3U9PL

Crystal structure of murine siderocalin in complex with an fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
DILMTQSPLSLSASLGDKVTITCQASQIIYNYIAWYQQKPGKAPRLLIRYTSTLESGTPSRFSGSGSGRDYSFSISNVESEDIASYYCLQYDNLPYMFGAGTKLELKRADAAPTVSIFPPSSEQLATGGASVVCFVNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKVDYERHNLYTCEVVHKTSSSPVVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 212
sequence length 212
chains with identical sequence M
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pL01
5GHWL 2YMXH 4JFFA 3MJGX 4U6HB 1SJEA 4JY6A 2YD7A 4PJ5D 3EHBC 5HYSB 4Z7UB 4PV8A 1AGEA 2PTTA 4YHNA 3NBNA 5CBEA 3M45A 2HT2C 2E9BA 2BCKB 3BPOB 1DBML 1HKLH 1FL3B 4LKXA 4HEME 1FO0B 5FGBC 2FB4H 4NKDA 4YE4L 4JFQB 5EIIA 4JFDA 3IF1B 1EFXB 4K55A 2FEDC 4HC1L 3HC0B 2VXVH 4UINL 2P5WB 2LTQC 4HUUA 4YLQT 4QGYA 5BV7H 4NRYA 2D0FA 2ILLA 3CFJA 1X5KA 2Y23A 5E08L 2CRIA 2XZAH 2VR5A 4ZO6A 3PL6B 4MCYB 3MLSL 2HJLA 4M61B 4XPGL 2G60H 4X6CF 2EKSB 5KVDL 4GBXD 4G43B 2F15A 1ND0A 2ZZUT 4E41B 1UH2A 5INCB 1MAJA 4RWHA 3BP6A 4QRPE 4HKZB 5H94B 4EN3D 1UADC 4NQCA 3U7AA 3AB0C 3ARBC 2EIZB 4KK8C 3I2CH 4OZGF 3RVTC 3IGAB 2OTPA 2VDLL 1INEH 5ALBL 3MV8E 3K8KA 1IKNC 3MUGA 3SDCC 4PJHF 4N1EA 5B39A 2E3VA 4FA8A 1U8IB 3V6OE 3X12B 3K8LA 5EFIB 1Z9SA 3FCTA 1RJYA 4OCXL 1DBJH 5DRXB 5F7DA 5C7XL 5FM5M 4OLUH 3GIZH 3FTGA 1NBVL 3FRPA 3K1KC 3CGTA 4N5UA 3WFDL 4LPTA 4PY7A 4FQQB 2VC2H 3U6RB 3MODL 2BVQB 3NFSH 1QR4A 3FN9A 1EDQA 1NPUA 4J3XA 4TNVK 5CD5D 1SBSL 3GJFA 5F1KC 4P3DA 1CFTB 4LVHB 3Q3GA 5ISZB 3RVXC 4MJIB 5IESH 5I1IH 1NFDA 5C0FB 3LEXA 3RUGE 2VDNH 3VA2C 3NCJH 1MFBH 1N5AA 4L4JA 4NNYB 5CEZD 3REVB 3X14B 1BZ7B 5JQHC 3IJSB 1B6UA 1KEML 2YPLE 4UTBH 4OD3H 1CDIA 4HF5H 4DZBA 5I1CH 3RWJA 3MSPA 2HRPH 1U92B 2V5MA 5T33L 4YGVB 1UJTA 4KAQH 4LP4A 1NCWL 4OM0L 2A6JB 1JN6B 1DLHA 3IS0X 1AR1D 1BD2A 4YBLC 5B21A 4AL8L 1DQML 1YA5A 1RV6X 2B0SH 1Q72H 3DUSB 2V5SA 4JVPA 1U93A 5FYKH 1RZKC 4NRXB 2CXKA 3LKPA 1JV5A 3VFGH 1CT8B 4WFED 4Z7VF 3HB3C 4BKLB 4PJAE 2IG2H 3SPVA 4RMQA 4E5XA 2VLJD 1IAII 3RX5A 3GMOB 2X4PB 1OAKH 3VFUA 1QTYT 4Z77A 4NQDD 4QRPB 2IBZY 2X7LA 2MSPA 3MUZ1 1G6RH 3JVGA 1F8TL 1H0DA 2QQKH 5IHUL 5GS1A 3SY0A 3U7WL 5BZWA 4Y5VC 3D9AH 1Q94B 4QRUB 5IB3B 3MV8B 4P2RA 3FQWB 2X4OB 4M6ML 1HQ4A 1A1OA 1QQDB 2N7AA 3VXUE 3PXHA 4DEPC 3BRGC 3BQUA 4CVXB 4LEOA 1CR9L 2X4QA 3BKML 1U8LB 5CMAA 1DVFD 4NKMA 1FNSL 1UXSB 2A83A 4U3HA 3MLWL 4J6RH 1AO7D 2LQRA 2CDFA 4PP1D 1UG9A 1HINH 1NMAL 4Z6AT 4WVRA 5E9DA 4ESKA 4JZOB 1JZ2A 4Z76B 5ACMA 1AHWA 1J5OH 3MRLB 1D7FA 1LO5B 2AJYH 4ONHB 2N56A 4RFNB 3DBXB 4KI5F 3N1PC 5MEQB 5CP3A 1A4JB 1JPGA 4OZFH 2OL3L 3O9WA 3DYPA 2CIKB 4FNLL 4BQBA 4PLKD 4G8GD 3OB0H 3ZE0E 4X6DF 4G8IB 2GAZA 4EXPX 2ZUXA 4ODVL 1UM6L 3IFNL 1SJVA 2PW1B 2VXQL 2YPLB 4JLRB 5IB5A 4LIQL 3LRGA 4HX1A 4JO4H 1XIWC 3CFKB 1JRHI 5ACZB 3MXVH 1MOEA 4WHYH 1YNLH 4ZUTB 3WHXB 5J0BA 1RHHB 4MD5A 5CHNB 3MYZA 1BFTA 4HWBA 3L9RA 4GO6B 3QP3A 3TBWB 1GC1H 3QUZA 1H3PH 2WINA 4Y16D 3G6JE 3RL2B 2GFBA 2ZWLT 1NCAL 3E8UL 2IMNA 1EO5A 4WIQA 1ZK9A 3T4AB 2AJ3B 1UYWL 4HUXA 4GKSB 4OF7A 1HXMA 1QHOA 4PJAB 1ZVYA 2K1MA 3ARED 3RZCD 4K8RD 1CL7H 4PY8I 2DQEL 3ZTNH 4LSDA 4ZAKD 4N5EC 4JR9H 1PKOA 5DURB 3SQOH 1L4IA 2DLFH 3HZYA 4P49A 3TN0D 1I7RA 4KKCC 2IANA 2Z91B 2GK2A 5FM8A 5T3ZD 5IVZA 5D72H 5TH2B 3S37L 1CBVL 2F19L 2GK0B 3DRTB 4KDVA 5SWZE 3GKWH 5F88A 1A5FH 1A7RH 2Z92B 3VXUB 3B6SB 4H1LG 1G9EA 5JUEL 4KMTH 4G7VH 2OCFD 3Q6FA 4JO3L 1MFEH 2LU4A 3RVVC 1ADQH 2PXYC 4DAGH 2FZ3B 4U33A 4CVZA 1AIFB 2WUCL 5T1MA 3T3PF 2QKIB 1W8NA 4PGBA 5BVJA 1NBZA 1XGTA 4UAOC 1A4KB 4LHQB 1KIUA 3QNYB 2CKNA 2ED8A 1NBYB 4QHUB 1A1NA 3QCTL 4MCZB 1WEJH 2D7OA 1QLEL 3Q0HA 1NL0H 3MLXL 4DKFH 5CGMA 4PRPE 5T5NF 3HNTL 3W2DL 4ZMAT 3FFDB 1KTLB 1IGTB 2W9DH 5D7KD 4ZOEA 5ILTH 4G8FB 2H45A 2DQIL 1DQQB 4UI2A 4IDJL 2V2WA 4F7MA 5FGBA 2HKFL 4LHUA 2NTSP 1HKFA 5K9OA 4XP4L 1A6WH 3BEWB 2I07A 1ZT7A 1IT9L 5IMMA 2ZP0T 3L1OH 4Y19A 4ZO8A 4WI9A 5DK0B 3EFDH 3GMMB 1CLYL 3TPUA 3EUUA 1ZTXH 1A6VH 3RL1B 3TBYA 1IM9A 1SEBB 3G6JB 3KYMB 5FGSA 3WN5C 4D9QD 4LIQE 3MRQB 4OI7A 5KSBA 3RY6C 3RWGA 4Z7QE 5D70H 1ZHNB 4FFWD 4HHAA 3DECA 5DD3H 4H88L 3MXWL 3OAZH 1MEXL 1NGYB 1JGUH 4U6YB 3VD4A 4MAYD 1X5XA 3IDYC 5GGRA 2DQJH 2M26A 2VLRA 3DWTA 2BY0A 3D39D 2NY4D 5IKCB 2NY3C 1YEHH 5MEPA 2PCPB 5C2UB 4YDLB 3DROB 3INUH 3ARBA 4NT6B 4YR6A 3QAZB 2P7TA 1IKNA 4X6FA 2A0LC 4JRXE 5A2JH 2C3WA 3SDCA 5SWZB 2Q8AL 3ARVA 5T1KB 1FFOB 2V5YA 1KC5L 4NGHL 5AD0B 5HXMA 4PJGA 1S9VB 3ARDC 3WYRA 3JWNC 1LDPH 4QTHA 4P5MA 4JRYB 3WE6A 5IFAH 1VADB 3HE7B 3RWFB 4MB5A 2HTKC 2VH5H 4FQXC 5KJRL 1H3WM 4ZUVB 2C26A 1I3GH 5E00A 3TESA 2VQ1B 3TA3A 4H25A 2X70B 3U7YH 5FOBB 2D4FA 2X4UA 5KSAB 4W6YB 4I1NB 4C57C 2FGWL 5JLZA 3MFGB 3QXVA 2CD0A 4Z7WF 5IMKB 4HMCA 3CPLB 5FKAB 5FK9A 4MHHI 1SHMA 4EQ2A 2DRUA 1C08B 4NKIH 1IQDA 5DD0H 1GXEA 4MNHA 1OGAA 4PRPB 5MP6H 4KZEL 2EIEA 2NQCA 1AJ7L 3O81A 1CGYA 2HG5A 3MV9E 4NN6B 3LOWA 2PYED 4C55A 3UJIH 4C54A 1Q8MA 3ALPA 4HCRH 1HI6A 5GGUA 1RZJL 1HYRC 4M8VA 3B83A 3P3YA 1ZHLB 3M8OL 1PX4A 1KN2L 2OL3B 3MREA 3T65A 5F44A 2V9QA 1UB6B 3AGVA 4KKBD 3QIBD 1S7XA 2QSTA 1D9KC 4LK4A 1DQLL 2C3HA 3P9LA 3MFFA 2VXUL 4QOKA 1F4WH 