4PJ9D

Structure of human mr1-5-op-ru in complex with human mait traj20 tcr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
238
structure length
230
Chain Sequence
AGITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSAGASTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLDRAKPVTQIVSAEAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 230
sequence length 238
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj9D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj9D02
4P2RB 1XGTB 4BUHA 3SHSA 1C5DB 1H5BA 3QDMD 5ECJE 1DBAL 5L2JA 5JO5A 4JY4A 1LEKB 4XP5L 1YMMD 3LKSA 3V0AC 4I3RL 1S7WA 2D0FA 2FYYA 3QCVH 3MUGB 4FTVB 3MYZA 3HNSH 4FG6C 1AQKL 3T77B 2Q87A 4WWKD 1UM5L 2EE6A 5K9JH 5ETUB 1YNLH 1P69B 3L6FA 4J6RH 3MQIA 3O8XC 1YDPA 3O3AB 1BOGA 3FZUD 2C3XA 4QTIH 2DTMH 5BCAA 4OFYA 4P3CL 5C86A 3GUTB 2H2PC 3FO0L 3MRLB 1QBLL 4XHQA 4CN4A 4HS8H 4JQVA 4MNQD 1NBZA 1JPST 1T3FB 3QUXC 1CK0L 2DLEA 5KSBB 1K6QH 5CD3B 4NOFA 1NGQL 5HYJD 4YO0A 2F54E 2ESVA 2OI9C 5F7WC 4R26L 1VADB 3MJ8A 1Z3GH 3IFOA 1JWMA 3O11A 3QUZB 5T1MB 4XGZB 4JZNB 4GAYB 3BKYL 2Y23A 3GO1H 4JM2D 3ROLB 4Y2DB 1CD1B 3U4BL 1FH5L 3ABZA 1I9JL 2H2SD 1QVOA 1KULA 2FHBA 5B3JF 5FA3B 1A7BA 1BHGA 4P2OC 5J57B 4NNYA 1MPAL 1SY6L 5ADOH 5FUCC 4GUPA 4G8IA 1U92B 2CLZA 4S1QL 4XBPA 5FF6B 3WD5L 5E70A 4IMKA 3PE9A 5D7JC 2X4UB 4WFFD 4YXKH 4XVSH 2EYTB 4HT1H 1GCFA 5MERA 1E0OB 1K4CB 2VN4A 4YGVA 3S37X 4L3CA 3EZJB 1A7NH 3V0VA 1JGLH 4H1LB 4L4JA 3JWOL 4JAMB 1WICA 4HG4J 4JG1H 2CUIA 1BGXH 4JFPA 5IW3A 1MREH 4JEGB 1J7VR 4JKKA 4DN4L 3TH4T 4HSQA 4XTRD 4YPGA 4YFDB 1FNSH 4NQDE 1V8HA 5T1KA 1HYRC 3BRFA 2GITA 2JJTA 5J89A 1OP5H 1GRWA 1MIMH 4DUWA 5H94A 4QF1B 2AXHA 5ICZA 3P73A 3MBED 3OJMB 4GFTB 4GRWE 4ZTOH 1F4YL 3P4MB 5D8JH 4PRHB 2XT1B 3BDYH 4YQXL 3I9GH 5I74C 1N6QL 4M7JH 4F37F 4Y5YA 3GSWB 5C2BL 1G7HB 4QOKA 5H37G 1EEUA 4AG4L 5SWSA 2KPNA 1WTGT 4HMEA 3TM6A 5TF1H 5I73B 4GXUM 4LCUB 4MX7A 5CJQL 4CVWA 1CFBA 1VFOA 2EC9U 1YEHH 2F54D 4WNQA 5T5NF 3C6LA 5HJ3A 5D1XC 1UCTA 3GI9L 3WL9B 3LSOA 1QSEB 1IEAB 3FRPA 1FVEB 4PR5A 1G6RB 3OG4B 3G6JA 4MD0B 5FUZH 3U4AA 3HPJA 5GJSH 5C0AB 4OCXL 5D2LF 4BSWB 2HG5B 1YUHA 5JLZB 5E2TL 2XN9B 1KT2B 5LCVL 1H9VA 4UTAH 2A6IA 3P0GB 4FQQA 5D6CB 4KKBD 2WW8A 1ORSB 4TN9A 3HNTL 4KROC 1FRGH 1CLYH 1CGYA 1PLGL 4OB5H 3O45B 4D0DB 3B83A 3PGFL 3ZT7A 4XNMB 3DUHA 2VUOA 2IEPA 5IW6A 1FFPB 2JB5L 4RAHA 4LPXA 5C71A 1TMCB 1CLZH 4GKZB 1X5XA 3OJDA 3JVGA 2YEZB 1FHGA 2YKLH 4KV5F 1F4HA 2P47B 4GBXA 2IBZX 1SEQL 4XCFL 1NBVH 4K3GA 4IIQA 4UU9A 4ZYKB 4D3CL 5B3JE 2JCCA 3QUYD 4PJ8B 5BXFB 2WUBL 1I1YA 4IOSD 5ESVB 1IQWH 3CLEH 3CVIH 3JTTA 4NQDD 5JW4Q 3E6HA 2OL3A 1J8HE 4G9DB 2NY6D 4ODBD 4AL8L 3DECA 1M71A 2WWMD 3N0PB 4L8SC 5IVXB 4NDMA 2WBJD 5I1JH 4ODUA 3GM0A 5B38A 4TOYL 3T2NH 1UM4H 4HWBH 1CDHA 3S4SG 4BZ1H 3QDGA 3DSFH 2R0WL 4PV9B 2WM0A 4X6FA 1MI5B 2ZSWA 1WV7T 1KC5L 1TPXC 1RK0A 4RGOH 5AD0B 4MVBD 4G6JH 4L8DB 5DJ0A 4CMHC 1TJGL 1X6LA 2E9WA 4K94L 3DJ9A 4I18B 3CFJB 1F58L 3S96A 3L5IA 1B0GA 1KN4H 4DUXA 3V0WH 3F7YA 4ZMAT 4WU7A 3DTXB 1QSVA 1MCPL 1G9NL 2VDNH 2ZCHL 3VWKC 3SDDA 