VH 5EU7C 1MCPL 1IJ9A 4M5ZH 5DMIL 2NW2B 1SJHA 4OLYH 5KAQG 1D5BA 4X6DA 4XPTL 4J4PD 4X8XA 1HHHB 4K2UH 5J6HA 1UM5H 3V6ZA 1R24A 4U6YB 4PJXA 3O3AA 5AWNL 3T0AA 4JB9H 2KH2B 5FOBB 3VFOB 1FBIL 2JB6B 1J88A 4G6AC 4XMKL 1L9NA 5IESL 4DVRL 2EZ0D 3RAJH 5FYLE 5D71L 1YYLL 4ZXBC 4ZXBA 3NGBB 3FB8B 3IF1B 7FABH 3D1MC 1FVCB 2QQNL 2OL3A 3MNVB 3KPLA 3HFML 4LLVA 4ZPTA 1NCWH 3I85A 3ARPA 4JJ5A 4FZEH 1KEGL 3N1PC 1OM3H 2CSPA 2X1OA 1FVDA 2AGJL 3NIDF 4F7PA 5F7DA 1MCPH 1NFIB 2EO9A 4U7SA 3QYCA 4KRNA 1I4FB 5A2KH 3B3IA 5HSFA 5IJVA 5KVGL 1C5CL 4KGLA 4Q0XL 3VXTB 4KQ4H 3U7WH 2Y07L 3CUPB 5JIHA 2WWKO 1XGPB 3SBWA 5DK2A 1VGEH 3VRLF 1Z0NA 1BPVA 2YD1A 3M1BB 3H9YA 1TMCB 3MRRB 4FXLA 4XMKH 4BKLB 4U3HA 4R3SA 4DVRH 3MJ9L 3EAKA 3GSUA 5EU6D 3DGGB 1BQSA 4QNPF 2ENYA 2AJZA 5DRWB 1V7ML 4YHNB 2NXZB 2CQVA 1D5MA 4M5YH 1BFVH 2CXGA 2VDML 4BSJA 3HFMH 5T3XE 3B9AA 1NAKL 2CLZB 4LDEB 1GOHA 2H2PC 4PGDA 4PJAB 4PRHA 3I6LD 4X6BA 1IGYA 5DSCB 4F7MB 4PJBA 4Q74A 3U0PA 1OSPL 3QRGH 3PNWA 3OBAA 3SOBH 3TA3C 2B4CC 2Q7YB 3TA3A 4U2YA 4BQBA 1C5CH 3SE3A 4A6YA 3TGXA 5TQ0L 2YHGA 2NY7H 3WE6A 3WNPA 5IB2A 1SY6H 2XOTA 2QSQA 1T7YA 1T6VN 1NUFA 1U8OA 5EOTA 4B5EA 1IAOA 1MREL 1WVZA 2PO6D 5T33L 5CGMA 2C4XA 3S88L 2EYRB 1M7DA 3CVHL 4LQFL 5HHMD 5TPWL 1NAMA 3CFBA 3HZMB 3EZ8A 3HZYA 1V7MH 3TBYA 2HWZH 1J1XL 1KYOK 4HZLA 3FQXA 1HIMH 1DVFC 1WTGT 2ADFL 1DVFA 1NAKH 4WTZA 3QAZC 5FF6B 5TDPA 3B5HA 5IT2L 5JNYB 1CD1B 4X7SL 1IZKA 5CP7B 2IPUG 3OKDB 4K94C 1X9QA 3HE7D 4YX2H 3B2VL 4G80A 5T5NG 2G5BA 4DFHA 1MFEL 1FLRL 4L4VB 5EBWA 4LLYA 3AC0A 1A2YB 5FKAB 2QADB 5JXEA 3OWEA 4XNZB 4X6EA 5B3JE 3ARFC 1B0GB 2XWBA 2R1YB 5DUBA 4MJIA 1JZ2A 4OGAC 4HJ0C 4JR9L 3MROA 1J87A 3DYMA 2BDNL 4LQFH 3GSRA 1AXTL 4IJ3C 1NBVH 4IDLA 5DLMH 1JPSL 5GGSB 3E2HC 1ZLUK 1A47A 1H3VA 3O3BA 1CDYA 