2NNAA

Structure of the mhc class ii molecule hla-dq8 bound with a deamidated gluten peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
182
structure length
182
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II antigen
publication title A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nnaA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2nnaA01
2GITA 3HE6C 5J12C 4ZUWA 4HS3B 3FFDA 3TN0A 1IL1B 3W11D 4MVBC 4RISL 3DV6A 4LF3A 3WCYA 1XGUA 3ARFC 2YOCA 1OT2A 1S7UA 5DJ6A 5DMIH 5D2NA 1KXTB 4YHZH 5HYJE 3RY6A 2IPUG 1J0YA 2WK2A 3QRGH 4NP4L 2A38A 2VQ1A 1LNUA 1UKQA 4G6AD 1A47A 2EKJA 3E6FB 1IAMA 1BQLH 3GM8A 4LIQE 2VLLA 4KI5F 3CFDA 5IROA 3MLTA 1I9RL 3PWPB 5SWSB 2QV2A 4JAMA 2O61A 2IH3A 3C09B 5GGQH 4PLJD 3UJTL 3MRMB 1LE9A 1KTLA 1Q1JH 2W60A 3JTSB 1MREL 1RJZB 3DHJA 3MV9E 3STZA 8FABA 1U8IB 43CAA 5BQ7B 2CIIA 1MPAH 3B2UD 3RZCD 4KVNH 2QHRH 3UZQA 4TVPE 2J88H 3MYJB 4HBQA 3T09A 2OZ4H 3ULVH 1JTTA 4U6YB 4HUNB 1T3FA 2GCYA 1GC1L 4TSAH 4S2SB 1T20B 4UNUA 1JP5A 4WI5A 3V5KB 3ZTJG 3S3SA 5SWZA 3V5DB 1J0ZA 2FX9L 4HJ0C 2XZQL 1YA5A 4FQHA 5D5MB 4UNTA 5INCB 1XEDA 1MVFA 1N0LA 1I9JL 1CZ8H 2VNCA 2WUCH 4OIIL 3KJ6H 1NEZB 2JK5A 2UZYB 2GY5A 5CEXB 3SEPA 1UXWB 3RVVC 4KROD 5JIPA 5ILTL 4B7IA 2VDOH 3HMWL 3HR5A 5EN2B 3P4OA 1QRNA 2XKNA 1JGDB 4UTAH 4FMFA 4XVSH 3FO0L 5CUSL 5H37G 1AGFA 4HMCA 3D3VD 3NIGE 1FLRH 4MLSA 1A7OH 4LLMB 3CVHB 2FJHA 1J1OL 2B20A 2NY5H 3X14B 5FGCE 2BOBA 4HLJA 4PJ7F 4LCWE 1OB1B 3WD5H 1U8NB 4KU1A 4PS4H 3X11B 5CAYB 5E08L 4KK6D 3MREB 5I1EL 2ZWLT 3G5YA 3I6KB 4NQVA 1MLCA 1T7ZA 3QAZC 4CW1B 1LEIA 3LKQA 1OAUH 1GIGH 3PP4L 2FNBA 1JYNA 4JREC 4UOW1 2ORBH 3WS3B 4X6FA 3U0WH 5C0AB 1TITA 2OLDA 1RK1B 3OJVC 4U1NA 4WW1B 1DQQB 3GEWB 1I4FA 3BZFA 3LRHA 4TQEH 4GLRI 4IMKC 5TE4L 4HWEL 4IRSC 4TNVF 1ES0B 3QG6A 2AI0L 2NYYC 3WNLA 4BM7A 4YHZL 3EOYG 5MENB 3MBEA 3LKRA 2PXYC 4PREB 5EC2A 4K23H 5IKCA 1QBLH 3D39A 1QKZH 4K3EL 1OWWA 3F5WB 4TPRL 2UWEF 1BQLL 4DFIA 1IM9D 5EIVA 4RIRB 2G5RA 3AS2A 4AIXA 1YUHA 2FX7L 3BZ4A 1HYSD 2BSTB 5JOPD 3VFVA 1UJ3A 2HFGL 1AIFB 3V52H 1NANH 2YPLD 3VWJA 4YEFA 2V2WB 4OJFH 1MPAL 2XWJA 3DXAE 1DE4A 4PJ5A 4QGYA 2QHRL 2W9DH 1WQVT 3ULVL 1JPST 3FN0H 4HZAA 1N4XL 5DDHB 1KELH 2EYSA 2OTWA 5CCKH 3GMLA 2IAND 5EBLB 4TSAL 4HS8L 1UZ6E 3L6FA 4YBQD 3OXSA 5J3HD 4PTUB 3QEQD 4YAQA 3I84A 4U3XA 4BFIA 3JVGA 2WUCL 3GHEL 3SKMB 1XGTB 3CSPA 5EBGA 3CUPA 4OZFH 1NJ9A 3T0EB 4HG4K 2VDOL 3FB5B 3RTQA 3DX7A 1GZPA 1JBJA 2HLAB 3MV8D 5HDBF 4XVSL 2P5EB 2PCPA 1JN6A 4I3SH 1FLRL 1HH6B 2BNRD 1JHKH 1OCWH 4HHAB 4HUWB 1JF5A 4NQDA 3PL6D 3WYRA 5EOCH 4GBXB 4R26H 1CGTA 2FZ3A 2FECI 2XN9E 3WD5L 1B0WA 1KXQE 3ZZ1A 5AUMB 5C08D 1A6VH 3L1OH 1YEDB 5EUOF 1CD8A 1D5XB 2ATKB 4EOWH 4HFWA 1OAUL 1GIGL 1P2CB 1HOCA 3HRZA 4IM8A 4GUPA 4WO4A 4HJGA 1KENH 3FFCD 5D2LF 3OXRB 5LAXA 4WW2F 2H9GA 2PKDA 4JPVH 5EU6A 4HIEB 1PJ9A 1F3JB 1ZEAH 1GHFL 1NSNH 4JY6B 2H2SD 2R0LL 3EOAB 5HBBA 3KPSA 1U3HB 5D7IE 2QBWA 4K94H 5EBMA 4Y19B 5ESVB 4MCYA 3H0TB 1KB5B 3V5HB 1CE6A 1MCKA 4QHKJ 3RL2B 4K23L 3SDAD 4BH8A 4R97B 1RZJC 2ZSVB 4PRHB 4JZJB 4QRSB 3ZKQD 3NABL 5LGJA 5FB8A 2A77H 1H5BC 3PXHA 4JRXB 4BH7A 1RHFA 5C70A 1NMCC 1T7VA 3Q2CA 3B8YA 2EYRB 3V6BR 5J7CC 2OI9B 1PLGH 2NY6C 5GRWA 3RWGB 2BVOA 2QEJA 4OJFL 2IAMD 3FB8A 2W9DL 2APTA 4D0DB 1T6WA 4YR6B 1NBQA 5I18H 1RZFL 3VXRA 3R0NA 3ARDD 3JBG7 1ZLVH 5CCKL 3C5ZC 2IF7A 2EC8A 2FEDC 4UB0H 1LP9F 2DIJA 1T2XA 5ID0B 1QD0A 3D25A 3PWPD 5SWSD 2ZUQB 5EO1B 3GJFA 3PIQA 3QQ3B 4JJHA 5DLMH 4HPOH 4E41B 3T2OA 1J1PL 4WV1B 3VMOA 5IHZA 5DRNA 3QDMB 1OQOA 5F9JA 2A9MH 3BKJH 1CI5A 1FL6A 3SDXE 3VD9A 3WFHB 1T04A 2B4CH 2G5BB 4YBLC 1DEDA 4HUVB 4PRPB 1CGUA 4CRPA 1AXTL 5GGRY 3BPLB 4I3SL 4O02L 1V3LA 4UV4H 2BOCB 1OCWL 4KI5C 5D7LB 4O9HH 5EOCL 1FN4B 4MA8L 1NCWH 1FNFA 4ODWB 5BW7C 2CRZA 4ZDHB 1INQB 4N8CL 1MJ8H 1DCLA 4O58L 5DFWH 3DURB 4PB9H 1KUMA 1R6VA 2ZCKL 2J8OA 3FRPA 4OD2B 3GBNH 3LHPL 4Z8FH 3O8XA 3GJFK 4LFHD 1NCUA 3HNVH 5I8KH 3CSYA 4X4YB 1HI6B 3SOBL 4WU5A 5F7WC 3Q6GH 1L6XA 2BRQA 4MD4A 2L0DA 4XCEA 4GSDH 3MLZH 5TFSL 2EE6A 5KVFH 4K7PH 5IMLB 4D8PB 3PE9A 1Q72H 4KI5E 5DQ9A 3C9NB 5HGHA 2GIYA 3DMMA 1JGVL 3KJ4B 4JPVL 2VN7A 4AL8H 2RGSA 1RZIB 4ZO9A 5EU3B 4HH9A 4N1CA 4YLQT 3OMZA 2NW3A 1JF6A 2FH8A 4P2RE 3IKKA 3EBAA 4K94L 5JIIA 4X6DF 3ARGB 3LSOB 2Z92A 3BIKB 3HI1A 5CILH 3U1SL 2VXQL 5F9WC 1ZT1A 3IU4H 3MRDA 2D03H 4M7ZC 3V2AR 3IDYC 1I85A 3PWUB 5C0AD 1GAFH 1HHIA 9CGTA 2A77L 1MFBH 5I17B 3CDFA 3V0VA 3UTTB 3EHBD 3LDBB 1U2CA 2J12B 1E4WH 4CN1A 1PLGL 3L3IA 5JIKA 4RMTA 4O51B 2IQAB 2XACC 3ESVF 4KI1A 4P5MA 3TO4B 3QQ4B 5DVMA 4O2CB 4PGEB 5MEND 4Q58C 1VACA 2XZCL 1EZVX 3VXNA 4UB0L 3DV4B 3MJ9H 4X8JA 1DVFA 4XP4H 1X5HA 5HI5C 4PJ8A 2WAHA 5BZWA 4PJ7E 3PG2A 3PQYA 2VLRA 5DLML 2Q7YA 4HPOL 2EYTB 2DI7A 2F5BH 5I1IH 4DFHA 4X6CF 4M8VA 2C1OB 3QUKA 5DJYB 3OKNA 2A9ML 1TPXC 4ZS7H 1N5AB 1F02I 3MOAH 2DWEA 1CFNB 2EDFA 1QPPA 4OZGB 5HI4C 1YMHA 4R8WH 1TMCB 2XQBH 5IQ7H 5IBLD 2DYPB 4U49A 1NGXA 3QNZB 3EYUH 1ND0B 3CDGA 1RJCA 3QFDB 1UENA 1A6TB 3O3BB 4EZMA 5F1IA 4W81A 1NCWL 4Y2DC 5TE6H 3W2DH 1TJGL 2E3VA 4XTRD 1MJ8L 5EZLA 3C5JB 3PJSA 2ZCHH 4PB9L 1DANT 5DO2C 2P43B 1F6FB 4CADA 4CU8A 4WNQB 