1OTSC 2Y36H 2DQUH 2NLJA 1IAKA 3PDDA 2QHRL 3MRKB 5EN2A 3QCUH 1WT5A 4FNLL 4MAYC 5KW9L 4F7CA 3HMWL 1OW0A 5KSAA 3RPKA 3UTZA 1RZIB 5EU6E 2XQBH 3KWWB 2KQNA 2VABB 1SVZA 3DROA 4F7MA 3RWHA 5I75B 4MS8D 3MV8B 1Q38A 2GSIA 4WWKB 3CXDH 3LRSA 4RIRA 5CBEB 3C5ZA 5ALBH 1DCLA 3MRMB 5AUMA 1YEGL 2IMNA 3CNKA 2EC8A 3CVHA 4X5WA 4DFIA 2X42A 3O9WD 4KRPC 3U0TB 3EO9H 3F58H 1OQXA 5LJYH 3PGCA 1BFVL 2FATL 1XCQB 1I9RL 4MNQB 3G5XA 1BBDL 1KTKE 5CGYD 3BHBB 4KUZL 5D2LE 5FUOH 1AXSB 4F9PA 1JWUB 2AJYH 2PN5A 5DT1L 4U0RB 3HMXA 4GO6B 3QFDB 3FO2B 1C7TA 5HYJB 3ILPB 3OBAA 1J8HD 3FN0L 1QFUH 3N06B 4JHAH 1NMBL 5F96H 3H42L 1NAMB 3A67H 5JDSA 1ETZB 1TZHA 5EOQL 1KBGL 1RULL 2X4TB 4WEBL 1EZVX 1BVLA 4HGWA 3MSPA 4QT5A 3F8UB 3FT3B 2MCPL 1KCRL 1BZ7B 2R23A 3ARVA 4V1DB 4K94C 3SJVA 3BI9X 4JZJB 2GCYA 4PB9L 2IJ0C 2OTWA 3EJZC 3IDIA 4X80L 2P49B 4P5KA 4BZ2H 1G9NC 1I85C 3CFDB 1MRDL 4YHLL 4NN7C 4IRSA 1TCRA 4QXGH 32C2A 3IJSA 1S7UB 3QWQB 4OZ4A 4MCYA 3GSQB 2CKNA 3NACL 4U7KA 2HN7B 5IM7B 5E5UB 1X7QA 5F6HI 2VDPL 4DKFH 1WEJH 3WIHH 3KLHC 5E1AA 2DF3A 1GXEA 2XIDA 4BK5A 4UIKH 1FG9C 1FE8L 1KJVA 2DWDA 3HI1A 4MXWH 3F12A 5EU6D 1N8ZB 3LDBC 1XEDA 3ZKMC 4N8CL 3OKEB 1QBMH 3MFFA 1KEGH 1A6AB 2R15A 5AG9A 4LEOB 1DDHA 3QEQE 3CFKB 4PREB 5C09A 3QNXA 4R0LA 2WINA 1KPVB 1U91B 5I1IL 1FJ1B 5T1DH 3HE7D 4LPVA 1UEYA 1J10A 4KHTH 2V2XB 3IXAB 4NKIL 1FG2A 3VW3L 5E6IC 5IQ9B 1C5BH 3MOAH 5EO0A 3KLAA 1LDPL 3K8LA 5IGXL 2NX5E 2EZ0C 2X10A 1OTUD 3HNVL 3LS4H 4JO3H 2OM5A 5E8NB 5IHUL 3QNZB 2F54B 1YYLH 4FS0A 4N5ED 1RZ7L 4JKWA 4Q9RL 2OMBA 5EOTA 5LQBL 2IPTH 2R9HC 3FB7B 4TULH 1JRHL 5IB5B 1AD9B 4PJIF 3N1GC 4ODXA 1NCCH 4YHOL 2QHLA 4KJWC 5EUKA 1KB5L 2VKXA 2AV7B 1JMZA 4N0CC 4DGIL 3IJYB 5BRZB 5IFJA 3WE6A 3QUKA 1DQJA 3QIBB 4PG9B 5I2IA 1R0AH 1TTUA 5DJZB 2VQUA 1JPFA 3MO1A 3SDAC 3S7GA 4QXUL 3BD5A 1CE6B 4B0MM 5B8CB 3ARDC 5F7DB 1CGSL 1HINL 1IGJB 1ZLVH 5F7MC 5J0BA 3I3BA 3LKNB 1DLFH 3QT2A 1LO2H 4PRIA 3IDYB 4XPHL 1JUFB 3ARGD 5DJ8B 4UIMB 2W0LA 1D9KD 4OUUB 4AT6A 4OCWL 4NJAH 1DL7L 4LIQL 4NQDB 5ANMA 3E3QC 1MIEH 5F1OB 1WBZA 1MCSA 3OXSA 5FYJH 2EE2A 2NXZC 3QEQD 5EU4A 1U8JA 1BVKA 2R2HA 1BVZA 5E9DA 4JCMA 3VFMA 2VLRA 3F7PC 1XCTA 5KVFH 2X44D 4KQ4L 3ARFA 4HS6A 2MJWA 1UXSA 3RHWF 1UA6H 3M17B 4NUJB 3KPLA 1NL0L 3NFNA 1A3RL 1X6NA 1WWBX 5J11B 5JPMA 2X4PB 1CFQA 3MUJA 2NX5D 5IMLA 5SX5H 4YFLF 3K0WA 3WFCH 2FO4B 3C8KB 2BX5A 1WZKA 5DJXA 5E4IA 1T1YA 2JELH 1NBYA 5F9WC 5F9JB 2GJZA 3R4DA 3B9KA 5JXED 4HUMB 1YECL 4OF5A 5CCKH 3K2UL 4QRQA 1JZ7A 1A9EB 1HHIB 4KTDH 6FABL 2AJSH 5EO9B 1OGTB 3V7MA 1K5NA 4OTXL 1I3RB 1CDJA 4GRLA 2G60L 1J1XL 2A6KB 1BJ1J 1OTTD 5IJKA 2X7LA 3ZMRA 2FX9L 1AHWC 3U46B 1TQBB 3NCCB 1MF2H 5C8JA 1DN2A 3LD8C 2B7DT 3D0VB 4WRLA 4WW2B 4G43A 2DB8A 1NUDA 2DJ4A 4L9LB 3ARED 3KYOB 4LNRB 3ZZ1A 4FZEL 3PGDA 1G7JA 8FABB 5I1LB 2BP3A 3LKQB 4OJFL 1LDSA 3I6GA 1IEBB 1UENA 4XRCA 3QCVL 2DQGH 3LB6D 1BQHB 2W65B 2PYEA 4AEHH 3EDJA 5DMKB 1B2WH 4Z9KB 5KG9B 4PLKD 3SE4A 2UVFA 4PJIE 2BVYA 2C7UA 5K9QG 1FLRL 4OQTA 4QTIL 5CUSL 2R4RH 3X11A 4E42A 1PEZA 4HIXH 4YC2B 4W6YB 4R2GD 4WUUE 2ZUQC 1LD9A 2I27N 3OAYH 4DK6A 4C56E 3R8BB 2R2EA 