1Z9OA 3D87B 2J1KA 4JJHA 4WW2B 2WBJB 4UT9L 4OAWA 5IR1A 3CFDA 1UXWB 5IGXH 4RIRA 1Z0NA 4KMLB 3BSZH 3D85A 4UTAL 3CD4A 3ROOA 3MNVB 4JDTH 5GGRY 4JN1H 2IBZX 4JKPL 4LMQE 2C5DC 5C0EA 4LVEA 1NAML 3EYOA 4MWFB 4JG1L 3RPKA 1D5BA 1XCTA 2I5YL 5ITBH 3CIQA 5I9QC 1AP2B 3OKYA 3O3AA 3WS3A 2EH7L 4BZYA 4OFYD 3HRZA 1IJ9A 1X3DA 2O5YL 3V6ZB 4TPRH 1K4CB 3U46B 1GHFH 4L4TD 3QXDB 2QQLL 3CLFL 3QISA 1N8ZA 4N8VA 3FO9B 4H8WH 4JRXB 4LLQB 5E8EB 1KCVH 1HIMH 1MHEA 1U8QA 4PRHE 4Y5YC 3QQ3A 1WWAX 4XCYB 2ESVE 1I7TA 4JPIA 5CBAA 5DEFB 5LKNA 1UVQA 1U41A 1WFUA 1NCCH 4JPVL 5KW9H 2AXFB 4Q9QH 3WLBA 3H3PL 3P4LA 4HJ0D 3G6AB 3S36X 2HFFB 3KLSA 1CGTA 4EIZC 2PW2A 5EUOF 5ID1B 15C8H 1BMGA 1DUZA 4ZS7L 5FA3A 4LGPB 4S1SL 1UM5H 5ICYA 2X4SB 5BOPA 4KQ3L 5GS0L 1D5IH 2V9RA 1KYOJ 1ZS8A 1AI1L 3G08A 2HH0L 3P73A 4D0DA 4QRQB 3NPZB 1DQJB 2R69L 3MV9B 4JFPA 4M5YL 1TPXC 4P9HC 3TYGL 2BNRB 1Z5LB 4XX1E 3EYVA 3BZFB 1ZHKB 4IMKC 1WBZA 3B5HA 3AC0A 3AU1A 1BQHG 5AZ2L 4XPAL 3GRWL 4AM0A 4L8SC 4UV7L 4Q7DA 3C60C 3N85L 4HWZA 5DRNB 1JGLH 5JPNA 1XIWA 3H0TB 2VXSH 3B8YA 3K2UH 2P24B 1EGJA 5AAWA 4P4KA 3VDCA 2Z0BA 5GGTL 1J8HD 2IQ9H 4WTZG 3O6FB 1K2DB 3SCMD 3UTPE 2E8ZA 4N0FB 5ICZB 4EVNB 1GVIA 1Z6JT 2JELL 1DN0A 1WLHA 3H3KA 2DM3A 2QADD 5F1NA 4OCYL 4ZFFA 2BHUA 4NKQB 4OZ4B 5F6IC 4J3TA 4MA8H 4XAKE 3LHPH 3GMQB 1V3LA 3BO8A 3VWJD 4W6WB 4AENA 4JKLA 2CDEA 4P2CG 4U6VL 1FVDB 5HHOA 3QXTA 1E4XH 4ZPTA 4XCCH 1JPTL 1MFCH 2E9IA 4NN5C 2AKRA 4WDIA 4V1DE 4U7KA 4X83A 1OLZA 2VQUA 5BRZA 1AGBA 3UYPA 4JAMB 5I17A 4P48A 4F7PB 2FWOB 2ID5A 3UPAA 3QO1A 4PRHB 5FYLH 5AAMA 4OV5A 1OOAA 4IRSC 3JTTA 2E7MA 3GSWA 2ESVB 3WUWB 3KPSD 1YNTA 3O2DL 1NCDH 1A6AA 2EC9T 4ELKB 4LASH 5SWQB 4OZIA 1JI1A 4OKVA 2PXYA 3MV7A 4Y5XC 1AY1H 1QFUL 2UUDK 1ADQA 4O5LH 3NAAL 2OYPA 5DQ9A 1E4JA 2P8LA 3B3IB 5EIVA 4UOW0 3BH8B 4X6EB 4OM1L 2NY1C 4F8QA 5C0CA 1QPPA 1MFDH 1OM3H 1KB5H 5JA9A 3KR3L 2DQFA 2WLYA 4PD4K 5C0DB 1L9MA 4PGCB 1FIGH 3G5YA 1LQSR 1MCDA 4EI6A 5LQBH 3P11L 1VFAB 4NNXB 2QL1A 3V6FB 2JE8A 1S3KL 3I6LD 1V7ML 2MCPL 4G5ZH 1U36A 4OLEA 3N9GH 3S3SA 3E6HB 1U91B 1NSNH 4OCRH 3F7YB 2EIBA 5JW3L 4I0PC 2FD6H 2JIXA 1MUJA 2FO4A 4JG0H 5FO8A 4HXBH 1OAYL 4CU7A 2XG4A 1VB9A 2VDRH 5D93C 4PLJD 5JR1H 1A7NL 1JRHL 2UWEA 3TT1H 3FHQA 3V0AC 3WN5A 2R4RH 4ZNCD 4P4RB 5JW4R 5J1TC 1RIHL 3THML 3DVIA 3RY6A 5F7EH 4Y2DC 4X8XA 4R0LC 1CLOL 4HS8H 3EO9H 4QLRA 4CMMB 3OJDB 1PLGH 3NACH 3G5XB 5DQDL 4WFFD 4YHZL 3QDGD 1T80A 2OJZH 4KGJA 1G7IB 4NSKB 1S7UA 4POYA 4PRIB 3S35X 1OLLA 4QYOA 5DEGA 3IETB 3UPRB 3PGCA 3W0WE 4DCQB 2HLFC 4V1DB 1WC7B 3JV6A 4FS0A 3A6OA 2ICCA 9CGTA 1NAMB 3U4EB 2MCG1 1FFNB 3QIWD 3ZKXB 1T2QH 1JHLL 3VFRA 3QH3B 4JFYB 2ZSVB 1CICB 3ARDA 1MLBB 1R6VA 1F11A 4UILL 4HZLB 5CJBA 3V4PH 1I8IB 5C6TH 4HXAL 4RA3A 2H26B 5IVXE 5A2KH 3WSQL 1I3RA 1KCSL 5E6ID 1I4FA 3OAYK 3KHQA 4YK4B 4FQXA 2W91A 1E27A 3P0VH 2Z8VC 3ZE2F 3IU3A 2EE9A 5F70A 2VAAA 6FABL 4H26B 2HT4D 1T4KB 1J0KA 4XBGB 4I18C 1AKJA 1KIRB 2QQNL 1Q9OA 3A6BL 4BZ1L 3MLVL 1OAUL 4YPJA 1H8NA 3S5LA 2YHGA 3NPSB 3F62A 1NLBL 2PO6B 3L3JB 1MCCA 5BMFH 4HIXL 3ZMRA 4X4XA 3RJQB 3TO4C 1BFOA 4ERSL 2R0WL 1PZUB 1TTGA 2ITCA 3U0TB 3VGGA 1LEGA 4OFPA 5I73C 1LD9B 2ICES 4JB9L 1CE6B 4JN2A 1F6AB 2J88H 5EBGA 2VZ1A 2FJFB 3ABZA 1QEWB 2FX7H 3UYRL 4NDMB 3S34H 3OTTA 1AGCB 4ODXB 1I1AD 4U49A 4AH2B 4IJ3B 3KJ6H 3HC4H 2ARJA 5MENA 1P84J 2JJSC 1KPRA 3IDJB 3HG1D 3QPQC 1D9KA 4PBXA 4NWUL 3H8NA 1BFVH 1FL5B 3F7VA 1OTSD 3JV4A 2ZUSA 4EDXB 1MWAA 1KB9K 1GZQA 2YSSB 4Y1AE 1HSAB 3PDDA 2IPKB 4TVPH 4UB0H 3HA0A 2OTWA 3IKCA 4OGZA 2UZXB 3R8QA 5TF1H 4LLVB 5CGYC 1B0RA 2UVEA 5BO1H 4NZRL 3CVIH 4FQLH 4Y4FC 3SKNA 1YEDA 2Y06H 4FQ2H 1HQRA 5D5MA 4NZTL 4M3JA 4ZTPH 5C0AD 4AIOA 1RJLA 2FSEA 2Y5TB 1OAZH 2ZCHL 2KQNA 3KPMB 3I50H 2VTFA 2P5EE 4WI4A 3ARUA 1F4YH 5HGDA 1MRCH 2XACC 4NRZB 1XF4B 1MJJA 3NCFB 4UV4H 5J9PA 3HI1B 3KPRA 4OGAD 2DBJA 5DMGC 2XQBL 5EU4B 5GIRB 3W0WB 5GS3A 3SEPA 3PJSA 5IQ9B 4E9LA 4DN4H 2WUBH 4LLMA 4Y5YA 5HVWA 1T04B 5C0BA 4LAQL 2A6DA 5CEYB 4YXKH 1NC4D 1FG2A 4L5FL 2R2CA 3KLAA 1FV1A 1U3HC 4R4BA 4JDVA 2EO1A 1EAPB 5IVXB 1T3FA 25C8H 2ADIB 4QXGH 3IXAA 5TE7H 4PPTA 4U2ZA 4ACPA 2W92A 4YHOH 2VWEC 3BUTA 4WU5B 4AYFA 2DN7A 2BFVL 4H20L 3BVNA 3B8SA 4OF0A 1OTTC 3D18B 2DL2A 2MFNA 1FFPB 1T6VN 3FQUB 2H3NB 2XTLA 5C09E 3VFPA 1BECA 3HCVB 4NUJB 5CZXC 3RWHA 4R26H 3U79A 1FH5H 3MROA 4PGZA 4Y4KC 1IARB 2F8XC 4IMKA 3P2TA 3VMPA 3DX6B 1REIA 1CGSH 1JNLL 4L8SA 3D3VE 4K23H 3LZFH 3FOMA 3DIFB 3C60A 5DRWA 4WWKD 1CD1B 2L4OA 5EA0H 2AV1B 4I3SL 3MC0A 1ZGLP 1EHXA 2H32H 4GAFB 3FO0H 2NY0D 1HH6A 2NY6C 5IW3A 3DJ9A 2W65B 2E9WA 4YUEH 3MUJA 5AEAA 1DSFH 1MCWM 1TCRB 1M05A 1W2KT 3D25B 4Y1AB 4RAVA 4U1NA 2E9JA 2WLZA 5HD8C 1F4XH 2F54D 4CMHB 2AGJL 4XCFH 4LKCA 5HDOA 5DGQA 3LCYA 1Z0MA 5GRVK 5M7QA 1JHKH 4M03A 3FN3A 4ZUUB 4RGMB 1UJ3B 3QRGL 4FZEL 1NLDH 4RRPG 3BRFA 4F15C 1KXVC 2DWDA 4QRRE 2P5EB 4JVUA 1FNEB 4LCWD 2AQ1A 1RUPL 2GTWA 5IUSA 1SEQH 3RHWF 3SGDH 4LCIH 4M9OA 1JZ7A 2W9EH 4BQ6A 4HEPG 1A8JH 3UEZA 1JZ8A 4BFIB 1JK8A 1QG3A 12E8L 2DAVA 3SDXA 1YY9C 2HVJB 4MJ6A 1CTNA 4F7TB 1N0XL 1XGQA 3BWAA 4MDJA 1I1FA 4IRSA 3ZTJH 3QHZH 2B20A 4RAUB 4B53A 1NCNA 2QHRL 3QNXA 3MNWB 3WD5H 43CAB 1K9TA 4OLXH 4XP5L 4U31A 