3ZE0E

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze0E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze0E02
5EIIA 2ICWI 4ZTOL 4LHUB 1URLA 2MQ3A 3L3HB 2DLFL 2CSPA 1GPOL 4PGZA 2G2RA 3W9EA 1QRNE 3ARGC 2V2XB 1OARL 5D7LD 3U6RB 4LSQH 2P7TA 4KK8C 1RHFA 3GSWB 3DGGB 4P57A 1CE6A 3NACL 4QOKA 2XKSA 4YK4C 3UAJD 4OI7A 3DYMA 4ZPTB 4JAMA 4UIMB 5I1GL 2OP4H 1DANT 5HHXH 5E6YA 1G0YR 2J5LC 4XP6H 3BH8A 5JOPE 4HJJH 3LKPB 2EC8A 1M6OB 3WFEL 3A6CH 2WIMA 1UKTA 5FGSA 3HZKA 1QRND 5D2NE 5I1AA 3B5TA 3BSZL 5INDB 3R06A 3VRJA 1S7TB 1CG9B 5I71B 3QWRA 2DKMA 3F7YB 2P8MB 2IADA 4O2CA 1CFNB 3KPTA 4N9GA 4WI3A 2ARJQ 3PL6A 5FYLE 4HQQH 4WI8A 5FUCC 5JLZA 1LEIA 4FXGB 1DQML 3AAZA 1DSFH 4QKXB 3WD5H 3VMOA 1H0DA 2QHRL 4M8QB 4X8JA 4MMXC 3G6JA 4BH8B 4EI5A 4MDIB 1P2CB 2HKHL 3AB0B 4Z7QF 1ACYH 5C0DA 4G5ZL 3RTQD 4EJ1C 4PRAB 2R2CA 3MRHA 4BQ6A 2BMKB 2OJEA 2VC2H 1WZ1H 2ITCA 1Q0YL 1BF8A 4XC3L 3MX0A 2ZP0T 3OZ9H 5EOTB 3QQ3A 5D1XB 4MNGB 3ZHDA 1RUQL 3EYVB 1H8NA 4NUJB 5BXFB 2R69L 1JGLL 4EUPB 4JDTH 1OTUD 2UZXB 2GITB 4GRWF 3TIEA 5D7LA 1RK1B 1I9RH 1YNLL 5IMOA 1GVIA 1NL0H 5F9JB 4OZFH 3U4AA 2CKBH 2YHGA 5E8EB 5EORL 3BIAX 1ZE3C 3NGBB 1T7VA 3FO0H 3SDDD 2DQEH 4EBQH 3MV01 4BFIB 2ARJB 1CFSB 4M3JA 4JKPL 4IRSB 2D0FA 4IDJL 3HNSL 5IHBA 3ZZ1A 2FIKB 5IF0A 2ATKB 3G9VA 3QIWD 1QRNA 3RHWF 3VFUB 2JJSA 4ETQB 2K3TA 3BJ91 4OM1L 3VH8G 4OZ4B 2PR4L 4PTTA 3QUYB 3HZVB 4JO1H 3T4AB 4OIBA 3RAJH 1F58H 5TE4H 1OQOA 3RPKA 1AJ7L 3VG0L 1D5BB 3H3PL 1H3GA 4HIXL 4LAQL 4KDTC 3ULUF 2CMRL 2HH0L 2ICES 4LEXH 1KLGA 4F9LC 2O5ZL 5KJRL 4Y4HC 4G6AD 5MEOA 1CFTA 4Y2DC 5D2LE 3BP6B 3O2DA 2IWGA 4JFPB 4MWFA 5DZLA 4QHLB 4JPKH 5DVKA 4LMQE 2HVJB 3QXDB 3VXNA 1KEGL 4HUXA 5FUZH 3O8XB 5D2NA 5F7DB 3IT8D 4LLQB 4K7PL 3RVVC 1W72L 4GRWH 4HXBH 1RFDL 4FG6D 5ID1B 5CUSL 1MNUH 2ZNWA 2DB8A 2DIBA 2GSIB 1T83A 2XY1A 3EO1A 3DVGA 3Q5TA 4ZAKD 4QTIL 1RD6A 2QQQA 3CVIL 5LJYH 3O3DA 4L3EE 4K23H 4R3SB 4C58B 1DQJB 4OM0L 1VSCA 1D5MB 5SWZE 1KXTB 5IW1A 1OAXL 3MRLA 3MCKA 5J12B 1T1YB 4KUCF 3GJFK 3STBA 2UZYB 4GKOA 5A16A 4JZJB 2UYLB 2OBGA 5E8PB 5DI8A 5DQJA 1CXHA 2AEPH 4YE4L 3LAFA 1LO0H 4GKNB 1TNMA 5IMMA 2IJ0C 1PEZA 3R0MA 2DBLL 1DL7H 3GMNB 2OSLA 1WEJL 1TJGH 3DBXA 3C5JA 4DN4H 2BVQA 4YIQA 4KQ3H 3SDDA 3OAYH 4L3ED 4PBVC 2BVYA 3KDMB 1KPUA 3HAEG 5DURD 1P84K 1IT9L 3ULUH 1DBKH 5DHVB 1NEZG 4HKXB 3SGDI 1U8IA 5EZIH 5ALBH 4XCCH 5D93B 5ILTH 1RZJL 3FMGL 4I2XB 2X1QA 5DJAB 1BZ7A 4LPXA 4Q6IB 2B4CH 5J1AA 3VWKB 1UWXK 4LSRL 4F57H 2D03H 5F9OH 3GSNL 4W6WB 1M71B 1C5DA 4NGHL 5F44A 1IGTA 2AW2A 3T3PE 2OM5A 5DT1H 4UT7L 1J05B 2MOVA 3G04B 4X9GA 2JE8A 3QO1A 1ZT7B 4Z77A 1T66D 2OL3B 2AEIT 2FJGB 3ZDZE 4LVHC 1YMHA 4MAUL 4ODVH 4GSDL 1KCRL 5D7IE 4OZGE 2DQTH 35C8H 5IFAH 1TJIL 5MEPB 5IB5B 2Q87A 3MJ7B 5FKPB 4CN6A 2A6KB 1HIML 2Z8SA 4I0KA 1F00I 2C1OB 1OP3H 1RJCA 4ZUSB 3UTQB 3GDBA 4G80A 3HG1E 2EZ0D 3LQAH 4Z95L 1F02I 2B20A 3BKMH 1OM3L 3S35L 1OL0A 1MCNA 3MBXL 1ETZA 1C5CH 3BKJL 3IDJB 5I15H 5D2LA 3L3KA 3L6FB 1HSBB 3CSPA 3WNMA 2NY3D 5EU5B 4JM2B 1KCUL 4JDVB 3PL6C 2DWEA 1A9BA 1NGPH 1BECA 4XMLL 1D5ZA 3B9KD 3I75B 4RDQG 3W9DB 5J11C 3QEGH 2QSQA 1VFBB 3HG1D 4BK4A 5FA4B 4EI5C 1OP5K 5TQ2L 5D7KE 4L3EA 2JB5L 4G6JH 2I9LA 3VD9A 2XNAB 5GGTA 5SWZA 3N1PC 4MD5B 4PRBA 5DRZA 2XOTA 1U3ZA 3QXWA 4LCYA 4GAJL 3V7MA 1CD1B 5I6XC 1JTOA 1MFDH 3VFMB 5HI5C 3C6LD 1LD9B 4IOIA 1HILA 3NCEB 5JPNA 3SE4A 4PTUA 2X10A 3GKWL 4BKLA 2OLDA 2PCPB 1X6NA 3JWOL 1I3GH 1P84J 4PJDF 4X4ME 4PV8B 3MRGB 4OGZA 5IB2B 3PP3H 3G6DH 4N0FA 4Y8AA 2I07B 3PUCA 3BW9A 5EUOF 1NBYB 3F62A 4K9EH 5F88B 5IVXE 2YMXH 2DQDH 4QXGH 4DZBB 3K8KA 1JWUA 4A2MA 4FQQB 1RZIB 4XP5H 5DXWA 2QHLA 1JWSA 3IDMA 1R5WB 1JHTB 2A6DB 4R97B 1ZHBA 1R5IB 5C0AE 2OP4L 2VE6A 3RIFK 3WIHA 5JDSB 5HHXL 3M17B 4UTBL 5IJVA 4ZYKB 1KB5B 3NH7L 4XP6L 4Y7MA 3RVXD 4HJJL 2V7HA 1IC7H 4DGIH 1JP5A 4JFYA 1H15A 1UM5H 1GGYA 2R2EB 3AFLA 4UBDD 3P11H 1RMFH 1FYTE 4C4KO 5CJXA 5D7IA 4OZGA 1FZOA 1C5BH 5JIIA 1D6EB 3VRLE 2BOCB 4P46B 4LLVA 1ERNA 5AEAA 5C0AD 2OQJB 1TCRA 3HG1A 2PW2B 4HQQL 2DJSA 4YEEA 5EOCJ 5JHDB 3KLAA 1NAKH 5CGYD 3WD5L 3EOTH 4WEBH 5D2NC 1DQTA 1AFVL 1A4JB 4LRIA 2FR4A 1YY8A 1MRCH 4BUGA 3NCCB 1EFXD 3IDYC 1AKJB 2ZSVB 2R1XB 5DUML 1T83C 1BBDL 2X1WL 1UA6L 1ACYL 3QIUA 3STLA 4DOHE 4NRXA 4XTRC 2I9TB 4FNLH 12E8L 1J0HA 3MRNA 4RCAA 1WZ1L 3EGSB 2X2YA 5CKGA 2D7MA 3VD5A 1U8OA 1N4XH 5LVEA 3OZ9L 4D9RE 3WHXA 2QQLL 4HXAH 5HGHB 4R4BA 1FQ9C 4K2UH 4MZ3A 1VACB 2EYSA 1Q9KB 1RZ7H 1EDQA 4OF8A 4HBCL 3I50L 4JDTL 2G60H 1U41A 1INEL 3MUJA 5I75B 1I9RL 1R3KB 2JTDA 1G9NC 3VH8A 3UXFA 4UU9A 3SDDC 1NFDF 2CUMA 2BC4B 2CKBL 1OVZA 4P5TA 2FBOJ 3VFNA 3B4NA 4NN6C 3FO0L 3BWAB 4OZIB 2DQEL 4D9RD 4X4MA 5EB9A 4UILH 2E6QA 4RAHA 1H3VA 4IS6B 5KSAB 2WP3O 43C9B 1G7QA 1QLEL 1CWVA 2D7TL 3BRGC 1S9VB 3MMEA 1J1OL 2FO4A 3RUGE 4DZ8A 3ULVE 1NSNH 4NN5C 1JZ4A 2QBWA 4TN9A 5IVXA 4OI8A 3RWHA 5E5UB 5EH1A 4YDIH 2V5SA 3HN3A 1BEYL 4JO1L 3RAJL 5TE4L 5KSVB 3EJZC 3TH4T 2EKSA 2AV1B 1J0JA 1YEKL 3ROOB 3SJVE 1QEWB 4G6AC 5C0AA 4ZTPH 1H5BB 3T0DA 4UAOC 3W5NA 4LEXL 3M8OL 1GGCH 4N0YL 1KTLA 1E27A 2WSKA 3VFWB 4ELKA 3L1OH 4X4XA 3TA3A 4LQ1A 3CFKB 3UYRH 3ZTNL 1FVEA 