4LU5L 5LVEA 4Z8FL 4I18A 4YXHH 3BW9B 5I8KL 4KKNA 4I3RH 2VMFA 3BUYA 3Q6GL 2ZCLH 3FJTA 4OLXH 3HNSH 2UWEE 1FV1B 4GSDL 2XTLA 5KVFL 2P5ED 4D0BB 5EZJA 1EPFA 1P9MA 1VCAA 4PRBA 4OZ4A 2Y06L 1X6LA 4OGXL 2HTLD 4Q9QH 4GBXD 5DK0A 1VGEH 1J5OH 1GH7A 3MNZB 1JI1A 3ALXA 4XMLH 2AQ3A 4TUJA 3PHSA 4HKJA 3VXPA 3RY4A 4OFPA 4IIQC 3ARBC 5E9DE 5EH1A 1VB9A 2DQHH 2AV7B 4KKCD 3WUWB 4JFOA 1JK8B 3NCYP 2HWZH 2WM0A 2R8SH 1WBXB 1FVCB 1RZ8B 1MJUH 1N59A 2AEWA 5IB2B 2Q20A 1R5WA 3IU4L 3QJFB 4OD1L 2D03L 1F90L 4IJ3C 1GAFL 4F9LA 2OJEB 5LGHH 3DRTA 4FZEH 1MFBL 3QYCA 1MCEA 5CHNA 5C0RL 4P9HH 2Z91A 2FJFB 1J87A 1K8DB 1S8DA 1E4WL 3L5IA 4RDQG 5IB4A 3KNBA 2E8ZA 3L3DB 4L3EE 4OF7A 5I8EA 1U3HD 4PJEA 4WFEE 3QDJA 4Y19D 5IW3A 4JVWA 2P7TB 1IFHH 4Z77A 4XPTH 2COQA 3EYOB 4HIJA 4Z18A 5FEBA 2VL5A 3QUMH 1TVDA 3FQTB 3QPQD 4ZXBC 4PRHD 2FGWL 3MJ9L 4XP4L 2E6QA 2VAAA 4WW2C 1U91A 1AKJA 5DRXA 1RFDH 4JRXD 1SJHA 2Z0BA 4JM4H 4OCXH 1BQSA 2F5BL 1U92B 4CL7A 2EDRA 5HSFA 4OF5A 3QISA 3OKOA 3AU1A 4P46B 1QFUH 1PY4A 1ZOXA 2KZ1B 1JNLH 2A74B 3PWNB 2AJVH 2N1KA 1WBZA 1DBJL 5IVXE 1EXUB 4R8WL 5IQ7L 3BD5A 3L5XL 1ZLVK 5DA4A 1JIBA 2XA8H 4RFEB 5JHDA 2ZUUA 2YR3A 4MXVF 5LGKA 4LSVL 4QKXB 4QO1A 3TPKA 3REWB 3W2DL 4FFVD 1AD9A 4GRWB 4JO4L 4Y5XA 2FGZA 3P73B 2VQUA 4E41D 1JZ5A 1C5BH 4QWWC 2DBLH 3I3BA 5DJ2A 5HGDA 3QDMD 1FJ1B 2WIIA 2EDBA 2GITB 4LSUH 4ZUWB 4YXHL 2UY7A 3FFDB 3TN0B 4BZ2H 4OFIA 4I3RL 5LXGL 3F58H 4U33A 3HA0A 3DV6B 2ZCLL 4LF3B 4NQEE 1XGUB 4OLXL 3HNSL 3QUZA 4OGAC 3TBYA 3S88L 1S7UB 5DJ6B 1A9BA 3THMH 3T3MF 5D2NB 3MCKA 5I8OL 4R4FH 4GW4A 1S3KH 1CL7H 5D7LD 4P2QA 3SE4A 2VQ1B 4Q9QL 4PJIE 1QYGH 1T0NA 1J5OL 1LNUB 2X4NA 1BBDL 4Z7UE 2A6JB 5K93A 5AYUH 2DRUA 4IOSD 4IHOA 3CFDB 3MLTB 5EORL 2YD4A 4JAMB 2O61B 2IH3B 2DQHL 1LE9B 1D9KC 1KTLB 2R8SL 3SDCA 1HK6A 2W60B 4G7VH 4CBPA 2CH8A 1IE5A 3STZB 8FABB 43CAB 2DQJH 2CIIB 4LQ1A 5GGRA 2JCCE 4MAYA 5KSVA 3RUGA 5LGHL 4FZEL 4R3SA 4PJHE 1ZMYA 4P9HL 5DC0A 3IXTA 5T1KA 1H3PH 3ARXA 2GCYB 5CJ8A 3L5JA 3IFLH 1S5HA 2EE9A 3ZMRA 1Y6NR 3ARGD 4XPHL 3MJ9A 4L4TE 5SWZB 1IFHL 1FNSH 3QUXA 4FQHB 2R0ZH 4XPTL 3BESR 2Q7NA 2VC2H 3QUML 2YPKA 4Z5RA 2JK5B 1VPOH 4Q0XH 1IKNA 3HE6A 1RFDL 5T33H 4RA3A 4P4RA 1UM5H 3K80A 4JM4L 3P4OB 1QRNB 2JIXA 3V4PH 2XKNB 4OCXL 3VI3E 1NC2A 3UTTD 1EDQA 3ARFA 1AGFB 1FYTA 1P7QA 2EXYC 2D9QB 4TVSa 1S5IH 1QFUL 5K59F 3UZVB 2FJHB 3TO4D 1JNLL 3IETA 2BOBB 5EO9A 4KDVA 4LCUB 3JTTA 1ZHLA 3WV0A 1NDGA 5HDQH 4NQVB 3G5YB 1MLCB 1PW3A 1JF1A 1ZTXL 4HKXA 3RX7A 3NIFE 4CMHB 1WAAF 4H88H 3U4BL 1LEIB 3LKQB 3DSFH 1RZJH 3BP6A 2RCSH 1TLKA 2X9XA 2BHUA 4HKZA 4S1DD 5D72H 4X6FB 4U1NB 2CKBL 4NRYB 1I4FB 4BZ2L 4TUOA 5C6TH 1U8PA 5T1LA 2EC9U 5JOEA 1FDLH 1JWUA 1EFXD 2DYPD 3THML 1NKOA 1JZ3A 1G6RL 1YECL 4R4FL 5C71A 1AY1L 3MBEB 2W38A 4K7FA 4XI5C 4AEHH 3TZVA 2J8UE 4GAJH 4H8WC 2H8PA 4G9FA 5EC2B 5IKCB 3D39B 1JHTA 2X5PA 4POZD 4S10A 4PY8I 5ITBH 5IW6A 5I75C 5FKAA 1UM4L 1EGJH 3T65A 3AC0A 1YUHB 5GRUL 3BZ4B 3O2DL 5BVPH 5DJZA 3NIDE 3VFVB 1R5VA 1HWHB 1UJ3B 1RURH 3C60A 3VWJB 2DQJL 2XWJB 4JR9H 1AXIB 1DE4B 4PJ5B 2XZAL 3MLRL 3QXVA 4XH2A 5DD3L 4X6CE 4NN7C 3LPWA 2EYSB 2JJWA 2OTWB 5HJ3A 3D1MC 3QHTC 1TDQA 1T1ZA 4K9EL 3GMLB 3KYNA 3HHRB 3P0YH 3IFLL 3QUMA 4QRRA 4MQTB 5IK3A 1ZS8A 1S7RA 1TENA 2B2XH 5HXMA 3OXSB 2VLKA 1RK0A 4NM8H 4YUEH 1A7PH 1SJEA 3WNOA 5LWYL 2XFXA 4BFIB 3C5SA 1WV7T 3CUPB 5KVGL 3BP7A 2BVUA 4ONGL 1NJ9B 3VXSE 1ACYL 1JYXA 4YO0A 3QQNA 1UM5L 3RTQB 3DX7B 1GZPB 3V4PL 2J8HA 2PCPB 2E7CA 1EO8L 1JN6B 5KSAA 5EZOH 3SKJL 3DVGA 1S5IL 8CGTA 4YHNA 5BV7L 4NQDB 5K9JH 4U6HA 4TYUA 2NR6C 1RU9H 2FZ3B 4GG6A 1TXKA 2IMMA 1B3JA 3BD4A 2IBZY 3OAYK 5K9OA 2DKMA 1FAIH 2FIKB 1CF8H 1KGCD 3J8F7 3TBWA 1JZ7A 2CKBA 1UM6H 4HFWB 4PJAA 3DSFL 3MFGB 1UFUA 4MS8C 1HOCB 1RZJL 4OI7A 3HRZB 3QEHA 5I1LA 1HHJA 1T0MA 4GUPB 4NJ9H 4WO4B 4P46D 1Z9LA 4ZMAT 4HJGB 3GKZA 1G6RA 4HDIA 2YD2A 2H9GB 5EU6B 5C6TL 4OCYL 2QQKH 3E8UH 1KPUA 3S35H 3KPSB 4G8GA 3EJJX 2P5WA 4DUXA 3WS6C 5EBMB 3QQ9D 4XPBH 4MCYB 5CGTA 4HZLA 4AEHL 1WSST 1PD6A 1NAMH 1ERNA 1CE6B 4GO6B 3J7HA 5FA4A 1RIUH 2A1WH 4DZ8A 3S36H 5C7XH 2F53E 1J0HA 4M93B 4FNLH 1MI5A 3TBSA 5LGJB 3NH7L 5FB8B 4BH7B 3GFUA 3TN0D 1L0XA 3MQIA 2PN5A 4CU7A 1RURL 1AI1H 5HHMB 1OM3H 3OZ9H 2JB5L 2BVOB 4JR9L 3FB8B 5E70A 4YK4B 3VXRB 1S7SA 2D4DA 2WZPD 1YNLH 5HY9A 2FJGA 3P0YL 3D25B 4KV5E 3E2HC 3ZDXF 3GJFB 3PIQB 2DOCA 3PWVA 4B50A 2MHAB 5B8CC 4GXVL 3W81A 4U1KA 4KJPD 5IHZB 4UMGA 4FQQA 1HWGB 5DRNB 4UTBH 5F9JB 4MXVE 1J8HE 2VDPH 1FL6B 1X5FA 5BMFL 1E6OH 4LHUG 3GMOA 1AGCA 2Q6WA 1T04B 4LPCA 3FO2A 1DTUA 1KTRL 4MQXC 3N1GC 4X7TA 4CN6A 2EEBA 3BT2H 2PUQT 2E7HA 4X7CC 1HXYA 5EZOL 3VD4A 1L9NA 5I74B 1KJ2H 1K4DB 5K9JL 1FFPA 1XF4A 4PLKC 4UZGA 4EI5C 2PW2A 1QR4A 5SWZD 3C6SA 2I07A 1BGXL 1X5YA 3KPPA 2P44B 2Q3ZA 3IDMA 3D69A 5E4EC 5FECA 1FO0H 2VLME 3O8XB 1FAIL 4J23A 1IVLA 1CF8L 4OSUL 1H5BA 4GS7B 3HG1E 5HHOE 3CSYB 4K3DH 1LDSA 4WU5B 3K8KA 1QRND 2WW8A 1QP1A 5J6HA 4EXKA 4G5ZH 4MD4B 3WEXA 4TTGA 4YHPA 4AM0A 1FBIH 4XCEB 4WUKH 3DETC 3PV6A 5DQ9B 3F7RA 4ENED 5CJXC 5HGHB 3ARWA 4P9MH 3DMMB 1UC6A 2X4OA 2XA3A 4PUBL 1WTGT 1IQDB 5DI8A 3HUJF 5D96C 4EI6A 2QQKL 3MRKA 4YC2B 3E8UL 4HH9B 4NKOB 1TQBC 2DLGA 