4Y5XA 4I3RL 5I8KL 1MCWW 4IIQA 3HTLX 3IJYA 4MXQC 3VU2A 1G9NH 1MCFA 1MFNA 2YPVL 3KYAA 2FR4B 3CK0L 5TDNA 3V79C 1Z3GH 2BVEA 1BAFL 3QUXC 2W0FA 3RWDB 2XPGA 1QD0A 5IBUG 1KB5A 1M7DA 3QEUA 1ZVHA 2Q76A 2D7PA 5GSVA 5KVEH 2EDBA 5C09B 1KENH 4HJJL 5L7XL 1LK2B 3MUHL 3VFWB 4AIZB 2NNAB 1BEYH 2DKUA 1KJ3L 4XWGH 4JFFD 3TZVB 2FLRT 3D3VB 4HWUA 2GT9B 1TNNA 3CSGA 4FQCH 3ZYIA 2CLZB 5I1LB 1OPGL 1DBKH 3BYTA 3LQAL 5I1AA 2AJUH 2KH2B 2AK4E 3TPKA 2X4NA 1U8HB 4GW5B 3X3FH 4JFDD 3WXWH 2X6MA 1GGTA 3IU4H 4IM8A 2HN7A 4Y2DA 2HJKA 4F8TA 1XR8B 4R0LA 1FNGB 4YEFA 5BZDA 3S97C 3O11A 4MNQE 1KLGB 4NJ9H 3GSUA 2DYPA 5D7LA 1WAAE 3PNWB 1Q0XL 2CJUL 4QRRB 5IB1A 4LEXH 3HE6B 3QG7H 3JWDC 4KRPC 1JUFB 1B90A 4OGXL 4KTDL 5EU5A 2F74A 1U0QA 1AD0B 4MAUL 1GGUA 1QNZH 4RX4A 3LKRA 4NQCD 2OK0H 2L7JA 5D1ZB 4ODUA 3IDMA 3V5DB 2CUHA 3QQ4A 1S7VB 3OPZH 4I3GA 3CXHJ 3QJHA 2B7DT 3UTTA 3T1FA 3WO4C 4TOYH 4U6XA 2FL5B 4U0RC 1BQHB 4GG8A 3HZMB 3P4OA 4JKWA 4D0CA 3I6GB 2AABH 1T1ZB 3EOTH 3GK8L 1RIVL 1R0AH 3IFPB 4JFEA 1KG0B 4I18A 2JCCA 4HGMA 5LCVH 5C0RL 1KJ2H 1CDHA 1Q9KB 4EI5B 4KK9C 5F96H 3MRNA 2DQGH 1G9ML 2GQHA 5J1AA 3TO4A 3I85A 2XWTB 3L3DA 1F45A 4KUZH 2ADJA 1AGFA 5DSCA 1FORL 1U58A 4JM2F 1YN7B 2IMMA 3W9DB 1U8PA 3RA7H 4X7SH 5D7JB 3SE9H 2V9TA 3VD5A 3O4OB 2JJSA 3FT3B 1A47A 4XMPH 5INDA 3S3PA 3EYQC 3IDUA 5D7SL 1A14H 4KKNA 1YEFL 2AK4B 2EDHA 2BHZA 4WUUE 3VFVB 1BD2D 1R3LA 3LQZA 3GMRA 3UAJD 4WFGD 4JM4L 2PYFB 2BSSB 5DUPH 4Y4FA 4DUWA 4PJ5E 5LVEA 2ZOLA 5DVLA 1GZPA 3MUY1 4MNQB 1HEZA 4CN4A 1IVLA 2HMIC 3ZHKA 1HILB 3N50A 3JZ7A 1W72L 4GKZB 5DR5H 1U8OA 3OKDA 3AM8C 2G75A 1R5VA 4FQ1H 1ORQA 4XVTH 4QGTA 4KDWA 4M1CD 1QFOA 3PHSA 3ULSB 5F9JB 1C12A 1EXUA 1XGUB 1NGPH 4X4ME 3PV7A 1JYWA 1MF2L 3BZEB 4TSAH 5IIEA 4JFXB 5HDQH 1MHPL 1PDKA 5D8JL 4MD4B 2Q1EA 1PD6A 5TQ2H 3MMEA 5HDLA 3RAJH 1MI5B 1GL4B 3VXPB 1U3HA 1KCRH 2GI7A 5GRUH 4BSWA 3S88H 3QPXH 3BPOC 1FO0H 1FVCA 4PYGA 1FJ1A 3UROR 3BQUD 1D6VH 4YDKH 4P5KB 5J12B 3BXNB 2VIRA 1DCLA 2R29H 3K3QA 3VJ6B 1AQDA 1JNHB 5EOTB 5C0IB 5EH1A 1PSKL 2A6KB 3D0VB 2J4WH 3EGSA 5E9DD 3WLWD 4ALAH 3FFCA 3X11B 4HFWB 2O61B 4Y4KA 4K2UL 1PQZA 1H8SA 1Q38A 5LWYL 3OAZK 5DVMA 2ADGA 1MCIA 1YEJL 2IH3A 3O9WD 2VZOA 4XC1L 2VXTH 1FYHB 1FZOB 5CGTA 4YDIL 4TUJA 4ZO7A 1GIGH 4GJTB 5IEHA 3I02B 1L7IL 1WT5C 2GY7B 3PXJA 1J1XH 1N3NA 1DE4B 1SYSB 2OLDA 4K7PX 1EEZB 1HN1A 2HFEA 1BIIB 4NUGL 4L8DA 4KTYA 5F3HB 5F9WC 4A6YL 4G6MH 3QUZD 1ZA6B 3BESR 4PJ5B 1IGCL 1FLTX 4H1LA 1UCTA 3GBNH 5HI3D 2X9WA 2DMKA 3KNBA 2H1PH 4EJ1C 3QEQE 5GGSB 4GRLC 3UTOA 2CO7B 5FO9B 3RVUC 5KSVB 1GH7A 4XNMB 1ETZB 3VI3F 1KJMA 4EQ3A 5BOZG 4M00A 3LMJL 5E2VL 2XKUA 5A16B 2Q6WB 3OR6A 2AEPL 1KXQE 1ZSDA 5SX5H 1A6ZA 4OD1L 2NX5A 2HWZH 4P3CL 5E5MA 3TC9A 1YPZE 4ONGL 3U4AA 4G80B 4O02L 4JO2H 3MGOB 1A6TB 1IGFH 1JWUB 4KZDH 5IMOA 2ATPA 5T3ZL 3KPPA 1BBDH 3W81A 5CJOH 1JYXA 1HKLL 5JDSB 1ZGLM 3FO1B 2UV3A 4Z0BL 4NQDE 1P53A 3MLRH 4G42B 3X3GL 1QSVA 5IMLA 3MYJA 2DI9A 2NXYD 3G6DH 4F80A 4RFOH 5D6CA 3QUXA 1CK0H 4Z7OE 5DVOA 3UXFA 4PYHA 4NM4H 2VXVL 4PJEF 3G5ZA 3LDBB 1T1WB 4L3ED 4K94L 2GJJA 2GIYA 2FH6A 4CN1A 4DGIL 5DC9B 1B9ZA 1T0MB 2J6EH 2G60L 3FB7B 3EJJX 4OLWL 4ZOCA 2MQ3A 5CEXB 3K2MC 4XB8A 3R06A 4NO2A 4UU9B 1KSRA 3EHBD 4X80H 2Y25A 3QWRA 2W38A 1PKQA 2HT2D 5CD3A 5F1IA 4OSUH 3WIHH 3H9SA 4F7EB 2DLGA 4LHUD 3FB5B 2VN4A 1INEL 3MA9H 2AEIT 2NY7H 4M8QA 3OR7B 1MJUH 2FEDD 3TIDA 1XH3B 5L9DH 1RUQH 2OP4L 3O8XB 5BQ7A 1VACB 1AGDB 1WBYA 1MCJA 3P4NA 4XGZB 3TYFA 3QQNA 4X6CE 4QRTA 5GRVL 1IM9D 1DBJL 5EBLB 3GIZL 4R90H 2OJEA 3QEQB 1J0IA 4ORGB 3BGMB 1C1EH 3SOBL 1HHHB 1RMFL 3NZ8B 1YMME 2VC2L 1LWRA 3FT2A 1T7VA 2VLRD 5ENWA 1G7QB 3NFSL 4CDHA 3DX8B 4RFNC 1BM3H 4OZGE 2Q3AA 1LP9A 1OQXA 4NP4L 4AT6B 1P4IH 3ARBD 1W72B 2D7MA 4R4FL 5IESL 5I1IL 5EOCL 4KK8D 3RVTD 4YXHH 3RY5A 1EERB 5CINL 1MFBL 5HGBB 3TNMA 1BBJA 1U3YA 1TZHB 2DBLH 4M7JH 3SDCD 2I9LB 4EUPA 4J2XA 2J8UF 5I16A 5FV2A 3EIFA 2DI8A 5GHWH 1RULL 4OBRA 4OTXL 4UTBL 5H35B 4OD3L 5DDHA 1NUFA 2FIKA 4NQDB 4WU7A 3KPLA 5HHQA 4LLUB 3IDXL 4HBQA 1IZJA 4GW4A 4JY5L 3VXOA 3B43A 1OY3B 1DBMH 5T3ZE 2ZSWB 3TO2A 1CI5A 4BFGA 3CH8A 4KWUA 3U0PA 2NLJB 4YE4H 4HWEH 4LOUC 5IW6B 4JQIL 1UQSA 1W0VA 4S0TD 2EE6A 1IEAB 4Q6IC 4GRMA 5J11B 4HC1H 4TYUA 3V2AR 5FFLA 2RFXB 3OKKA 1NDGB 1OGAD 4QWWC 3VXSA 1F90L 1E4XI 1TJIL 3VE0B 3VRIB 1OAKL 2A73A 1Q9WB 1AO7B 3MLSH 4CBPA 4LQ1A 4P2QA 4R3SB 5KVDH 2Y36H 3GMLA 3CXDH 3ARWA 4OZIF 4F37K 1VFBA 4AEFA 3HR6A 5F21B 5JOFA 3BH9A 4WNQB 3O6LH 5L88H 4DKAA 5EZLA 4QHLA 1IGYA 3HMXL 4BYHA 1I9RL 1XF3A 5L2JB 4JY4A 4OD2B 3ARXA 4QOKD 3ARFB 3DVNB 3SDAC 2VDLH 4YHYC 5ALBH 4Z7VE 4X6CB 5D7KE 2VL5B 3HB3D 2YN3A 4J6RL 3B9KB 3AM8A 1HINL 2GTZB 1YMMB 1ED3A 4OCXH 3PWUB 4A6YB 4I9WD 1ZHBA 2XI9A 2R2HB 3QCVL 4MA1C 2DMCA 1NBVH 1J5OL 1ZT1B 5FA4A 3VXNA 2AJYL 4OZGB 1CG9B 2FECI 4X5XA 3VH8G 3WFDH 5IBUB 2YD3A 4O58H 4IOSD 4Y16B 1RUAH 4D9QE 5HPMB 4Z7UA 3C6LC 4QHKI 5TFSL 5EC2B 3FKUS 1SBSH 1ZLWH 2BCKA 1FL3A 3AREB 1CFSB 3RZCB 4U0QB 1EJOH 1QSFA 1FFQA 5CWSB 4ZAKB 3HMWH 4HLZG 4PJAF 1EVTC 3D39E 4LLYB 3DX9B 3T2OA 3TN0B 3MXVL 3HC0A 1HSBA 4K07A 1KPVB 5DJ0B 3C08H 3MRGB 4UDTB 1H3PL 2GSGB 4PJDA 3WFHA 2YUXA 4KI5E 2NY5C 5T33H 1WBXB 1NCWH 1E28A 