4UT9L 4RAVB 2ADJB 2DQUH 4R4FH 4RAUA 3RHWK 4JPKL 1J88A 4FG6C 4HK3N 3D0LB 3D18A 1U93A 1Y6NR 1FYTA 3VE0B 3RWJB 5CINH 3IS0X 4HXBL 4M7LT 3PWJB 1F3DH 1TZIA 4J7RA 3WLWD 5KVDH 1MNUL 5EU4A 3QQNA 2NY6B 3OSKA 3DROA 5DVLA 3VXME 4NO5B 1G9NH 1MWAH 4FP8H 3D2UB 4K23L 3MOQA 3SO3B 1D5XA 1YMME 4ZO6A 1GHFH 1IEBA 3EKCA 1JGUL 2EXYC 3A6BL 3OJMB 4NQSB 1B0WA 3NN8A 4X6DA 3G6AB 4HIEA 4F33A 3MRRB 3TNMA 1NEZA 1BWWA 3HS0A 2AEPL 3VFSB 5TDNA 2L7UA 2BHUA 2E7MA 2QR0A 4JGUA 2AXHA 1LO0L 4LVOC 2V2WB 3WIIH 3FFCB 2GIYA 1A7RH 5JNYB 1DL7L 3U7YH 1V7NH 3O4LE 4PV9A 4ZUTB 2BNQD 1FNGB 4NP4H 5FK9A 4R4ND 1A6TA 1S7WB 4MXQC 2PYFB 3SDCB 1RHHB 3TBWB 2GAZB 4CU7A 2C3WA 2VSCA 3C2SA 4JY4B 2VLLB 3ULUL 1JHLH 2W0PA 2OL3L 3P0GB 4XCCL 4KMLB 5ILTL 3G5ZA 5ACLA 5HYSA 5DD6A 2B4CL 2WQ8A 3SE4C 5GGVH 4WWKD 4MXVF 3FQXA 1HQ4A 4HC1L 4F57L 2D03L 3OG6B 1ADQA 5DJ0B 3LEVH 1ZLUH 5ICYA 1NC4B 1T66C 3CSYB 2NY0D 5DT1L 1J87A 3ABZA 4L3CB 5FYJL 3RWFA 4XXDA 5T1MA 5DO2D 4MJ2A 1NGZA 4EI6A 2X4SB 4FTVB 4RWHA 4JFOB 1OD9A 1PDKA 2FJFB 2VRAA 4ODVL 3NABH 3PHQB 3UBXB 4BZ1H 1F4XH 3DMMA 3O4OC 3RUGA 4IMLB 5IFAL 3WLBA 3TO4D 4JREB 3KLHD 1K85A 3QO0B 1U3YA 3GHEH 1ZGLB 4LLUB 3SJVA 3LQAL 1ES0B 3NCJH 4ZPVB 2BSRB 5FO9A 3O6LH 3BKML 3OXRA 1NCAL 3RDTD 3JWNC 5CJXC 5IESH 1ZWIB 3U2SB 1C5CL 3OX8A 2CRIA 1BZ9B 1MLCB 3GBML 4NCC2 4GLRI 4XBGA 3GJFA 1H9VA 2RAMA 4C57C 1U6AL 1HH6B 3RWCB 5DD5L 2CLVA 2CIIA 5GGQH 3RVWC 4IOFD 1VGEL 1JI1A 4HH9A 1OAUL 7FABL 2QADB 1MCKA 1IZKA 3VXMA 1G7LA 3ESVF 3CCHB 4LRIC 5I16A 1FZJB 1S9YB 1YMMA 3GMMB 3QIUC 1K3ZA 3MYJA 1I7UB 3UP1A 3ZYOA 4OGXH 1XIWD 1B0RA 3NIDE 2VLKB 2UVFA 5E95B 4YNYA 1A7QL 5LXGH 3CX2A 3LS5L 1E6OH 4WTXA 5IHZA 4LVEA 5B38B 1UQSB 2EC9T 2DIJA 2LTQC 3EDFA 3H0TB 3O4LA 1J1PH 2H3NA 1I3GL 4P3CL 3UTPE 1FE8L 5IK3A 3OKKB 4CVZB 3ARWA 3G6DL 1JBJA 1Q38A 2ZZUT 4M6OH 1J86A 3BPLB 1KV3A 4GG6F 1CBVL 4K9EL 4LDOB 3ES6B 2YD9A 3GSQB 2QKIB 4NHUA 4P5TC 1HHKA 3HLAB 4YXLH 4Y5XB 4JKKA 5GRJH 4RFNC 3EBAA 1DQQB 3NA4A 5HYJE 1JTPA 4QRRB 3VDCA 4ALAH 3MA7B 1KCVH 2ZG2A 3ZE2F 2BVUA 2SEBB 1TVDA 5C9JB 4Z7OE 3QCUH 3E1F1 3CU7A 4PJXB 3FOMB 3L3HA 4QEGA 3EW3B 4QGYA 3P11L 2VABB 1RMFL 1IJ9A 2V2XA 1ED3B 5DRNA 5GJTH 2R29H 1NBVL 1C5BL 1YPZF 1G7JB 2BY0A 4JN2A 1KJVB 2BY1A 4ONGL 5ESAB 3GSWA 1I9JH 1T4KA 1JI2A 3QXVA 5IVZB 4HW6A 3TA3C 5HYJD 15C8H 1VFUA 4U1KA 5TPWH 2M1KA 3MRIA 4OGAC 4OFIA 1KC5H 4XCFH 1NAKL 3IDGA 4LLAA 3MLWH 3EOTL 3PWVB 2QQKL 4WFHD 5GGSB 1M6OA 2P5EE 1MRCL 1QSEE 1K2DA 4K3EH 4MYWB 1T0MA 3T8XA 4IJ3B 3THMH 3Q1SH 3P4NB 1NMCC 3C9NB 4FNLL 3JTTA 1S7TA 5GQBA 2GKIA 3F7YA 2NXYD 4DEPC 4XP9L 2P8MA 5DA4A 1T7XA 1CFNA 3EHBD 4U33A 4HXAL 5DYOB 5IG7B 2ICWB 4FXGA 5B8CB 4M8QA 4FZEL 2JJWA 4GG6B 3PNWA 2G60L 2P5ED 2J1KA 1QSED 3GEWB 5HHOB 1RZ8B 4AEIH 1BLNB 4KZEH 3OHXB 3L3OA 5T1DL 1SHMA 2AEQL 4PRAA 4YQXH 4BFGA 4XMPH 2OX5A 2BMKA 2X40A 5KAQG 1A6ZB 2RFXB 3DUHA 1P4IL 2WZPD 4O2EB 3DRQB 4UDTB 5EOTA 4UILL 5E94A 4MNGA 2D7NA 3EYVA 4MVBD 1XF4A 1Y6KR 1ZA3B 4OJFH 1HHHB 1N3NB 2AGJH 5BXFA 3KJ6H 1DBJH 2FZ3B 5IQ9B 1PG7X 4EUPA 1NSNL 5EBMB 2GITA 3OAZH 3S5LB 4NFDA 3IU3B 3HZMA 4YDIL 3I85A 5F9JA 3VXTB 5GS1B 5E8EA 1JNHB 1DVFA 5HYJA 1RUKH 1KN4H 4HF5H 4ZTPL 4O9HH 4ORGB 1JGEA 1GGCL 2R1YB 4BFIA 2ARJA 1CFSA 5CEZE 3DMMC 4IRSA 3ULVC 3UYRL 3HAEH 1VKXB 1EFXB 4KV5E 2FIKA 1IFHH 2ATKA 1ITCA 5A1AA 3AREB 4YHLL 3BMWA 1E28B 4ETQA 5ISZD 5CINL 4OZ4A 4PJBF 4PGCB 1IEAB 5JMRA 4NQEB 2RCSH 5KVDL 4RDQF 4ZS7L 4BZYA 3GIVB 3LPWA 3LCYA 9CGTA 4J6RH 2J12B 1MWAL 4FP8L 4PLJC 3QA3B 2AABL 1V7MH 3ILPA 4GS7C 1GHFL 5CIPA 1GXEA 3VWJD 1IQDB 3I02A 1JF1B 1FL5B 5CEZD 1LE5A 2NNAB 4W4OA 1PY9A 3FN0H 4DKDC 4QHLA 5IIEB 4TVPE 2HVJA 1QSEA 3QXDA 4YZFE 3IJHA 4WUKH 4XBEH 3W82A 3O8XA 4L4TD 4MD0B 1OD7A 4NWUH 1I8KB 1NUGA 4LLQA 2YPLE 3BHBB 4HIHB 4H26B 5I8OH 1V7NL 2XKNA 4MXWL 1U8NB 2GSIA 1X44A 5F9WB 4F7EB 4NP4L 1TZHB 4B5EA 2Y07H 1FNEB 1I9IL 3UZVB 1D5MA 5DSCB 1QUNA 2ZSWB 4FFVD 1JHLL 4NT6A 4KDVA 4PB0H 4F3FA 2GCYB 1CXKA 3PV7A 4JZJA 3ZHLA 4E0RA 2UYLA 5E8PA 1BQUA 2NY0C 3MLZL 2VLMD 4LIQE 1QLFA 3JUYA 2YPLD 4HKJA 4RISL 2X05A 2Y5TA 3LEVL 2IAMD 3GMNA 5GGRY 4WHTB 3SOBH 3BH9B 2HFFB 4LGPB 3O2VH 4ZQKB 4ZD3H 4V2CB 1N59A 4ZSOB 3E2HB 3ZDYE 1GZPB 3NABL 4GXVH 5CBEA 1QOKA 3T0AA 5DHVA 3WJJA 4HKXA 4M5YH 3U4BH 3KLHC 2C26A 4I4WB 5C3LD 1F4XL 1RZFL 4BSVA 4PRIE 3IB4A 2BFVH 4K3JH 5LQBH 3A6OA 4PJ8D 1JHKH 2D31B 4YEFA 1K3IA 2WWMC 4BYHA 1FFQA 4TPRL 2H2PC 4YGAB 1IAMA 5DZOA 2BCKA 5HHNA 3GHEL 4CMMA 1WC7B 4DGYH 1MQKL 3EDDA 1ZHLB 3HE7D 4JGMA 3C8KB 5LWYH 4DW2H 1CD0A 3NCJL 1J05A 3G04A 5SWSD 4KJYB 4Z7VE 3O6LL 4JFDB 2XTLA 1E0OB 5DK2B 3H9SD 4OKVB 3VWJA 2FJGA 1FNHA 4LSDA 1INQB 1UJTA 1KCSH 5I8CB 4IOFC 4PRID 5MEPA 4WI4A 1FG9C 5HXMA 5IB5A 4N0UB 4MB3A 4PBXA 3MJ7A 4L8DB 5FKPA 1WISA 3OAUL 4M4PA 2BNQB 1HH9B 2A6KA 2OZ4L 5MEND 2C1OA 4JHAH 2AK1H 3LKQA 3UTQA 2E8YA 3IF1A 1MOEA 4UV7L 3MV9B 4NFBA 1OLZA 1KNOB 3CX5K 2NY1D 2AI0L 2YZ1A 4TNVK 4RMVA 2R4RH 1K8DB 2BDNH 3S96A 3CFEA 4K07A 4OGXL 3R1GH 5I71C 1XCQB 4KKNA 4AQOA 3L6FA 1HSBA 3LZFH 4HWBH 4JM2A 4UTAH 4G8FA 3TGXA 4JDVA 2YPLA 4PP1D 2C5DC 2CR6A 3I75A 1Q0XH 3W9DA 1J1PL 5EZOH 2XICA 2DYPD 5FA4A 3HC4H 