2ADFH 4PJ5A 1ONQB 4I77H 3BEVA 5IT2H 2ZCHL 2FEEL 4XCCL 3P2TA 3QUYD 1SYSB 4Z7WB 4NQEA 3DMMD 1X6LA 5F72S 1BF2A 1RK0A 3BGAA 1CGTA 4NKOA 3V9FA 5J13B 2IQAA 3KLSA 3WL9B 4Y4FB 1ZMYA 3PG2A 4TVPE 4FXKB 1OP5K 2DQGH 3GFUA 2F15A 2H2SD 4OGXH 1I7ZB 1HN1A 1D9KD 3UMTA 4YC2C 2R0LH 5E94A 4WRLA 3RGHA 3D39D 1JE6A 3TJEL 5CCKL 1FG2A 1NFDE 4FP8H 5D6CA 2H8PB 1CFQA 1ZXQA 4JR9H 3UTTB 2EIZB 4OQ1A 2BXYA 1F3JB 2DMBA 3MV9A 2P5EA 4YDIH 2BDNH 1T21A 1GAFH 4JY5L 5C0BE 4Z7VF 1RIVL 2VDQL 3HUJF 1NGZB 4LAQH 3IETB 4FFWC 5F70A 4JANA 5ICZB 4W70A 3I3EA 2PTTB 1NJ9B 4JO2L 1KTDA 4YHOH 1Y18A 2ZCHH 3GDBA 3RNKB 1CLOH 1DE4A 4XCCH 4XWGL 4OZGB 1S8DA 4KMQA 5ETUA 1LEKB 2L0DA 3R0MA 2P1YA 3K4AA 5F7EL 1S5IH 1FFQA 1WGOA 4DZBB 2Z31C 4S2SB 3BPNC 3LPFA 1ORSA 1TPXC 4JO1L 4LPUA 3G5XA 1MH5A 1KPVA 3ARDB 1IGJA 2OZ4A 2IJ0C 3LZFL 5KS9B 1JZ8A 4HF5H 1A7QL 1ADQA 4Z5RB 1RIHL 5DJ0A 4XVSL 3BKYL 4Q9BA 1YEFH 4HV8B 4ZUWA 5DDHB 2HFTA 1BOGB 3SDCB 3TJEH 2BOBB 5HDQL 4M43H 5M7QA 3UBXB 2KDGA 4O00A 1S7TA 5HYJD 3LN4B 3ZDYE 5DQDL 4PJDE 4R26L 1Z9MA 5DEFA 1CE1L 2WIIB 3FO2B 5EC2B 4W68A 2XA3A 5C3TA 2VLRA 2NYYD 3R8QA 4GBXA 3O8XC 1MELA 3O8XA 1SYVB 4OZHE 1XF2A 1F8TH 5F7EH 1A6WH 1M4KA 2O26U 4RQQA 3H7BB 5IBUG 3AS3A 3GMNA 1JYWA 4JKPH 4NQCE 1JV5A 3BE1H 3DV4A 1F97A 4LSRH 5HYEA 4U6VH 3E3QE 3T09A 3KYMB 4JM4L 2BERA 1YPZF 3TVMB 2HFFB 4EEEA 5IB4B 4NNYB 4GG6E 3FFCE 1G7JB 1KPRB 2XTJE 1J1OL 5TH2B 4YDLB 2P5WD 3MRGA 8FABB 2DKSA 3X14B 5E0QA 4YE4H 4R26H 4R7DB 2FNBA 3GGWA 3VI3E 1Y6MR 4HWZA 4PJHB 1FH5L 5HHOE 5EORH 2NY2C 1RI8A 3MBEB 3HKFA 3H8NA 2X4NA 3F65A 3H3BC 4ZFOL 4TQEL 5I1HL 3GSQB 5LJYH 3VWJC 2CO7B 3KJ4B 4HIHB 1YNKL 2HMID 4NNPL 2Y25A 2FEEI 4MYWB 4EI6A 3L3DA 3OKKB 2W07A 3MXWH 4HKJA 1AGDA 2BXZA 3CMGA 2VQ1A 4OQTA 2Z91A 1XIWB 3X3GL 3QHZL 2FHFA 3DROA 4MA1B 