4W4NA 3Q3GA 4I3GA 2NW3B 1C5CH 5M94B 4JKKA 1CDYA 3RIFK 4A2LA 4LEXL 4XPBL 4YHOH 4IRJA 2Z92B 1CXFA 3HI1B 1NAML 2DQDH 5FYKE 3PWJA 4KVCH 4WEUD 3MRDB 3JV4A 1RIUL 2A1WL 3S36L 3JV5A 4FNLL 1E27A 4LQFH 1HHIB 4UIKH 5CD3A 4S0TD 1EHLL 3V0VB 5E8NA 5SX4I 4LVHB 2VDQH 3MFFA 4IDJH 1VGKB 3L3IB 1ZGLP 4P5MB 1MRCH 4JG0H 5BZDA 3VA2C 1IAII 2I24N 5I1JH 3MBED 2DN7A 5E56A 4NOFA 1N8ZA 1VACB 4QYOA 3VI4F 2DIBA 1G0YR 3D39D 3VXNB 1NMBH 3TNNA 2OR7A 3DOSA 4X8JB 1DVFB 4K3JH 4JKMA 1DR9A 1LEKA 4PJ8B 3F7YA 3EYFA 3VFSA 5BZWB 3PQYB 2C4FU 1WWWX 2DLIA 2NY1C 1GGCL 3D2UD 1S7WA 4LCCC 2VLRB 4PJFB 2Q7YB 3UBXG 2BXYA 5IBTH 4AJ0A 2YEZA 5GRJL 2VZOA 3T0BA 1DBAH 3CU1A 3QUKB 4PJCE 3OKNB 3VWJD 4M43H 2VDPL 3EJZD 1JPGA 3DI3B 4WFFE 3BPNB 4PJ5D 4DN3H 4D94A 2EZ0D 4G8EA 4G3YH 3ULUC 2DWEB 1DQJA 3WIIL 1D3CA 3BN9C 3BWAA 4KK9C 3RVXD 1OTUD 4YDKL 1L4IA 3BT2L 1NGXB 3CDGB 4QXWA 2ESVA 4LDOB 3DNKA 3VGHA 4CJ0A 1KJ2L 4UINL 5F1IB 2BHZA 1G7QA 1KXVC 5EZLB 3PJSB 4GRMA 5JOFA 5C1MB 4CADB 4EUPG 3D9AH 4I18B 3BDYL 4PGCA 1IILE 3ULUE 5HPOA 1XGYH 4K3DL 4PJ7A 4JKWA 3BUYB 3RTQD 4FQIH 1EJ6A 1BZ9A 3KYOA 4WUKL 4LRNH 4HUXB 1MCWW 5E5RB 5EZJB 4NQDD 4PRBB 4OZ4B 2YXMA 2CLRA 4KPHL 5DK0B 5HYIA 3HAEG 1DL7H 4TUJB 1NAMA 4HKJB 2GYSA 3S34H 3VXPB 5IVZA 2CXKA 3D0VA 5EOTB 3SGJC 5D9SA 4WTZA 1A4JA 4QOKE 3LOWA 4MZ2A 5SX5H 2YSSA 3T1FA 4JFOB 4EN3A 5GPRA 1WCQA 2DQDL 5IMKA 4D9RE 1N59B 1MRDH 3S8WA 1R5WB 3RL1A 3H3BC 4M6OH 5HGAA 3I6LE 4WO4D 5F93C 2DL9A 3ULSA 1FH5H 4LQFL 4UIKL 1EMTL 2DB8A 3DRTB 4E5XA 2AK1H 3EDJA 4HK3J 4P2YA 3DHMA 5CHNB 2A6IA 4FFWC 2XPGA 3O0RH 2Z91B 5EU6D 4WJ5A 1H3VA 2WP3O 1VERA 1OAQH 3FZUC 3SJVD 1NL0H 1S8DB 3KLSA 5IB4B 3KNBB 4IDJL 5E8EA 2UWEA 5I8EB 3KPSD 4JG0L 4LASH 5ECJE 4PJEB 5I1JL 2QL1A 3QDJB 1KLFA 3K7UA 4FFYH 4Z77B 3RDTC 4YQXH 2NY3B 4HIJB 1ZGLA 4MA1B 1A1NA 1KBGL 2VL5B 1MWAL 2Q3AA 1NMBL 5DGQA 1KEGL 5E9DA 2VAAB 1NBVL 4K3JL 1U91B 1AKJB 5DRXB 1OTTC 1SJHB 1FZJA 2NPLX 3PP3K 4H1LG 2X4QA 4TNVK 5IBTL 4N68A 3OKYA 2WSKA 3IDXH 5B3JF 3ULVD 1DBAL 5HHMD 3ZKXC 3OKOB 2YN5A 4AMKL 4YHLL 2DS4A 3DBXA 4M43L 3C6LC 2D7NA 4DN3L 4GMSL 5M95B 1WWAX 2MKLC 4G3YL 1KJ2A 4G6AC 3UTQA 1WBZB 1IZJA 4YDVA 3MOQA 3VXRD 4Z78A 1XR8A 2BC4A 5BS0A 2X9WA 4IIQA 3ARBA 5JHDB 1S7XA 4DGIH 2AV1A 4GAGL 1Q9OA 1CTNA 1L6ZA 1AD9B 2W1NA 5L88H 4Y5XB 2DD8H 5HYQA 4OD3H 2X6MA 4LSRH 5T3XH 3QXDA 5DJ2B 5HGDB 1NGWA 3D9AL 2WIIB 4C54A 1DSFH 3RWFA 3MRGA 1XGYL 3WLWD 1D6EA 4LVNC 3F6LA 5EOQH 3QUZB 2E27H 3TBYB 4UBDC 1N2RA 3NCJH 4LRNL 1A9BB 5L9DH 1BM3H 3MCKB 4GW4B 1G9EA 1PKQE 5EUOA 1IEHA 1YN6A 3HNTL 4P2QB 3V4UH 3EOTL 1U42A 2IALA 4S1SH 4H0IA 1U93A 3HE7A 1T0NB 2X4NB 1IZKA 3S34L 4YH6A 3MMEA 3V7AE 4IHOB 4KROC 1KPVA 2YUVA 4ZXBA 2XKUA 3O8XD 1J1XL 5D2LA 2EIDA 4WW2A 3CFBA 1G9NC 3SDCB 3IJHA 5A1AA 4PJBF 4P99A 1MRDL 4G6KH 1DFBL 3BAEH 4XAWH 5GGRB 4MAYB 1FH5L 4LOUC 5KSVB 4Q9RH 3RUGB 3ZDXE 3DMMD 2AK1L 4R3SB 5ERWA 4IRZL 3P2TA 5FOBA 2VWEC 1NAKH 4PBXA 3IXTB 5T1KB 1NL0L 4NQEA 3ELAT 4OLVH 5IHBA 1S5HB 5F96H 2Y1VA 1I8LC 1HKFA 2KZWA 2Q8BH 3L5WA 4CUCA 1JRHH 2A9NL 1SJVA 3QUXB 3D3VE 3MLWH 2CDEA 2DJUA 3VA6A 3CNKA 1ORSA 4F9PC 3DSNA 2YPKB 4N0UE 1GXEA 2XG4A 4Z5RB 5GISH 5KSBE 3HE6B 1TVHA 4P4RB 3MCLH 4OT1L 2JIXB 4OZIE 1CIDA 2OL3H 1NC2B 1J05A 3ARFB 1OSPH 4DTGL 4RMQA 3QULA 1FYTB 5K9QI 1P7QB 1LP9A 4EQ2A 4GG8A 3IETB 5ADOH 4ETQA 1OT1A 2APWA 4U1GC 5EO9B 4Y1AE 3P11H 1TZIA 4K2UH 3JTTB 1ZHLB 1UYWH 3DX6A 1NDGB 2YXFA 2KQNA 1HYSC 4OQTL 4FQCH 5GZOC 1DVFD 4DGIL 4PJ8D 4HKXB 1D9KA 3HUJE 4HFUH 4MA3A 4J8RB 4L4TA 2VLRD 3CH8A 4JO3H 5J89A 4YPJA 2ADGA 1V3KA 1V7NH 1KN2H 3KPMA 3BP6B 1N0XH 3TVMA 4HKZB 5T3XL 3B9VA 3KXFE 4WRLA 2OK0H 3WFBL 2VZ1A 2DQUH 4TUOB 4HLZH 3BVNA 1U8PB 1IT9L 3CLFH 1JWUB 3NCJL 1PX4A 3PWLA 1BM3L 5KSUA 5JOPE 3GZKA 5JW4R 4YBQC 4JFZH 5J3HC 4WENB 4K7FB 3TZVB 2YPLE 1M7IA 3VFMA 4Q2ZA 2AJ3A 1G0DA 2H8PB 4G9FB 3WO3B 1BJ1H 1MCCA 2X70A 1JHTB 4M7JH 1KLUA 3DX9A 4JY5H 1NBYA 2LAGB 4XRCA 5C0ND 5FKAB 5IW6B 3T65B 2JTDA 4EVNA 1XH3B 4LPWA 3D85B 2H2PD 2IANE 5DJZB 3ZHDA 3RKPA 1R5VB 5F3HA 2DQFA 3GMNA 2J6EH 4G6KL 3C60B 3PL6C 1CYGA 1T66D 1WEJL 2W0FA 1PG7H 1QLRB 2EEDA 1XT5A 1AFVH 1J9CT 2BNUA 2CPCA 1KG0A 3QEQE 4X6DA 5JA9A 5J1AA 3K2UH 5E1HB 5HJ3B 5C0IB 4FXLA 2VDRH 1FRGL 1PSKH 3KYNB 4U3HA 1ZHKA 4YX2L 3WFEH 3QUMB 4QRRB 1KTDA 3MV8E 5IK3B 1ZS8B 1S7RB 5SX5K 1HSAA 3GSRA 2VLKB 1RK0B 1WT5C 1SM3H 3UMTA 2R0WL 1HDMA 1SJEB 2XFXB 3C5SB 2Z8VC 4N0FA 5GISL 4JO1H 3QSKB 3BP7B 5F1KC 5C08E 4YO0B 3MCLL 4O2FA 5FYLH 4D9QE 4X9BA 4I77L 1C7TA 2OL3L 4C57C 5E8PA 1OSPL 4HC1L 4X4MA 5GS2H 5KSAB 3DVGB 2Z8RA 1FSKB 4YHNB 3KDMA 2DQIH 1G7MA 4U6HB 3SDAC 2D2OA 1C5DA 3QDJD 5ADOL 4XMPH 1HZHH 4K71C 4CMMA 4GG6B 1EEZA 1KF9B 1U8HB 1JNHA 3KHOA 4WFHD 2NY3D 4QRTA 4X6CA 1UYWL 4M5YL 5K9OB 3QDGA 1QFPA 1R0AH 4LBEA 3UJIH 4WI3A 4NZRH 1AKJD 3TBWB 1FFRA 2CKBB 4C59B 4PJAB 3RPIA 2D3VA 1V7NL 3QEHB 5I1LB 1HHJB 2N7BA 3A6OA 2PF6A 1T0MB 3AY4C 1CQYA 3HPJA 4NQCE 1VSCA 1UJTA 1V05A 4YGAB 3ROOA 1G6RB 4HDIB 5D71H 3U9UA 2D7QA 5JUEH 2WP3T 3CLFL 3WMSA 1KPUB 1I1YA 2UVFA 4G8GB 3JUYA 4M5ZL 2P5WB 2MMXA 5JHDD 5DJ8B 1WFUA 3MRRA 4TN9A 1C16A 4JFZL 3D87B 4GH7B 4HZLB 4NCDA 2NY4C 5TQ0L 4UAOB 1RQ5A 3ABZA 