2EE6A 1CLCA 2LU3A 1LDSA 2XNAA 3AB0C 2R0ZL 2ZUSA 4MD5A 1U95A 4Z0BL 5BQ7B 3GSXB 5ADOH 2MKWA 3QXTA 1CD1A 3HE6D 4X98B 5FYKE 1MFAL 5HGAB 3ZYIA 3L7FA 5GRJL 4J3XA 2MHAA 2F15A 1S7SA 5D8JH 1MY5A 3MRGA 5DWUH 4QTHB 4FFZL 2IBGA 3IFOB 3VXSB 2L7JA 5F88A 4MJ5B 4FQPA 4OF0A 4UV4H 3WL9B 4AT6A 4DZBA 5GJTL 4HS6B 1DVFC 4PRIA 4FQQA 2APFA 1DJSA 1AGBB 1RZIA 2VDQL 4WRLA 3NGBC 2AJVH 1N26A 3QUXB 1R5IA 4IRSC 4K8RD 5F6IB 4Z7OF 5JDSA 1XZ0B 1KC5L 4XCFL 1ZHNB 4JB9H 4UOW1 5D1ZA 1KB5A 2NQCA 4Z7VA 1RQ5A 5HYQB 4ZFOB 4H8WL 5GRYA 4JZOB 4G42B 4FFYH 4GW4B 4MLIA 3VFRA 3VFGL 4QT5A 1CIUA 2R2EA 4K3EL 4IOSD 1BD2D 3ZO0A 4UT6L 1U8PB 4GBXD 3HC3H 3WFBH 3TF7C 3Q1SL 4OD1H 3V7AG 4N8PA 1F90H 2BOCA 4P46A 4NKDB 1F8TH 3V4VH 3W39B 3U0WL 1Q9WB 2OQJA 1SYSA 2PW2A 4W4OC 1CGXA 1CK0H 5CLWA 5LGJB 1GGIH 1AQKH 3O8XC 4L29A 2PYEE 1N6UA 5JORB 1CYGA 1YEJL 3HB3C 4KWUA 1AKJA 2R1XA 3AGVA 5J8OA 1FDLL 2I9TA 1QFUH 4ERSL 3T0WA 4ZG1A 4YQXL 3K1KC 2H41A 4EOWH 3D39B 1OAYH 4MVBC 3EGSA 4FQ1H 1QP1A 1ZGLP 3GGWA 1YUHA 5J12C 1SBBA 4WCYH 3S36L 4JZJC 1IQWH 4HPYL 5HGHA 4PS4H 5GISH 3RBGA 1VACA 3RNKA 2AGJL 2PYED 1DBJL 4NKQB 2YK1H 4PJ9A 1NGXA 3T4YB 5C0BB 2A74B 3OB8A 2UWEB 2X6MA 1E4KA 3AMKA 3L95B 2XWBB 5AYUH 5I8EB 3BPOC 1J0ZA 1ZTXL 3F58H 3GM0A 5KVFH 1R3JA 1WV7T 3IRPX 4GKSA 1XF5B 2ICWJ 4DUVA 1MVUA 1LQSR 2BC4A 3PDGA 4U6YB 1RUKL 4HF5L 4R90H 1ZHKA 2VXVH 3WJJC 3D3VB 4QCIB 3BWAA 3ULSB 5EFIB 4OZIA 1DR9A 4YC2C 2ZCLL 5D93C 3QG7H 1OGTB 4IS6A 3SDAB 5KSAA 3M07A 4CBPA 4TSAL 1OF2B 3VGBA 4G43B 1IFHL 5LGKA 3T77B 3H3KA 1FBIL 1KFAL 3CK0H 1S9VA 3S8WA 3ZLQC 2BRQA 1XT5A 3ARRA 3CUPB 5HI4D 4P4KD 3RX7A 4F7TA 5KSVA 3VWJC 2D4DA 3ROOA 5K9KB 5DR5H 4O2FB 1V7ML 1H5BA 3QQ9C 2P46B 1F42A 2HJLB 3DX7B 3MSPA 4KV5F 5IQ7H 4HPOH 1BHGA 5KSBE 2BVEA 4X4ZA 4XBPB 2ADJA 4NKMB 5FF6B 2D3VA 4GW1B 3ZKMD 4BQCA 5E08H 4ODTH 3D0LA 3SDYH 4WUKL 4OLVH 4XBEL 1SVCP 4NWUL 2PF6A 5IBLD 3KPPB 5I8OL 4RGND 4P4RB 4FFVC 3ARBD 2VQTA 2Y07L 3D2UA 1TMCB 5EG6C 3I3BA 4RMRA 4PJ7E 4XPTH 4PB0L 2EEBA 4JM2C 3G6AA 4WFFE 3MRRA 5DMJB 1G6RA 1GH7A 1S9WB 2DS4A 1F4YL 3OKMB 1IM9B 1MCLA 3FFCA 1Q9LB 4NZTH 1QBBA 3H9ZA 4P3DB 2FX7H 5JNYA 2EEDA 2X1XR 1P1ZB 4MJ6B 1JV5A 2VDMH 4CVUA 3O2VL 2ENYA 1F97A 1S7WA 2HFGL 1GYAA 1UJ3B 2PYFA 3SDCA 2D7OA 1JYXA 3TBWA 5CEZH 5LKNA 4JY4A 4ZFZB 2R23A 1FZMB 2APVA 3AU1A 4M5ZH 1FIEA 5ISZB 3BKYL 3QUZB 4K3JL 5LQBL 3BYYA 3VFOB 1JHKL 2EDNA 3BO8A 3V7AE 4I3RH 2ZKHL 5BRZB 8FABA 4P4KA 5T33H 1F2XK 4YAQB 5DJ0A 4QRRE 5D6CA 1NGYB 5IOPB 3QWQB 3CSYA 5T1LB 4DGYL 5CEYB 5IB4A 2X9XA 4DW2L 3I3EA 2X41A 5J4MA 1U3JA 3QDJE 3GKZA 1GSMA 3ZDYF 2BVPA 2YD8A 2X4SA 4PJXE 1FVDA 1H3PH 5BJTB 2Y6SD 2R1WB 3KJ4B 3LIZL 4ZDHA 4KK9D 3PHQA 4U6XB 3UBXA 1NEUA 4R97C 1I3UA 2BVOB 4IMLA 2FBJH 3DPBA 5DD0H 5CGTA 5C9KA 2XWTA 4WI9A 3TBTB 1LVEA 2AK1L 5D1ZC 3HPLB 3TN0D 1BIIB 4TTDD 3ARBA 1ES0A 2Y36L 4ZPVA 4OLWH 2BSRA 3MLVH 5C0CD 2A2QT 2R4RL 3QDJD 3BE1H 5L0QB 2BDNL 4P2CG 5E1HB 1ZWIA 4KDWA 5JXAH 4LF3B 5KSBA 3R1GL 3ZYJA 5E2TH 4JFQB 1MLCA 1NLBH 4P46C 4OV5B 4PRDB 4PP1C 5I1IH 4LP5A 3LZFL 2CGRH 4HWBL 2E7LA 2X4PB 5CWSB 2XZAL 4LIQH 3RWCA 2DL9A 4OLUH 1CT8B 4PJFB 3IETB 5EZOL 1IGFH 1SVZA 1R0AL 3HC4L 4XP4H 2AJSH 2VH5H 1S9YA 1YEHH 3QPXL 5J57B 3GMMA 5C8JB 1C08A 3FT3A 4PJ7A 4X7EC 1I7UA 4RMQA 4A6YA 2VLKA 3JXAA 1A2YB 1PX4A 3S3PA 3NIGF 2APTA 5K9JH 3FAXA 2VR5A 4XWOD 4MNQE 4NSKB 2HKFH 3WNOA 1OGAE 2VXTH 4Q0XL 5T1KA 3SCMB 4YDVB 2X7LB 3QDGD 1YEEH 3VGHA 5A2IH 5SWSB 1UQSA 3H0TA 1JNNH 5D8JL 5FA3B 4PJ9C 4CVZA 5DWUL 2J8UB 1E4KC 1BZQK 3O6FD 3C09B 3MLYH 1EBPA 4ZFOL 1HYSC 4MB4A 3VD4A 4LNRA 4FMFA 3GSQA 5CSBA 4K8RC 4YXHL 1A0QH 5I66B 1RUPL 4QF1B 2A6IB 1KLUB 2PTUA 1OGAD 2Y1VA 2AJVL 5I1EL 5KSAC 4QRRA 4Z78B 5FM5O 4BH7B 3MA7A 4P2QE 2VOTA 3T0VA 4JB9L 5C9JA 3QDJA 3OGOE 2XI9A 4PJXA 3B83A 4G3YH 3FOMA 1I1CA 2FLBT 4KVNL 3FQNB 4FFYL 1D9KB 4P9MH 4JKWA 2J3SA 4F8QA 4HWEH 1I1RA 4YFLI 3QIBD 1ED3A 5HY9B 1G7JA 3KPLA 2ZPKH 4NQEE 4OD1L 4HULB 1QBMH 1KJVA 2IALB 4YDJA 1H5BC 2CIKB 5ESAA 3V4VL 1QFWM 2A9MH 4Z7NF 3VFPB 5JW4M 3KYOB 3ZKND 5IVZA 3OKOA 4Y4KB 3B5GA 4B50A 3AC0A 4NQVB 5LBSL 4P2QD 4JQIH 4PYGA 2X4RA 1AQKL 3BYTA 3PWVA 5GGSA 2G9HB 5E2VH 2NLJA 4JRYD 3UEZA 4M1CC 3WNLA 1LEGB 1DEDA 4BQ9A 2NY6C 3LH2H 4M7ZB 4V1DD 1MFCL 4XHQA 1QFUL 2ED8A 1OTSD 5JW3H 3SO3C 4F7MB 3KPRD 2VZVA 4U1IB 2VL5B 1OAYL 4KJWD 4K8RH 4YHZH 3R8QA 1PJ9A 2UVEA 3EZJB 3PWUB 1UCBL 4WCYL 1UKQA 3UX9B 4PS4L 1P7HL 3MRQB 1KJ2B 2YK1L 5EC1A 5CBAA 1KB9K 4M43H 4R9HA 5CMAA 1RZ8A 1LEKB 2QSCH 1BLNA 5AYUL 5DMKA 5F7KC 2VAAA 3BEVA 5CCKH 5JW5B 5E9DE 2H32A 3MJ8A 4MNQA 3OHXA 4ZXBB 4UIKL 4NCC1 4R26H 1OGAA 3FONB 3SDCC 3MUGB 2AXGB 1A6ZA 4YHIA 2XA8H 4O2EA 1NMAH 1RULH 4UDTA 3QG7L 5IW6B 1ZA3A 2WIIB 4Z9KB 1HHHA 4Q6YA 5HI4C 1N3NA 4KTYA 3CK0L 4P4KC 2FZ3A 1A9EB 5F1IA 2V7NA 1BVZA 5EA0H 3FOLA 3QIBA 4MQXD 4R96B 4JE4B 4WI5A 2NY7L 4PLOB 1HNGA 3L3GA 1XGRA 3KG5A 5E9DD 3FB8B 4X7DC 1L9NA 5DK0A 3VXTA 3I6KB 5GS1A 4WFGD 3OMZA 1JPST 1WCBB 1CLOH 2EDWA 1W0VB 3VG9B 4P2QA 5CP3H 5AD0B 3FRPG 1S5IL 4HPOL 3OKYA 4QXUL 3QHFL 3QSKB 2UUDH 5GHWL 5DDHB 1VKXA 2QJDA 2IPKB 4JREC 1CICD 1G6RH 1SEBB 5IBLC 5E08L 3KYKH 1A6WH 1ZLVK 3P4OA 3WUWB 