3RZCB 2HA1A 1S7WB 4GW4B 3KYNB 5TGBB 3RIAK 3VXSA 4YHKL 1S7UA 4ZPVB 4F33A 2F54D 3QIWD 2D31A 2XN9A 4P99A 5J3HD 4IM8A 5IB5A 3D25A 5GJTH 2QSCL 2VL5B 5E8EB 4CN6A 4G43B 5DVOA 5MEPA 1K8IB 3F7RA 5HHPB 4P2RD 3Q6FA 1MJJA 5F1IA 2Z92B 3N1GC 5D7IF 4N0YH 1BVLB 2BY2A 3RVTD 1LE5B 1LO5A 5I1HH 4ZUUB 2XFXA 3SGKC 4DN3L 1OVZA 5ERWA 4WGWB 5JHDB 2EH7L 5JOEA 2V17L 3FJTA 3M45A 1J7VR 4GFTB 5D1QC 3F12A 3P11H 5D1QA 3HR6A 4BUHA 2ED7A 3ROOA 3ARQA 3X3GH 3QI9A 3QHZH 1H0DB 3CFKB 1ERNA 5ALCL 3QIBB 5C6TH 4NM4H 4HXAH 1HHIA 2R15A 3EOBB 3PL6C 4FXGB 4P2OA 2Y72A 4MAYA 3C5SA 4MNQD 4FQ1L 3KPQA 3T08A 1U91A 3QQ3A 1JGVL 4OM0H 1INQB 5E6YA 1AD0A 1CYGA 3PABA 4O02H 3TZVD 3QXDA 4WI3A 4G3YH 3AAZB 2D7PA 3W5NA 4Z0BL 5D1XD 5DURB 1O7SA 2W59A 4GO6B 4PJ7F 3PWJB 5C0FB 5F1SA 1NCDH 4UB0H 2GUOB 4Y1AD 5GGRY 4G8IB 3QA3A 1DLFL 4PB0H 1FGVH 2IC2A 2EH8H 3L5JA 2Y36L 3WCYA 1A7PH 2VLKA 2ERJB 4OUOA 2AEIT 4PJ8B 3O9WB 5MI0B 4P9HH 3PDOB 4HSQA 3LRSA 3NAAL 1T0NA 5HGGS 4TULL 5GSVB 2FL5B 4AY0A 1E0OB 1XMWA 1JHKH 2AXFA 4JPWL 5J8OA 1TTFA 1F4YL 4MJ6B 4ODVL 5A3ID 5BO1L 3PP4L 3ZKXC 5HVHB 4EIZC 4DZ8B 1JGVH 2ITCB 1C08A 4HWBA 2R29H 4RGNC 4BSWB 3QWOB 3TH2T 4LFHG 3T0EC 1T89C 2W9EL 2K1MA 3T0EA 5GHWH 2UVEA 3B9KB 4RFOL 5CJBA 1MFBL 2YK1L 1CL7L 1U2HA 4U1IA 4J8RA 3W39B 2ZSWB 1JWSB 1CE6B 1VHPA 4QRUA 1VFMA 5DVNA 2G9HB 4Z0XA 4PJEF 5I30H 1TZIB 4RZCA 4WW2C 5IMLB 4WW2A 2MQ0A 3FO1B 3QQ9D 5IVXF 4BJLA 1JF1B 2XZZA 4UT6L 4XPFH 4Q7DA 3U9UA 3MUJA 2FLRT 4HUMB 3KPRA 2GFBA 2EEAA 5FKPA 3IDXL 5GRUH 5E70A 3HC4L 4WCYH 4JHAL 2VDNH 1HHKA 1PZ5A 2EE6A 5ALBL 4HH9B 5H2BA 1FNSL 1BLNB 2NY3C 4G9FA 3S3PA 3PIQA 2NNAB 5HGAB 2DBLH 1N26A 1S9KC 3PP4H 2GTZA 4M9OA 4JQXC 2FJHB 4JQXA 1T2QL 1RFDH 5DD3H 4WI9A 4APQC 4LLWB 5C86A 2IQ9H 3RU8L 4EZMA 4NO5A 3ZO0A 4I5BB 2VR5A 4M6ML 5DD0H 