2EKSA 3HPJB 2BY1A 2R0KH 4G43A 3CX5J 1DQMH 3I75B 3VFSA 5D2LF 4E41A 3NA4A 5CJQL 1MHHB 4E42B 4X6DE 1TNMA 4HKZA 5H94A 3L5JA 5E2UL 3ARGC 5I2IB 3RX7A 5IHZB 4JR9L 3OKMB 5D96B 1OP5H 4BSVB 3QUKB 1WT5A 3QXAB 4GFTB 2DLFL 3RWCA 2EIZA 2VZTA 3SQOL 4AEHL 5ID0A 2DQDL 3IGAA 2A6IA 3QAZC 3CH1A 5IT2H 3VI4F 2BVOB 3P30H 2BVYA 4Z5RB 1XIWD 4CJ1A 1NJ9B 2QSQA 3NFNB 5IHUH 5DJAA 1U8IA 3U7WH 4P4KD 2MJWA 2O5ZH 5EFIA 5I74B 1A7RL 1EUTA 4ZUWB 5DRXA 3SBWC 4CKVX 4Z7VB 2PYEE 4XNXL 4KMTL 4G7VL 2F5BL 4IRJC 5B3NA 1F3JA 2ENYA 4DAGL 4GRLA 3FOLA 4FQQA 3RIAF 5DI8A 3U6RA 1IC7H 2XOTA 3LN4B 1FIEA 3BKMH 4UQ2B 2BVQA 3BN9C 1FNSH 2R1WB 4N5ED 5JW4M 1RUML 1OVZA 3MLWH 5HHOD 1CFTA 5ISZA 4MJIA 4KKCD 2BVPB 4MA7L 1NL0L 2EYSB 1NMAH 4DKFL 3F7RA 4PJBF 1KFAL 4LNRA 5I1EL 4NN6C 2IFFL 4XRCA 1IGJB 5EBWB 3REVA 4M6NL 3X14A 1DN2A 3EOYG 1U95B 5BRZD 5ILTL 3T2NL 1O5DT 1WFOA 4RNRB 4O2EB 4CW1B 2OL3H 2AXHA 1KN4L 1ITCA 3MRHA 4UIMB 3OMZA 4MAYB 5IV2B 3CVHB 2DLTA 1U92A 5EU3B 4YGVA 3RVVD 1YC8A 4DFHA 2A6JA 3T3PE 2V17L 3D39B 2NY4B 4BA8A 4ZPVB 4ODVH 2PXYD 1UM6H 3MV7D 5F8QC 3IFNH 5KS9F 4OFKA 2VXQH 2EEBA 3EFDL 2WBJC 1RZ7L 4LIQH 4L4TE 1XZ0B 5ANME 4NRXA 3VFTB 5C0CD 4BKLA 1A9EB 2B1HL 5CJ8A 4N8CL 3MZTA 4HS3A 4QT5B 2A74B 1TVDA 5CILL 5DD3L 4NZUH 2X4PA 4X6DB 3IDIB 1JGUL 1WJ3A 4QRPA 3TBVB 1K3ZA 1NCAH 1T5XA 3E8UH 1N7ML 1D5XB 1G7HA 3L5WB 3ZHDA 1UYWH 4NO3A 3O2WL 3NH7L 1YEHL 2DQEH 2EICA 2A9ML 2PN5A 1Q94A 4QRUA 2MWCA 3MV8A 2OQJA 3GSOB 3LV3B 3HFML 4Y7MA 2JIXD 4XPFL 1QQDA 4O2CA 1K8DB 4ODHL 3RHWK 3QFJE 1NEUA 3S37H 2PYEB 1FE8L 4EEEA 3QWOB 4YDVB 3KPQB 4XXDB 1I3GL 4M7ZB 4MA3B 3U7YL 4JZOA 4LU5L 4HUNB 1CIUA 1Q1JL 3QIBB 5DS8B 4LSUL 4ONHA 3MBEC 2NY3D 1A4JA 1J8HE 2VQTA 4X9FA 4GW1A 2BZDA 3F6IA 3RUGA 2CIKA 1U3ZA 5MP6L 1LEKB 1I8MB 3QCTH 1IC5L 2GEEA 4G8IA 1J12A 2A0LD 1RZFH 3PV6B 3CMGA 4WW2F 1QLEH 4G8EB 1YEEH 3MLXH 5ESQB 2YPLA 1S9YB 4FQPA 2AJZB 4HKXA 3ARDD 5HHXL 3V5HB 4OZFB 1KYOK 5ACZA 1CGXA 3I3EA 4ZUTA 1MAML 3WHXA 5I15L 1RHHA 5CHNA 3E2HB 2DQIH 2HTKD 4FQXD 2VZ3A 4Z7WE 1ACYL 1FFRA 2HKFH 1NH6A 3B5GA 3HUJF 5GRZA 4L4TB 4KMQA 2Y1VA 2HTLC 5ANMB 1IEHA 1JF5A 4TQEH 5FM5O 4KKAC 4Q6IA 3T4AA 1AKJD 2OM5A 2QSCL 3PDOA 5GZNC 4P2YA 4HC1A 1WV7T 4HH9B 1E4KA 2Z35A 4KV5F 3K4DA 1CXHA 1MNUL 1IL1B 3WNOA 3C5JB 2Z91A 4PJCA 3SGDI 5FF6A 1MVUB 2FJGB 5LXGL 1MCOL 3MXWH 4H88H 1MEXH 1PBYA 1ZKAA 5JHLL 4G6JL 2GK0A 4TPRL 4JEGB 5MEND 3RNKB 4BH8A 2V5RA 1D9KD 4H8WL 1S7RB 2Z92A 3K4AA 4TRPL 3VXUA 5EPMB 1QPXA 3B6SA 4UT7L 1NMCC 4NOBA 1IEBB 3QFJB 5DGRA 5F7UA 3I6LE 1UH3A 1NANI 1CXEA 4NQXB 5B39G 2Q8AH 5CSZA 1AIFA 1OGTB 5KW9L 4R97B 1U8JB 1PY4A 3C8DA 4JKMA 1BVKB 2CK0L 1KC5H 4GS7B 4NGHH 2XWJB 1A4KA 5D2NE 3QNYA 3JTSB 1NBYA 2X4RB 4OCWH 4QHUA 2XNAB 4MCZA 3FRPG 4PR5B 3K0WA 1B88A 2OXHA 4HK3N 3G5VB 2OMBA 1MJ8L 1J8HB 5EORL 1D5IL 4HWNA 2FGWH 3C6LA 2C9AA 2B1AH 2HKHL 2JB5L 3GMNB 1L7TL 4PTUB 1S7SB 2PR4L 5E2JA 3VGHA 2QADB 3TBTA 2DQCL 2JJWA 3T2QA 1ACZA 4KZEH 5C0BD 1AJ7H 1VFOA 1RFDL 3VWJB 4WFFE 1FC2D 2R4SL 3OXSB 4U7MA 1BF8A 4M93B 4DN3L 2FRGP 4G9DB 5DK0A 5KVGL 1DANT 1RZJH 1ZANL 4S11A 4OLVL 4Z7WB 3C8HA 5EUOE 2IQ9L 3M8OH 1KN2H 3RL1A 4B7LA 3G6JA 3KYMA 1C16B 3MRQA 4QHMB 1J7VR 3BW9B 1KXTB 4OF5A 2E7HA 1DQLH 1ZHNA 4NHCH 4MJ5B 1SMOA 2VYRE 2GCYA 3OKNA 2VXUH 5H37G 5ERWB 2EDXA 4F33A 1SYVB 3ARYA 1NGYA 4UT9H 2CIIB 3OJ2C 5F89B 1YZZA 2R56L 1H3UA 4N0RA 1IAOB 4Z9KB 5IKCA 4UTAH 4PBVC 3DROA 4X8JB 2ZNXA 4JKPH 1MFCL 2WK2A 4U3CA 3C60D 3ZDZF 3GJEB 3GM0A 3AROA 4F2MA 4JG1H 4XNZC 3W39B 1N64L 1FFOA 2EH7H 2JCCF 5I18L 3F12B 3SBWA 2O5YH 1CICC 5FYLL 1S5IL 1JPFA 4FXLA 2D3VA 1NCDL 1VADA 2DS4A 2VDOL 4LASL 3DXAA 4ZUVA 4LCCB 5F7FA 2X70A 1T03L 2CUIA 5FOBA 1EBAA 3K74B 4ZFOL 3T8XB 1GOHA 1EEYA 5D2NB 5IMKA 2DWEB 1M7IA 3O41A 4EZMA 4JPVH 3HRPA 5FEBA 4NO5B 5DJ8A 3H3PH 4PRPA 3CC5B 3S9DB 3NA9L 4EXKA 1VEPA 5ICXB 1N6VA 1VCAA 2FECL 1KIPB 3TIEB 1SY6L 4LBEB 4ZS7H 3U82B 4PB0L 4S1SH 5ITFA 2PTVA 2BMKB 1NGZB 4G5ZL 4KQ3H 4JE4B 2OZ4L 2W1NA 3N9GL 1DFBL 1NSNL 4KPHL 1AI1H 1ZHLA 4IRSD 2HH0H 5GS0C 5C0AE 2OL3A 2R69H 35C8L 4M5YH 5ECJE 2YEZA 1JMZA 1AFVH 3RFZC 4WCYL 3SKOB 4XPAH 3V7MA 3GRWH 3KDMB 4MB3A 2WBJA 4UV7H 3TT1L 1YNKH 5EUOB 3QO0A 4K9EC 1YEIL 1JFQL 2NY1D 1GCFA 1BOGA 3MNVA 4WV1B 3WNPA 3ULVC 3QIWB 1P84K 3HAEA 3WDHA 2YPKA 5GGTH 3KYKL 3ILPB 4OGYL 3VXMD 4AG4L 5ESVB 3IRPX 2A1WL 3EYSH 1CFNB 1INQA 1XGRB 1AP2A 1JGVL 3PGFL 3KJ4B 4OCYH 4XWOC 5KANI 1BF2A 1T89C 1SMAA 2P45B 2LAGB 3V6ZA 4ETYA 2R1XA 1K4CA 2BVTA 3U46A 3MLTB 5I1HL 3QXDA 4I0PD 4U6VH 1Y6NR 4MMXC 4JRXA 3SGEH 3IAPA 3VH8B 5CUSL 1JPTH 5EU7C 2SEBB 1F3DJ 4QCIB 3RP1A 1T7ZA 3ZT7A 5I0ZA 4Y2DD 4DQOL 4ELMA 2VISB 2ED9A 1WSST 5B8CC 3G6AA 2EXYC 1I1AB 3IXTA 2HFFA 3MLYL 3UO1H 2F5AL 1D6EB 5FYLE 3HG1B 2DYPD 1C5DA 5D7LD 3OSKA 4G6FB 1U3JA 3MBEA 1QFUH 1MVFA 2X4SA 5J13B 4RZCB 1CFQB 3UDWC 1DQJA 3MV9A 4HDIB 3DRQB 4OM1H 1T6WA 2F54E 5A3IC 2HLFD 3STZA 1ZHKA 2EE2A 3KR3H 1JF1B 3C5ZC 5JOPE 2NW3B 5JOEA 5F71A 4UUJA 5C0AB 3IJHA 3H0TA 3KJ6L 4YNYB 3IDNB 1S3KH 1T1XB 3U9UB 4L1HA 2MCPH 4GAJH 4U1GB 3UTTD 5IWLC 2P24A 3ZE2E 3O45B 3GSXA 3KLDA 3B4NA 4LHUG 2IGFL 1BFVL 4EVNA 3TT3H 5E70A 3EO0B 4PJFA 4KJWC 1NMBL 4JFED 1OAYH 3LD8C 4NYLB 4OUUB 3TCLA 3LSOB 