2Z93B 4UQ3B 3KDMA 4XNZC 5JTWA 4OAWB 1PG7L 3LKPA 4R3SA 4ONGL 4JHZA 4CU7A 3H9HB 4N90E 5C0CE 1JBJA 4WO4C 4XPAL 5I15H 5DFWH 1K6QL 4CGTA 4XHJD 3SGEH 3TZVC 4W4OA 5BVPH 5FO8B 4L4TB 2LVCA 3GK8L 2UYLA 4EVNA 3PWJA 1JCKA 1D6EA 3EYSH 3OAZH 4YDIL 1D5MB 3IKCB 1DBMH 3A6OA 3T3PF 5I1EH 1T83A 1HXYB 3QDJE 2NYYD 1TXKA 4NQEE 1MEXH 4G42A 1GHFL 3GO1L 3RWCA 3BRDA 1FNLA 2YWYA 4LRIC 4JZOB 5EA0L 2QSQA 2E6QA 5A1AA 4E0RB 4Y4KD 3UP1A 3IDGA 5A2IH 4TSCL 3RNQB 5F70A 1MY5A 4NQUA 2ED9A 4U2ZA 5ADOL 4KHXL 3QHTC 1YPZF 3L3DB 2MMXA 1R5IA 3CSBA 4N1EA 1X4YA 3ZT6A 2NY7H 4TTGA 1ERNA 3CH1B 5EU6B 5CHNA 4JO2L 2XTJE 1MCEA 3SBWC 3STLB 3IFNH 4PGEA 4DJMA 4X6CA 4XWOC 4X6EB 5I8CB 1R3HA 2VXSH 4HT1L 1QNZH 3RI5K 4CBPA 1OOAA 4NRXB 3EYQC 4K8RH 2Z91A 1LQSR 3QHZH 3V5KA 4WHTB 1U8PB 1JGLL 3B9DA 1HWGB 2X09A 1PAMA 3S5LB 2AERT 2EEDA 4K3DH 3G6AA 3IDNB 4R4NC 1MREL 4LQFL 4ZS7H 1ZVHA 4AJ0A 3BZ4B 5C07E 1FNSL 4XT1C 3T4AB 3MRGA 3EBAA 3TIEB 4GLRI 5D2LB 3WXWL 1J05A 1YY8B 4JJ5B 4PJ9A 2NTFA 1A7PL 1S7RB 2BXYA 3LKOA 4HCRH 4HKXA 4KJPD 1F6LL 3RVUC 3DWTA 3GMNA 5FKPA 4P3DB 4ZTOL 3AU1A 4MDIA 1H0DA 4WUUD 1P7KA 3F5WB 4C56D 1JZ2A 1KJ2H 4RAUB 3I9GL 3HRZA 3NFSH 3FQXB 4M7JL 1RIHH 1E6OH 4YR6B 3KLDA 1P9MA 1UZ8B 4N90D 5C0CD 1UB5A 1JZ3A 4I77H 5DQ9B 2DQJL 2IPKB 2V7HA 2IAMD 2OXHA 4D0BA 3GBMH 4E41B 2YPKB 4KMLB 4JFDE 3MBXH 3QRFM 1LEGB 4JR9H 5FECB 5GQBA 3CZFB 4NBZB 4TNWK 4HS3A 2G5BB 5DEFA 3PDOB 3QDJD 1IFHH 4JDVB 3WO3B 2VMFA 3ARBC 2OJZH 1KNOB 1XF2A 1R3IH 4NC1E 3HUJF 3QEGH 5TQ2H 5GJSL 4PJ5A 2R1XB 4OV5B 2UZXB 1M7XA 4NM4H 3LPFA 4I0KA 5DRZA 4UTAL 4DK3A 2YD5A 3WS6C 4YDJB 3QNYA 4ZAKB 4ZTPH 4C57C 2WMPA 1CXEA 1YZZA 5IQ7L 1D9KB 1ES0B 2XTJD 4JANA 5E8PA 1ZS8B 5ACMA 1A7QH 4D2NA 3NZHL 5KANG 4N8VB 3ZHDA 3BESR 3T3PE 2A74B 3C87A 1K8DA 4RGNB 3VXMB 4M1CD 4OKVB 5I1HL 5DD6B 4HKJA 3MA9L 5HGBA 1CTNA 1G0XA 1LGVA 2BRRH 3F7RA 1MHCB 3DX9B 3JV4B 5C07D 4DZ8B 1IQWL 3CLEL 1F11A 1RIUH 3BPCA 1AQDB 1YPZE 2O5XH 4P4KD 5HHVH 4UB0H 5I1JL 5FYKU 4PY7A 1SQ2N 1I7UB 4Z8FH 1RJCA 2ICEB 3TCLB 4HWBL 4BZ1L 2D7NA 5E7BA 3EOTL 1QZ1A 1GOHA 2OJEB 5GISH 3MCLH 4P3WA 3DETD 1J1PH 3PWNB 3QO1A 4PLJC 4RGOL 3HE6D 4EIZC 2BOBA 3EYUH 2EDTA 5FXCH 3SO3B 3OGCB 3IDJA 1AGDA 4JFDD 4MJ6A 1ZGLB 1ZVYA 3FB8A 3V0WL 5DDHA 2J3SA 3NA9H 1BX2A 2VZTA 2QLVB 4FXKA 3OG6B 2A0LC 2R2CA 3BZFB 4G6AD 1A3QA 2BFVL 3SOBL 5I1DB 1JPGB 4XCYA 4H20L 4WHDA 2IPUG 4PBXA 2WSKA 5IHBA 2EDXA 5HPMA 2BJMH 3QUMA 1XGYH 3L3HB 3OR6A 2XQYG 1B4JL 1FN4B 3ORJA 5AYUL 3CXDL 2RQ8A 2RCSL 1FVCA 5ALBL 3W9DB 5ISZE 5H2BA 5J12C 5ICXB 3ZYJA 1C16B 3QO0A 4JGUA 2ATKA 4O9HH 2B4CH 4F7EB 5B39G 1Q9WA 4OLYL 5FYKH 3F58L 4OKDA 3H3PH 2R0KH 1NCUA 3PJSB 3TESA 1LK2B 2LU7A 1ADQA 2VDKH 1HHGA 4XPBL 5D1ZC 1CYGA 2X9XA 3HUJE 3S36L 1OAKH 4PJ7B 3GSNH 2WLYA 4JPVH 3BQUD 3QFJB 2WBKA 5DK3A 1KPUA 1OAYH 4DZBB 1ORQB 1DBJL 3HLAB 4RQQA 4QHLA 1K3ZA 1T1XB 1U9KA 1TVBA 4UT7H 3VFRA 4G9FB 2GHWB 5F96L 1FO0L 3GB7A 4ZFGH 2OX5A 5KOVC 5KVDH 1UQSA 3BSZH 5BMFH 3BN9D 5F3BB 2VWEE 3EJYC 3PP4H 3ZKXC 2E8YA 4Y4KB 1BD2A 1H3PH 1ZVSA 2UUDK 4O2EB 4Y16C 4GKNA 1R5VA 3X13B 4MXQC 5CZKA 2Q86A 1J0KA 4NC2B 2X4NB 2P5EB 