5KVFL 1HILA 5A1AA 5IIEA 4JFOB 5IVOA 3LIZH 1KXVC 3GMLA 3MLUH 5EZIL 4JN2B 2R2EA 1JNHB 3CVIL 5JUEL 4MB4A 2CK2A 4U1KB 3OXSB 1YNLL 3FB5B 4LSTH 5I0ZA 4PP2B 4MB3A 3WO3B 5JW5A 5CP3A 1N6QL 1FC1A 2EDKA 1I7UB 3B2UD 3HAEB 1NGYB 1BGXL 1KN4H 1UVQA 3DUHA 4Z7VB 3HUJB 2Z93A 3S37X 1UH2A 2AEPL 2X7LB 2E27H 3CFDA 5ALBH 3O4LD 3G5ZB 4QRPD 1FNSH 3VE0A 5F9JB 4WV1B 4ZFZB 3C5ZC 3GNMH 3C5ZA 5DJDA 4AEIH 1NKRA 2V9QA 4X99B 1S7RA 5D7IA 3QUKA 2JJVA 1DLHB 3UZEA 2JF1A 5CSBA 5IMMA 1CT8B 3SO5A 1N5YL 1X7QB 4TNVK 5FGCB 5KTEH 3ARVA 2ZG3A 5DD6B 4DWHA 2Y23A 3BX7C 4XBGB 5MENA 1TCRB 1K3IA 3CVIH 1CR9L 4OFYD 4PRPD 2JJWA 4U31A 1XF1A 2R1XA 4Y5YB 2O5YH 4QCIB 5AD0B 3CCHA 5C0RH 4OM1L 1BZ7B 2OQJB 3P30L 4PJFE 4LNRA 3BEWA 3QUZD 4F3FB 1CFVL 3OGOE 1X5ZA 3PWPD 3P9LA 2ICWB 32C2B 5HXMA 1A0QH 3SJVB 2JJSC 5C9KA 3WMSA 3PP3H 2YEZA 4JQIH 3GSOA 1I7RA 5E4EB 4ZUTA 1ZLVK 3VGAB 5JW3L 2YXFA 3MREA 4BM7A 3QG7H 3QUMA 4P48A 1JRHL 2I07B 5E1AB 4TUOA 2EC9T 3QXAB 4XC1L 1PDKA 5EFIB 3PE9A 4QHKI 2XQBL 1N7ML 2LAAA 4L8DB 2HFEA 1REIA 3FT2A 3U0WH 1P84K 1YNTB 1DL7L 2ZKHL 5DJCA 1CR9H 4HJGA 3RY5A 1KOAA 1YPZB 3ELAT 4ZS7L 3ARGC 1PD6A 3ARGA 4K3EL 2EKSA 1TJGL 3ABZA 1VFAB 4J3WA 4NQSA 5E8OA 4F7TB 2NY6B 5INDB 2DKMA 4KUCD 4NDMB 5CJ5A 5BZWB 3LN5A 4KJQC 2DMKA 1EO5A 1NMBH 1OGAB 1IC5L 4CBPA 2DWEB 4B7LA 4PRIA 4NKDA 5EU5B 2JCCA 2CIIB 3CFJA 5F9OL 1TNMA 1IKFL 1FN4B 5EBMA 1ZHNB 4JRYB 4K9EL 4N1CA 3REWB 2ZUWA 3CDYA 4ISVB 4Z7WE 2J6EA 4UIKH 1JRHH 4ODBD 1BEYH 4MD0A 5CD5D 1F45A 2OJEB 1UXSB 2VE6B 3EKCA 2F74B 4P2QA 2EDJA 5KG9B 2VJXA 4YHIB 4LIQL 5SV3A 4F57L 3U30C 2MKWA 4XCFL 3GJFK 3Q3GA 4DUWA 4P46B 3BQUC 3WIFB 5JQHC 4JN1H 4MNHB 1WSST 2B4CL 1CCZA 1Z9OA 2W91A 4K3EH 1TJGH 5I1EH 2A6JB 3CFEB 1TJIL 3DRTB 3UTTE 5CBEB 1FIEA 3PGDA 4M1DH 1VADA 3PGCA 4E41B 4JQVC 1K2DA 