4FABH 4MDJB 5IWLA 1WBYB 2DI7A 3ARBC 4LHQB 4PGCA 1IEAA 1YYMH 4NQEA 3CFDB 4XVTL 2H8PA 4YHKH 1MJ8H 2YUXA 3GIVA 1ACZA 3MV9E 5DD3H 3QA3A 3L3IB 4P23D 2IEPA 5D70H 1OTTC 3S3SA 2HJKA 1MRFH 5DFVD 4OCNC 4I0PD 1JZ6A 1IQDA 1JF1A 4XPTL 5E8OA 5E8NB 1FL5A 2E7LC 4OBRA 3MXWL 2NNAA 3U1SH 3BT2H 4ZNCD 4P9HH 3BGAA 4L1DA 5BV7B 5FYJU 2XQBH 1OAQH 4L8SB 2CK2A 4MD0A 4NJAH 4RX4D 3MLXH 1I8KA 1YN7B 3LOWA 3BHBA 4XVUC 3WMSA 4H26A 1K9TA 1JJUA 2P1YA 5FCUL 3CH8A 2AEWA 5IMLB 5JO5B 3X12B 3MOBH 2NY4B 4AMKL 3IFNL 4F7EA 3P73B 2VDML 1TZHA 2Z35B 4OCSH 1FNEA 2Q3ZA 5DSCA 4QRQB 2ZSWA 4NKIL 4M1GH 1KB9J 4Q74A 5D5ME 1I1AB 3X3GL 2EDFA 4MS8D 5C7XL 2EYRB 4M93B 3EYUH 3FFDB 5F89B 1HKLH 3VXRB 2YRZA 4I3RL 4P5KA 1CDUA 2DQHH 5E03A 5E9DA 4WHTA 3N1FC 3FO1B 3TC9A 2HFFA 3BPLC 4Y16B 3VW3L 1FAIL 4ZQKA 3MRDA 5C07E 1H3PL 1GZPA 2VL4A 2XTJB 3RZWA 4RFEB 3LDBB 4HEME 3GJEB 4YFDB 1JPSH 1S7RB 1G7IA 5HPMA 4RGNB 4G9FE 2LFGA 4N9OB 1DBAH 5I1HL 2D31A 2O61B 4G7VH 2W9DL 2AK4E 4U7MA 1UFUA 5F1NA 2Q8BH 2JIXB 4X6BB 1F11B 3UC0L 4C56D 2VR9A 4PJGF 3CXDH 3C8KA 3CH1A 4ACPA 4OLWL 5DC4B 1AE6H 2FHFA 1J0YA 2I24N 2R9HC 3BP7B 3BE1L 4JFDA 5C07D 4OKVA 2GTZA 3MJ9A 2VDRL 1AGFB 1LO3H 1IAIM 2B8OT 3OXSB 1BAFH 3HMXA 4HGWB 4A6YH 5E2TL 1NLBL 4PJCB 1JFQH 1CQKA 4OB5H 4KTEL 4PJHB 1V05A 4G9FD 2BSED 4TRPH 1HH9A 3OF6D 3HNTH 2AK4D 4S11A 4OLUL 4XPBL 5LCVH 1CXIA 5IBUG 1YJDH 1IGFL 3MV9A 4G7YH 1MCOL 4NN7B 3PGCA 1ZEAH 4XP4L 2AJSL 5F7MC 4X6FB 3RZCB 5JW4Q 4JANB 1KN2H 4HS8H 5L2KB 1K8DA 5IFHH 2HMID 3O11A 1MCQA 1HXYB 1QPPA 4C83A 1JYWA 3CLFL 1N5AB 1P69B 2R15A 3LKRB 4EZMA 4HKZA 3BEWA 1C7SA 4J4PD 3LRSB 4XXCA 2HKFL 1NANI 3CLEH 5MEQA 2VXTL 1Y6MR 3BUTA 5GS3A 4HUKB 1A47A 1XR9B 1KG0B 3WEXA 5I0DA 3MRMA 4L5FH 1BQHB 3EJYD 4DKEL 1I1YB 1VADA 1G9MH 3CMGA 5DEGB 3CPLB 2X4NB 5F96L 4NNPH 3UJTL 2DWDB 1KJMA 5GRUH 3X3FL 1P5VA 5BO1L 3MLYL 5D5MA 5BQ7A 1I4FB 2UWEE 1A8JH 2GJZA 4S2SB 4X98A 1A02N 5HGAA 2IQAA 5F1OB 3MLSL 1IGML 1Q72H 4D8PB 3IDXL 2GSGB 1BGXH 4C4KT 2DLEA 4PJGB 5C08B 1EGJL 4NBYB 3F65A 3UJJH 3IJSB 3V0WL 3HUJB 3IKKA 3QIBC 4G3YL 5C2UB 4OFVA 4NC0B 3IFOA 3S97C 2MPAH 3TO2B 2FEDC 4HWEL 3WL9A 3ZKNC 1QHPA 5GS1C 5IP4A 4HS6A 1MCDA 5DJZB 1QBML 2P5WB 4G9FA 1AGBA 3TBYA 4GW5B 2A9ML 1NGWB 2NX5E 3D0VB 4PRHE 3OF6A 1PYWA 1RIVL 3DLQR 2P8LA 5FAAA 3BDXA 5T3XD 4QNPF 4JQIL 4JRXD 1NBZA 1WK0A 4N1EA 5IWLC 4K7PX 4KMTL 4QWWC 2XXMB 3OJDB 4YHYB 4GW4A 4Z5RB 5L8LB 3U9PL 2H32H 1AD9B 1CR9H 1S9XA 2NY5H 4AJ0A 4NKDA 1TLKA 4I5BB 2B1AL 1HSAA 5FO7A 3TNNB 2NX5D 2XZCL 4PRHD 2F74A 4YHZL 2YPKA 2BSTB 5TDOB 1Q9WA 4KY1H 5K9OB 1I7RB 5LGJA 4UB0L 1PKOA 4P2RE 2BSSB 1IRAY 3P0VH 5JORA 2ZJSH 2DLTA 4NO2B 1K6QL 1FYHB 3QT2A 1IGCH 2FX8L 5F9WC 4KKCD 3JWDL 1E4WH 2PTTB 1BOGA 5DJCA 3V8CA 4K7FA 4U3XA 3BUYB 2WV3A 1FC2D 2XA8L 4MAYB 1TFHA 5DJ6B 4U3HA 1UXSB 1RULL 2X4QA 3UTTB 4RMSA 2V17H 2AJ3B 5CFHA 1IGJB 1WFNA 4P2RD 2CRZA 1DTUA 2A74A 1OPGH 2E6PA 2UWEA 3JTSB 4MCYB 2IQ9L 3L95A 1UKSA 2XWBA 4R0LA 2IF7A 5I8EA 3RU8H 1XF5A 1J8KA 3BP4A 5A2LH 3B6SB 3E2HC 4AEHH 3FRUB 4OKDA 5TE7L 1CLOL 3D3VA 4QCIA 4WTZA 3Q6FA 4HZLB 5EFIA 3BZEB 3MCLL 5EU6D 4E42B 3JBG7 1BQSA 1A7OH 1N8ZB 1U3HB 3O41B 3SDAA 2FB4H 3KVQA 3FT2B 4X6EB 1M4KA 1OF2A 4KGJA 3S37L 3IKCB 4G43A 3GIZL 1NDGB 1VENA 3QBTB 3T77A 4OUUB 3SKMB 1HCVA 2F54B 3VCLB 2X44D 2ICEB 4FABL 3MLRH 4Q7DA 3FTGA 4HFUL 3D85D 3CVHH 5B21A 3JV6B 1FRGL 4YHKL 3OWEA 1MJ8L 2EDTA 2NX5A 4PRHA 5K9KA 2YSSB 3GMPA 4YBHA 4O2FA 5D70L 3B2VL 1ZANL 1MRFL 2K9UA 2HJLA 2HT3D 3DX7A 1HHIA 3BVNB 2CLZA 3BWUC 5J6GA 1YC7A 5M94B 3QQ4B 4RIRB 3U1SL 3BT2L 2NYYD 5FF6A 2ERJC 2YUVA 4GW1A 4MQ7B 4P9HL 4NHCH 4PJEE 3QPQD 2XQBL 2YEZA 3FQWA 1U8QB 3CFBA 3LN4B 1FGVH 5GS2D 3MLXL 4X9HA 3DXAD 1NPUA 1YY9D 3L3DB 5TJWK 3MOBL 3O0RL 3EOBB 3O81A 4PJFE 5EO0B 4FQXD 4Y0GA 1JRHH 4OCSL 5CJOH 1N6QH 3DJ9A 1AXTL 1Q8MA 1N6VA 3EOYG 3FB5A 3PGFH 2EIZA 4XNQB 1T20B 4TULH 4BZ2L 3VU2A 1I8MA 4UI2A 4XXCC 1T6VN 4IRZL 5B3NA 3A67L 4YR6B 2Y9RT 3EYUL 4JFEB 2F58H 5KVGH 3OKMA 3S6CA 1IM9A 3VMNA 1MJJB 1Q9LA 2GK0B 2DQHL 4P3DA 3N1QC 4BA8A 1CGYA 1M7IA 4H1LG 1P1ZA 4DVRH 5CKAA 3CSGA 5CHNB 4JFFE 3QUMB 2APXA 3BD5A 1PLGH 1ORSA 1UJ3A 1CICB 3BRFA 4U6TA 2HLFD 3MJ9H 4LSUH 4ZFZA 3HMXH 3SQOH 5IEHB 1FZMA 5TGBA 3KXFB 3B9DA 2BNUA 2F53B 3NFPA 4PR5A 2J4WH 4W81A 4EDXB 2AJUH 1RVFL 3PGDB 3VGAC 4JR9H 1NGYA 4NRZB 2NW2B 5IOPA 5T1LA 3RX8A 3CXDL 5CEYA 4XNXH 4KI5C 4XX1G 4QHUB 8CGTA 5FDWB 1VEPA 2HT2C 4JFFD 3NCYP 4M9OA 5EU3A 2VMFA 1W0WB 4CVWA 2VJXA 5BJTA 2FNBA 4F9PA 3UTSD 2R1WA 4JDZB 4WW2A 3WBDA 4HX1B 4OB5L 4U6XA 1QBAA 5DVMA 3LVEA 1QKZL 3QUXC 4P49A 1EZVX 4K71B 5GZND 1GZQB 3TBTA 1XF2B 1KEMH 5JPMA 3HPLA 1BIIA 25C8L 1TZGL 1BBJB 2I25N 2CDGA 3LV3A 5TH2B 2OXHA 4M6AA 3V5KB 3MUZ1 1TITA 1KN2L 3U9UA 4BSWB 4HS8L 5CD5D 5IFHL 4JJ5B 4G6KH 4CAGA 1PD6A 4LF3A 3TVMD 4M8VA 2XN9E 4M9PA 1CFVH 5J13B 4JFQA 1RIUH 4OV5A 4PRDA 1WBZA 5HGBB 5JQ6L 4PJEA 4PJ5E 2X4PA 1DN0A 5CWSA 1MHPH 1GGBL 2WBJD 1NCWH 2ZCHL 5IVNA 1L7IH 2Z31B 1WITA 1DDHB 4L5FL 4ELMB 1CT8A 1X5JA 3DVNA 4PJFA 1G9ML 2MWCA 4NNPL 5F7LB 5IMKA 5E8DH 2D4FA 5DUPH 4HHAB 3L5XL 3ZE1E 3REWB 2M8XA 1YECH 1BFOA 2XN9D 2F5AL 4KJPC 4LSSL 2WBKA 