4BZ2L 4R7DB 1JFQL 4F7TB 4QY8B 1J0IA 2YWZA 4LGRB 2HLAB 5CFHA 1N5AA 5D2NE 3CSYA 2D7TH 4DKFL 3IVKB 4UQ2A 1DQQB 4UI2A 5EBWB 3WUWG 1WEJL 1VGKB 3WIHL 3RIFF 4ETQA 4LBEB 3FMGL 4FQXA 3ALPA 1N26A 4HUWA 4ELMF 3RTQD 3IS1X 4R4BA 4XMLH 1KEGL 3EJJX 1OVZA 3FJTA 1Z5LB 2FGWL 4P4RA 4Y89A 5D96C 5ISZD 5GGVH 4D0CB 3U9UB 4PJIB 3QEHB 5CD5C 4M61A 1UVQA 1NLBL 1HCFX 4EXPX 4IRJA 4RAVB 1UWGL 3VRLF 1Q0YH 4JN2A 4TUOB 1U93A 5HI4D 1DVFA 5T1DL 3O6LL 2YD1A 3E6FA 4KHTL 4D9LH 4WUUB 3QPQD 4HIIA 4C56B 1AO7A 1C5BL 3MACL 2ZUXA 5C0CB 4F2MA 5IR1B 4LASH 4HIEB 5EO1A 2FECL 1B6UA 2IAMB 4YDKL 2VC2H 3NIFF 3VJ6A 3L3GB 1AP2B 4CN1A 3B2VH 3LS4L 3L1OH 5HI5C 1YYLL 3V4UL 1JN6A 5DUPH 3GIZH 5CJBA 1CICC 5E99H 4FFVD 4LNVA 4C58B 2IPTL 3NFPA 3QDJB 4QOKE 4NQEB 5JORA 2GKIA 3VXQB 4JVPA 4NN5B 4TULL 3DLQR 1ZLWH 4LSRH 3HR6A 3WO4B 3U4EB 1I3UA 4ZUTB 2HJKB 3X12A 5D6DC 3KS0H 2MWCA 3VXTB 5D72L 3SGKC 3CPLB 3UDWC 3VFNB 3BGMA 4R97C 3JV0A 4M7ZB 4PJAA 4XP6H 2VR5A 5SWZB 3RVWD 4GKOA 1U3HA 4L29A 1TTGA 3TT3H 4Z0XA 3N50A 5CILH 1NCBL 1A47A 1D5ZB 3OKKB 2KZ1B 2AV1A 4BZYA 1ZAGA 2VXUH 3HG1A 1Z6JT 3RWIA 5D1QA 4KKAC 1CS6A 1F8TH 2DLIA 3ECBB 2BSRB 4OF6A 3SDCB 1CLOH 1SJEB 1LO2L 1ONQB 4KXZH 2JE8A 1AE6H 4IS6A 1U8LB 1Z2KA 4H25B 4MHHI 4JPKL 2HT4C 5DHVA 1MAKA 1AI1H 1QFHA 3MRDA 3TV3H 1J88A 1MIEL 3VMPA 3KYNA 4R7NB 5FYJL 3QA3A 3MRFA 1GZQA 4LPUA 3A6CL 3LRGA 1UYWH 5A2KH 4UUJB 1OGAA 4MA1B 4MD5B 1OF2B 1X5LA 2WQ8A 4U2YA 2F53A 1UA6L 1CDBA 3GMLB 5T1KD 1HXMB 4I0CC 4MMXC 3PHOB 3C60D 4PTUA 3K1DA 1MRCL 3PWPA 5IB3A 3AY4C 3WFCL 5C9JB 4X9BA 2NR6D 3SO5A 1W8OA 4JFDB 2JELL 2WNGA 1EEZA 5IB4B 2JJSA 1FL3A 4LOUD 2X70A 2WZPD 1WCBB 5CJ8A 4XNXL 5EBLB 4XPGH 5CCKL 5HHOA 3ZO0A 4KTDL 2AJSL 1JPTH 4IOFC 3DSNA 1J9CT 2ERJB 2Y6SD 4JQXA 1GGYA 3S9DB 4WHYH 1ZA6A 1OWRM 4CAGA 2E7HA 3KYAA 4LVOB 3CFCH 1OP3K 5DQJA 2Z31C 5KJRH 5LGHH 3VD3A 1MF2L 3WKML 4ZUUB 3WFHB 1SJHA 3NTCH 1IM3A 5KVEH 2NY3D 3ULVF 2DDQH 4JN1L 3HC4H 4Y2DC 3NIFE 1BIHA 3VXNA 1QFWM 3VGDA 4QRUA 1RHHB 3KNBA 4PJEF 1HNFA 2H45A 4IOIB 4AEHL 2D31A 1B2WL 5F97E 1LMKA 3INUH 1CFVH 2H8PB 1H3VA 4G8EB 4PIRF 1PW3A 1I9IH 5LAXB 2CLRA 4LLDA 1F4WH 2ADFH 5E4EB 3BWUC 2DN7A 1DEEB 3WEXB 1UXWB 3FRUB 3ZKNC 4RDQG 3MCG1 3GI8H 3UYRH 3CSGA 1EHLH 2FGZA 5I15L 3MGTB 1HH9B 3IJHA 5DZOA 4JY5L 2V7NB 1PKQB 1Q9KA 2Y9RT 4J4PD 4UV4H 1JZ6A 4HGMA 3QR2A 4KK5D 4YXHH 5BVJA 1JGDB 2E7BA 5J8OA 1UFUA 1KJ3H 5I1EL 2EKSA 1RU9H 3MA7A 4OCLC 2SEBB 3FTGB 3JV6B 2R69H 4UNVA 5I1KH 4M6NH 2HT3D 1IM9A 1FGVL 2FJHB 3EFDL 1NGPL 2DI8A 2D4FA 4R4FH 3THMH 1NEZB 1PX3A 3PABB 1CZ8H 1I7ZB 4KY1L 4W81A 5I73C 1KXVC 5GS1A 1A1MA 4QTHA 4HUKB 5L2KB 1PSKL 3HI6H 1L7TH 3IFNL 4I0PC 2HKFL 1A0QL 1CDCA 1EXUA 5JNYA 5AZEL 1ZHNB 3AB0B 5ERWA 1OAZH 3AMLA 1H5BB 4H8WH 5IBLC 5JO5B 2YMXL 5GPRA 4DEPB 1P7QD 4B53A 1P7HL 5HVWA 1GIGH 5DC0A 2VNCA 1S7WB 2FYYB 4ZS7L 4NM8H 5IP4A 4L1HA 4K7PL 8CGTA 3BMWA 4EZMA 2D9CA 1QYGH 3WJJC 4JRXE 3L6FB 5IMKA 3ULUH 3GFUA 3LV3A 1YDPB 1BOGB 4HCRL 2BY0A 3R1GL 1A6WL 3BUTA 3KPQA 4LKCA 4RWHA 4URTB 3DMMD 2AKRB 4NQSB 3ULVE 3NFSL 1YY9C 1E6OL 3LAFA 4LLAA 1WK0A 4Z0BL 5F88A 1ZTXL 3X3FH 3GBML 3QH3B 