5DYOB 4JQVA 2Q8AH 3SDXA 4YAQB 2IAMD 3RUGA 4RGMC 5GXBB 1AO7D 3O3EA 4PGEB 1M1SA 1BFOB 5J12B 5F88A 3RY6C 5K9OA 1X5GA 1MCRA 3BYYA 2KUTA 3VRJB 4NNXA 4UU9A 3UTSD 4U0RB 3IDYB 4PS4L 2XIDA 1OAUH 1U8PA 4OZGE 4LHUA 3QQNA 4R4NC 2XZCH 3HS0A 3C2AH 4HMCA 1VFBA 3TCXA 1AHWA 4LIQH 3LVEA 5IW1B 2OMNA 1IFHH 1S7SB 4XMLH 4XC3H 4A6YH 3CC5B 1CLZL 3TO4B 1QP1A 4R2GC 1JWMB 4LCCC 1EPFA 1EMTL 2GQHA 5I75B 4U6XA 1PLGH 3PQYA 4LPYA 5ECJE 3QDMA 1DBKH 2WBJC 3CSBA 1B90A 2X4UA 3VFMB 3EFFA 5C07D 4M8QB 2X4QA 4XXCC 5KVDH 4XXCA 3QJFB 3D0LA 2NTFA 2PW2B 3QPQD 4KZDL 4NC0B 5EWIH 1H15A 4CL7A 4PJ7B 4HKBA 3CSYA 3BT2L 3OG6B 3I02B 2H1PL 2Q6WA 1T5WB 1UM4L 1A1MB 1JRHI 3DX6A 3U7YL 1A6TB 4K94H 1L6XA 4UDUB 5C7XH 2EO1A 3GO1H 1SM3L 1FL3A 1H3PL 2AI0H 1EDQA 2R4RL 3D85B 4Y8AA 5E6ZA 5ID0B 5BXFA 1KLUB 1Y0LB 4FQHB 4P4KB 3ZDZE 3KPPA 3HPJA 5E4IA 1WAAE 5B39A 1Q9WB 3ZKSD 1MJUH 3L3JA 1ZHBA 1C8PA 3JWDC 4L3EA 1BVKB 3IRZA 1TVBB 4WGVB 3O6FC 4KROB 3O6FA 3NCMA 3TIDB 5C0AD 3INUL 4GMTH 3N50A 3T0VA 3HPLA 3FQRA 2HTLC 4WU5A 1EBAA 3SDDA 3NCJL 1L7TH 5T5FH 4U3CA 3LKQB 2YWZA 2B20A 1N59A 5HD8D 3AMKA 4HS6A 3ZE1F 4PJEB 3VXRB 1D5XA 2DQFB 2F8XC 2H1PH 3S34H 5IVXB 3VXOB 5I1KH 1OPGH 3HCVB 3MMEB 1IT9L 4LSQL 3G6JF 1H3PH 5F9WC 1F6AA 5GRXG 4S0SD 1OP3H 5C0ND 2P8PA 5E6IC 4ZSOA 5E6IA 2AVGA 4J1UB 1CI5A 1CU4H 3OHXA 4I9WD 3N1QC 4RNRA 4JFDB 3V5DA 1NGPL 3NIDE 5TF0A 2Y7QB 2CIKA 2JELL 4N0UA 5T1LB 3QR2A 5ITFB 2EIBA 4ONFL 4M9PA 3EYFA 4HKXA 1RZJL 5CUSL 4GQ9H 3RPIA 3N1FC 1N4XH 2FZ3B 1SEBB 2Q3ZA 2VISA 3VRLE 5JORB 4KK5C 1QSED 2C7UB 3NPSC 4HKZB 4XTRC 1KB5L 4PBVC 1T66C 4KTEL 4WFED 1R3JB 3X11A 4HEPG 1JFQL 1UA6L 2VYRE 4G7VL 4R90L 4M48L 4QNPE 2OZ4H 2ZPKL 1ADQH 1OWWA 2KQNA 4LHUG 5E2WL 5F7LB 1SMAA 1DQDL 2AK1H 3DWTA 4N1EA 5HYQB 1U8JB 1NGPH 3BUTA 4XCYB 3JZ7A 3VFOA 