1XGUB 3NVQA 4PJ5D 4NSKA 3SE8H 1A6AB 1RZKL 1AO7B 4YO0B 3SCMA 1Q72L 1XCTB 3CMOL 5DEFB 2IH3B 4U0RB 4WVRA 4LARL 1FGNH 5F70A 5DJ8B 5FA3A 4I3SH 4JFFA 2EIEA 3LEYL 1I85A 1V8HA 1J0IA 2J8UA 5SX5K 5GZOD 1MHHB 1HOCB 3GSOA 2FD6L 5BW7A 3FB7B 2MPAL 1F4HA 2CH8A 4TTGA 3L3JA 4TQEL 4BQ8A 4XWGH 3KGRA 2VAJA 4U1SB 1E4XH 1FZKB 3T2QA 1J5OL 5I66A 2A6IA 4B41A 1J8HB 1QHOA 5EBLB 5HDBE 4CL7A 2CKNA 1UM6L 5BVPH 3VFTA 4RBPK 1XGPB 4POZC 3SDAC 4Z7UF 3VGGA 4FFWD 3WS3A 5MP6H 3JV4A 4Z78A 3C6SB 5E6IB 3GSUB 2HTKC 3RVTD 1BIHA 2KDGA 3V5DA 2YD2A 3P2TA 4S1DD 2HVKB 3EYOA 3MTRA 5SWQB 2X4OB 3FQNA 3TVMA 1D9KA 4TNWF 3DUSB 3CZFA 4RWYH 4WHYG 3TBSB 4KROD 4KI1A 2XFXB 3D87B 5C0JB 5F7WC 2NTFB 5ID0B 1PGRB 2NY5L 5C0ND 3QJFB 3VFPA 2PO6B 3KYOA 1AQDB 2VLJE 4WI7A 1NJ9B 1QQDA 4GKZA 1ULVA 5I8KH 2XZQL 3S4SB 3F6IA 4X80L 4X9BA 3LN5A 2XACC 5I17B 1EO5A 3P0VL 4KKCC 2VXQH 2ZJSL 3X13B 2ESVB 1LEGA 2WUCH 1W8OA 3QZWG 4PJ5A 4XI5D 2X4UB 3QXUA 3D25B 3V6FA 2VL5A 1DQDL 2A6JA 1JZ8A 5IFJA 1RURL 4LDEB 3U30B 5I2IA 2VLJD 5T3XH 2JLLA 4XX1E 1R3IH 2IBBA 4Z0XB 4EQ2A 4F58L 2Y06H 2DTML 1JGVL 1AC0A 3TT1H 4CNIB 3MRQA 4OFYD 1KJ2A 5C0FB 3KS0J 4DUWA 1OPGL 5DUBB 1LEKA 2HWZH 3H7LA 1A14L 2G75A 4ZXBA 4MHHG 2NCMA 1UJ3C 3MUGA 4KRPD 4AEHL 3BQUD 4Y5YA 3UO1H 3RIAK 3ARFB 2F5BL 4OAWB 1UZ8B 2A77H 3CFCH 1ZLSH 1A7OL 5D1QD 3STZA 2V5YA 2XTJE 3MJ6A 1DBMH 3BXNB 2CR3A 1JNJA 4QY8B 4R2GD 5KVMC 4FRWA 2IMMA 4AL8H 4R96A 1WSST 3CVHL 1M7XA 5T5NG 4Y4FB 3T0ED 3W2DH 4APQB 5AUMA 2A0LC 4KFZC 2ILLA 5EOQH 4PRPB 4X5XA 4WU7B 4YXKH 2DTSA 4F9PC 3EDKA 4WFED 1WCBA 3WSQH 3KJ4C 4OSUL 4WW2C 2NYYC 4LBEA 5JR1H 1W0VA 4BFEA 3T1WA 5AD0A 2I26N 1A1OA 1OSZB 2YD3A 3QPQC 4K3GA 4U1HB 5DDHA 3QEQE 3E8UH 3X17A 2IPKA 1CGSH 4PJCE 1T0NB 2RGSA 5GS0C 3O9WB 4PPTA 1KIRB 1YY9C 4WI6A 4FA8A 1FGVL 3RL1A 5ESQB 3GK8H 1C1EL 1CLYH 5I19L 5JA8B 1WBYA 1QFPA 1T22A 2XIDA 4MB5A 3CFDA 3VXUE 5KS9B 3N0PB 5IB1A 2O26U 3K8MA 5FGCB 4E5XB 2GJ6E 3N1MC 1JRHL 4H1LA 3L3IA 5CJOL 5HHME 4LFHD 1ZV5A 4OZHE 4RGOH 5F93C 1EMTH 4RZCB 3U0TB 2X89A 3QUML 3QFJB 5D7JD 3QEQD 4YBQD 4OFYA 1P4LB 3IVKB 4R7NB 1NAMB 2F58L 3RGVB 4LCWD 1M05A 1VEOA 1YN7A 4XPGL 3LQZA 3FZUC 4QXTB 5H35B 5I76A 1QVOB 5IMLA 3VXUD 3N85L 3X12A 2Z8RA 1SBSH 4LP4A 5DLMH 5EU6B 3P73A 1RIHH 2GJ6D 1EHNA 4L1HA 3T2OA 3TCXA 4BFBD 5HHMD 4U1GB 1PLGL 4GRMB 3SN6N 4D2NA 1BFSA 4LSUL 2L4OA 4QRQA 1CGVA 3K3QA 1A4KA 4UNTA 1I1AA 2P8PB 2EYRA 1S78C 3VXOB 4OFPA 3SCMC 5F89A 4PP2B 1VGKB 5GS2H 3ARGD 5EWIH 1MVFA 4EXKA 4I3GA 2EO9A 2AJUL 1UWGL 4KK8D 5BS0B 1B2WH 4JR9L 2D9QB 4LOUC 1I85C 1I8LA 5C08E 4WJ5A 1FN4A 4XVSL 2CRMA 4XNXL 1WAAE 4MSWB 4NQDB 1FSKB 4TSCH 5BW7C 5K59E 1QO3B 5FUCE 3HUJE 1INDH 2KPNA 4QRTB 1VFAA 1YEIH 4ZUUB 4JFXB 4G8GB 4WUUE 3GJEA 3JZ7A 3DXAB 3O6KH 5FO8B 4QRPE 1B3JA 3RPIB 5B3JE 4OCXL 2YD7A 4HWUA 4PGBB 3O6MH 1KEML 1NFKA 2JIXA 4X6BA 1F11A 4DCQB 3C2AH 4F37K 4J3VA 2BP3A 3QULA 5FECB 5CD5C 3EYQD 3TVMC 1B88A 3H6JA 3ARDB 1D9KC 3MGOB 3TZVD 1I9EA 2HJFB 5ETUA 3QNXB 5A3ID 1YQ2A 1NCUA 3FCTB 1DBBH 5D7JA 1Q9OB 5CJQH 5HD8D 1CFVL 1FNLA 2ZUQB 4K94C 4PJCA 3O3AA 4MNHA 5HVHB 2KZWA 1FFOB 3GB7B 3U36B 4XCEA 1MHPL 1BVKB 4QRPD 2Q7YB 4CN1A 4QHKI 1BM3L 1NCWL 3BD4A 3FN3A 2L0DA 1LP9F 2V9TA 3VXUA 4WNQB 3DRTB 1KBGH 2BOBA 5A2FA 3MACL 2GJ6A 4PY7B 2GFBB 1A1MB 4S1RL 4X6FA 3RZCA 1V5JA 4JANA 2Q6WB 4PUBH 1II4E 3V52H 5L2KA 2O5YH 4M7ZC 1IKFH 1HXYA 4RQQB 2VN7A 1N5AA 1YECL 4GLRH 4OLXH 2VXUH 3LKRA 5FGBC 3BIKA 1IKNA 1XMWA 3EO0B 1NC2B 1DUZB 5TDPB 3SE8L 4ZFGH 1AGDA 1QSZA 1NH6A 2BNRB 1I7TB 1XR9A 1KG0A 3DYPA 1BQHA 1MELA 5GZOC 1M7DB 2E3VA 1XGTB 5DEGA 3CPLA 4I3SL 2X4NA 3ZE1F 5HGGS 1BFVL 1QYGH 2KUTA 4Z8FH 4DKAA 5GSVA 4ETYA 4ENED 1LO4H 2FSEB 3QI9B 1I4FA 4N8VB 4ZXBC 3GSRA 2ARWA 4LCUA 5I1LB 2C3VB 3VFVB 3F7VB 4S2SA 5I18L 1KOAA 2NXZB 2QSVA 3SKNA 4Y5YC 4X5WB 3HRPA 2EDRA 1RZGB 2R0WH 4LSVH 2WAHA 1M1SA 2A9NH 4D8PA 1I7ZB 4Z18A 2Y25A 3L7EB 4AZ8A 3ALWA 4NQCB 5C08A 4E41E 1WAAA 3WIFB 2VZOA 3TZVA 1MHEB 3JWDC 1R5VB 3HUJA 4Y4HD 3VJ6B 5ESVB 2OTPA 3VI4F 3TO2A 4NO0D 2WBJB 4WUUA 1P7QD 4X99B 3ZE0E 4AK1A 1SJEA 1TQBB 1XR8A 2Q86B 4QRPA 2IFFL 4PJAB 4GW5A 1OAKH 2DQIH 3QZWA 3RVVD 3D0VA 3VG9C 4OLYH 2Q76B 4OQTA 4AQ1B 3WUZA 2F19L 4DFHA 3KPOB 4E41D 5KTEH 5ICXB 1WIUA 4F7CB 4QRSB 3ALPA 3MBEB 2IG2L 1W72B 4P48A 2YC1A 3WKML 3OJDA 2VXQL 4ODHH 1HHJB 4Z5RA 1FC1A 1MI5E 1S3KL 4XI5C 1CQYA 1HINL 3INUH 4M00A 1MSPA 2FX9H 3K80A 3W0WE 2F8XC 4NQTA 2YZ8A 3ARQA 3GUTA 3BAEH 4I5BA 2AAVA 2P24A 4JLRB 1EXUA 2AS5M 2BSTA 1DUYB 5TDOA 4YHPB 2VQ1B 3G9AB 3F6LA 5T3XL 5K9OA 2C7UB 1R3IL 4JFHE 1HI6B 1I7RA 5BV7C 4ONHA 3TT1L 1X5KA 1Z9OA 4Y19D 4JFEE 1PG7H 1NCCH 3MC0A 4NO2A 1MI5D 1QFOA 3U7AA 4OTXH 2HWZL 1EVUA 2NY4C 5JA9A 3PQYB 3W0WD 1SY6A 5J3HC 1OB1A 2LAAA 4FQIH 5J6HB 3EO9H 5CEXA 4DWHA 2O5XH 3UO1L 5IR1B 4MAYA 1I1AC 5DJ6A 1UXSA 3UTTA 4J3WA 2A77L 3CFCL 5F72S 4JFHD 5KANG 2ADFH 4LLYB 2AJ3A 4D9LL 1N0XL 1IGJA 2GTWB 3QFDB 3W11D 4NO0A 4XNUH 5HJ3B 5A2JH 2FCBA 4MCYA 3M1BA 1I8LC 4OCWH 4QOKD 4G6MH 1KYOK 3W2DL 3C60B 5LGHH 3NZ8A 3B6SA 3IFLH 3MRJB 4H1LH 4YXKL 1MCRA 3FRUA 3TJEH 2DD8H 3WSQL 1T5XB 4DAGL 1YQVH 2XTJC 2VDLH 3BZ4B 5EN2A 4E41A 3BZEA 3LDBC 4G8IB 