4Z0XA 2P45B 2GTWA 3FQWA 5FA4B 4M7JL 2GFBA 2R29H 3QWRA 5DVKA 4DZ8B 4R96A 4UU9A 1X5IA 1T5WA 4Y4HA 1MI5B 3TBSB 1A7NL 4LNVA 2ICWJ 1FZOA 2R2EA 4N8VG 2J6EL 3PWPE 3QUZD 3SE9H 3UPCA 1NLBH 4O00A 3WXVH 1LD9A 1PG7L 2F5AL 3ULUH 1FGVH 1CDUA 4P2QD 4JKLA 1S7SB 3V8OA 5EBWA 5GZNC 2VDRL 4NN5B 3F8UB 1PSKL 5HY9B 2FJGB 2AS5M 3NZHH 3T4AA 3PWVB 2FLRT 1SM3L 5E99H 3SDCD 4OGZA 4CNIA 4FQQB 2OL3A 3OTTA 1NLDL 3DTXA 4MAYD 5D5ME 3GMOB 4KY1H 4AENA 5BV7B 1AGCB 2Q6WB 2VXSH 3X3GH 3FO2B 5FYLL 3WHE1 3ARPA 3V4VL 4X7TB 4FQXA 4PJDF 4RNRA 5T1KD 1HH9B 3NA4A 2I26N 5GRZA 1I3GH 5ICZA 3BWUC 1HXYB 3VFPA 4G6ML 4KKAC 1FFPB 1XF4B 5DEFA 4BFEA 2L4OA 3EJYC 3VH8A 2PW2B 1HZHL 3M1BA 3C6SB 2I07B 3QUXD 5IWLA 2OTUB 3KPPB 4LSSL 4Y89A 3VGEA 5JORA 2HJKA 3IDMB 3D69B 4LGSB 5FECB 5IFAL 1A3QA 1QRKA 3H42L 3L9RA 4DCQA 3HE6D 1H5BB 1CLOL 3MLVH 3BZDA 1EAJA 2V9QA 5ENWA 2JIXD 5J6HB 4MVBD 2AK4A 3WEXB 1NC2D 4YHPB 4AM0B 3ARFD 3PV6B 3INUL 4YFLI 1FYTD 1P7QD 3DWTA 3MV9D 1X4XA 1FE8H 1CDJA 4Q9CA 2X4OB 4PJGF 4YFEA 3QR2A 4XX1E 1T4KA 5DI8B 1OAKH 4EI6B 3FAWA 5JUEL 5C0AE 3MRKB 2NXYC 4QT5A 3R06A 4W6YB 3Q3GB 4URTB 3D48R 3VMNA 1NFDF 5KVMC 1LDPH 4IRJB 4NO0B 5F7HA 2AABH 5IJVA 3Q5YA 3ZDYE 1YMMA 3PWJB 2Z31A 3D5OF 5MENE 2OMBA 4UILL 2J6EA 2KDGA 2YK1L 3ZT5A 3G6AA 1E27B 1FNLA 4NUJA 2GK0B 1CXKA 5I1HH 4MNGA 5CD3B 2VDKH 2NY2B 3HG1A 5HHOA 4OLZL 5E8NB 1LO5A 3QH3A 5T1LD 5MEPA 1KN4H 3MFFB 3RWIA 1NLBL 1MCIA 3ZTNH 3VXUA 2XYCA 3CDYA 1FGVL 4XTRC 5BZDB 3E6HA 3VMPA 4EI5A 1N8ZB 2APXA 4QYOB 1IC4H 4HJ0D 4ONFH 5ALBH 2A73A 2X4SA 4G9FD 2XNAA 1A5FH 5ID1A 1JZ2A 3FRPG 2W65A 3T0EC 3TNNB 1U8JA 4OCWL 1JTPA 5MP6H 2WBJA 5AG8A 1LEKB 1RD6A 3EYFB 3F7YB 3VFSB 1HYRC 1YQVH 2NX5A 1S7WB 3LH2H 4UUJA 3FB7A 3BO8A 3KYMA 1AD0A 5CKAA 1IM3A 2V5RA 2WIMA 2YEZB 4HIXH 4OUOA 2ZSWB 4XNXH 3C60D 3RGHA 4NFCA 4F8QA 2HTLC 5CJXA 3UC0H 4GBXC 1JPGB 1R3KA 1I7TA 1INEH 4KY1L 1ZHBA 3Q6FA 4G8EB 2VXSL 5J1SC 2ZPKH 1BFOA 3DUSA 3BWAB 3T0EE 2UV3A 3OAUH 2ESVB 4OTXL 3GNML 4AK1A 4ZODA 2FH6A 4QRRD 5KG9A 3R8BB 5KVEH 4UQ3A 2L7UA 1NCDH 2VLKD 3RU8L 4NKDA 1LO2H 1FCCA 4GRMB 1K5NA 4M7ZB 5JOFB 4JGMA 1Z3GL 1SVCP 3VG0H 4PGCB 4P23A 2CDFA 4PJ7B 3FT2A 1BZ9B 5IBUB 4UNVA 2EDJA 1OPGH 3M8OL 4P4KC 1FE8L 5H35A 3U36A 1WAAA 1OAKL 4R97C 3WN5A 1CLZL 2FATL 4WWID 3QPQC 2APBA 1B88A 1NAMB 5IVZB 3D0VB 1CICA 3RHWF 5D9SB 1A4JB 4ONHA 4NWTL 3T1FB 4OZFG 4LCCA 5JXAH 4EN3B 4K7PX 2OI9C 5IMKB 3ARYA 1Y6KR 1KCSH 5DC9B 1U3YA 3RL1B 4Y19E 3HI6L 1ZWIA 5HGAB 2KBGA 5B4MD 1DQLL 2MCG1 3ULSB 5KAQG 3OKEA 4E5XB 1C1EL 3BH9A 4J6RH 5I1HL 4OCSH 2A6IB 2XPGB 3TO2A 4OCMC 4WJ5B 4PRHE 1KN4L 3QCUH 5E8EB 1RJLA 2UWEB 4BQ6A 4JRXE 3ZTNL 4G8GD 5CFHA 2P5WD 4FFVC 2IG2H 5DSCA 1LO0H 5L2JA 1GGBH 1X4ZA 2VZSA 4HMDA 3QNXA 1FFNB 1INDH 5F72S 4JG1L 4WV1C 1MOEA 1ZGLB 1A1NB 2DMBA 1A5FL 1KULA 1MCDA 2FL5A 4PGDA 3B2VH 5MP6L 4M1DH 5E9DB 2SEBA 1WZKA 6FABH 1MI5D 2Y36L 4N5ED 1P69B 1YQVL 4HBCL 1MQKH 1FZJB 3LH2L 2X4QB 3KVQA 3O6LL 2YD1A 2AEIT 5ESAB 1F3DH 1RIHH 4DKFH 3DBXB 1GGIH 3JWNC 1INEL 4LVOC 2GK2A 1UZ8A 4E41E 1KJ2B 3UTQB 4YDVB 2ZPKL 3QDME 4Z78B 1XR8B 3WIHH 2BC4B 5BS0B 2LU7A 3O4OC 4BSJA 3OAUL 3SGJA 2XQYG 4IIQB 3ARBB 4M7KH 2DJSA 1S7XB 5E8OA 1V5JA 2AV1B 1AXSA 4RWYH 3BKCH 5D7JA 2CIKA 4PRPE 1NCDL 4S1RH 5C3LD 1EBPA 2WANA 5HYQB 3QIBA 1LO2L 5D7LE 3ZE2F 5JZ7D 3QXDB 4IJ3B 1NGWB 3KJ4C 3NFPA 3VG0L 3RWFB 3MRGB 1D6EB 4OKVA 5D1XA 1GGYA 1FGNH 1QNZL 1WVZA 4DW2H 5AD0A 4UT9H 5F7EL 1UH2A 2O5ZH 3QT2A 1N2RB 1F11A 2X42A 1VFAA 1OPGL 4Y2OA 3O3DA 3SQOH 4QRQA 1RAMA 4KHXL 4NSKA 5EUOB 4GW5A 1YN6B 4U4BA 2IALB 4AEIH 1U93B 3HE7B 3H9SE 2W9LA 5I9QB 3E3QC 1MCWM 3MMEB 3MO1A 1DBBH 1RPQA 1KPVB 4ZXBB 3LN5A 1AC6A 5D2LB 4WW2B 4KGLA 4YGVB 4KK8D 2DL2A 5JXAL 4ZTPL 3CFBB 3LDBC 3LEYL 3IJHB 5HDOA 4FQLL 1U3ZA 3TO4C 2DM7A 3TT3H 1WISA 3C6LA 3ARUA 5CSBA 4XHQA 4J6RL 4Y4FC 5ERWB 4OCSL 5FOBB 4Z7OE 4M3JA 4N0RA 3E3QE 1NUGA 4R4BA 4NQEB 3QCUL 4M7LH 1Z9SA 2FEDD 1QFWH 3U30B 1FNHA 1MWAB 3N1FC 1PKQA 3UTTE 3L5WB 5HHVH 5ELIA 3R1GH 1A9EA 4NUGH 1Q0YH 2CDEB 4PJDE 2O5XH 2JJTC 3HB3C 1ORSB 3B2VL 4JZOA 3FOMA 2VISA 4M1DL 4UT6L 6FABL 3UJJL 4FXGA 1TVHB 3H3PH 1MQKL 3K74B 2CK2A 2NY2D 4W6WB 3MJ8A 4DQOL 3SN6N 1J05B 3KLDA 3EUUA 1RIHL 3QULB 3T8XA 4GXUM 4XP9H 1GGIL 1FIGL 1LP9B 2J4WL 4GG8B 4KI5D 4ETQB 4ELMF 3PHOA 4HF5L 4POZC 1GRWA 3HI5L 1TZIB 3WIHL 2CK0H 3DX6B 3MRPA 3ZHKA 1CFBA 1MAJA 3BSZH 3BKCL 4HQQL 3BEVA 1D9KB 4MA3B 4S1RL 1UXSA 3RBSA 2ADGB 1AJ7H 4QF1A 3SHSA 4I0CC 3TVMB 4KRPB 3RA7L 2QJDA 1NFDE 4OI9A 5TDPA 3STBA 1PBYA 1A21A 4RAUA 5FO7A 1JI2A 2A6DA 1FGNL 1X4YA 2ZKHH 1UWGL 3BVNB 3MXVH 4DW2L 4UT9L 5HHPA 2JB6A 2BX5A 3V95A 2CMRH 2FO4A 2VZVA 3FAXA 3PWLB 5KSUB 1IQWH 3SQOL 2ESVD 3G6DL 3V0WL 4XP1H 2IGFL 3GMRA 3OPZH 5EZIH 4JCLA 5A40E 5E95B 3LMJH 1M7IB 3VFMB 4Q2ZB 2AJ3B 4FP8H 2DQGH 1OGAA 1GOFA 2X70B 4F9PA 1CR9H 1OAZH 1HE7A 2YUZA 1KLUB 1UB5A 1DBBL 1BP3B 1NBYB 2NZIA 3DX9B 2D0HA 5GJTH 4PBVC 4DGYH 5C2UB 3EDEA 1RV6X 4EVNB 2G60L 4P2OC 3IXAA 3HUJA 3NFSH 5F3HB 2DQFB 1SMOA 3GMNB 1RUKL 2LABA 3GMQA 1S9XA 4DKEL 4TSCL 1LK3L 3TT3L 2W0FB 3C2SA 2BNUB 3KXFA 4WGVB 1KG0B 4X6DB 2AJZA 5J1AB 1SHMA 2EO1A 3W5NA 1ZHKB 4KWUA 3ZKNC 4NZUH 1U8LB 4D9LH 1KTDB 5HI5D 