4UV4L 5F7MC 1R5WB 2VLRE 3HNTH 3K4ZA 3I84A 3PXJA 4UV7L 2M1KA 4X5WA 3DURA 5KSBF 5JZ7C 4Z8FL 3A6BL 4O5LL 3NGBC 2AXGB 4YWGL 4M4RA 3WIHH 1P4BH 4EVNB 3MCG1 3QDGA 4RISH 1RPQA 2OS7A 4YEFA 2YUVA 1FVCA 4BZ1H 3RX7A 1RAMA 3WFDL 3C60D 4KKBC 2MFNA 1IKNC 1KB5H 2Q86A 1HQRB 4R0LB 5FYLD 2BRRL 3OGCA 1RU9H 3QEQB 1HHJA 3KPMB 2QSTA 3SCMB 2KL6A 5LGJB 4NZTH 3G08B 4YBHA 5E2WH 2O93L 2NX5D 1U3HB 1WBZA 5DVMA 3EOAA 4M62H 1ZV5A 5D72H 3L3KB 4UV7H 4QRRA 4EIGB 4OZ4B 3NACH 5B8CC 2ZOLA 4TSBL 4NGHL 5B8CA 3DGGA 3DVNA 1B2WH 2FSEB 3LKSB 5TFSH 2PNDA 2NXZC 5LWYH 4YHNA 1U95B 3KXFD 1HEZA 2DQIL 3DV6B 1A9EA 5J0BA 4R4BB 2LU3A 3FT3B 4X6CF 4PJAA 3O0RH 4LLQA 4Y19A 5EO1A 3T4YA 1JMXA 1VFUA 4OCMC 5GS2H 1QRKA 4QOKD 5I1LB 3C8DA 1JWUB 1UYWH 4LVNB 4YHZL 2DS4A 4XWOC 1CVRA 1S7QA 3LEYL 1EGJA 4DKAA 2GTWB 3BIKB 4OQTH 3KPSD 1WK0A 4EBQL 4HK0B 2A74A 2VWEC 4KPHL 5LQBL 3MRHB 1P5VA 5JOFA 1OD9A 1K5NB 4TRPL 2VXUL 5DC4B 1XCTA 2HJFB 3IKCB 1MAML 3T3MF 3DYOA 2CRIA 3F58H 3BD3A 3BP7B 3G5VB 3E6HA 4Q2ZA 2BNRA 1NC4D 4TSBH 2W9DH 1MJ8L 1OARL 2BZDA 2YWYA 4B0MM 5KSAD 3G5YA 2E7HA 3UPAA 5FYLL 5IVZB 4PLJD 1FGNH 1FNAA 1V7NL 5E7BA 2DQDH 4LCWB 1EEZA 4R4FL 1YEGH 4YHLL 3KNBA 4KFZC 4LCIH 3OJDB 5SV4A 1RJLB 2BVYA 1KNOA 2ZUVA 2VKWA 5IG7A 3MV7A 3HUJE 3S98A 5EOQL 4C54A 1KIQA 5D7SH 3U82B 3VFSB 4MS8D 4FFVD 5ID1A 4AMKL 4MX7B 2BP3A 3H9SA 1U6AL 4KDVA 2EICA 4XNZC 5DWUL 1UEMA 3MOAL 4PP1D 3L7FB 4NO0B 1A3LH 1LQSR 4LRNL 3WUWG 2R1WA 4LLMB 3IDGA 2FX8H 2X89D 3CK0L 3HB3C 2Z9TA 5DJXB 1NGWB 2X4SA 4FQXD 5FGCE 2WM0A 3VH8A 4QWWC 4S1RL 3VXNB 1MLBB 5FA4A 5DHXB 2ED9A 1W8OA 1UM6L 2NW3A 2MQ3A 3RIAF 1DUZA 4LSSH 3L3GB 5C09A 4XCNB 5DO2C 1WZ1H 1R5IB 2FGWH 1ONQA 3TBTA 1FIGL 4KKLD 4R4FH 4DW2H 1QPPA 4OB5L 2CR6A 1SYSA 3O4OC 3H3PL 4X4ZA 1QSFA 4YFLF 5T3XL 1WWBX 4KKCD 5J13C 