5EDXA 1N8ZA 1U3HA 3O41A 4P99A 3FT2A 3IKCA 4FQLL 1NDGA 4U1NB 3QHTC 1AI1H 4OUUA 5CD3A 2CUHA 3SKMA 4HK3J 2XKUA 1QPXA 3MV7E 3PWPB 4X6CF 3EYFB 3QWRD 3GK8L 4M02A 2AV7A 1CLYL 3QDMB 1MEXH 3JV6A 2NW3B 3PXHA 2VLRB 3F7QA 2A38A 3PWNA 1ZA6B 3DTXB 5SX4H 2GY5A 2FATL 4M6NH 5D7JC 5DJYB 4RGOL 3MZTA 4YGVB 4EI5D 2M26A 3HFML 2I5YL 3QHZH 4AENA 5A40E 1FJ1A 1IM3B 1IBGL 3QQ4A 5C0EB 1IILE 4RIRA 2FHCA 3F7PC 3TFKC 3I6LD 2OI9B 2E9IA 3LN4A 4HFWB 5KW9H 2YR3A 3MV7D 1XEDA 1LO5B 1X6LA 2XZZA 3G5YB 4JY6A 3CFJA 3W0WA 1ZT4A 3DX9B 3L3DA 1IAKB 1EEYB 4KGLA 4MJIB 3RZCC 4MZ2A 4ELME 3EOBA 5EO0A 4OZHF 5IT2H 1RIHL 3IFPB 2UZIH 2NMSA 3B9AA 2BHYA 2QQNH 1IKNC 4YJZL 2CK0H 5KG9B 1MFEH 4ZODA 3QEHB 1A6VH 4BELD 1G7MB 3BPCB 4JFEA 5DQDH 4NPYA 4PLNC 5EWIL 5IHUL 3U4EA 2GK0A 5CJBA 5EO1A 3BZFB 3KNBB 1B2WL 4FMKA 1MH5B 4HJ0C 3VRIB 2NTSP 1FO0H 1P9MA 4NDMA 1EHAA 1C16B 4D0DB 4YH6A 3ELAT 4PJIB 5GSRB 4TSCL 5CHNA 2CPCA 4PB9H 1INDL 4F15C 4PBWD 4HCRL 1LNUB 1HEZB 1YEIL 1GC1C 1UM4H 3LKOB 2IANB 3AUVA 4KQ4H 2XRAH 4G6FD 1T1ZB 1XGQB 3O6KL 4HMEA 3ZL4H 1G7HB 1BJ1H 1KYOJ 3KXFA 3T65A 3BRDA 3GMLA 4HZAA 4O5LL 4XC1H 1FAKT 5IKCA 4L4VE 4EDXA 5C6TL 3FB6A 3EYQC 4LSPH 1KIPB 3TZVC 3FL7A 3VXPB 3C2AL 3QJHA 5A3IC 4NRZA 1Q94B 5K59F 2DQGH 4Q2ZB 1F6FB 3GI8L 2Q7NA 4UMGA 5JOPD 4QHUA 5HD8C 4HUUA 1W0WA 4D0CB 5H2BB 3KLDA 4H88L 2VXSL 1DBBL 3P9MA 4LGSB 1A5FL 4JDZA 5CJQL 3EFDH 5IROA 3MODL 3V0VB 1AR2A 1MAMH 3TH2T 5C1MB 4ODSH 4ZOBA 3MV7A 1MCIA 1GZQA 4XTRD 4L4VD 4IIQB 3SDXE 1XF2A 3P77B 3IXAA 5FYLD 2LVCA 1KBGL 1MCSA 1MHCB 3ARPA 3WS6A 3VA2C 1QNZH 2FL5A 4YHYC 1WF5A 2UY7A 3V5KA 1FFNB 3MQIA 1ONQB 4BSWA 2GW5A 2O5YL 4JJ5A 4QHMB 5H94B 1IKFL 2EDBA 4YHML 2YS4A 2NY2B 2Z91B 5T5FH 2DKSA 3LSOB 4OLXL 4WU5B 5LAXA 5I74C 3MREB 1JZ2A 2XQYK 2VO5A 5JOFB 4ZFGL 3S36X 4XRCB 1I3RB 3B3IB 3HHRB 1X7QB 4Z7WF 2Z31A 4ELMA 1DDHA 3DIFA 2IBZY 3IU4L 5K9QG 3N9GL 2VDNL 4ENEC 1JUFB 5FKAB 3U7WL 3LKSB 4GRLB 1Y18A 2E9WA 3HI6H 4GAGL 2NR6D 3K2UH 4Z8FL 1QFWH 2JCCF 1RU9L 4OZFB 1NBQA 1IVLA 3C8HA 3NAAL 2CKBB 1FH5H 2CLRA 1QR1B 4MAYC 4D94A 5J06A 3I6GB 4YO0A 4DVBB 4KJQC 1J12A 1WICA 1XCTA 4XPFL 3EJZD 5DEFA 4X4YB 4OLEA 5DQ9B 4R7DB 2W60A 3ALXA 4LPTA 5DJ8A 3AM8A 3I84A 5GJSH 2EE2A 3TJHD 4G8EB 2YPVH 1RJYB 4POUB 1CGWA 3FB7A 3O2WH 1PQZA 1WJ3A 5TF1H 1TJHH 2E7HA 4WO4B 3OB0K 1G0DA 3RWGB 5L88H 1FZKA 1YNTB 2K7PA 4ZNEE 2Z93B 2R56H 1OAKL 2FYYB 5I30H 1J8HA 5EBLA 5KN5B 4L4VA 3SKOB 4JY5H 5AZ2L 3U0PB 3RKPA 1U3HC 4UQ3B 1BQLL 1TVHB 3C6SA 5EZLA 4FZ8H 2EEAA 5E6IA 4KKBD 2DQJH 5KTEL 1TETL 1F4WH 5DRWA 5CSZA 3SGEH 5E24E 1FLRH 4JZNB 3OJ2C 4IDLA 2HVKA 2EXYD 4GRWB 3GRWA 5SWQA 4CGTA 1JPFA 1PKQB 2X4OA 3ZE0F 3DUSA 2VKWA 2ITDB 4UDUB 4OIIL 4WWID 4D3CL 2NTFA 1SY6H 4NUGH 5L7XH 3WXVH 5KS9E 1MCJA 2XY2A 1QBLL 1CVRA 3BAEL 3QJFA 4YDKH 5FGCE 1HQRA 3SEPA 3SDXA 3R4DA 4LLDB 1QSFB 3MZGB 3ZKQD 1NJ9A 4Z7WB 2FWOA 5B39B 4NNYB 4DKFH 5AYQA 5SWZD 2BRRH 4HK0A 4OGYL 1ZLWK 5CZVH 3H3BC 4MXQD 5KZCB 4N0RA 1KPVB 3QFJE 4QO1A 3P0YL 5I17A 2JCCB 1PG7L 2J6EA 4PREB 4G9DB 1NUFA 3MRBB 1T89A 4OTXL 3C8DA 4XHJC 5C09B 1XH3A 3D6GA 4KUZL 4BM7A 1ODAA 2XQYG 3TT3L 2X4UA 3EO9L 4LCCB 2O5XL 3C08H 1REIA 1PAMA 4ODUB 4Z0XA 4Y4HB 3W11C 4LLMB 3OKEB 4Y2DB 5HYSG 1EEZB 3HR6A 4XMKL 4D0BB 2YUWA 5C0FA 2HFEA 2AJYH 1FNAA 5DUBA 1P9MC 1ZAGA 2ZOKB 1MY7A 2P49B 4G6ML 5BS0E 5LGHL 5L2JB 5ITBH 4L3AA 4Y88A 3IFLL 3TJEL 3VD7A 2DD8L 3UPCA 3ARFA 2EH7H 1YQVL 5IV2B 2VDLL 1ZGLM 1R3LA 3ZDXE 4LDLB 2BJMH 4G8GE 2PKDA 3KPNB 2ADGA 1EFQA 3BXNA 3KPSB 4KAQL 1MAJA 1EJOH 4CADB 1JZ7A 4I48B 3OGCA 4ZNEA 4LASL 2RJMA 3WHE0 4JPIA 3OKLA 4APQA 4X0KB 3RVWD 4ONFH 3G6JF 4QLRA 4WU7A 5JZ7C 5MERB 4H25A 3SPVB 1OHQA 4RA0C 1GJIA 1I1FB 4Y19B 1OSZA 2D2OA 3QHZL 4N5EC 5IROC 3FHQA 3EOAB 3MV8B 2ZCKH 4JO4H 4U1HA 3UTOA 4LLWB 3QIUD 3KYMA 4Y1AB 3OR7A 1T0NA 4EIZC 3F5WA 5KW9L 5ANME 4LSTH 2LU4A 3WS6C 3BDYH 3WNKA 4F2MB 5KS9A 2CRYA 3C5ZA 3FT4B 4X5LA 5IT2L 4M1DH 3DI3B 4E5XA 4HUNB 5D7KD 2AJZA 4WI2A 5F8QC 4LNVA 2Y4SA 5J13C 4KK5D 2QQNL 1AY1H 2VTFA 4LVHB 3BMVA 5ICZB 2CK0L 1ND0B 1X5IA 1IE5A 3NTCH 3U0TA 3DI2B 3REVB 5C70A 3QFJA 1IC5H 4LSQL 3WNPA 5F7EH 1P4LA 3IVKA 4R7NA 1NAMA 1K8IA 5DQDL 3HCVA 4JAMB 3RGVA 2WNGA 4UUJA 4S1QH 3JVGA 2Z31C 1TVBA 4P5TD 2BERA 2BNRE 2GY7B 1K5NA 4JHZA 3T09A 5H35A 1IAIH 1TTFA 3VGEA 5I1DB 2EO1A 4GG8A 4GRMA 3A6CL 3PP4H 1UM4L 2H2SC 4KQ4L 5I1AB 5L8KB 1I8IB 1WGOA 1IL1B 3R06B 3VRJB 1DE4B 2AQ2A 5FOBB 2P8PA 2IADB 1JL8A 4O2CB 4PP2A 3PWLB 4N9GB 3WHE1 4MCZB 4OD3H 1VGKA 4EIGB 3PL6B 3DX8B 4XC1L 5EIQA 4NJ9H 4AIZA 4U0RC 1LEIB 4HJGA 4LSPL 3AAZB 3OTTA 1SJHA 5GRVK 4PY8I 3AM8C 3ZKXB 5JHLH 1H0DB 3OQ3B 5BS0A 4CU8A 2DQGL 4LHUG 4EI5B 3TA3D 1DSFL 3TV3H 4X6DE 5IW3A 3S7GA 4OGAD 1QO3A 1KPRA 5A2KH 4QRTA 3WE6A 2Z92A 4JFXA 1UGNA 4G8GA 3MRHB 1FYTD 3EFDL 2V9QA 3HR5B 2VC2L 3RPIA 1PZ5A 4KK6C 4P2OD 3QQ3B 3AS0A 5E6IC 4PGBA 4FOMA 4DCQA 4DTGH 4PJDB 2V2TA 4MA3A 1MJUH 2VDPH 1D6VH 2W9EH 1ZS8A 3TIEB 5D7LB 5GRVL 3FHAA 2HJFA 5IMOB 5EUOB 3T08A 3FCTA 5D7SH 1NKRA 3HMWH 1QSVA 1NL0L 2WUBH 1CTOA 3SBWA 1MCEA 5L9DH 3GB7A 5H8DA 2FO1A 2CDEB 2Y7QB 3U36A 4PGDB 1DN2A 2Q7YA 4EVNB 4HUVB 1BREA 5ANMA 2PXYD 3RI5F 3E3QE 