1HSAB 5HHVL 2NCMA 3R1GL 4EN3D 1Q0YL 4BUHA 3PNWA 1HDMB 1BIIA 3LEXA 4P46C 4N0FB 5TJWK 2NQCA 3K3QA 3FCTA 3BGMA 5D1QA 4NOBA 3QCTL 1LK2A 3H3PL 4O2FB 4TOYL 2D0FA 4WUUA 5E5MA 3LB6D 5E8PB 2EC9T 1KGCE 5IVOA 1A2YA 2KL6A 3QQ9C 3WIHA 1F00I 1KFAL 2GJ6E 3HZMA 3KDMB 1G7MB 1C5DB 2JJUA 1JZ8A 1UT9A 3L7EA 4CMMB 3BPCA 1EEZB 4JFPB 1RY7B 1JNHB 2HLFC 1SYVA 3QEGL 4X6CB 4DUVA 3RWDB 4JRYE 3QDGB 1WIOA 5I75B 5DO2D 2QQNH 4LBEB 2D7PA 5E9DD 1KTKE 3BSZL 4DVBA 3NACH 4ODSH 2Q8AH 3RPIB 5D2NC 4TNWF 4RDQF 3HPJB 2Q76A 4J1UA 4GRWE 2G75A 3ROOB 1BEYL 3K8LA 3U9UB 3Q1SH 2BDNH 2ZKHL 3S3PA 5F6IC 4R7NA 4NN7B 1MCBA 3FTGA 4JFFE 5BS0D 1I1YB 4XPGH 1A6UL 4LKXA 2R69H 5DD5H 3ARBD 3EO9H 1C16B 4XP1L 2E7LA 1NUNB 1MSPA 3F6IA 4KTYA 4KJPC 4WFED 3LMJL 1CS6A 4Z0XB 5D2NE 1WT5A 2GTWB 3FQWB 1ZLSH 1CR9L 2GFBB 2BSSA 1QFOA 3BFOA 5DVNA 4X5XA 1T5WB 5GJTL 4OZHF 4Y4HB 1JZ4A 1F8TH 5I1KL 1CVSC 2R4SH 1FZOB 2I5YH 4F57H 3RAJH 2R2EB 5J06A 4LAJH 1NPUA 1LD9B 3NTCH 3I75A 4NQCA 4MYWB 1WC7A 1QQDA 3NPZB 4FQ2L 5CIPH 3HE7D 4DN4H 3KPRE 3DGCR 5CP3H 5EBWB 4C83A 5F8QC 2YC1A 4JGUA 1L0QA 4U1MA 1NCCH 4OM1H 4KKBC 4NZUL 2YS4A 4ZXBD 3IS1X 5BO1L 3T4AB 4ZOEA 1DBKH 4N0CC 4CNIB 1YYLH 3EDKA 3MRQA 2OL3B 5C92A 4OLYH 5SWZE 4XNMA 3RRQA 1K9TA 2UUDK 4AENB 4ODBD 2P47B 3MR9A 2A6KB 4FQXB 5FGRA 4RNRB 3ZE2E 3S5LG 4MQSB 4MWFA 4NQED 3AFLA 5ICZB 1KB5H 3VDCA 3MXWL 3VFPB 1N6QH 4CMHC 1QRNE 5DEFB 4LKCA 4EXPX 3VH8B 3ZE1F 3M1BB 3H9YA 3LY6A 5IP4A 1FHGA 5DD1L 5I2IA 4P3DB 5JORB 3WFDL 2HJKB 5GGVH 4QWWD 2OJZL 5T3ZE 2VL4A 4QHUA 5IFJA 2E9JA 4QRUA 4JVPA 3L9RB 4DCQB 1J18A 1S9VA 3BJ91 4ODSL 1N5YH 2Q8AL 2AK4B 1W8OA 1HN1A 4OGAD 1DLHA 3OG6B 4TULH 1IEBA 2AJUL 3MODH 1YNKH 3N0PB 5KVDH 2BDNL 4L29A 1T4KB 5IGXH 2ZNWA 4QT5B 4MJ6A 3R06B 4KHTH 3EZ8A 4XPGL 4L3AA 2AVGA 4LSPH 2MQCA 5E4IA 4Z7NF 3EO9L 5B22A 3E2HB 3DIFA 4JKPL 1BBJA 1D9KD 5IJVB 4U0RB 4L4TD 4G6JL 1YMMB 3BJLA 3VWJC 1TIUA 2Z31B 1ZLSL 3EJZC 2WV3A 3TVMD 4KRPD 1GC1C 2EZ0C 3G6AB 4I0PC 3CSGA 4NUJB 1JYWA 2XOTA 1F8TL 4ZSOA 2R4SL 3D39E 4MNGB 1OTUC 2PNDA 4F57L 3HG1B 1RVFH 3RAJL 3S35X 5HHOB 1LO5B 3QH3B 4DEPC 3ZYZA 5MEPB 3CJJA 5IIEA 3N9GH 4QTHA 3EDFA 3RKDC 3RWIB 5C86A 1BWWA 3OBAA 3VXUB 2R2BA 1IGIH 3SKNA 4OCLC 4HCRL 3E6HB 4G80A 3UZEA 3C8KA 4EI5B 2NY7L 3S96A 2ARJQ 1KB9K 4DN4L 1A02N 2A73B 2X4SB 3S36X 4PJBA 3WS3A 4HH8A 3SO3B 1BQHA 4PJ5E 5ID1B 2W65B 1OQXA 3N50A 1U8JB 3OB0H 2BY2A 2WBJB 1NC4A 5F7DA 2EDWA 3RTQC 4ELME 4WHYH 3KLAA 5AZ2H 2NX5B 4OIBA 1KIPA 4UUJB 1DBKL 3FB7B 4S11A 3BO8B 3KYMB 1AD0B 1IM3B 1YYLL 4MAUL 1R24A 4OLYL 3FMGL 2BJMH 1JMXA 1I7TB 3K4ZA 4AEEA 3M17A 3Q6FB 1MFDL 4PLNC 1BFOB 4AEFA 3DUSB 1JGEA 5GQBA 2OBGA 4RMRA 1N6QL 1FP5A 5KG9B 2OQJA 2DDQH 1AQKH 5D1ZB 5JDSA 4UQ3B 3F7VA 4NKDB 3LCYA 5D8JL 4W6XB 4WO4C 4NQDE 4X98A 1K5NB 1F4WH 3K8MA 4W70A 4DKAA 3B5TA 1ITBB 2E7BA 3OWEA 3SGDH 4LLDB 4NZTH 3ZHLA 5LJYH 4OLWH 4Z7QF 2UY6A 5A2IH 1T2QL 4P23B 5EPMA 2X41A 3TA3C 2CDFB 3H3KA 4Y8AA 3FT2B 1LO4L 4KQ4L 2M8XA 4HGWA 2H45A 5TPWH 1ZVSA 5H35B 1OSZA 1EFQA 3U36B 1YNTA 3WN5B 4RX4A 2LV4A 2VE6B 4WY7H 3VFUA 1K4CA 1YEEH 4M93C 4MD5A 1Q9LA 1CICB 4LSPL 3T0EA 2HMID 3QDGD 1YN7A 5EU6E 4ONHB 5T3XD 3TBTA 1IGMH 4LCCB 3ULVC 1L7TH 2C4FT 3KPSE 2DKUA 1ZWIB 4R0LC 3OJ2C 3OKEB 4YK4C 3BH9B 3O11B 1KCKA 1K85A 2OR9H 2R23A 3TO2B 3JUZA 4MXWH 5CIPA 3V6OA 3N9GL 4Y8DC 3NBNA 1RJLB 5DSCB 5L2JB 1IGIL 3QNXB 3UDWA 3ULVE 3UPRB 1DN2A 5IR1A 1TETL 4HIIA 1RZGA 1SQ2N 2FL5B 4ZPVA 3QWRD 1S7VA 4PGDB 5I30H 3M07A 4OM0L 3WJJC 3WLWC 3VRJA 2SEBB 4Y4HD 3HC4H 4HPYH 5GGTH 5CEYA 2EH7L 4YIQA 5HYSA 4RFOH 2X4RA 2F8XC 3JV6A 5I74C 1UWEH 4P4KA 5FKPA 2BJML 3P9WB 5BJTA 1ZVYA 1UZ8B 1HILA 4XP5H 2ZSVA 2XTJC 3O8XC 4I5BB 2FYYA 2AQ1A 1DBMH 5BRZA 5E8OB 5D7JB 1AXSB 2DDQL 2CIKB 1AQKL 1F4YH 1CWVA 2EYRA 3CVIH 3TNMA 1ULVA 1I9EA 1FG9C 3QIBB 1GGUA 1F4WL 3UPAA 2EDYA 5A2KH 3DMMC 2MFNA 3FT3A 4X5LA 3NFPB 4NZTL 4D0DA 4OLWL 3L7FA 4YR6A 3ZE0F 4PGBA 5D1XB 2XT1B 5AD0B 4JPWH 4OFDA 3V7MA 2XTJE 5CD5D 4EDWL 1F11B 2GUOA 1VFAB 4OBSA 3O3DB 5TPWL 4QRQB 4NSKB 4GW5B 4KZEL 4JDVA 3S3JA 4X7SH 4JFXA 3ILPA 4D3CH 3QXAA 3W9DA 1I85C 1EX0A 2VUYA 4WY7L 4O4YH 3MO1B 2AJYH 4BQCA 3EYSH 3LN5B 1X7QA 4MJ5A 4FQ1H 1L7TL 4HW6A 5F6HJ 4MNHA 4PRPA 1Q8MA 3CK0H 2E9BA 2AK4D 3U83A 4HV8A 5IT2H 3O6FC 3C6LB 3LS4H 1XGPA 4YXKL 5EWIL 1AGEA 5GJSH 4AH2A 3RGVC 1BX2A 4R4BB 1DVFC 2FX8L 1G9ML 4HXAH 1PKQB 4ZO6A 4HK3N 1ACZA 1A9EB 4PG9A 3H9SA 5JPMA 4S1QL 5IMLA 1YMMD 1A7BA 5IESL 4JZOB 5I30L 3FOMB 2VISB 4Q6IA 4I0KA 4HPYL 4FXGB 5JW4N 3V6FA 2ICCA 4H0GA 2IQ9L 5GGTL 3NPSB 3HG1D 3MJ8B 4RFOL 5HHOD 2WQRA 4MQXD 1OGTA 4LLUB 3T8XB 2GKIA 3PQYE 4PJFE 2X4TA 4KRNA 4XP6L 3VXUD 3F12A 2VLRE 1X44A 1HHKA 1AGBA 4ZUVA 1EV2E 3PHOB 4EI5D 4NRXA 3P9LB 5FUOH 5C0NC 3PWUA 1WIUA 1AHWC 4YHML 1JGLH 3MRPB 1A6PA 1DBML 2RB8A 3BEVB 2NX5D 2QSTA 4WIQA 1UXSB 2DI9A 3CVIL 2AERT 1ROWA 2RFXA 1NGPL 3P4NA 4PJDA 3O81A 4U6VL 5FYLD 5SWQA 1P9MC 5TDPB 1OARL 5J8OA 4RAUB 4NHUA 3CXHJ 3O2WL 5FO7B 4Y4FA 2A6DB 4JPWL 2KQMA 3BRFA 4YHYB 5HHPB 2B0SH 2JB6B 3V9FA 1AO7A 2FO4B 3UYRL 2MJWA 2R2HA 1HQ4A 2EDEA 4PD4J 1B0RA 3GMRB 2FO1A 1I1AA 3BIBX 4X7SL 3CPLA 1OGAB 3BE1L 2JJTA 3WXWH 4QY8A 4O4YL 4G9DA 4F9LC 1UB5B 2AJXH 