3LH2H 3BP7A 2CRYA 4YO0B 1WIOA 1DQLL 3MBXL 4PJEE 3MJ8B 4JR9L 2VSCA 3IFOB 1JWMB 3O11B 2FBJL 1NSNH 4AENB 3L7FB 3S3PA 2FEDD 5L8KB 1VEOA 3RL2A 1UGNA 2VAJA 4U1MB 4F9LA 3RKDD 4FQJL 2OJZL 2AQ2A 2QL1A 1R3IL 1RV6X 3QEGL 1QVOB 1E28A 1BECA 4YIQA 2B1AH 1BP3B 4NM4L 1UM6L 1L9MA 3BH9A 3MRCA 4NNYB 2D0HA 3O6FA 1JHLH 1NGYA 2YUVA 4PP1C 4GUPB 4NQVB 4G8GA 2Z9TA 4I18C 2X6MA 4XBPB 3QAZB 1MAML 2VR4A 3L3JB 3QG7H 5T33L 4OZFB 2WIMA 1SHMA 1VFBA 2ID5A 2H9GB 3ZL4L 1E4XI 4I48B 4P46C 4HUUB 5MERB 4YGVB 4L3CB 3WHXA 3K1KC 3BD4A 2PXYA 3VXRE 3V0VB 2HKHH 3FQWB 3OWEA 3ARZA 4R8WH 4PUBH 4YXLL 5HD8D 4N0FB 5HGHB 5FM5M 2FBOJ 1A6VL 3VFWA 5FDWB 4YPGB 1Z9OA 1JI2A 3U83A 5I75C 5ANME 5T1KB 1B6DA 2GITB 3D39A 4MA8L 1RIUL 1TJIH 4NZRL 4JO1H 4JRXD 3FONA 4TVSa 1S9XB 3BDXA 4D9QE 3C60B 4P9HC 5H94B 2CGRH 2O5XL 5E9DE 3DO3A 4WFHE 5HHVL 5GRVK 4Q97A 4UB0L 2GUOA 2AEQH 2VLRE 4U6TA 4GH7B 5CIPH 4Z8FL 2AK1H 4P23D 3P0YL 3U0WH 3DXAD 4JM4L 4RX4D 4Y5YB 4S2SA 3ULVD 4QOKB 4UNTA 3DVFA 5DMJB 2DAVA 4QO1A 4Z7OF 1J1PL 5J3HC 5J1AB 1LNUA 5LGJA 1WBXA 3NIGF 4XCEA 3RQ3A 4LCCC 5C70A 4RNRA 4WNQB 3C6LB 5HJ3B 4QHKJ 1TQCB 4PR5B 4NOBA 4RGMB 2FCBA 4LPYA 2NY3B 3GMOA 4HWBA 4U6HA 3QHFH 3HPJB 2A9NL 4K2UH 3KXFA 3ZE0E 3B9VA 1ZK9A 2YD2A 1JYNA 3RFZC 1HSAA 4PJHF 4KDTC 1QFOA 3G5YB 5C0DA 2A6IB 4FQQB 4Q0XL 3D18A 4X5LA 5FO7B 1RZFH 1XGYL 4Y16A 2JB6A 4JZJC 3RRQA 1DANU 3IETA 4X8JA 3EYFA 5C0BE 2X4QB 2XKSA 1MCNA 3IAGC 3RPIA 1CQKA 1AJ7H 3LIZH 3UC0H 4O9HL 2B4CL 2ITDA 1A1NA 3H3PL 2R0KL 1UCBL 5DQDH 1CFNB 1B4RA 3OJDB 4BFGA 1DUYA 4KRMB 5FGCE 3VXRD 4XB7A 3W9EA 1KJMB 3TVMD 5FUCE 2OK0H 4IIQB 1OAKL 3AROA 2X41A 5CZXD 2JCCB 3WNMA 1FIGL 1I1YB 3JTTB 1Z9SA 5ELIA 2OL3B 1ZWIA 4OT1H 5L9DL 3DUUA 4NDMB 4D9QD 4FXGA 4UT7L 5DVOA 3DBXB 4WFHD 3MV7E 5B38B 4OD1H 4XP9L 3QDGB 3WFZA 2XZQH 4ZFGL 4Y8DC 3UJJL 4NKQB 4X6FB 2PW1B 4G6ML 2ZSWB 5BMFL 2YPLE 1RJZB 2EDRA 4EUPA 3PG2A 4OD3H 1H3PL 3TIDA 4FG6D 1HHHA 5DJ0B 5GIRA 5ILTH 3VGFA 5EZIL 4XC1L 1MUJA 3FB5A 1EJOH 2DBLH 2I26N 4HXBL 4CDGC 3IAPA 2A83A 3O8XD 1B0GB 1T89C 3F7YB 2Y1VA 1G0DA 3L5JA 4POZC 2H2PD 4JFXA 4IBLT 4XZUA 5HGDA 3NCMA 3SDDB 3SQOH 1J11A 1IAMA 1K9TA 2Q76B 5EN2B 4OCSH 3QUXD 3BDBA 2A2QT 3V52H 4WY7L 4Z7VF 3UTZB 1JYXA 1IRAY 4AQ1B 1EK3A 1IGYA 4KPHH 4PRDA 4Y19E 4F7MB 5TFSH 3RWHB 1G0YR 2VLJE 3GJFB 3QPXL 4NQCE 4Z7OE 2OR9L 4RIRB 4GG8B 5C0BD 3N85H 1UT9A 1SBBA 3NIGE 5AUMB 1DBBH 5GGVL 3QIBC 1BQHG 3CVHB 1MAJA 3DX8A 4X5WB 3VGBA 3I2CH 5CEXB 3QIUC 1Q0YL 1D6VL 4LCWA 5A16A 4FRWA 3RZCA 3PGCB 5B8CC 3WIHA 4P2OD 3VMOA 4IEFB 3DMMB 2I9LA 2CMRH 1RIVH 3JZ7A 3G5XB 4MDJA 4F33A 2R1YB 4LASL 1CBVH 1DEDA 2YSSA 3HZVA 2XY2A 4HBCL 4PJHE 4GKSB 1D5IH 3REWB 5D7JD 1CR9H 2AJXH 1FFOA 5EDXA 2EIBA 4RISL 4F57H 1CD0A 2F5AH 3GIZL 1JK8A 3HC0B 3VFGH 1CF8H 5E99L 1TZHB 5JDSB 2VLLA 4YHKL 1BVLB 3MV7D 2DQTL 2XRAH 5F7LB 5HHXL 4HGWB 1ZE3C 2EXYC 4QT5B 2VKWA 2BNRA 2XFXA 5EFIB 5EBGA 4WFGE 4LSRL 1MQKH 5ESAB 2YPLD 2R23B 4HJ0C 4QRRE 3SJVB 4TNVK 5E08H 3NMEA 5J11C 1BAFH 1Q8MA 2GCYB 3MR9A 4U1IA 4G7YH 1C7SA 5IESH 4P5KB 3U36A 3RGVA 4X7DC 3FFCA 4Z18A 2B2XL 4JFEE 4IRSB 5EORL 3IJSB 4OZ4B 3QISA 3UBXA 