2GJZA 1PQZA 3HG1A 3HNSH 1OCWH 1N64L 1HWGB 4J6RL 4UBDC 1ZGLA 2NXYB 1MHCA 1R3IL 1XZ0B 3U0TA 5MP6L 5FO8A 3H42H 3VXMB 4YFEA 1CQYA 1HH6B 3JUYA 1ED3A 3P0GB 5L2JB 3EDJA 4U05A 2XWJB 4LLUB 4S1RH 4Y2DC 4Y2DA 3FN0H 3NFSL 5FXCH 3WLWC 3C6LB 5HJ3A 1I9JH 2P45B 4M1GL 2JKXA 5EB9A 2WBWB 3MLSH 3RL1A 2YD4A 1QSVA 3VFPB 3UP1A 4AIOA 1FL6A 2PTTA 1YPZE 2NY1D 3KVQA 4RFEB 5DHYB 4MD5B 5GPRA 1NC2A 1RUKH 5I18H 3D5OF 3OV6A 3BHBB 5T3XH 5DZNA 5C0BD 2V5YA 1OGAE 4ENED 1YZZA 1LK2A 1DSFH 2VO5A 3RWJA 4L8BB 2FLBT 3FMGL 4OIIL 4RCAA 1VGKA 4RRPA 5LCVL 5T1DL 2SEBA 3OAZH 1SBSH 2FHCA 4IRSB 4H0HB 3MRKA 2VITB 1QO3B 3RWFB 4ERSH 4QY8B 5EO9B 3W81A 1G9NL 1BOGA 3SDCC 1RVFL 4D0BB 4GSDL 5L8JB 1PKOA 1OTUC 1OAQL 1C1EL 2IH1B 5GGUB 4AH2B 2XA8L 1D5ZB 3MLWH 5D5MF 5SWQB 1E4JA 1DN0A 3NFSH 2DTMH 5E03A 3G6JB 4EXPX 5ESVA 4EQ3A 5D1ZB 5H37G 3F7YB 1N2RA 4FABL 2MTPA 4G8FB 3NIFF 3FO9A 1MF2H 4UDTA 4KV5F 1FNGB 4M93C 4U1GB 1RULL 2QBWA 4JFXA 4E41E 3GMOB 2QSVA 2PETA 5HVWA 2P44B 1ZHKB 1F11B 1AGEA 4MQTB 5CP3H 1R5VA 3C09B 2VDKL 4GKNB 4XNQB 1XAUA 5D96B 3UEZA 1BBJB 4TVPL 4UTBL 1C12A 1FZKA 3IJHA 3KYMA 4ZAKB 5D7IE 4KC3B 3IDJB 5D70L 4EUPB 3FB7A 5BRZA 3BKMH 5DTFB 4YDLC 5IQ9A 4HQQH 4NQCD 5DMKB 2NQCA 4JPIB 5CFHA 3EOTL 1DBMH 3IB4A 4YQXH 4LLDB 2ZOKB 1I8KB 4DKEL 1QNZL 4U1SA 4PJHA 4PRAA 1KTRL 3A6CL 1CBVL 1D5IL 2PR4L 5HI3D 3ARUA 4OF6A 3FQTA 3FFCD 5EOCL 2XTJD 2FIKB 4BYHA 2WWKT 5IR1A 3PHOA 3KJ4C 5A2LH 4UINL 3UJJL 4KQ3L 5C08B 2EDLA 5I74B 4DTGH 1UQSB 3GZKA 3RWIA 3VH8G 3MQIA 5HI4C 4EDXB 3HTLX 4OT1L 2VDKH 4NN7B 2ARWA 3GRWL 3HE6D 4NWTL 4XCEB 1XIWC 4QRQA 4UTBH 3QQ4B 4WEMB 4CNIA 5AEAA 5H35B 3V5KB 5KSBB 4MA1C 1G7LB 1MIEL 4RWYL 4LVEA 1SJEA 1QR1B 2BCKA 4ODHH 3RVUC 4PJ7E 4ZO7A 3ULVC 1CD0A 2YS4A 2P48B 1U8NB 5DA4A 1Z0MA 4QT5B 1QD0A 3QUMH 1QFPA 3RWGB