2AJYL 1A0QL 2IPUK 4XVUC 5ICYA 3ROLA 3GSVA 4XPFH 4P23D 4PJGA 2AKRA 4FQ1L 4X83A 3IXAB 3SDDA 2BVYA 4BJLA 3BRGC 3HUJB 4ZNEA 3MLSH 2WMPA 2XG5A 3MGOA 1UB6A 1YEHL 4OUUA 1S9XB 4KJQC 4XCNA 5DC4B 5T3ZH 3T3PF 3QO1A 4F15C 4HUMB 1NFDA 3VRLF 3KXFB 3LS4L 3I9GH 4WFFD 2AJZB 2NY3C 4MA1C 4V2BA 1JRHI 3X3FH 3OSKA 2BZDA 3QRFM 4CJ1A 1CICD 2JJSC 1DP0A 4B41A 1KIUA 1HQRB 1EH9A 1U8OA 4LP5A 1PDKA 5I1CH 3PNWB 1OP5H 3QHFL 5GGTA 1BIIB 3LEXB 5C9JA 2BSED 2XXCB 2ICES 5C0CA 3QDJE 4N8PA 4BQ8A 4NP4H 3LS5L 5HTSA 3FCTB 3BGMB 4WFHE 5D1QB 2X4PA 5E94A 4BZYA 2HVJA 1LK2B 3ULUD 1EVTC 3UX9B 5JMRA 5AAWA 3EO1A 4WUUB 4I48A 4ZFOL 5E5MB 3GO1L 5DD0L 2MPAH 3G5ZA 1A2YB 3I3EA 2FHBA 3HZMB 3H9ZA 3K0WA 4HAGA 4L1DA 4NBXB 3UJTH 3SE8H 4Y5XC 1RZ8A 2JKXA 4PJ9C 3L7EB 3BPCB 1SYVB 3DUUA 2E9WA 3QIUC 3CZJA 5DUPL 1BD2E 4Y7MA 4ODXA 2VDLL 4LMQI 1H9VA 5DWUH 4DVBB 2ZP0T 4P2OA 1TQCC 3BYYA 3I02A 5JHDE 1GC1H 3TESA 4D9RD 2OP4L 5I0ZA 4G8IA 1UVQA 1S7TA 3SE4C 2Q76B 4J1UB 5DJXA 5T5FL 4CGTA 2VZ3A 2G75B 2FX9H 5L0QC 2XWTA 4MHHI 3RVTC 1F3RB 4R7NB 1I9JH 4ISVA 4OIIH 1O7VA 2V5TA 3DUHA 3FTGB 4DOHB 5SV3A 4WEBH 5F7MC 5ILTH 2GJ6A 3HMWH 5D7JD 2DQCH 2RHEA 4YPGB 3FO0H 4XC1H 3QIBD 3OQ3B 4LK4A 4P2QE 4U1SA 2BSSB 2AJXL 4X5XB 4JRYA 1UA6L 4LPVA 4FG6C 4XPFL 3MCG1 1EXUA 5D1XD 1KACB 4FFWD 3MLSL 5I1EH 3MLUH 4YWGL 3FZUD 2DWDA 1UADC 2HKHH 1FCGA 4NQCB 4BK5A 2M26A 5CJ5A 3I9GL 1QQDB 3PP4H 4K71B 1DQML 3STLA 2YC1B 3RUGE 5IV2A 4JFFA 3X3FL 4PRDA 4U1MB 1CD0A 1VKXA 4AY0A 1MNUL 5TE4H 4HWEH 1OTTD 4MX7A 3RNQA 5I1CL 3C8DA 2AI0H 1PG7X 3MRQB 2ZNXA 1IGYA 4I1NB 4QHMA 4ZFOA 4ZUSA 4XNMB 3OL2A 3C6LD 3DVIA 2F54A 4NC0B 2A6JA 3MACH 3MR9B 4TPRH 4K3EH 3V79C 5L8LB 4JM2F 2MPAL 3RHWK 4MWFB 3TFKD 1XIWA 2FX7H 3G6JF 3O6ML 3LKPA 1IGTA 3SE8L 4LKCB 5E2WL 2NY4B 2HFGH 1FYTE 4JFDE 2LTQB 3P77A 1MCOL 3KPRA 5I2IB 3VXME 4QHUB 5IFJB 4QRUB 5DWUL 1BF8A 1N4XH 2R4RH 4U2YA 3TT1H 1S9VB 4ZUUA 3UP1A 1HHHA 3B9AA 1DLHB 4UBDD 5F9DC 4HS8H 5FO9A 4PJXF 3A6BL 1IEBB 4F8TA 3TZVC 5DEGA 5DT1H 3QXUA 4L29B 5JQ6H 1FNEA 3GHEH 1Q94A 4MJ6B 2ZUTA 2EH8L 4WEBL 3CFCL 3GJFH 2BNQA 4IS6A 4WI7A 3RWCA 3UTZA 2DQCL 3DIFB 1BBJB 2MCPL 1T1WA 1NDMA 4P9HC 4XC1L 4X9IA 3C60C 4F7TA 2C9AA 12E8H 3OKLA 3P0VH 1PQZA 2WUBH 5JIHA 4G9FE 4GKSA 4LOUD 2CLVA 4ZSOB 4JDZA 5C09A 5EA0L 4LCUA 2E9IA 5F7FA 3EOBA 3MLUL 5IIEB 4QTHB 1I8IA 2QTEA 3U9PL 1V3JA 2X40A 2HKHL 2R2BB 1MCFA 3SKNB 4G80B 2B1HH 3CCHA 3C8KB 1PX3A 3S96B 4BSWA 4PJBB 2DICA 1OGAD 2O5YL 4Y1AD 1BQHB 3TCLA 4NRYA 5JR1L 1R3HA 3WSQH 1NC4B 5F7DB 3UTOA 3KLAB 2PETA 4U2ZA 2WQ8A 1QBAA 2DBJA 1KIPB 5DZOA 1GHFH 2R0LH 1X5LA 3B6SA 4HLZG 3NMEA 4QRRE 5KSAC 1FSKC 4XVJL 1R24B 4C55A 5EU5A 1JE6A 2VLKE 2FLBT 3KXFD 4XVTL 3M17B 1V7MH 3AAZA 3MACL 1G7JA 2V7NA 2NXYB 1JGEB 1NCAL 3NABH 4NN6C 1F42A 2OQJB 3GDBA 5GZOD 5HDLA 5JDSB 1W8NA 2ENSA 1ITCA 3DI2B 4M1GH 4F3FA 3NCFB 4ZFFA 4JEGB 3F7VB 4W4OA 1OP5K 5B4MC 3IU3A 2C1PA 2A83A 4X98B 3ALWA 1FVDA 4WTXA 4OF6A 2VXVH 4I0PA 4GG6E 1T7WA 4M8QA 1A7QL 4KUCF 5EPMB 2R4RL 1RZFH 1KV3A 4PLOB 5D1QD 3TT1L 5M7QA 3HN3A 4ELMA 1H15A 1K3IA 5HHQA 2EDKA 1BAFH 1W2KT 2CSPA 5L7XL 4WUUD 5DJCA 3G9VA 3MOBH 4HGWB 4Z95H 1ZVSB 2KPNA 4PJAE 1ZVHA 3MRCA 4UAOC 1OSZB 4JVUA 5DT1L 4L8BA 3LKNA 1J1PH 1YNTB 1EAPA 5JQ6L 4OF0A 3VFUB 1K4CB 2J7LA 3T4YA 4MD5B 1Q9LB 4N5EC 4FFZL 3VRLE 2HG5A 1YN7B 5JHLL 3TBTB 1KNOA 4KGJA 5KANI 1I7RA 4GRLA 4ZFZA 4G8GE 2P5WE 1AXTH 4O02H 12E8L 3P0VL 2WUBL 4K9EC 1TZHA 3A67H 2BRRH 2CRMA 4MA8H 1XF5A 3FQRA 3QPXH 4N8CH 4LP4A 4O58H 2R23B 2OS7A 4KKLD 4NN5C 3WHE0 2ZCKH 5CIPB 3UTSE 4D9QD 3IGAA 1M7DB 1MI5E 3LHPH 5DA0B 1RSFA 1UCBL 3MRNA 2FIKA 4NKQB 4KTDL 2Q86A 2Y6SC 5KZCB 3BKML 3RZCA 1JCKA 3SOBH 2B1HL 5E5UB 1N7ML 4HUKB 5JZ7C 5IR1B 5TFSH 4HIIB 2YRPA 5E8DL 3S98A 1RZGB 1S7QA 4L4JA 5GRYA 4ZPVB 3RX5A 1S7VB 1JGVH 4ZYKA 5BV7C 3VRJB 4I4WA 3WSQL 3WFCL 3JWOC 1A7RL 1CD1A 4TTDD 3ARSA 3TA3A 2PTUA 5CEYB 4YIQB 3OHXA 5HYSB 4R7DA 3T0WA 2X4RB 4WHTA 3SE3A 4X7DC 3JV6B 4YFDB 2D4FA 5IHLB 4P4KB 5FKPB 4EIZC 4Z7WF 2VAJA 4L5FH 4NQCD 5BJTB 3C08H 1V7ML 4QXUL 3U1SH 2VXQH 2FEEL 4E42A 1HILB 3ARRA 1DEEB 4J7RA 2FYYB 5JW3L 1DUZA 5I1GH 4KK8C 5BRZB 2HTKD 3MRLA 5GSVA 1R3JA 3OF6A 1YEIL 1GOHA 4M1GL 4G7YH 1QUNA 3TNMB 3TGXA 3PDOA 2W0PA 3FT3B 4R0LA 2VXVL 2QR0A 3L7FB 4M6NL 2XZCH 1MELA 3QZWG 4PGBB 1J0KA 2CRIA 1YPZF 2APVA 1CK0H 1BAFL 4LEOA 3ZDZF 4LLVA 1MQ8A 3OKKA 3MOBL 5I1AA 5DR5L 2GUOB 2N56A 1EHAA 4IRJC 1U3JA 4Z95L 5C0BA 3P0GB 4UDUA 2MHAA 2NY4D 4JDVB 4NQTA 2NMSA 4QXGL 4JFXB 4RA0C 3ILPB 3QXAB 3W9DB 5HHXH 3BN3B 4NBYB 2VABA 2ZOKA 5ISZE 3WJJA 3FQNA 2NY2C 4HGMA 1X7QB 4MJ5B 4POUB 2BY1A 2DAVA 3HRPA 2CUMA 4MNHB 2PTTB 2WINA 3S4SA 4H20H 3BX7C 3A67L 4HV8B 1K4DA 2P8MA 2BRRL 1TJGH 4LVOB 1I3VA 2EO9A 3QPXL 1XGPB 1T7XA 1AGEB 4WHCA 1RUPH 4AH2B 4MMXC 1BX2B 1VEPA 1YEJL 5GZND 4LU5H 3O4OB 4ODTL 4ONOA 1EUTA 4OZHA 3GB7A 5I71C 4PG9B 5E6YA 4XXDA 3H9SB 4TNWK 5CS7A 5JPMB 3G6JE 1CFQA 1U0QA 2Y06H 4OGXH 4Q6IB 3TEUA 1IQDA 5TDNA 3V6FB 5E03A 3RP1A 2ZG2A 1IAIM 2BP3A 4NKOA 3NGBB 1OGTB 1MJJA 2V2TA 1EA9C 2X4TB 3CSBA 3F12B 5TE7L 4KKAD 4L5FL 1HHKB 1AGBB 4JPIA 3C08L 5TQ2H 5FYJH 1X5JA 5ANMA 4ZUVB 5J9PA 3EJYD 4NRXB 4OD1H 5JO5A 4YXLL 1F90H 4K3HA 