5CKAA 1KIQA 2C3XA 2H41A 4OZ4A 2NTFB 2RB8A 1A7NH 2AEQL 4HD9A 1NC4B 4FQLL 3ZDYF 3T2PA 1UJ3C 2WW8A 4DFIA 3TO4D 4FQ2L 2APWA 1RIHH 1FVDA 2DLHA 3BN3B 2V7NB 3UCRA 5FB8B 5IFHH 3I50L 3ARTA 3TEUA 2ADFH 2OSLB 4MXWL 1CLOH 2R1YB 4G9FE 5HYFA 1MRCL 5J89A 4YHKL 1TVHB 5SX5K 5DQDH 3DX7B 4UV4L 4YHZH 5FUZL 1AQKL 2DQTL 4MQTB 4JAMA 4F7PA 3QPQD 2FWOA 3S36L 4Q0XL 5DMYA 3S96A 3RNQA 2ZUQC 3PQYE 2YKLL 3MTRA 2R9HC 4DN4L 4R6UA 5IBTL 2ESVA 3WUWA 1GSMA 1CQYA 3GZKA 5DJCB 5SWQA 4ELKA 5AG8A 5CGYD 4KROC 3QUML 4JFFE 1JHLH 5MERA 3B3IA 4Y4FD 2C1PB 3BH8A 3KPOB 3AXLB 2AEWA 2Y07L 3FT4B 4XP9H 1HHKB 4HXAH 2D7QA 1KCSH 2C7UB 2ZCKH 2NY0B 4P99A 4PGCA 4UT6L 3GSRB 1BJ1J 4KJYA 4F58L 4B5EA 1NCBH 4JFDE 1VFAA 4NNXA 3LEVL 3VMNA 5ELIA 6FABH 1HH9B 4PJ8B 5DMGD 4ZFOB 2F54B 4IOIA 5E4EB 1FZMA 2QQNH 3FJTA 3GIVA 3A6BH 4BZ1H 3MLVH 5I8OL 3PWJB 4P59H 1NLBH 4MMZC 4HIXH 1U9KA 4I13B 3F7PC 1FGVL 3F7YA 4ERSH 4K23L 1G0DA 3OKEA 1QRNE 5TDPB 5BJTA 1U3HD 5C0JB 5EA0L 4C83B 4JB9H 1R3HB 1MCNA 1UKSA 2ZOKB 2K9UA 2ZG2A 3FO0L 1DBBL 4L8CA 3L7FB 3WXVL 1KNOB 3UYRH 1QVOB 2MHAB 4CU6A 1PYWA 2BOCB 4P4RA 1BQSA 4NQCE 3ELAT 3UC0L 5GRYA 1F4XL 43C9B 1OTTD 4NWUH 4OCNC 4OJFH 2O5XH 5DC4B 3T0AA 2YZ1A 3QJFA 3TBSB 4OLZL 3LN5B 4CMMA 3OJDA 4K3JH 5J6GA 1LO2L 5CZXD 3W11C 5TGBB 1G7IA 2VABB 5I76B 3FFCD 4NSKA 4Y4KD 4QF1B 5T5FH 4KRNA 5E1AA 1PG7X 4XH2A 3HE6C 4JFHE 4LCUB 3CDCA 1SEQL 4ZOBA 1HOCB 2OMNA 4LCIL 4Z0XA 4DCQA 4V1DA 1WC7A 4KDTC 1TMCB 3WEXB 2ZCHH 1NAMA 4FQIL 5D1ZC 3U4EA 5CAYB 5DRZB 2NY6D 3C6SA 3KS0H 3IYLW 3PQYB 5HY9B 3ILQC 2ZSVA 2Q86B 3OHXB 1J1OH 1CICA 5CCKH 4HZLA 2XQBH 3DV4B 1I8IA 4L9LB 5HD8D 2H26A 3WD5L 3D5OF 4JPKH 4EDWH 2BRRH 3D2UB 4LSQL 3F65A 4JFFB 4LAQH 3HR5B 1SJEB 1Y0LB 4L5FH 1AGEB 5ETUB 4P5TC 1NDMB 1G9NL 1T4KA 3C09B 3WNMA 4YHNB 4NN7C 3ALWA 3QDMA 5F72S 4LKXB 4Y4HC 1T7YA 2Z31C 2PO6A 3GDBA 5FO7B 1EZVY 3VXRE 4NO0A 3RIFF 5EIIB 4JFDB 2BFVH 3U0TA 4X98A 2H8PB 1BD2E 4H20H 1LD9A 1KENL 4J3OC 5E2TH 3EDDA 2NX5D 3AS2A 4NHUB 1YY9D 1CU4L 1F6AA 3MRBA 1H5BC 4P46B 3Q48A 4NRYB 4NDMA 1ZAGA 4ODXA 4PJ7A 3UBXI 4AH2A 4HZAA 5DHYA 5EZIH 3ZL4L 1QRNB 2HJLB 2JB6A 3AMKA 1FL5A 1DBKL 1BLNB 1FQ9C 4YHIB 3BP6B 1RZIB 2YSSA 1HSAA 4MXQD 4PP2B 2AJUL 2IPKA 4ETQB 5B38A 2DTSA 3S35L 4I3SH 1MHCB 4ZD3L 4NQCB 2E7LC 4JREC 3WXWL 3QUXD 4LLVA 4WHYG 5JHDD 3BDXA 1FP5A 1N5YL 5GGTA 1EEQA 1BWMA 1UEMA 1V5JA 1ZA3A 4LPXA 2Y5TA 5J06A 2AGJH 3KPMA 4NJ9L 5TPWL 3UTQA 4OI9A 2V2TA 4NRZA 3S6CA 1XF4A 1U8MA 5IW1B 3ULUC 1T89A 3FCTB 1RJYB 2E5EA 3JWOH 1A3RL 3QG7L 3HI1A 4KJQC 1KELL 1ZEAL 3W0WA 3QRGH 1Z9MA 2EDNA 4FZEH 3BZDA 3QWRD 4G3YH 3QRFM 3C8KA 3RDTB 2JK5A 3S4SA 4PY7B 4CNIA 1RUPH 1K6QL 5CEYA 4OFDA 3RIAK 3H9SD 1D5ZB 2BSRB 5D6DA 3O3BB 4WHTB 4XNUL 1ZLWK 2X40A 3CLEL 4PJDF 3PF2A 12E8H 1WZ1L 5IVXA 4P3DB 2EDTA 3Q3GB 2FBJL 2ADIA 3V4UL 1Q9LA 2VL4A 3LEXB 1NUGA 4J1UA 3EAKA 4XNQA 5B8CA 1CD8A 1EBPA 2DF3A 1KOAA 3AMLA 3WFCL 3ZKQD 2QHRH 1MCQA 1YUHA 4L4VD 3WMSA 3LPGA 2JF1A 3O2DA 5DJ2A 1X5YA 4I3RH 1JGDB 4H0HB 3ARPA 3SO3C 1QHPA 4DZBB 1FFPA 3GSNL 2VJXA 2XRAL 4KRPD 3QUMB 2H3NA 3KYNB 3VXRB 2DQGL 5EO0B 3P40A 2YPVH 1HE7A 3CK0H 2XICA 1DLHB 1BD2B 3FONA 3VXQB 2K7QA 1G7MB 4KUZL 4Q74A 1IRAY 3C5ZA 5T3XD 4H0IA 4N90E 2FX8L 3DIFA 2X1XR 1U93B 3NCYS 1CD1A 3RI5F 2AV1A 1JV5B 1OP5K 4X7SL 1JNJA 2R0LL 3SE9L 1SM3L 4AK1A 5IWLA 1VENA 4YAQA 3SPVB 1RVFL 2W65A 4F3FB 2YRLA 2XA8L 1BJMA 2ICWJ 5DFVC 4Z77B 3D25A 2X7LB 4Y1AA 5TE4H 4WEBH 4WI8A 1XGPB 3W9EB 1H0DB 1ZLUK 1VFMA 5GS1B 3SY0B 4KK9D 3LQAH 2H32B 4X5LA 3LQAC 1UJ3A 4ZUUA 3PE9A 2V7HA 4TTDC 3ARZA 3T09A 5FDWB 2P5EA 3BQUB 1FNEA 5DR5L 5JNYB 2B4CC 2AERT 5TDOA 4FQ1L 4XTRC 4J3UA 1XR9B 4XVTL 3VXSD 2A83B 4BFIA 1TZGL 3RGVB 4N1CA 2DJUA 4P2QD 1Q0XH 1C5CH 4L3EE 4TSAL 3EYQD 4FFYL 3U48A 4OGXH 1J0ZA 4KTDH 3MNWA 1NCTA 4MAUH 43CAA 3ARQA 4ZFZB 1KCRL 4ODSH 3S88L 3V7AG 1JPGB 4X4YA 1MCRA 2XQYK 3O9WB 1A3QA 2E6PA 5I1DB 5HHPB 5I30L 2BOBA 4YDKL 2FR4A 4P23C 2GAZB 3V6BR 1X5ZA 2HMID 2IAMC 3DUHA 1HYSC 1MRFL 1RZKL 5IB5B 5C09A 2DDQH 32C2A 5EU6A 3VFWA 4HG4J 1MPAL 1EJ6A 3S5LG 2KZ1B 5C0RH 1YJDH 3L9RB 5DD5L 1JL8A 5C8JB 3GUTB 2WINB 3TZVA 3D3VA 3TFKC 2CKBH 1OL0A 1G9MC 2GT9A 3QDJE 3VGAB 1GIGL 2FHCA 4HUXB 1HXMB 4BM7A 3TCXA 1FORH 3STLB 2RAMA 3MRFA 1QSFD 4KJPC 3OX8B 5DD1L 1U8HA 4GW5A 3NVQA 4NFBA 3ZDXF 3HZKB 1DR9A 3HZYB 1T2XA 4P57B 1I7RB 3O8XC 2WANA 1MREH 2EC9U 3NFPA 5D7SH 4G6ML 3QI9B 5F6HJ 3FHAA 1KLGA 1H3VA 3V8CA 4R7NA 3OBAA 3PNWA 2H1PL 4JM2B 4QRRA 1A7OL 3TH4T 4QHNA 4E41D 3HE6A 3VFMA 1PX3A 3NTCH 3KLHC 1CDYA 3Q6FB 3BMVA 1AD0A 4KDTA 4TSCH 5D1ZA 1LVEA 3F7QA 4YC2C 1DQTA 5JTWA 2JLLA 4L3EB 1JF6A 1S7QB 3RPIA 1S7VA 2MKWA 1P2CB 1TTFA 3L95B 5GQBA 2FL5A 1MF2H 2DICA 1OGAE 2DKMA 5LGJB 3PGDA 3OG6B 1T1ZA 3QZWG 3MA7B 2X44D 2E27L 4BJLA 4FQHB 3IFPA 4P5TA 2YXMA 1KG0A 3WFZA 3VI3E 1JWSB 4RFOL 3BIKB 1EZVX 1QACA 4GRLD 5C9JA 4JZNA 2Z31A 3RVUD 3SJVE 3OAYH 4F7MB 1NC2A 4PJCF 5DYOA 4HK3J 2I07B 1ZT7B 4D9RD 2HFTA 3L3IB 4YDJA 3KVQA 5ISZD 2LTQB 1H5BA 1RK0A 4J8RA 3TPUB 5D1QB 5GGVH 3TBYB 4H5SA 1IM9B 3GSNB 5D7JA 2Y5EA 3MRJB 1FN4B 3RWGB 3QDJB 5LWYH 5C08D 4HHAB 1KCLA 1TJHL 1YEJH 2I9TA 4I9WE 4M02A 4OSUL 4XC1H 2D7TL 2AK4A 1AC6A 2VLRB 4UQ3A 4NQEA 5M95B 4PJEE 