3WIIH 3WXVH 4FQ2H 5DJAA 2J88H 2HJFA 3O2DH 3H3KA 1VACA 1E4KC 1NFIA 2VXUL 4HPOL 2O5YH 5E1AB 3WKNA 5B4MC 1RVFH 1CLOL 4OFIA 3HI1B 4H1LH 3H7BB 2DLTA 1KENL 4GW1A 4Y19D 5JW5A 4G80A 2VLJD 4JVUA 2XA3A 5CGTA 1B88A 5D1XD 4NQCD 3S5LG 3FN9A 2AI0H 4O2FB 4LSDA 4WW2C 4JRXB 1N7MH 2E9JA 1DDHB 3MRHA 4L9LC 3QNXB 4R0LB 2WINB 3MLUL 4HJJH 4NO3A 1ED3A 3MLXH 2JTDA 4P23B 4GAFB 2UZIL 3QI9A 5EO0B 1QFWI 4I3GA 2QQKL 4HHAA 3GKZA 1HQRB 2DJSA 2QR0A 3U6RA 4KROD 3QXDB 4Z7VE 5AEAA 1QLRB 4MXVF 2YBRB 3U7YL 2IANE 3C9NA 3DVNB 3TBVA 1BFOA 2LTQB 1JNJA 3B5HA 4M8QB 4TRPH 3C2SA 4PJEB 1CDIA 1NJ9B 1P1ZB 3SDXA 5EOTB 2HWZH 5DD0H 3I6LE 4HZLA 4WEMB 3BJ91 1G6RH 4PJXF 1OQOA 5GS2D 4F15B 3BPLB 3Q5YA 2IQ9H 2FEEI 4WFGD 1A4JA 4K3EH 2GJJA 2BVTA 1DE4A 3IKKA 4U6VL 5EUKB 4QRRD 4DCQB 1AGFB 4OLXL 5M7QA 5KJRL 5LGHL 3MRIA 2ADGA 1XGRB 2DICA 4IMLA 3UXFA 1B3JA 2G5RA 3NTCL 3WE6B 1ZEAH 3QUKB 1VPOH 1DQJB 4YAQB 3M8OL 4JFED 4NNPH 2DDQL 3HC4L 5DJDB 5E24E 5IBTH 3LQZB 4X4YA 5HYQA 3G5VA 3W0WA 5L6YH 3EZ8A 5KS9A 2ZG3A 1KEMH 3P77B 4C54A 3UTQB 4MA3B 3TFKC 4YX2H 4PJDA 4PRIB 3TVMB 2N4IA 4N8VG 2DQCL 3BAEH 3OKNA 4JLRA 4OQ1A 1F4WL 5ANMB 2ADFL 3AVEA 1G1YA 1WBZB 3OXSB 4HC1H 4L3AA 4O58L 5E7FA 3SE3A 3VWKD 1OTSD 5EU4B 2W9DL 4YDVA 4TUJA 3TLRA 1BVKB 2CKBH 2R2HB 5E9DB 4EOWH 5ITBL 4N1CA 4MAYD 2VLRB 1XCTB 1KIPA 4TSAH 3GI8L 5I76A 3UYRL 3ARFB 3UTSE 1UXSB 3PXJA 1HQ4B 1QG3A 1C1EH 4FOMA 5D9SA 3WFDH 1VA9A 3GMPA 2GTZB 4PGBA 5JPMB 3QCTL 3MV01 3BT2H 4YXHL 5IMLB 1NGXA 2HH0H 5DJXB 2IAND 1T1YB 2AP2A 1RU9L 4ZNEA 1NBYB 3O8XB 1XGUA 2R69L 3L95B 2GJZB 1EGJH 4LHUG 3B9KB 4LLMA 1BD2E 2BMKA 2P42B 3ZDZF 3GSUA 3I6LD 3ARUA 3KPMA 3VFSA 4F3FA 2P7TA 4R4FL 3TO4C 5D71H 1K5NB 1UG9A 5C0JA 1CXFA 4GRLB 1F4AA 1PGRB 2DTSA 3D25B 4N9GB 5I1AB 2EICA 3EHBC 1IAOA 3G04A 1BJ8A 1NCNA 1J8KA 4ESKA 4N0UA 4B7LA 3FFDA 4M4PA 1UH4A 3RVVC 4DUVA 4LLYB 5GGVY 5ESQB 4G43B 1NH6A 4CW1A 3L3OA 3R8QA 3EIFA 4B5EA 3OSKA 1OAZL 1O7VA 3PGDB 1G7JB 4H8WL 4KJYB 2BNUB 2QTEA 1MQ8A 2HAZA 3MXVH 3RNKA 1GIGL 3I6GB 3QZWA 2RGSA 4M02A 4XRCB 3NAAL 5FGCB 5EWIL 4ZAKC 3EJZD 3CAFA 5JOEA 1MVUA 5M95B 4L4VE 3ULUL 4APQA 3ILQC 4PJGF 1A7OH 4E42B 3PL6A 4RBPH 3S37H 1LD9B 5IVOA 1LO5A 4ZUSA 1W0WA 2R2EB 3BUYA 3KDMB 3R0MA 4O51B 3LKPB 2XA8H 4R3SB 4RGNC 3KLHD 3MV7B 1VGEL 3B8YA 4JRYA 4PB0H 5D7LE 3IAQA 4XMPL 3D87B 3UTSD 3X3FL 3ZKMD 2YPLB 2PKDA 4LMQI 5I1CH 3VFOA 5SWQA 2UYLB 1XGPA 3PWJB 1D6EB 4PGCA 3E3QE 2R1WA 2EYRB 1NCDH 2NCMA 1NSNL 4HCRA 4G42B 3DIFB 4NWTL 1KIRB 1JV5A 1IC5H 5DJ2B 2PYFB 5TF0A 3O4LA 4HKBA 1KJ2A 3VGHA 1NUGA 1BD2D 2JF1A 3IDGB 4OFDA 1RURH 2B1AL 5C6TH 1R3JA 5E6ID 5I74B 2NY5L 2W07A 4QRPE 4DGVH 1FBIL 4OIIL 2EZ0D 2PCPA 4NO5B 1R5IB 4PJAE 4OGYL 5CHNB 4GOSA 2V2WA 3CFIC 4PGEB 3QG7L 2VLJB 3VFUA 1R3HB 4O2CB 5F89A 3WN5C 1WWCA 3HG1E 1ZV5A 1QUNA 1YEDA 2WUCH 4P2CG 2R9HD 2PTTA 1P84K 5C0FA 5ABDE 2HKHL 5MENE 1PKOA 1S3KH 1S9WA 1EEQA 1MCJA 25C8L 2FNBA 3VD7A 3G6AB 2C9AA 3ZDZE 1TJHL 2BVUA 2IF7A 2CK0H 4XPFH 1AGCA 3MRGB 3ULUC 1EVUA 4N0CD 3UPCA 1TZIB 4KROB 1TJIL 1M05A 2R29H 4YUEL 3RGHA 4IJ3C 4L4VD 1FV1B 2NTFB 3BZDA 3LKOB 4HKXB 4FQHB 2R2BA 3SDAD 