1P4BL 4RGNC 2H1PH 1ZA3A 2JE8A 1MCLA 3MLXL 1P53A 5GGUA 3W39A 5I1GL 3S9DB 1NC4D 5IM7A 1AC0A 5C0RH 4G7YL 2VYRE 4HEPG 2ESVE 3UEZA 1VGKA 2RFXB 1IJ9A 3P4NB 4PJDB 5SWQB 3N1MC 3IFNL 4IMLA 3GSNH 3QA3A 5BXFA 3O6FA 2YZ8A 4NHUB 4NQXA 3IJYA 2B5IC 4Y4FB 3FO1A 3UO1L 3O41A 1CK0L 4RGNE 1HSBA 3RGVA 2NXYD 4WGWB 1AO7B 3VW3L 2FGWH 5D7SH 2R2HB 1HQ4B 3VJ6A 1KPRA 4PJFA 4X9FA 5CSGA 4EN3C 1B0RB 3P9MA 1RHHA 3OAZH 3TH4T 1IAKA 1I1AB 4A2MA 3MUGA 3CPLB 1BZQK 5HHXL 4JQVA 3TBVA 4QY8B 2F58L 4G9DB 3DGGA 2W9EH 3V7AG 1KEML 5ICYB 3ROLB 3GSVB 1JVKA 3DPBA 1DBJH 4ZOAA 4PJGB 4HJJH 2IPTL 4M61A 3LB6C 2AKRB 3L5XH 3SDDB 2UVEA 3MGOB 1UB6B 4H20L 4OUUB 4XCNB 2V7HA 4LSVH 4ZNCD 3QO1B 4J3WA 5H2BA 1NFDB 4JO4H 3T1WA 4DAGL 1QFWI 3CX5J 1RUPL 3QFJE 5E6IA 4RX4D 2N4IA 4LRIC 4WDIA 1FZKA 2B8OT 1AHWA 4FRWA 4IDLA 4MXQD 3T0ED 2LFGA 5LXGH 2BY3A 1U8OB 3U79A 5FO8A 5JW4M 3CX5K 3ARDA 3S88H 1AR2A 2FBJL 5C9JB 4HUXA 3U48A 3WFZA 5I8OH 5FK9A 4ZS6C 1KOAA 4MDIA 5C0CB 2BXZA 15C8H 4RGOL 1IKFH 2X4PB 5E94B 3HC3L 2HVJB 3AM8A 1BBDH 3AROA 3EO1B 3FONA 4I48B 5EOTA 2J5LB 3G5ZB 1S78C 3QJHA 4N90D 5DRWA 5EORH 4E0RA 3AREA 5B21A 5KTEH 3PGFL 5TQ2L 3LPGA 4JJ5A 5FYJL 3O3UN 2NNAA 4X6EA 2AEQL 3DUUB 5J0BA 1LVEA 4KFZC 2H1PL 4ODXB 4GT7A 1KJMA 1NCNA 1GPOH 1RZKL 5KAQF 2HT3C 2ID5A 5BS0E 4P2OB 1P4LA 3I02B 4ESKA 3HCVA 4G8IB 3U0PA 1UVQB 3IDNA 1MLBA 1S7TB 4BFGA 1P7KA 4XPHH 3GSNL 5DJXB 4P4KD 2EXWC 1P5VA 3HE7C 1ZT4A 2XWTB 5HDBE 5I9QC 1BPVA 4ISVB 3OAYH 2GSGA 2PYEE 5D7SL 5A43C 2JJSA 5A2FA 2GJ6B 5BRZD 3IDIA 1F58L 1Z0NA 2HJLA 3AVEA 2AGJL 5EUOE 4U1SB 1JGUH 2W9EL 4JRYB 1BD2A 1EHNA 1XAUA 4HJJL 1BVLA 1JL8A 2AXGA 4L9DA 1JPTH 4JN1L 4OB5L 5CINH 3LD8C 5EFIA 3O2VH 3EZJB 5D2LE 3U30C 2DWDB 1Q9KA 1ZTXH 2GSIA 3U4BH 2XXMB 2HN7A 4PJ9A 5L8JB 4XBGA 4YDIH 4Y5YC 3WHXA 3STLB 4JANA 3QIUA 5HYFA 5IV2B 1D5IL 4JFFB 4PRDB 2I9TA 2CKBH 5ACZA 7FABH 3AXLA 1F6AA 1I7ZB 1VKXB 3L3GA 2XWBB 4Y5VC 4RMUA 4MX7B 2NXZC 3RNQB 1X5ZA 4HWNA 3TP4A 4PRPD 5HVHB 1KC5L 5F9AC 1SYSA 4CN4A 1G6RH 1YECH 2X7LB 1IGYB 1AY1H 4QHMB 4ZFOB 4RBPK 3FQUA 4ZUSB 15C8L 4XHJD 1DLFH 4KXZH 1IKFL 1YJDL 2RJMA 2F54B 1F2QA 3EW3B 4D2NA 5F6IB 5IFHH 5JXEC 4LLQA 1UM4H 1UEYA 5GRUH 1XIWB 2VKWA 3O2DH 4BUGA 3LKPB 1IGTB 3MBXH 5DMYA 5KTEL 3GJEA 5KOMC 1N26A 3T0VA 3BYTA 3T2NL 3ZDZE 1CBVL 3P77B 3TVMC 2C3VA 3H9SD 4KRPC 3KPRB 4HUUA 1LP9E 3QO0A 1OTSC 4HK0A 5FM5O 2XZAH 3MLRH 1GPOL 1P4IL 4V2CB 5DD3H 3RZWA 3GSNA 4ZUUB 3EGSA 3HAEH 5FAAA 2G2RA 3DYOA 4K9EH 4OAWA 1HHHB 3RFZC 5FO9B 1F4XH 1VEOA 5FGSA 3FO9A 3NCBB 5DEGB 1WZ1L 2X1WL 1AGDA 4XXCC 2HAZA 4Z7VF 4HX1A 5B3NA 5LWYH 3SY0A 3GI9L 4YJZL 1FNEB 1Q94B 4CVWA 5FYJU 4EQ3A 5KVGH 4JFHD 2BNQB 3E1F1 4ONGH 4IS6B 1ACYH 1D7FA 3RWCB 3KS0J 1A1OA 4U7SA 3UTZB 4WFGE 2DLHA 3T0AA 1T1WB 1NDMB 3HLAA 4F7TB 1EO8H 3OGOE 1O7SA 4FZ8L 1KT2A 2HYMA 4JFDA 3OKLB 3SKJH 1PQZB 1X5AA 4ALAL 5BV7H 1KCUL 2VKXA 1YEKH 4FMKA 1JGUL 3JWOH 3VXMA 4GKSB 2CLVB 1CTOA 4JDZB 4MCZA 5C09B 1JYVA 4Y4FD 6CGTA 1PFCA 1JPTL 5CINL 3EOBB 3O2VL 1IC5L 1I8IB 3CFKA 1AO7D 1T5XA 2AJSL 3DJ9A 4LHUA 5JQHC 3CU7A 3CCHB 1CU4H 4J8RA 5A3IC 1C8PA 3OAZK 1I1AD 1II4E 4M7LT 2FBOJ 4BSWB 4XMKH 4YDIL 1KYOJ 2Q87A 1F2XK 1FNGA 3HB3D 4X6DE 3TCLB 3MUJA 3GIVA 2ILLA 1GZQA 2ED8A 7FABL 1R3HB 3HC0A 1L7IH 4F33A 1MJ7L 3WLBA 4RMWA 4N0YH 4OCYH 4BELD 3IKCA 3SDDD 1KYOK 3B6SB 3WJLA 5EU5B 3O3EA 1A6WH 1DLFL 2YA0A 5C2BH 4N9GA 2EDDA 5IFHL 3AAZB 4PP1D 1G7JB 1WGOA 2V7NB 2HMIC 1NEZG 3MV01 5DTFA 4L4VE 4LFHG 3FHQA 3NH7H 2PR4L 5IVNA 1XH3A 3D85A 4X80H 3MBXL 4X4ME 4QRPA 4F3FB 4ZFFB 2CD0A 4PY8J 3PUCA 2JB5H 2LE9A 2C1PB 2V2XA 2R0KH 2A83B 3IU3B 1FVDB 1SBSH 1QLRA 2IH1A 5C0CD 4AZ8A 4U1JA 4I0PB 1QFHA 4PFEA 4M8QB 5J13C 4ELMB 1H15B 1I1FA 5C0IA 5HHQB 3NOIA 3QDGE 4DEPB 1QOKA 5DJCB 5T3XE 5F6HI 1F4XL 1J88A 3MRCB 3PF2A 4L8BB 3B9EA 3TF7C 4GXVH 3LKNB 1EAPB 4XX1G 2BVEA 4HKBA 3I50H 3T4YB 1FORH 1WLHA 4Y4HC 5BMFH 1G1CA 2HG5B 2BVPB 2K7QA 3E0GA 2YN3A 1KNOB 5DJDA 1I7RB 4GRLB 4ZFZB 4P2OD 2WWKO 4KAQL 2J2ZA 1OD7A 1JMZA 1TZHB 1YEKL 1BFTA 4OFYA 1KJ3H 3UROR 3JWOL 1GSMA 3NIGF 4LCYA 3TIDA 1XF5B 1IAOA 3FQRB 1BGXH 1U8HA 1X5XA 2ZG1A 3KPQA 5CZXD 3UBXA 1YQ2A 1S9YA 3GKWL 3IGAB 3A6CH 1T1XA 3MRNB 3PHQA 2Q86B 4OSUH 3ZKND 3RZCB 1E4KA 4NDMA 2GJ6D 1CU4L 4BQBA 4YNYA 1F13A 1UH4A 3VD5A 5E2VH 4XMKL 3AB0B 1TTFA 1S7QB 5D70H 5BOPA 1TJHH 4NCC1 5CMAA 5HD8D 1RIVL 1RULL 1IMHC 4ZYKB 4JRYD 4U6TA 4I4WB 5L6YL 1L7IL 4PUBH 5MHSD 4N0YL 5GRVL 1CD1B 3TA3B 4FQXC 5CD5C 2ITDB 3NCCB 4LCIH 3OHXB 4R7DB 3S7GA 3V0AC 4WHTB 5FXCH 3AMKA 5DJ8A 3VG9C 4LEXH 1FIEA 4JFQA 3FN3A 4EUPA 1A6WL 4F58H 3FT4B 1G7HA 5C2BL 3O2DA 4XCCL 4YDLC 5IWLC 4E42B 5DUBA 3NCMA 2EDXA 2HLFD 4Q7DA 5CLTA 3UTSA 5JNYA 3JSSA 4JFFD 1DUZB 4NM4H 3LPFA 3MRLB 5GSVB 3PP3H 4X80L 1R3JB 3REVB 4M4PA 1EHLH 3SGDI 4RZCA 1XGQA 3HAEA 2R0KL 3PDOB 1SBSL 4M6ML 4YEEA 5ICXA 4R0LB 2QR0B 3P3YA 4XNQA 3VFWA 3QUYA 1J0IA 1JPFA 2F54D 2P8LA 4LMQE 4LEOB 2F74A 3B4NA 4LLVB 1C12A 3OKKB 5I1AB 5ADPH 5A2JH 1XIWD 1K6QL 5C0BB 1TJIH 1GGCH 1QBML 1F4AA 4U0RC 1UZ6F 2AK4E 1A6AA 4UDUB 5GRJH 2Z31C 4O2EA 4BYHA 1EFXA 3KPRD 3I50L 1FORL 1MHPL 2VABB 2ZOKB 5DS8A 3H6JA 2H3NA 4MJIA 3FQNB 2GT9A 3WIIH 1QSEA 1M05A 1HH9A 4YDKH 