2E7LA 3AB0B 3RJDA 2F8VA 1L7IH 2IPTL 3ARBB 3ARFC 2EEDA 3WFEL 3QUYC 5I66A 2PYFA 2BSSA 5E95B 5EZOH 1GGYA 4X6FB 4XVSH 2IJ0C 1HILA 1IFHL 5HJ3A 3SDCB 3BEVA 4NUGH 1WAAA 3B9KC 4A6YH 1K85A 2MTPA 3DSNA 1IGCH 4QRPD 4QTHB 4P5MB 1A1MB 1B4JL 1ZV5A 1WIUA 1QBMH 3O3DA 4RMUA 5JPMB 1H15A 1UC6A 2DM4A 2UYLA 2X4UB 3LMJH 5E2VH 2AEPH 1TENA 4PRAB 1T1YA 4RBPK 3MV8D 5D1XC 5FK9B 4YXHL 4Z95L 3VXPA 2J7LA 3QDAA 2F53E 4OD1H 4X7DC 4P3CH 1IQDB 4M7JL 2Z93A 4NFCA 3DVGA 1OGAB 4MNHB 5JXAL 4ONGH 3BXNA 1I3UA 4O02H 4KHXL 3LRSA 3GMPB 4HS6A 2ZKHH 3VJ6A 5T3ZH 5HHNA 5EOTA 1QSEA 2GUOB 4FXGA 1VGKB 1EMTL 1T22B 2H6PA 3HN3A 3RTQC 1HI6B 2MKLC 5GGUB 3WDJA 4XNYL 3D0VA 3SJVB 4Z0BH 3FO2B 3X3GH 5D71H 3MREB 5DZOA 2WWMC 5DK2A 4HWEL 2XY2A 3BPLB 2NXZB 2EDQA 3X11A 4WHCA 4OZHA 1T20A 5EZJB 3P9LB 1I1YB 4XB7A 3VFNB 3MLZL 3C9NA 1QFWL 2CK2A 2IWGA 4K94H 4OAWB 1F4AA 4P9ML 5IR1B 1FZOA 1S5HB 2J8UE 4JDZB 4DGIH 5BV7C 4RIRB 4IEFB 4DZ8B 3I02A 2AS5M 2OR7A 5EUKA 4R2GC 2HAZA 5JIIA 2V2XB 1DE4A 4OLWH 2Y36L 2YPLD 3QULB 3CXDL 4K71C 3G04B 5JXEC 1O7VA 2UVFA 2DMBA 3CX5K 1KACB 3KPNA 5C0EB 3O6LL 1EEZA 4XMLH 1M7XA 3HI5L 5EWIL 1D5BB 1BIIA 1QLRA 4WUUA 1LE9A 5L88L 4PJEB 3F58H 3OGCB 2P44B 5F3HA 3O3AB 3WCYA 1BP3B 3WS3B 2R8SH 1WWCA 5I74C 1ZA6A 4Y5VB 4XPBL 3VCLB 2MMXA 2X2YA 4LOUD 6CGTA 5IFJB 1N2RB 2AXJA 1N8ZB 4N8VB 4MQXC 2ZNWA 5K59F 5GGSA 5DO2C 2OP4H 5FO9A 4DEPB 1JVKA 2C4FT 3QQ3B 2OI9B 4QWWD 1I7TB 5E8PA 5CBAB 5E03A 4OZIE 1UVQB 2VAJA 3MV7E 1OD9A 5CZVL 4HK0A 1DTUA 1RMFH 3SOBH 4FABH 3ZZ1A 3TA3C 2VERN 4O58L 3MGOA 1A6TA 1RUAL 2X5PA 1IGIL 5C0CE 5FA3B 2F53B 3MOQA 4NP4H 5BW7C 5DWUL 3DOSA 3VXUD 4R4FH 3CVHH 5T1LD 5EOCH 5I0DA 3SDAD 3PWPE 3P73B 4D0DB 1EJOL 4AY0A 4D0BB 4P23A 4GAYA 3HMWL 3MRMA 4XPHL 5CINH 4ZG1A 3MJ8B 5C2BL 1WK0A 2IAMA 4JGJA 4WFHE 2YA0A 2GJ6E 3OG4B 4XCEB 4AM0B 1RULH 3A6CL 4OTXH 4UDUA 1T1WA 4XBPB 5JORB 1X5FA 3C08L 4HWZB 4KI5C 3IDXH 1XIWB 2PETA 1CS6A 3AY4C 4ZO9A 4DKEH 4JY5H 4K7PL 5AUMA 5F7NC 2QEJA 4PY8J 3QHFL 2R0KL 2EC8A 5CEXA 4FMKA 5C6WH 4DK3A 4LP5A 1RJZB 4JQIH 3C6LD 1MY7A 1DN0B 1PVHA 2J8UB 5KZCD 3TV3L 4YFLF 5F1NB 3BP4B 5DJZA 3RWIA 4QRSB 4F7EA 3BAEH 3FB5A 1WICA 3BO8B 1BHGA 1A7PL 1F90H 1TJIH 3B9VA 3E3QE 4AENB 4MXVF 4CVUA 5IT2L 2CDEB 3SGEI 2BRQA 3P30L 4MJ2A 4GXVL 3OR7A 3SKMB 3N1FC 2FATL 2G2RB 3O8XA 2R2EB 2VSCA 1VACA 3V52H 2H2PC 1VPOL 2AKRB 2O5ZL 1X5HA 4WDIB 5GGSY 4LCYA 4WY7H 2MOVA 3PIQA 5D2LE 3CMOH 3HMXH 3QEQA 1I9RH 1YYML 4ORGA 4NCDA 1CDBA 1HHHA 3ALXA 3QO1B 1R3KB 1V05A 4OV5B 2EH8H 3BKYL 3ZT6A 2P46B 1IC7L 4PS4H 3GSWB 5F7KC 5I6XC 4I48B 1I75A 1A6AB 3KYOA 3ARGD 4OZIB 1D5MB 2PXYB 3MV7B 2WIIA 3VI4E 1W72A 1YPZA 5DQ9B 4CN6A 3M1BA 2P8LB 2VDPL 4LSVL 4UAOB 3QCVH 1UACL 4B41A 3L3GA 5C0CB 2HT3C 1ZLSL 1ERNA 1QA9B 4XC3L 2I9LA 2DQFB 4KTEL 4PJFF 2I24N 3DMMB 5TE6L 2GJZA 4Y8AA 3LY6A 5H35A 5IVOA 4EI6B 3PWPB 1QRKA 3D0LB 4YHLH 5TFSH 5KTEH 4IRJD 4YHML 3E2HC 2DIAA 3DXAD 1Y18A 5IHBA 2ZSWA 3V5KA 4LLDB 1A02N 2LAAA 3TLRA 2GJ6B 3ZYJA 3ZYZA 2NLJA 5JQ6L 5IW6A 4D9LL 3BN9D 5MENE 1MUJB 1OF2B 2FO4B 1IEAA 5FO8B 1J05A 2D31B 4MJ4A 4PJBE 4L29A 4Q97A 4M6AA 3UTSA 1TZIA 5LAXA 5HTSA 2RFXA 2CH8A 4MS8C 4PRPD 4P4KC 4OFVA 3EYFB 1T66C 3IS1X 1FZJB 2ZUYA 3VE0A 4NZUL 1GC1C 5IB2A 1Q9WA 1WFTA 1OW0C 2IALB 4GG6A 5CJQH 1KEGH 4WNQA 1I7ZB 3IDYB 3DO7A 3CAFA 2FJHB 4LL9A 5E2UH 3TGXA 4NC1E 3VWKC 5KS9E 1ONQB 1S7UB 2OR9H 2Z8SA 2NY3B 5DMIL 4AEHH 5L2JA 4WO4B 3DVNA 3ARFA 1NEZB 2DQDH 4QYOB 3QUYA 3UBXB 3LN9A 4PGDA 1A22B 2WBJD 4X6CA 2VL5A 5D2LB 2Q8BH 3B9KA 4R97C 4FG6C 5C0BE 2X89A 1YMMA 1G7JB 2R2HA 3ARDB 4XNXH 1F11B 4ZS6C 4JRYE 2F5BH 1ZT1A 4CU8A 3BGAA 1I4FB 5MHSE 4FQXB 1UZ8B 2A38A 2B8OT 1J88A 4D8PA 5HPMA 1FCGA 3IFLH 4PJHA 2AV7B 2APBA 5EC2A 3NABL 5D1XA 1RUMH 2DI7A 3QSKB 1A0QH 1AKJB 4I5BA 1Q9OB 1RZFL 4DW2H 4MA7H 1YEEL 4J3SA 3UPCA 3T0EC 1LMKA 1KFAH 5CWSA 5I1EH 4LSRL 4X4XB 4C4KO 2DIBA 1BFOB 2IFFH 4U4BA 2ITCB 2HVKA 4M93C 4M6NH 2DTML 2M1KA 3O6ML 3TN0A 5L2KA 2I27N 2CDGB 1FAIL 3BPCA 4JN2B 3T2NH 5DJ0A 3RTQA 1KN4H 2VITA 4UDTA 3DNKA 1GOFA 1CDGA 2GSGA 1E6OL 1S9KC 4JHAL 5MENB 1JIBA 1KPRB 2V17H 4TQEL 1D9KB 3MBED 4PJBB 3LQMA 3I75A 1MY5A 3RQ3A 5DJXA 1IKFH 5FHBL 1FL6A 5DTFA 1MHHA 3JV4B 4E42A 2YA1A 1RZ7H 1JZ3A 4U05A 3MV9D 2ZUTA 5GSRB 5I2IA 5IHZA 4Q9CA 2OTWB 3ZE1E 1BWWA 3OKMA 4ZUSA 3QUKA 2B1HH 2NY2C 2VZSA 3DGGB 4N8CH 3SKNB 1YEDB 1RZ8B 5CILH 5JXEA 3MBXL 1HQRB 1P7QB 4Z78A 4XPTH 3H42H 2GSIB 1JNNL 1N7MH 2FSEB 4R4NC 4Z5RA 7CGTA 1IM3B 5KS9B 4IBLT 1NJ9A 3LIZH 3NFNA 5D7IF 1KF9B 3O2WH 3NH7H 3HUJE 3WHE0 1CE1L 3KXFE 1LILA 2NMSA 2A9MH 5J9PB 3BPNC 1TITA 4Z7VA 5DFWH 1WZLA 1JTOA 1HWGB 3UZEA 1ZWIA 3HFMH 4ZDHB 2IH1B 2HTLD 1FBIL 1K8IA 4XPFH 3MLUL 4WTXA 4KKAD 2CGRL 3DTXB 5GZND 2DQHL 4KV5E 4ODHH 4Y5YB 1UA6L 1CXLA 5GJSL 2A6DB 5C0BB 1TQBC 3VG0L 4GH7B 4PJIF 2R1WA 1FE8H 1FV1B 2YC1A 4PJ7F 4JDVB 4OCWL 5CJXC 1QUNA 1LEIA 5EN2B 4AQ1B 1UB5A 4FQJL 3IXAB 2BVPA 3VRJA 3NCBB 2EYSA 3NN8A 3GGWA 2MPAL 5F7YC 3SGJA 4LU5H 4XI5C 4HUWA 1IGJA 4WI2A 1ZGLB 2B1AL 1Q1JH 1U95A 3WHE1 4LSUH 3BVNB 1EH9A 1RIUH 3GNML 5BW7A 4O2EA 3UJTL 4CW1A 4E0RB 5GS2D 3ULVF 3VXME 5CKGA 3NGBC 4PG2C 3U1SH 4N0YL 3RWHB 3WKMH 2WQ8A 5E8DH 1TPXB 4NQVA 3MROB 1IC5H 2BNRE 4IRZH 