3UPRA 4EBQL 3L9RA 4WNQA 3DRTA 5F21B 2NR6C 1U8LB 3CAFA 1QRNB 2GFBA 1A1MA 3O2DH 2YN5A 4G6FB 3B9VA 2FJHB 1KELH 1T89C 3HI6L 4CVXB 3K2UL 3UZQA 1N64H 4JEGB 1AP2A 4V2BA 1C8PA 1FH5L 4NZUH 3EO0A 1IAOA 1F58L 4YHNB 1NC2A 1U92A 4IRJA 5TDPA 4OCMC 3AS2A 3U30C 1X4YA 2BNRA 5MEOB 1I7TA 3PE9A 5FYLH 2E7CA 3TJHC 3E6FB 5HI3C 1QD0A 1GL4B 2X9YA 1M7DA 4FQHA 4WGVB 5JXEA 3LMJH 4NOBA 4EUPG 3DMMD 3GRWH 3RTQB 3ULVD 5FUZL 3IXTA 3O2WL 3QI9A 5E4EB 3EO1B 4PIRF 4N8VA 3DVGB 5I1LA 1HKFA 2D7PA 3O3DB 3OAYK 5J1SC 2YWZA 5L88L 4L9LB 4JCMA 1TDQA 1RZGA 3ARFC 4P2OA 5I30L 1D5IH 3SJVD 1VERA 4KKBC 4JY5L 2VZ3A 1I7ZA 3MOAH 1HZHH 3MCKB 1CI5A 5D2LF 3L7EA 1NCBH 1YZZA 4FZ8L 4PLJD 5DI8B 5DQJB 1JN6A 3WIFA 3Q6GH 4IEFB 1FLRL 1U36A 2VISB 1R5VA 2KKQA 1VB9A 4EN3D 1UG9A 5DJDB 3VJ6A 4O4YH 1C12A 4M7KH 5ESVA 2OSLB 4APQC 3DBXB 5B22A 2Z8WC 1MWAB 2W38A 1NFDB 3QDME 4YIQB 3SDDB 4NUGL 4PJAA 3WXVL 5L7XL 1TJGL 2ZUWA 2EXWC 1HDMB 1CFQB 2B39A 2PXYA 1KPUB 3VXMD 4DN4L 4YDKL 4KQ3L 3RWIB 3DO3A 2Q76A 1YMMD 3DV6B 1U8IB 3RJDA 3CDFA 3ZTJG 3QIWB 4O51B 4W6YB 5CZVL 5IB3B 1DBKL 1X5HA 1RK0B 5EZIL 1RI8A 1WZMA 5ALBL 2B5IC 2PUQT 4QRSA 3MBEA 1OP3K 3AMLA 1W72A 3LPGA 2DM4A 2H1PH 2AVGA 4QRUB 1HHJA 4N68A 1MIMH 3TYFB 1NGQH 3C5ZC 4P59H 2VITA 5F9OL 5EU7E 4JG1H 3QO1B 4Z77B 3O4LD 2GYSA 4Y5VB 5I1CH 3P4LA 4NM8H 4YPGA 4NZDA 4JLRA 3C08L 3K4ZA 1DUYA 2P48B 4KU1A 4JHWH 1FVCB 3VDBA 5IHLB 1HI6A 2WINB 4M6MH 3RGVC 3ZYZA 3QDHA 3O45B 3RWDA 3JVGC 1HXMB 4XCNB 2DQTL 2D0HA 1AXSB 35C8L 4Q9QH 4Q97A 1T1WA 1CFBA 5DD1H 5HHPA 5HHQB 2AJYL 2YD1A 4ZAKB 3T3PF 5EBWB 4JO3H 3PJSA 3IRZA 3PQYA 4F7PB 2WWMD 5TFSH 5J6HA 4U1GC 1TENA 5ITBL 2H2PD 3WXWH 4QHNB 3ZDZF 4PJIE 4NRYB 2HRPH 5D2LB 1BFTA 4LHUD 5GGTH 5IR1A 5DJXA 2IFGA 4M7LH 5D7IF 4OZGF 5I15L 3EDEA 5FEBA 2IANE 4LLYA 4F8TA 2GT9B 4EN3A 2XYCA 4RA3A 2ZOLB 4N1HB 3GSNA 3C5SA 2BHZA 3MRCB 1EJOL 5HJ3A 1NGPL 4X83A 4NFCA 4ODWB 3PP3K 4L3EB 3A0OA 2I9LB 1P4BH 3T3ME 3QEGL 3C60A 5DURB 5AZEH 5LG1A 5EUKB 4G6JL 4PRBB 5DRZB 3MJGX 3MRJA 5HDOA 4AG4H 4QYOA 3ZDXF 1MCWW 4XCYA 4G8IA 2XWJA 2I60H 4JCLA 1H8SA 1MFDL 3ARYA 2E5EA 4I18A 1FFRA 1HILB 5JPNB 3OKNA 4PTUB 3PWPA 1QFHA 4BKLB 5E70A 5C0IB 3PXJA 3BDYL 3QDMA 4N0CD 1R6VA 3WIHH 4IM8A 4KK5C 2NW3A 3QAZB 1UB6B 3LS4H 5CZXD 5F97E 3MROB 4MNGE 3GMOB 3BW9B 3RY4A 3DTXA 1FFPA 4DFIA 2WMPA 5E4IA 2W9LA 5BVJB 5DJYA 2F8OA 2ZUQC 5J7CC 1AY1L 3SBWC 2I27N 4GO6B 1VHPA 3Q3GB 4YGVA 4YDLC 2R4SH 2YMXL 2DQDL 1EUUA 2V6HA 4QXGL 3MRFA 2HLAA 1JWSB 3IDMB 1IC5L 3RA7H 5C0EA 4XP5L 1ZHBB 1WBXA 2RR3A 4DN3H 3DX9A 4GUPB 4ZTOH 1IAIL 1EEYA 4GFTB 4JFYB 1H8OA 1H15B 5D1XD 1GPOH 1UYWH 1IC7L 4LHUA 1CDHA 3UTPD 4DGIL 3IFPA 5IVXF 1OARH 5D7IB 1UM5L 2NY3B 2ZUYA 1FZOB 3PP4L 3T1FB 1MUJB 2WWKO 5FIEA 5KG9A 4IRJC 3U6RA 2IPUK 3AY4A 3NACH 3B9KB 3BPCA 4OD3L 4I1NB 4OF5A 4Q9BA 5I1GH 3DGGA 3HG1B 3UTZB 3KLAB 1DVFD 4ZPTA 4UQ2B 4UIMA 5DGQA 3BZFA 3ECBB 3KNBA 5JXEC 1MH5A 2E7BA 1C16A 4D0DA 2JF1A 3WFEH 4IRSD 1YY8B 4PJIA 5GSRA 4WEBL 3LKPA 3QI9C 1EA9C 3STLB 3MUY1 1HEZA 4NRXB 3LKOA 3LHPH 1BPVA 2IANA 3TIDB 5JIPA 3VRLF 3C6LB 5BCAA 4P2OC 1G7HA 5INDA 3QUYD 1X3DA 1CG9A 2OXGA 3WHXB 4HLZG 4MQTB 1DQMH 1KIPA 2LTQB 2UY6A 1N4XL 4LKXB 3VXPA 4HAFA 4X6DF 4UZGA 5C71A 1MJUL 4Q2ZA 2VDPL 1BX2B 2BK8A 1D6VL 2EIDA 4K2UL 1RZ7L 3NPSB 4BH8A 4YBLB 4JG0H 3VH8B 4MDIA 1P2CA 4G5ZH 4UU9B 1LDPH 3FO9B 5D7SL 1CD8A 3O8XD 3HMWL 4AEFA 1F6LL 1U8JB 2WUBL 2PXYC 1Q0YH 5F3HB 3K0WA 3EFFB 2YXMA 4HV8B 1YDPB 4XC3H 3HB3D 1NMBH 3T2NH 2J2ZA 1QSFE 3BPNB 3P77A 3KPMB 1MHCA 1TPXB 3IS1X 3MBEC 5D1XA 3MNZB 2R69H 1JGLH 1FFNA 5EIVA 3RWHB 4PGEB 5E0QA 2P43B 1KIQB 4NUJA 5JTWA 1ONQA 1HHGB 4I2XE 4QHMA 1N64L 4W4NA 1RK1A 2Z91A 4XH2B 4FN0A 1YPZB 3SKUD 5C09E 2WLYA 5C0AB 2YN3A 3E3QC 2EDDA 3SY0B 3MREA 1VESA 3RI5K 5JOFA 1VA9A 1HNFA 2J88H 4X4XB 5DHXB 5GGSY 2DKUA 4IDJH 3HNSH 4MX7B 5FYLL 1X7QA 3QISA 3L1OL 3PIQB 5F1KC 3T2PA 1IARB 2YOCA 3RUGF 3ULVF 2DQUL 1U93B 4R4FL 3LMJL 2YA0A 3LKSA 5FKAA 4GRLA 3VGDA 3VGFA 4RRPG 1NDMB 1TZIB 3VFUA 4ZUWB 4OZFA 1CL7H 3DROB 2CKBA 3VWKD 5FYJE 3H3PH 3QUYA 3HZVA 3T4AA 1DP0A 1GOHA 1NANH 2W1NA 4LAQH 1CDBA 3DECA 1QR1A 2CMRH 2HH0H 3PHOB 1D5IL 1G9NL 1D5BA 3I6GA 4DVBA 1RZJC 4J1UB 1TQCC 2O5ZH 2LQRA 1GGUA 3NN8B 4Q9CA 3HAEB 3MXVH 2VWEC 4F33B 3S37X 3RKDD 5GIRB 5H37G 5DQ9A 4EN3C 1NEZB 3K7UA 3MNVB 1OP9A 3QQ9D 3Q6GL 1EHLH 3BP6A 3P4MB 4JFPA 4ZFFB 4DOHB 1ZLUK 3MO1B 1RFDH 1RJYA 4O4YL 4M7KL 3WIIL 5CUSH 2AP2A 4PV9B 5F7DA 3C60C 1ADQH 1A7RL 4QTIH 3CVIH 5ID1A 4WO4A 5FK9B 5FYJD 3U7YL 1A6TB 3TPUB 1G1CA 4OM0H 3RVUC 3RY5A 2FYYA 2EDKA 3BESR 4GQPH 2OS7A 4R3SA 2ATPB 1DQJA 4UQ3A 1JGDB 3G5ZB 4I18C 2Z0BA 4H0GA 1Z3GH 3I9GH 4YE4H 5DD6B 3MV8E 1T1YA 4KUCD 4QHKJ 4JZNA 2H1PL 5ABDE 3ULVH 4FQCH 4TVPD 3T0XA 1PKQA 2DBLH 4JM2D 5GGVL 4JKMA 4GKNA 1WEJH 1U2HA 4M3KB 1YEGH 4JM4H 1LHZA 2FDBP 4P59L 4LGRB 4O00A 5T1MB 1B4JH 1Z0NA 1QSFA 5I73B 4PRNB 3KDMA 1F3DJ 4NNYA 3FMGH 1FORH 3WJLA 2OI9C 3FJTA 4BZ1L 1KPVA 4I2XA 5DJAA 3GJFH 3GSNH 5DD1L 5EU7C 4Q6IA 2X5PA 4CKVX 1CGUA 4NGHH 4PREA 1EH9A 3MRBA 3PHSA 3VWKA 4PJBB 4KRLB 4UT7H 3SJVB 5C09A 2D7QA 1M71A 1MCPH 3OXRB 1L0YA 3QNYB 4WIQA 2Q1EA 4LCCA 3WXWL 4MAUH 