3WJLA 3CFEA 3GMNB 3MJGX 5LWYL 3AU1B 1OGAE 5FCUH 3MUHL 3U0WL 4ZDHA 4AIOA 3HRZB 4PYHA 4X6DA 1F97A 3RWJB 1UB5B 2P5WA 3ET9F 2GW5A 5D7LD 3TPKA 2LU4A 2V7HB 4D0BB 4LIQE 2FLRT 5C08A 2QKIA 5JXAH 4XHJC 3OKLB 1S7XA 1SJXA 3FQUA 4HS3B 3IRPX 1ZANL 4HXAL 7FABH 2D3VA 2HFGL 5CSBA 5T5FL 4Q2ZA 1OSZA 2WBWB 2NXZD 3BYYA 5DK2A 2CDFB 1XF2B 2XWJA 1XIWA 1INQB 2NY5C 2J8UF 4KDVA 5K93A 5GGRY 2DQIH 1TPXB 2NNAB 4QRPD 4CMHB 2NXYD 4ZXBA 3RAJH 1A3LH 3IGAA 4G6FB 3T0XA 4TVPL 2W59A 2WIIA 1DANT 3HC3H 5E8PB 2JLLA 3LIZL 2VJXA 2VLKE 3STZA 2A9MH 3UC0L 3D2UA 3HG1D 3DOSA 3VWKB 5I1GH 1K8DB 4MWFA 1QR1B 5DQDL 5J1TC 2AS5M 1A6UH 1L0XA 4MAYB 1CT8B 2VUYA 4X4XA 1QA9B 3P11L 4HKJB 4F37K 5MEND 1RY7B 4GRWH 1A2YA 4N1HB 5HGBB 3N1PC 2FRGP 4I9WE 3T3MF 1XF4A 4HWZA 1F3DH 1HEZA 4AM0B 1F11B 4LSVH 1KFAL 3GMRB 3BPCB 2VLME 4G5ZL 4JGJA 1T2XA 3QQ4B 1L6ZA 4PY7B 4YEEA 1Q0XH 4OD1L 3W39A 3RVXC 4F8TA 4MJ5B 1OGAD 2G9HA 2XZQL 5F1NA 5CLTA 5DRXA 1KCSH 1A6TA 5J6GA 4OD3L 2D7PA 3GSNA 1EFXD 2HT2D 5L8JB 1XF5A 2BOBB 1MH5A 1U8KA 1EJOL 2DBLL 3VA6A 2AEIT 3IDJB 3P30H 1AGDB 2HLFC 4MJ6B 5I16A 1T2JA 2V17H 3WNPA 3FB8B 2DLFH 3BKJH 5DDHB 1BX2B 2B1HL 3FHAA 4FXKB 2PR4H 4JFZH 1G84A 1R6VA 3O3BA 4MNGE 5DSCA 1BQLH 1W72L 4OCSL 4NN5C 4XCYB 4XCNA 4AY0A 5CAYB 4WO4D 5HHQA 3WO4C 1OD9A 1ACYL 1I8LC 2ICES 3VFTA 4J3WA 5FHAH 4EBQH 3TZVD 3MODH 1CDYA 4R90L 4QGYA 4ZPVA 5HPMB 3QUMB 2LVEA 3BH8A 1CQYA 1WTLA 3L5HA 2VISA 3LN9A 5CP3H 3OR6B 4XPTH 1F13A 1P84J 1RJYB 3S4SB 5AZ2H 3MRQA 1FVCB 5IEKA 4GSDH 3N85L 5H2BB 4M7ZC 4JJHA 3PV7A 3QO0B 4NN7B 2ATKB 1U8OA 1IKFL 4J3OC 2VLKD 1Q9WB 4MD4A 1RZKH 3RA7H 2DKUA 1MJ8H 5DD1H 3NIDE 3B6SA 1HHGB 3DYOA 2YN5A 3SDCC 3QG6A 1F90L 2J8UE 1CBVL 4I9WD 2PO6A 3I02A 3LDBB 2R8SL 3HI5H 4ZUVA 4RQQB 1CR9L 2HFEA 3D3VA 5FGSA 1TVBB 3P4NA 2OCFD 3VFRB 2VLMD 2F5AL 5TE4H 1CF8L 4BFBD 2DQFA 3GB7B 1I8IA 3LEXA 3EYQD 4RZCA 1FDLH 3NPSB 3Q48A 3EFFA 1QRKA 2ZWLT 1UQSB 4JRWA 2XOTA 1UJ3A 1F4XH 1MQKL 1BD2B 4R4ND 3C2AH 5E6IB 3BKMH 1F3RB 4GKNB 2CXGA 3T1FA 1R5VB 3ZYIA 4QXTA 1BAFL 2Q86B 1AGBB 4G7YL 3HAEH 2APTA 3V4PH 4N9OB 1NEZG 3RVUD 4PJFF 5E8OA 3TYFB 1BWMA 1QD0A 4WENB 5CSGA 3WXVL 4FQ2L 1S7SB 3O2DL 3CSYB 4H88H 5L7XH 3ESUF 3BX7C 3GRWL 4OLVH 1CVRA 2O5YL 3V6OC 4K3HA 4ETQB 5IWLA 2YA2A 1MHPH 1ZGLP 1RZ8A 4OUOA 4LVOC 1RUQH 1N3NA 3ZTNL 1T21A 3AAZB 2I5YH 1KF9B 4P4RB 1EHAA 1YN7A 1P2CA 4LPCA 5KAQG 3ARBD 2C4XA 3H0TA 4M61B 4PBVC 1UVQB 4RA0C 5DEZA 2P8LA 5BV7H 4OI9A 5T1LD 2Q8BH 3T0EC 4JN2B 1PYWA 1INEH 1DVFB 3MNVA 3E6FB 3MLXL 5TE6H 1MJ7L 5IKCA 4HIIB 5E2VL 1AO7B 1I7TB 2FD6H 3V6ZB 2AQ3A 1KPRA 2GJ6A 1PG7X 3MLTA 3V8OA 1ZHBA 5EO1B 2UWEA 1JHTA 5GRUL 2HRLA 5GJTH 3VJ6B 1EERB 43C9A 5EPMA 3DUSA 1NGWA 1JN6B 3QJFA 4M5ZL 2BVQA 1GVIA 1ZHKA 3FO9A 2C4FT 2QADC 5EOCJ 1QQDB 5EULV 3JWDL 3ZE2F 3BP6A 1DSFL 2NXZB 3NFPB 4ZUWA 3ZYZA 5JORB 4L8CA 4PRAA 1UC6A 4OIAA 2DQHL 4LARH 1MNUL 2IQ9L 1CI5A 1IKNC 1S7TA 1RZJH 2OBGA 4K3EL 3MCKA 3O0RL 5GSRB 2OP4H 1UWEL 4QRPB 4U1LB 2NXYB 4EDXA 3BGMB 1RFDH 4PJAB 5ENWA 1KCVH 5IOPA 4FQCL 4QRSB 1U3HB 3KXFE 3WLBA 4Z0XB 4NNPL 4XMKH 1XGQB 1FGNH 5IBTL 2L0DA 3T65A 1M4KA 3BXNA 5L6YL 