3D39A 2ERJC 4EUPG 1PFCA 1FNFA 5AZEH 4MX7B 5DVKA 4L3CB 4BK5A 1G7LB 1O0VA 2YUZA 3NIFF 3FOMB 3C60B 5DRWB 5HHXH 1QP1A 3VFTA 3RI5K 3DSFL 4PJXF 1MAMH 5I15H 5FECB 3AY4A 4WV1C 1HH6B 1A9EA 3SE4C 4P2OB 4NHCL 1I9JL 4QT5A 1ACYH 2A74A 3QEGL 1AR2A 4DVBB 4X6DA 1M05B 5IOPA 3AAZA 1D5XA 4U1NB 3L5WA 1K4DB 2XXMB 4LKCB 2QSCH 2BHYA 5IK3A 3LAFA 1IC4H 4WI3A 1CGUA 4WEMB 4KQ4L 4GRWF 3BHBA 3GSOA 3LV3A 4CGTA 5HGAB 1MNUH 5D7LE 2G5BB 3GI8L 3M17B 4W70A 1K8DA 2CMRH 3RU8H 3HUJB 3IT8D 2GTWB 5LXGH 1MCOH 1G6RA 3KXFB 1EUUA 4NN5B 4OQTH 5F3BB 2Q7YB 3UTPD 5JHLH 4G6JH 1F42A 2PYEA 4U7SA 3O2VH 3REWA 3QWOA 3BP7A 3OJMB 4YDVA 4DVRL 4XXDA 5B22A 4TRPH 4HLZH 1XGQB 4H8WC 4UT7H 2P1YA 4MDJB 1I1FB 1FZKA 3FQXA 4IRSB 4XAKD 4UNTA 3JV0A 4ZOAA 4PD4J 5DS8A 1T21B 2OXGA 4Y5XB 1CDCA 3ZDZE 1TQCC 2CK0H 4HGWB 4CVWA 2NY1B 4XCNB 4V1DD 1LEKA 4LSSH 4PLOB 2JCCE 3PV6A 5JA8B 3UZQA 4NPYB 1VHPA 2XPGB 2AQ3A 1CN4A 2Y9RT 1JWMB 2FGZA 1MJ8H 1NGWA 1M7DB 2AJZA 3QEUB 5HYSG 5EORH 2Q76B 5GSVB 3VXMB 3SE3C 1CICD 1AXIB 2HKHH 2JB5H 4OZFA 5A40E 1L7TH 4NWTH 3RX8A 3L3KB 2ZG3A 2VZUA 2PR4H 4U1GC 5TF0A 4HIEB 2DQCH 4R7DA 2YD4A 1AFVL 4BQ8A 1KT2A 1A6UH 2XT1B 4NFDA 1RFDH 2QLVB 1MELA 2R4SH 1YNKL 5ANMA 4I0PB 4LLWA 1CD0A 2ZPKH 5C9KA 4DN3H 3QDMD 5KVGH 1EPFA 3Q1SL 4LHJB 3TWCL 2AJVH 3BE1L 3KG5A 1KJVA 4HH9A 4I4WB 1ZANH 4DGVH 4OLVH 1MCLA 3ES6B 5HYQA 2X4NB 3FQRA 2P43B 1OQOA 4NO0D 1C8PA 2D7NA 5HHME 4PG9B 1OW0A 2HN7B 1I1RA 4Y2DB 4MSWA 3EYSL 1MVUA 2FJGA 1SBBA 1RU9L 4R0LB 4YPGA 3WO3B 2XIDA 2OX5A 5GRWA 2L0DA 4WI5A 5GS0D 2IBBA 3RNKA 2R56H 3VWKA 1T83C 5D7LB 4NQSB 2PUQT 3CDFA 1BVLB 5IB1B 1AE6H 1S7RA 4UIKH 2X10A 4PRIE 1IEBA 5EU5B 3QFJA 4IOFC 3LKRB 1UKQA 2R15A 1N64H 1OB1A 1OGTA 3ULVD 3D1MC 1U8JA 5HYJE 4N0UA 1OSPL 1BVKA 5I18H 2R23A 2XWJA 3T0XA 1VESA 1I7UA 1S5IH 3QQ4B 1VEMA 1MQKL 3WJLC 4YO0A 3UO1L 5IVNA 2ARJQ 3T1FB 2VDOH 4U6XB 1T03H 1J8HA 4XWOD 4D0CB 2P8PB 2C4XA 2XYCA 2VWEE 4IIQC 5I1JL 5CZKA 7FABL 4R96B 2X4TA 1WITA 3GMNA 2QR0B 4PJ8C 4PTUA 3W0WD 1S7SA 1IAKA 4B50A 3P9MB 4NBZB 2JCCB 3CU1A 4LVNC 4POZC 1RSFA 3NA9H 3BOVA 1R5IA 3MRNB 1X4YA 3T0EA 1KPUB 4PRDA 3LKNA 2F9BT 1UWGH 2IEPA 3LB6C 2HYMA 2BNUA 3O4LA 4LF3B 1SY6H 5I73B 4PB0H 1BZQK 4G9DA 2ADJB 1AGFB 4L8BA 4GAJL 5HHVL 3TVMC 2OZ4H 1ODAA 1U58B 2NYYC 4Z7WA 1DFBH 4KPHH 1BX2A 4PGEA 2EXYD 35C8H 1CXKA 4QHMA 2XTJE 3R1GL 1HHJA 4WCYH 4MJ5A 1K3IA 3QEHA 3TJHC 4UOW1 1AD9A 2VLKD 2CIIA 1CVRA 2XFXA 1GJIA 1ES0A 1JFQH 1YEIH 5F89A 5L6YH 1MJ7L 5A3ID 3T0VA 4RGNE 1S9XA 3N1QC 5HHMB 4OFIA 1R3LB 3GMRB 3C5ZD 5IFHL 4ODWB 1RQ5A 4QTIL 4OIBA 5IF0A 2ADFL 5F93C 3KYKH 3L3OA 3Q6GL 4OGYH 4AG4H 5GXBB 2ZOLB 1OHQA 3OKOB 1KTDB 3GJEA 2A1WH 3W39A 1U8OB 3OKDB 1JGVH 3PGFH 1JZ6A 1ORQB 4FTVE 3F12A 3VG9C 3CX2A 3CCHB 4PREA 3I6KA 5I1HH 4Y1AD 3NCEB 1T0NB 4KJWD 5EO1B 5FM4A 2NX5E 1AH1A 1EXUB 2IADA 1EHNA 3ZDYE 5IIEB 5CUSH 1GGCL 4X7TB 3U2SB 5HYJB 2GHWB 4LGRB 3T8XA 3L3HA 2DWEA 2CRZA 3I84A 1U3HB 4OLYH 5E99L 5CJXA 3R0NA 5DJDB 4XP9L 4NO5A 2ZCKL 2P5ED 4DQOH 1FJ1B 4JO1L 2XG5A 4JFOA 5KSUA 5ICXA 3MLYH 2F5AH 1NCBL 4RCAA 3ZKNC 3HKFA 3EYUL 5IM7B 4LBEA 2AAVA 3A0OA 3EJZC 5HVGB 5JHDE 4HIIA 8CGTA 2VR9A 4P46C 5HVHC 1C7TA 4EOWH 4P59L 2R9HD 3DV6A 5FUOL 4PG2A 3U0WL 1H8OA 2CSPA 4ZTOL 4Y4KB 1NFIA 1UWXH 1PQZB 4PRBA 4KROD 2ADGB 3K80A 1WFNA 3G9VA 4XMKL 1OARL 1EHLL 4HCRA 5HPOA 3ULUF 4TUJB 3OKLA 4ZQKB 2XTJB 4PLNC 2IQAB 2YD8A 4WV1A 1VFUA 3MACH 4AZ8A 2NY6B 1FRGH 3SE4A 5L8JB 4KGLA 4JPWL 2O5XL 4OJFL 2H2SC 5K9QG 2IGFH 3RGHA 5ESVA 1OP3K 4K3JL 1E4WL 1NMBH 5DD6A 5EU6D 5AWNL 3V0WL 1X44A 1EO8L 1I9EA 5TQ0L 3EFFA 2AK1H 4RGNB 1CFNA 5HYEA 1XGRA 2EDWA 1L0YA 5T5FL 2AEQH 4HJGA 3VGFA 1CLZL 3MJ7B 3D3VD 3MLTA 4L4VE 2RIKA 4H1LB 2FHFA 3KNBB 3I9GL 1EFQA 5GJTH 5FHAH 4GKNA 4F15B 3RDTC 5KG9A 4LARL 5FYJL 1QBAA 1IQWL 4HV8A 1KJMB 4MXWH 4FTVB 4YHKH 3OR6B 4I77L 1EEUA 2YK1L 5FUZH 1J1OL 1AQKH 5B4MC 1A6ZB 5CCKL 3P77A 2DQTH 4O51A 4QCIA 3VD9A 3MNZB 2NX5B 2Q7NA 3S36H 1MIEL 4Q0XH 5E5MB 3CDGB 1CF8L 2VISA 4JPKL 2YKLH 3QIUC 4EDWL 2BRRL 3H9ZA 3K46A 3EW3B 5IBTH 2BXZA 4I2XE 3QZWA 3HNSL 4O9HH 1KCUL 4G7YH 3BT2L 3W11D 4KK5C 5IMOB 4M1DH 4QNPF 4APQC 2ZJSL 4C59B 4QRRD 3QUMH 2P4AB 1CFQA 1HZHL 2VNCA 3HE6D 4YX2L 1F13A 3LKSA 4HDIA 2EYRA 5ALCH 5C07A 1UWEL 2Y07H 3MYJB 5D6CB 3QUXB 4RDQG 5H37H 5D1ZD 1P9MC 4XVJL 5E2TL 4UT6H 2B5IC 1LK3L 5JHDB 3DARA 4WJ5B 1P4LA 2NW3A 4C56D 2X1QA 4X9BA 4F58H 3ILQD 1ITBB 1U2HA 5C0AA 3SE3A 3LEVH 4ONFL 4YNYA 5EZIL 3U9UA 3ESVF 5MI0C 3MO1B 4TVSa 5E1HB 5IQ7L 5DEZA 1SVCP 4RGOL 5I8OH 3HLAB 1LO3L 2H9GA 4L1DA 1FGVH 2W07A 4M3KB 4P5TD 2XKSA 5SV4A 4YFLI 2W9LA 1T5WB 3FQNA 4NYLA 4OUUA 1RPQA 1A3LL 1DBBH 1HCVA 4HPOL 4Y4HD 1TFHA 2Z31D 3CNKA 1NC2D 3WXVH 2J2ZA 2YA2A 2ICWI 3BUYB 3SDDB 5FDYA 5EC1B 2P8MB 4A2LA 3UC0H 5AG9A 4XXCC 4FN0A 1I8KB 2BNQE 3PWVA 3TIDB 5SWSA 3NCYP 5T1DL 3SKJL 1JGEB 1WBYB 3PWNA 4OLZH 5HGGS 3BFOA 4QRTB 2K7PA 5KAQG 3DX7A 3JWOL 3DPBA 4L4VB 1LO2H 1NFDF 3RGVC 2WBWB 3MJ6A 1T83A 4G3YL 1GAFL 2Z4QB 2ITDA 4KRPB 2Y7QB 4YWGH 1I85C 3FT2B 2AK4D 1KGCD 3NCMA 5I8CA 4NQED 1S8DB 4FQIH 5FYJE 1YYLH 4AEIL 4I0CC 1F3RB 2C1PA 1F6FB 1JHTA 3KPOA 5FCSH 3WJLA 3MOAL 4I2XB 1KULA 1HHKA 3SQBA 3EZ8A 3B2VL 1CGVA 1D3CA 5I16B 4U0RB 4ZSOE 