3OX8B 1ZT7A 5F9DC 1CDYA 3GO1H 2PW1B 3DGCR 2OL3A 5GGTL 3NOIA 5IESL 2MQ0A 3AY4C 3OV6A 4M7LL 4XBGB 1QRKA 1AR1C 3OKEA 1TJIH 3ZT5A 2Y23A 1RUAH 1BP3B 1EEZA 1RUMH 2CLVB 2CIIB 3MGAA 4HC1A 3JWOC 1HIMH 5AAMA 3K4AA 5GGQL 3VXMB 1G7LB 1UWXH 1AC6A 4ZUSA 5I16B 2MTPA 5JHDE 1OM3H 3H42H 1UCTA 3T04D 2P4AB 4GOSA 1FPTH 1L0QA 5D1ZD 2GEEA 1JTTA 1B0RB 4H0HB 5IV2A 1T80A 4FQ2H 3IDJA 3UBXG 4WWKB 4J8RB 4CUCA 3KPNA 1MCFA 5IHZB 1W0YT 5EU5A 3KPSA 1WFTA 4N0CC 2N4IA 4XMLH 2NY0B 5LXGL 3O4LB 1E6OL 4P46D 5CZXC 5IUSA 4CADA 2OMNA 4I48A 3WIHL 1UB5B 4PJDE 5JHDD 1VFBA 4X0KA 4RFOH 2AERT 3QRGH 5FCSH 3NIDF 2X09A 5MERA 4Y89A 4M6OL 5F6HI 5EUOE 5EOCH 1I1FA 3FQTB 2R4SL 1HHKB 3TO4B 3EOAA 3MV8A 5D4QA 1AKJD 4LLWA 3RA7L 1G84A 1G6VK 3VFMA 4YXLL 1E4JA 2ICCA 3CDGB 3BJLA 2F9BT 3GKWH 1LD9A 3JWOH 5D1XC 5DFTA 1EK3A 3MUHL 4DN3L 2FECL 1Y0LB 5TQ0H 4ALAL 3RDTB 4F2MA 4OZIE 1KCVL 3SKJH 4C55A 4S0SD 2PCPA 3FT4A 1EJ6A 3QCUL 1UYWL 3O3BB 3LD8B 4PV8A 2NY2C 1OP5H 5IB2A 1X5YA 1WFUA 5DRNB 2I07A 4JN2B 1NBYA 4PJ9D 5ICZA 1ND0A 1Z5LB 3REVA 1T04B 4XB7A 1T4KB 1A22B 2R29L 4XNMB 5FYKD 4N90E 1BJ8A 1I9JL 4U1KB 5B38G 1HYSD 3MRIB 1R5WA 1JHTA 2A6DA 3DVFA 1J1XH 4UTBH 15C8L 3NH7H 3PABB 5TPWL 3IDGB 3ZKSD 5T3ZE 3M17A 5L6YH 3WNNA 4GRLC 3RWEB 1EIBA 3O3UN 4ZYKA 1XIWB 5I1DA 2VUOA 3MLWL 5KSAD 1K2DB 1T0MB 3T8XB 5DVNA 4NQXB 5HDLA 2N7BA 2A73B 2W65B 3V95A 3LHPL 3QUYC 2V5MA 1Z9LA 1I8IA 3JTTB 1IL1A 1DE4A 3THML 4WV1B 5FOBA 2BXZA 1D6EA 4N90D 3PWLA 1YEFH 4MCZA 5JW4N 3DX8A 1EAJA 4HUMB 2GUOB 5JHDA 2R0KH 5T3ZD 1AFVH 3PNWB 3OAZK 3EYSH 5DUMH 2BZDA 1BBDH 1A4JA 1UA6H 1D3CA 3ET9F 4JG0L 3V0AC 4EUPH 4WO4C 1LDPL 3L3OB 2ZSVA 12E8H 4AEIL 3FFCE 4KZEL 4U31A 4M1CD 1NFDE 3HR5A 1CDGA 2D9CA 3AVEA 4XMPL 3BX7C 2NY6D 2QQLH 1NMBL 5E94B 3T2NL 3D2UD 1MCBA 1XF4B 2GQHA 2Y5EA 4PJDA 1MRDH 3ARTA 2N1KA 3FO2B 3L5WB 4HBCH 3I50H 5C86A 4OJFL 1Q9KA 1INEH 1GIGH 3KJ6L 3HZMB 5EUOA 3B2UC 4RRPA 1R3KA 3FFCD 1DVFB 5HYJB 2H9GB 3QB7C 3BP5B 2CDEA 2Y7QA 4PGDA 4CW1B 1JGEB 2DM3A 4EVNA 4HUVA 1KN4L 2J88L 1ROWA 4O9HL 3WJLC 5CIPH 4FTVE 1QLEH 3SDCD 2D7TH 1U8LA 1J1OH 43C9A 4Q6IC 4RMWA 3RBSA 2YA2A 3ZTJH 1JZ5A 2KL6A 2FJHA 4I0CC 3VWKC 4KPHH 4CVXA 2YKLH 1CDJA 1BEYH 1CL7L 3V4UH 1OT2A 2NXYB 1YEKH 2RCSL 4LCCC 4U1LB 1UH3A 3ULUC 3QEUB 4YHNA 1B0GB 1JRHI 2AV1A 1NC4D 3RKDC 3ILPB 1UXWB 4J6RL 5CIPB 4N0YH 3M8OH 2AXFB 1QEWA 3I02B 1QLRB 3MXVL 3ZTNH 4UT9H 4M62H 1LE5B 2B4CC 1CE1H 4KTDH 3VFWA 3E6FA 4FTVD 2P5EB 3CFKA 1QSEB 2Z8VC 3IJHB 1EHLL 4RAVA 2COQA 3FN0L 2WLZA 3S5LG 5DC9B 1FL6B 3RTQA 4KXZH 2XKNB 3VE0A 5HTSA 3RWJA 4WDIB 1ADQL 1FL3B 1OSPH 4LPYA 3PWJA 2H26B 2R2BB 4L9LA 2DQCH 4YHOH 2YXFA 2DM7A 4NO5A 1JGUH 3A6BH 4NT6B 3DO7B 4F3FB 3LEXB 5IEKB 5ECJE 3C87A 4E0RB 4NQSA 1Z3GL 2VLKE 3I9GL 4YZFF 5DHVH 1OTTD 4CDGC 4JM2F 4U2ZA 5FHBH 1QLFB 2DLHA 2VISA 2XPGB 2C3XA 3LQAC 2ID5A 3ULVL 4FQCL 4HKJB 5DJDA 3VFSA 2Y5TB 4JJHA 4MXVE 2V2WA 3U46B 3RL2B 1YEGL 4JM4L 1C7TA 1MWAA 3BPOB 3OG4B 2ZUVA 1NFDA 1B4JL 3SOBL 4LAJH 1N59B 2QADD 4ZUTA 1HDMA 1CFQA 1G0XA 1FNGA 5I9QB 1NCNA 4XVUD 3MR9B 4ZD3L 3RWIA 3LKNB 5CBEB 3DV6A 2OL3H 3B9EA 4YC2B 1RHHA 2GAZA 3QIWA 2VLLA 4BSVB 4O51A 4GXVL 5IB3A 1FORL 4M5YL 3U4BL 1RK0A 2VLKD 2BY2A 4WFFD 1EO8H 3AS3A 4ZOCA 3TPKA 4HC1H 2HA1A 4GT7A 2BFVL 1F6AB 2BCKB 5HHNB 4CMMB 4QRUA 2V5RA 3TYFA 2HG5B 4WHDA 5T1KD 5FYJH 1MCPL 1NC4A 4L3CA 4Y5VA 3VWJB 4JGJA 5LWYL 3P9LB 4DQOH 4X7SH 4OF7A 4MJ4A 3KYNB 3GO1L 4FTVA 4JFOA 2EECA 5DF0A 2FJFA 1FVCA 3BN9C 1ZVHA 2WINA 1PEWA 1RUAL 4L4TB 3TP4A 3O45A 1RUML 1KCSL 5MI0B 1HXMA 1JPTH 4XCNA 1AXSA 4TVPH 4H0IA 1DQLH 3LKQB 3IF1B 5HHQA 4ZAKA 5EBWA 4JHAL 3QO0A 1HE7A 4AYFA 1ZGLA 4LLUA 5ACMA 4K9EC 4QRRD 4Z7VF 3CNKA 4F7PA 1NCAH 3H42L 4IHOB 1JMXA 1H3UA 3S96B 1FPTL 4QHNA 5ELIA 3CFEB 4CMHB 1UACH 4NRYA 4NWTH 2H6PB 3J7HA 3GBMH 2HTLD 3U2SA 4FQ2L 1EAPB 2R9HD 1BZ9A 4G8FB 1U6AH 2GT9A 5DD5H 2YPLB 4KKLC 2ZOLA 1NQBA 2IAMB 3ARSA 3GBNH 3ZKXC 1VGEH 2JKXA 4UTAL 1HH6A 1OAUH 3MRCA 7FABH 5KAQF 5GRWA 2Q20A 4ODWA 1Q0XL 2OR9H 2DJUA 4RFOL 3CCHA 2VSDA 1FZJA 5EUKA 1U95B 3QRGL 4ZMAT 3QCTH 4GG6E 5EOCL 4PJ8B 5HHOE 4NKOB 5ADOL 5C2BH 1E4XI 3L7FB 1A7QH 2OK0H 4IBLT 3LS5H 5E99H 2OZ4A 3I3DA 3HE7B 4LVNB 5C0IA 2MHAB 5B38A 1S7SB 2X1PA 3F8UB 4HLZH 4P3CH 5TQ0L 1FE8H 5HHVH 3ZE2E 3H9SB 3SKJL 1UB6A 3MROA 1UENA 3GMOA 4YUEH 1KB5H 1NCDH 1CBVH 1KGCE 2W0KA 3OKKA 2YWYA 5I75C 4AT6B 5BVJA 2JJTA 1T1XB 1OAZH 3B8SA 2PTVA 3UAJC 1HK6A 1JNLH 3Q3GA 4PRIB 4R8WH 2PN5A 3VA6A 4UV4L 5KVEH 5HHOD 3ES6A 1YPZE 2QKIA 5MENB 3GZKA 3HLAA 1OOAA 4Y5XA 3NZHH 4MNQD 1ZMYA 4OZIF 1DQQA 1VCAA 2NY1B 1J1XL 5D1ZB 4Z7VB 2JJSC 4GUPA 5L6YL 2SEBA 5CS7A 4ISVB 3VFRB 4ONOA 3S9DB 4QT5B 3ILQD 1DZBA 1KGCD 1UC6A 1NBVH 2DLGA 3T1FA 5E5MB 2CO7B 1MUJA 3JV5A 4ONGH 2VABA 3QCVH 3WFBL 3HC3L 3B9KA 3K46A 1JYNA 1YEFL 1F90L 1R3HB 1F8TL 2FEDD 1SYSB 4BSJA 1KTKE 3UTZA 2DYPB 3CIQA 5FV2A 4K3HA 2FLRT 1QA9B 4UQ2A 3ECBA 2Q8AH 2R0KL 4L29B 1RY7B 4FXLA 2QQKH 5HSFA 1CK0L 1MAKA 1GGIL 5BOZG 4OBSA 3RTQC 3EYSL 3MLTB 5E4EC 3HE6B 1XGYH 4X7TB 4XGZB 4DK6A 3H7BB 1AH1A 3ARED 3TIDA 4L9LC 4TUKH 3C6LA 4QWWD 1WWCA 1OY3B 2J8HA 5FYKH 4XP9H 32C2B 3NFNB 3P4NA 2VZSA 3C9NA 4NQED