5C0DB 2WINB 3S4SB 5ITFA 4GKNA 1UG9A 1BIHA 1KJ3L 2P8MB 4UINH 3KWWA 3QNYA 1YMME 2VSDA 5IOPA 1NUDA 2OTUA 4H1LA 3SO3C 1XCQA 3GSOA 4I9WD 3T3ME 2WWMC 4ODHL 1V8HA 4RGMB 3A6CL 2XTJB 2WBJC 2HH0H 3ZYJA 2RR3A 3BDYH 2BNQD 4MNGE 2AQ2A 2ERJC 4OZHB 3GB7B 2MKWA 4KKBD 1BHGA 4PB0H 4LDLB 3HR6A 4XXDB 5E2VL 3VXUE 4LPXA 4N0CD 5D70L 1NGQL 1G1YA 1TJHL 1CFQB 5ISZA 1DQDL 5ACLA 4KPHH 4U1HA 2C7UA 5T3ZD 5TDNB 2ARJA 5DMGD 2YBRA 4MJ4A 3RI5F 5C09D 4LCIL 3HZVA 5J11B 3BMVA 3SGEI 1PVHA 5GS0C 3N85L 1MJJB 1M4KA 1HCVA 2V2TB 2NX5E 5D7IF 4NO5A 5D1ZC 1JNNH 1F4HA 4NO0A 4P59L 4F58L 4JPIB 2P24A 5ANMB 4Y16A 5FYLE 5J9PB 1K8IA 3KAAA 3LEVL 5JO5B 4ELKA 4JFYA 4PRAA 2EKSA 1IGJA 1ZA3B 5GGUB 1EMTH 1NCBL 2GK0A 4P23C 3W39B 2ZUXA 4NM4L 3QI9C 4Z7VE 1T0PB 4MQ7A 5IM7B 5C8JA 4MNQA 2Z93A 4L1HA 2VXTH 1BZ7A 3GBMH 4UQ2A 4JM2A 2DM4A 2EE2A 1K3ZA 2VR4A 3G6JA 4IMLB 3QA3B 5BXFB 3O6FB 3MJ6A 1BQUA 4NQXB 1MCJA 3IJYB 3WN5C 4NZJA 3FO1B 3O41B 3DYPA 1KBGH 4XCFH 3LV3A 2AAVA 1MWAH 1CICC 1HSBB 3RGVB 5K59E 4X4ZA 1KIRA 1KEGH 5ADPL 1E4XH 5J57B 1NBVH 1I7UA 3VJ6B 4OFKA 1KPRB 1TJIL 3P9MB 4OV5A 1RHHB 1IAKB 5TF1H 3HMXH 1CQKA 3MUGB 3IAGC 4WHYG 5GIRA 1VFUA 2ZSWA 1W72L 3TBVB 4AMKH 4YHLH 3R0MA 3DGGB 4PJXA 4GMSH 1WAAE 4OGYL 4ZAKA 4I0PD 5C0EA 3SDXF 4JQIH 4LLWA 4M61B 3BZEA 3FRUA 1EJOL 3B8SA 2BMKA 2YZ1A 3GSUA 2V7HB 3RKDD 3ZT6A 3LRSB 4GAGH 1Y0LA 2VOTA 5H2BB 4XB8A 2I27N 1OD9A 4LDEB 3IRPX 5E6IB 1CFSA 4WDIB 5FDWA 1FZKB 1AHWB 2HH0L 4EBQL 2IAMB 1N64L 4PB0L 3JWDL 3N06B 1OP3K 3QXTA 5FO8B 2VZTA 4GRLD 3ARDB 2HRPL 3TIEA 3MV7A 2EDLA 5FK9B 4MDIB 4NBZB 4YHKH 3HNTH 1ADQL 3EOTH 1MAML 1XCTA 2H32H 5CEZH 3DLQR 3RWHA 2FB4H 4HWZA 2XKSA 1LO3L 3ARQA 1UACL 3FONB 4HWBH 4UV7H 4CDGC 3QJHB 5DRWB 4M1CC 5D7JC 1J1XH 4E0RB 1JNNL 4HS6A 5D7KD 3AREB 1CLYH 1MY7A 5C07E 3VWKC 4JJ5B 1Q9WA 4QGTA 3QIBC 2D31A 2NNAB 4X6EB 5AWNL 3K4DA 1DFBH 3QFJA 2CO6B 3VGDA 3CLEL 3VGFA 1KJMB 5D1XC 4IRZH 4XWGL 3TA3D 1P4LB 2VXTL 2WWKT 3GBML 1B4JL 2JELL 4PRNA 1ZANL 1BF2A 2D9CA 3HCVB 3U0PB 3IDNB 1MLBB 2HVKA 1FFNA 1P7KB 4LHJB 3MLYH 2BHYA 2YWZA 4F15B 2A9NH 1ZT4B 3TYFA 5HGBA 4XCFL 4X99A 1X5GA 2GSGB 1IGFH 4LRIA 2EDHA 2K9UA 1E4XL 1W72A 5MI0C 3IDIB 3GSQA 3VXOA 2HJLB 4OT1H 5LG1A 2PO6A 3OF6D 5TF1L 3HMXL 5F8RC 5ESAA 4DTGH 2CQVA 2P46B 4DVRH 4R4NC 3IVKA 3BUTA 1BD2B 3GIZH 1LGVA 4N1EA 4MGXA 2OTPA 3QG7L 4JQIL 1BVLB 4GXUN 2AXGB 3TFKC 5I8CA 5EFIB 5EU4A 3OKMB 4OQTH 2FD6H 4APQA 5T5NG 3BH8A 4TRPH 1Q9KB 1WFTA 1Z2KA 2GSIB 4I13B 3WUWG 5F3BA 3MZTA 5C0BD 2HN7B 4PJ9B 4KDTA 3EIFA 4XBGB 3WHXB 4XB7A 1UH3A 2IFFH 4JANB 5DMIL 3QIUB 1K2DA 3WFBH 2PYEA 2I9TB 5IEKA 2GJJA 5ACZB 3AXLB 1F6AB 4PTTA 5JTWA 1ADQA 3NPSC 3VFNA 3QRGL 1IT9H 3L3GB 1TQCB 4XAKD 2P49B 1ZSDA 4DGVH 4Y4KA 1SYSB 1M71A 1MVUA 4YHKL 3FQUB 4NO2A 3TJHD 4AIOA 4B0MM 5GGQL 5L0QB 5CEZL 2Z8WC 4OFVA 3D2UA 4EDXA 2FB4L 1ZKAA 1Q1JL 4NC2B 5EIIA 4HWBL 4LLQB 3IDJA 1BFVH 4UV7L 3DO3A 2XTJD 4YGVA 4KVNL 3OR7A 1CLYL 3GJEB 2J88L 3CMGA 2OZ4L 1F45A 2C3VB 3R4DA 1ED3A 4HUUB 3QO0B 1WEJH 4HK0B 4AYFA 4F2MA 3GSXA 4Z7WA 5DFTA 3GSNB 3EGSB 4HG4J 2G2RB 4YHYC 3H9HA 1NEUA 3VD3A 1FRGH 4P5KA 4OAWB 3RY5A 2ZZUT 4YX2H 1CZ8L 3H7LA 3KJ6L 1MWAA 3OX8A 5I76A 5CJBA 3MLYL 5EO0A 4RRPA 3FO9B 1MIMH 2R9HD 1AGDB 4Q6YA 5CGYD 1GCFA 4LAQH 4HX1B 2R0WH 3SY0B 4KRMB 1WFOA 5GS3A 4N8VA 3HMXA 4UTAL 1IGFL 4Y5YA 1T83A 1A7OL 1WBYA 2VWEE 2NY5L 1A1OB 5DHXB 3ZYOA 4I77H 4NZDA 4Y5VA 5JA8B 1YPZA 2CKNA 3HLAB 4HC1H 2Y5TA 2Y7QA 4X5WA 4PS4L 2B7DT 1KT2B 4JFDB 1JZ6A 1LE5A 4DVRL 3PABA 2CDGA 3RX8A 4NRZA 3K1DA 3GIZL 3VXMB 4U05A 3O6FD 2Z4QA 1H3WM 3BI9X 1OGAE 2DIAA 4GKZA 4MCZB 1G7PA 1QSFA 5IVXF 5JXEA 3OKDA 4M5YH 1PG7W 3RGVD 2FD6L 5I6XB 3CFKB 2ORBL 3U0WL 1T5XB 4TRPL 2AXHA 3IAQA 4LHUB 3PQYD 3I3DA 1J86A 1C08A 4TQEL 3SJVA 4QHKI 2IFFL 4JRWA 1FNGB 4DK3A 3GIVB 5D1QC 4RCAA 5HPMB 1GZQB 3HC0B 4F33B 1I3RA 1PEWA 1TNNA 3WLBB 3U2SA 3IKCB 2I9LA 4Z9KB 5BOZG 2H32A 2VRAA 5EU7C 4DGVL 4FS0A 1QBLL 4M5ZH 1QKZL 1U95A 5IQ9A 4U1IB 4PV8A 4HWBA 5KS9F 3O3EB 3SKUD 5TQ0H 4FTVA 5CGMA 4N9GB 2BERA 4XXCA 4ZOCA 4PJIF 2UYLA 2OZ4A 4Z7UF 4M9PA 5E6ID 1BFVL 5DTFB 1W0VA 2HT2D 4MDJA 3V52L 4K7PY 1B0GA 1A7NH 3ET9F 3WUZA 4WUUE 4KK5C 5F1NA 3VI4E 5FCSH 3FN0L 3IDGB 1KELL 4QRPB 5EU7E 1TCRA 5HVFB 1X5KA 1MCRA 3ZKMC 2V2XB 4P48A 2OXGA 2F5AH 1FFOA 2IH1B 3KLHC 4U1JB 4OLUH 2JCCF 4MMZC 4KKLC 4PJHF 1I1FB 1U9KA 1ODAA 1IGCH 1CXHA 2OYPA 3VFTA 1PKOA 4BA8A 7CGTA 1U8LA 2E7LC 1GL4B 1QHOA 1N6VA 1MIML 3ARED 2Q1EA 3B9DA 4LAQL 4GMTH 3ZSSA 1MUJA 3SBWC 5K9KA 4HKBB 1I1RA 1E28A 1FAKT 2A0LD 1NLDH 3V6ZA 4L4VA 4TTDC 3MGAA 1JHKL 3O9WA 4XVUD 4DOHE 5DJDB 3V4VH 4R26L 5IF0A 4FQPA 2QSVA 2GY7B 3TM6A 3VI3F 3D6GA 1A6VL 4X6BA 2YHGA 5JPNA 4G6MH 4KJQD 1KLGA 3L1OL 4LCYB 4OQTA 2FCBA 4LPTA 3TIDB 1IAOB 4JFPA 4EOWL 3KPQB 1RZ7H 4LSSH 2X9YA 3UBXB 5GS0H 1OWRM 3RWDA 4FQJH 1S9YB 5IFAH 2HTKC 4G43A 2X44D 1T1XB 3H42H 4ZG1A 4NN6B 3PHQB 1WWBX 1KENL 1CLOH 4NDMB 3UTPD 1X9QA 1ZHNA 4YNYB 3MRFA 4WWKC 3NIFF 4ERSH 1WK0A 2GAZA 3INUH 3RWEA 1ZEAL 1NSNL 4M62H 5F21B 3WNNA 5CMAB 4V1DA 1BD2D 4E9LA 5J56B 1AQDA 3L3OB 4RFNB 2ICWA 5FIEA 1NBZA 2FEEI 1GVIA 4JFQB 4EUPB 4AT6A 2CXGA 2ED7A 4N1HB 1G7HB 2X05A 5TH2A 2YUWA 2LTQC 5DUBB