4LSQH 5GZOC 1B2WL 1QSFE 4I0KA 1EHAA 1NANH 4J12A 3ULUD 3GBLA 2FIKB 4KJQD 4WU7B 4X5WA 4U1SB 5HHQB 4PJ8A 5L0QC 4ZFOA 2F54A 1OAQL 3P0YL 3T4YA 1FPTL 3CDYA 1G9NC 3PWJA 3KWWB 5DJYB 1GGBL 5DF0A 4HLJA 4TUOB 4U2YA 4PJDE 4KFZC 1JMXA 1UQSB 1J11A 1W0VB 1M71B 2Y72A 3B9AA 1SJXA 2OTUA 4GRMB 4C83A 4U1MA 2ZOKA 1LNUB 1CU4H 4Y8DC 4RA0C 3TVMA 4U1JA 1QR1B 3L7FA 5KN5A 1I3VA 2OZ4A 1N4XL 1QO3B 4TUKH 2XQYG 3UYOD 2BOCA 4BH7B 4D3CL 4ENED 2A73B 1YC7A 3K81A 3ZL4H 5TE4L 3WNNA 1DDHA 4WEBL 1GYAA 1RUKH 1QSED 4Y88A 5CJ5A 43C9A 3GMLB 1VFBB 3KAAA 3TBSA 2R39A 4HFUL 3LN5A 3QI9C 4UZGA 1X7QA 4XZUB 2YWYA 3HPLB 5TGBA 5K9JL 3S35H 4NJAL 3L5XH 3O3EB 5I76A 4HGKC 4PIRF 4ZD3H 3HAEG 2BNQB 5DT1H 4JY4B 2Z9TA 2EO9A 1R5WA 2J8HA 4OIAA 1RHFA 4LCUA 4G9FA 2WV3A 4WW1B 2YBRB 5J1SC 1N5YH 5IHLB 5F6HI 3D69B 3PWLB 3LEYL 1FAKT 5TPWH 3W82A 1N0LA 5DRZA 1NGQH 4Y89A 5DK3A 3PQYA 4MZ3A 5HY9A 1URLA 1C5CL 1A3RH 1ZHBB 5E56A 5DFVD 1RY7B 1KELH 3DV4A 1ZEAH 4D9RE 4S1QL 1AXTH 3JBG7 5ADOL 3VXNB 4WUUD 5GISL 5FUCE 4HH8A 5DHVB 4ODSL 3D2UA 4ZXBB 1K6QH 3HR5A 1Y0LA 1YDPA 3QCUL 4OCSH 3FB8A 5ETUA 1NDMA 1DANU 4GOSA 3TJEH 4XNUH 4V2BA 3CLEH 4TTDD 1MI5E 1WZ1H 3BP5A 5C08E 3T77B 2FBJH 3V4UH 1KBGL 1XAUA 5KBNC 4ZSOB 1NAKL 5FO7A 1QSFB 2EDDA 1X6NA 4XTRD 4OT1L 3WFCH 4GG6F 1MH5A 2H8PA 2DDQL 5IEKB 2RBLA 4NHUA 1HSBB 1P1ZB 4JANA 2JJVA 4P46A 1YJDL 5D1QC 5BS0E 3GSNH 2XRAH 4PJDB 3WFHB 3BDYL 3HI6L 3Q5YA 4HPYL 5E7FA 5B3JE 5BCAA 1E28B 1QRNA 2CKBL 1WCBB 3CFBA 1P5VA 2EDLA 2GITB 4NKOB 3VFSB 4O2FA 1BLNA 4YHIA 2FX8H 4JJ5B 1RZIA 5DUBA 4PP2A 4FP8L 4PTTB 1UM4H 4ETQA 1PG7L 4P23D 4PJ9C 1MHCA 2R0LH 1SM3H 1HXYA 3JUZA 3RWCB 2IAMD 3DYMA 4TULH 4X0KB 5ID0B 4JQXC 1RVFH 4ZYKB 1HYSD 1MREL 1MRDL 1WWBX 3GSVB 2A6IB 2XA8H 3CH1B 5D9SB 1S7WB 5CEZL 3PHOA 5CP7A 3BI9X 4TSBH 3U36A 1DLFL 3BIBX 3ZKMC 3MRCA 5DJAB 5F9WB 2VMFA 4PUBL 5JW5B 5IW1A 1HK6A 1QFWM 2WQRA 2VLLA 5IROC 3NTCL 4M43L 3PHQA 4ODBD 3TFKD 3X13B 1F3JB 4UOJA 3RDTA 4TSCL 2ZUVA 4GRLB 3FOLB 4YIQB 5DI8B 3CFIC 2AJXL 3JV5A 3ZDXE 1D5ZA 1LE5B 2BSRA 4KJPD 1LO4L 4GXUN 4JFZH 5FYJU 3RZWA 3O3BA 4WHTA 2IPUK 1TZGH 1M1SA 3FB6B 5I71B 3B9EA 1ROWA 3O8XD 1BZ9A 4HIJA 4K3DL 3QIUA 1A2YB 4LNRB 5CIPB 3WUWG 3MCKB 4FFYH 5EG6C 4XRCB 1QKZL 4P2RD 3JUYA 4APQA 3QEQD 5C08B 1JGDA 4DGYH 1RJCA 5KSBF 1OSZB 2NY5L 1NGXA 3EDEA 3MRHB 4R8WL 4YJZL 5I30H 3QUMA 3KYNA 1A6PA 2XN9A 3VXRA 5EO0A 3KLHD 3BPLC 4MGXA 2NXZC 4Z8FL 3VXQA 1G7MA 1P9MA 4RQQA 1PAMA 4WRLA 1MRFH 4FMFA 1RZKH 4GQ9L 4WENB 5BS0B 5GGVL 5LGKA 1WTLA 4XX1G 1FYTA 4UBDC 1MPAH 3PL6C 4JRWA 3RVWC 1CTOA 5DD5H 3HNVL 4F3FA 4HS3B 2D9QB 1DUYB 4AMKL 4H0GA 3QG6B 1T5XB 3W9EA 1XGPA 4NNPH 1G7HB 4OCLC 4PJCE 3MRPA 4PJGF 4NO3B 3GB7B 3VXTB 2H32A 5DD1H 2EXWD 2OQJB 1HDMA 5EZOL 4WI6A 5FDWA 3J7HA 3MRKB 4XXCA 4XVSL 4AJ0A 4O2CB 3BYYA 3UTSD 1GPOL 3LKQB 4U1LB 5JNYA 2OI9C 4WUKL 1XR9A 3H7BB 3F8UB 5HI4C 1QLFA 3RGVA 4G6AC 5CEZE 1A7OH 2QBWA 1QBML 2FH8A 1I85A 4LPUA 1GGIL 1W0WB 1L6XA 1PEWA 4MVBC 4ZFZA 4K8RL 4LVHC 3ARFD 2IAND 5I1DA 4GW1B 1JZ4A 3QUYD 3RUGB 3MCG1 5HHPA 4F7CB 4JHWL 3DUUB 1G0XA 4K7FA 3T1WA 2ZKHL 3PABA 1DBAH 4JGMA 4WFEE 1DEEA 1M4KA 3B9KD 3HZVA 3NIDE 3OZ9L 4GBXB 4Q58C 3PP4L 1ZT4A 2FDBP 2X89D 1AXSA 1OT2A 1YMMD 2VLJE 2YRPA 3IDGA 2E27H 4HKXB 5D71L 4EN3B 1EGJH 5DXWA 4HULB 4JHBA 3AUVA 1KLUA 5KVFH 1CFBA 5C8JA 2FEEI 3GUTA 3QBTB 5I8EB 4TNWF 5BXFB 4YHPA 2LVEA 2RCSL 4OB5L 5H2BB 2Q20A 4U1KB 2XKNA 5D1XD 3GHBL 4Q6IB 3RWEA 3QQ9C 1BQLL 3PDOB 4GLRH 3VMOA 2EECA 5FOJA 3STLA 3OX8A 2Z35B 2GKIA 3UP1A 1OP9A 3IVKA 4JCLA 2EKJA 3HZKA 1AO7E 4P57A 4XMLL 1FNAA 5L2KD 1FDLL 4PJCB 3CFEB 1A9BA 5FF6B 2OBGA 2CKBB 3F58L 3RTQD 1TJHH 3RKPA 1PW3A 2R8SL 2XZZA 3QI9A 2D7TH 1S78C 5B38G 5C70A 3V0VB 2WWMD 1DEDA 1SQ2N 4BH8B 4JM2A 3CZJA 1UFUA 2IPTH 2FBOJ 4Y19D 3WFEH 5DQJA 5T1LB 3SDAB 4HUVA 3V6OC 3GSQB 2VKXA 4YHYB 3O6KL 5GRXG 1TVBB 4G8GE 3UZVB 3SE8L 4C4KT 1QSZA 1IFHH 4LDOB 3DXAE 5CSZB 2V6HA 4R2GD 5DUMH 1YN6A 4L3EA 4FABL 1J0YA 2E7CA 1A7QL 5JO5A 5JXED 1S7QA 1JYVA 3MRIA 4QHKJ 2LABA 1V3JA 1M6OA 4MA1B 3VRLF 2F8OA 1P2CA 1EA9C 1B4JH 2D03L 4HMEA 1HNFA 4XP6L 3L95A 3BD3A 3S4SG 3MOBL 1RK1B 3QA3A 3DMMC 5LGJA 4DJMA 3MA7A 3CVHL 4FQHA 3RBGA 3BIAX 3C6LB 2PF6A 3FRUA 5K59E 5KZCB 4BZ2H 4Z95H 2P48B 1J1PH 1JWSA 5F7WC 4MQXD 3BIKA 3TBTB 3VGBA 8FABB 5DO2D 1W8OA 5JXAH 2BVUA 4LSTL 2HJFB 2VLJB 3VD3A 4KHXH 4HQQL 5DMJB 3OAUL 5J6HB 2BJML 3L3IA 5TJWK 4MQ7A 1EMTH 4DKEL 3AS1A 2AW2A 3GBMH 4XNYH 5E8NA 5D1QA 2XXCB 3TA3D 2EYTB 3WFBL 1KJ2A 3GSNA 3MRJA 1G7PA 2VUYA 3EKCA 4N68A 1FN4A 3Q5OA 3QDJA 1P7KA 2GCYB 3OKNB 4HKJA 3RKDC 3MLZH 1QBLL 1QFWH 4F33B 3I3BA 1E4KC 3QNZA 2JJUA 3BAEL 4P9MH 5FAAA 4MNGA 3E3QC 1DVFB 5E24E 3WL9A 4PJ9A 3ARGB 3H9HB 4LRIC 5DJ6B 2FO1A 1XGYL 2N1KA 4WO4C 4KH2A 4JQXA 3V52L 3OV6A 2IFGA 4S1RL 1L0XA 4KI5D 3EOBB 4F2MB 3HI5H 5EWIH 4WY7L 5E5RB 4N9GB 2VRAA 3IFOB 3CMOL 3CU7A 1J0HA 3ZO0A 2KPNA 4XPBH 4YZFF 1LDSA 3CUPB 2EH8L 5IROA 1JPFB 4CADB 4PS4L 4G8GB 1A1MA 4IRJB 5J56B 4NC0B 3DXAB 4ISVA 4ELME 3D85D 5JPMA 5FYKD 5BVPH 4MXVE 3U4BL 1FVEB 4PRAA 5EOQL 2APVA 1JPST 2RGSA 1EEYB 3EJYC 5EO9A 3QT2A 1NCUA 3X17A 1M7IB 3O41B 4KK6C 1TDQA 2BDNL 1EIBA 5CZVH 5DJ8B 2COQA 3GO1L 1U6AL 1Q0YL 3LS4L 3VDBA</