2AV1B 1H15A 4NO0A 3HG1B 2YUZA 3RWIB 5D1QB 5DJYB 1K2DB 3LS5L 4K9EL 4PLJD 4YX2L 1RJLA 1DN0A 2DM4A 4XC3H 4Y8AA 4U33A 1F2XK 4U7SA 5MENB 1NUNB 3CDGA 1AHWB 4MJIA 3BAEL 5DHVB 4NZTH 3MRDB 3C6SA 3IDXL 3RY6A 1FZMA 2G75B 2AJ3B 4Q6IC 5I8OL 3KYNB 1RD6A 2A0LD 4U1KA 3FL7A 3MRFB 1GZQB 1VKXB 3AB0C 2CKBL 1BEYH 4PJFE 3MYJA 4PRBB 1T6WA 5BS0A 1OGAB 1PY9A 1WZ1H 4L9DA 2F53B 2Z4QA 1JZ8A 1C1EL 5J4MA 2XI9A 3VXOB 3WFDL 4A2MA 4Z77A 4PJBF 2AK4E 4KMQA 4I2XA 4K3JL 5IB3B 4I1NB 2HH0L 5IFHH 4YGAB 2A77H 5DUBB 1DLHA 3D0LA 4HUXA 3DYMA 3NCEB 5KSBF 3JWDC 3L3KB 3BGFC 2I60L 1CIUA 2NY2C 5EUOA 4JQVC 1HHKA 2ZUQB 1RUKL 1JPSH 3REVB 3DNKA 1BFSA 4XNZB 2VB5A 4YZFF 5D71L 4HIJA 1FCGA 2J8OA 5D1ZD 5T3ZL 4XAWH 4WO4B 1DQTA 1AR1C 1BBJA 1WAAF 1ZA6B 2VITA 5D7SH 5DD5L 3IDUA 1WZMA 1X3DA 5MEQB 4NP4H 2ZZUT 4UILH 2FWOB 4OFPA 1SJHB 4M00A 1IM3B 3TF7C 2D7QA 4ONHA 4EI6A 1CU4L 3PWVB 4GAJH 4M7LH 1JZ4A 4K9EC 4IDJH 3EJYD 4QRUB 3MXVL 3KNBB 4MHHG 3ZE2E 4Y16D 1MOEA 1TTFA 3CK0L 4Y4FA 4MXQD 3RHWK 3KPOA 4P5TA 4LHUA 2H3NA 3EO0A 2CLRB 4LLDB 4IMKC 2DJUA 2VZ1A 1A7OL 3EYVA 1DQML 5L0QC 1LVEA 2ATPA 4BH7A 4OSUH 1YEJL 3S37L 3ISWA 4GAGH 4U3XA 4CMMA 1U95A 2BNQA 2XA8L 3FQRB 1PQZB 1T4KB 1UADC 5IT2L 3Q3GA 4U1SA 2L7UA 5E5MA 4AZ8A 4PB0L 5JW3H 4OCRH 5DMIH 1MJUH 3KHOA 4EJ1C 2X2YA 4UV7H 3IJHB 3UZQA 3QP3A 1Q9KB 5I1CL 1LE9B 1N59A 5GS0H 5GRZA 2JJTC 5BVJB 3KPPA 3RWEA 2CK2A 2AK4D 2MOVA 5DURB 2EKSB 4KKNA 3MA7B 4PLNC 4P2RE 5CD5D 4I4WA 1HDMB 5IK3A 5HY9A 4U05A 2HMIC 1S9YA 5E2UH 3KG5A 2F58H 2VDRH 3GHEL 1FFNA 3IF1A 1RURL 4OF0A 3S3SA 5C6TL 1N5YH 5HXMA 4HUVB 1V7NH 1U6AL 3T4YA 2C3GA 4JE4B 3CJJA 5BW7A 3MOBL 4D9RE 5GS1B 1A1MB 1JE6A 4K7FB 4ODHL 4QTHB 3UTTE 1EBPA 4OI7A 2R56L 3C6LC 4JO4H 5HI5D 3UBXI 4GMTL 1IEHA 1CICD 1T1ZA 2CUHA 5JNYB 4PJBE 3LHPL 1NLDH 4M7KH 2WUCL 5DD3H 5JUEH 3WSQH 3T2PA 2VOTA 5KSBE 2O5ZH 2R0ZH 1HYSC 1CG9A 3U1SL 4NSKA 3HCVA 2ZKHH 4W6XB 1RUAL 4PJCA 5JR1H 1E4JA 1G7PA 2GSGA 4NFDA 3S36X 3L5XH 4LSQL 3NZ8A 3LV3B 3UROR 1NGZA 1WAAE 2XTLA 4X98B 3QEUB 4DQOL 3MREB 2FL5A 3N9GH 2ZSVA 1NFDA 1RPQA 3CVHL 1R3KB 1XR9A 3KPQB 1EUUA 5FCUL 4KKAD 3JVGC 1JNHA 3IFLH 3MGOA 4RDQF 3UJIH 2FX8H 2EDJA 4GBXC 5IVXF 3GEWB 4TTDC 4IIQC 2YOCA 35C8L 5H8DA 3GSRA 1QRNA 3BP7B 2HT4D 5FKAA 4NFCA 3DRTA 4JPWL 5FYJE 1I1AA 5IBUG 4WV1A 4RMUA 3T04D 4OM0H 4YHIA 3UEZA 3HMXL 1T03H 1QPPA 1TNMA 3UX9B 7FABL 5IW1A 4X99A 3BOVA 4P2RD 1CE1L 5EIIB 3RL2B 1K8IA 1JTOA 5CIPA 3WFEL 3TBSA 1UZ6F 4Y4HA 1Q72H 1E28B 2XWBA 4M6AA 3Q6GH 1BLNA 2AJZA 3BH9B 4JKMA 1P6FA 1UKTA 3MRCB 5ID0A 2NY0C 2DQIL 3O6FB 3VWJA 4Z7UA 2R0LH 3X14A 4D9RD 1GPOH 4G8GB 4MJ4A 3RAJL 2CIIA 3UTTD 1L0QA 3SY0A 2IG2H 4CU8A 4UAOC 3HC3L 1VFBB 4LEXL 4DKEH 2AXFA 4BFIB 2A9ML 2D7OA 2CDGB 4HKZB 4FZ8L 1EX0A 2HVKA 3SDDC 3WHXB 3GSVA 4JGMA 2PXYB 4IOFD 5FB8A 1A6UL 1WT5C 1P4LB 4PBWD 3MLYH 3K2MC 2CRMA 1OW0C 5KSAC 3I84A 5KZCD 1KTDB 1GGCH 4IRZH 5E1HB 2YA0A 2VZOA 1MFCH 2EDFA 1T0MB 2MCG1 2Z31D 2D4DA 1L0YA 3GBLA 4LKXA 2D7MA 3DO7A 3D39B 4LSVL 5C0EA 3C5ZC 4EI5A 1ULVA 1BREA 5GHWH 2F74A 1M7IB 3QQNA 1FNFA 1FNEB 3SE9H 5C0AE 1Q0XL 4M3KB 2XN9E 1BQSA 1ZLSH 1JTPA 4S2SB 1KCSL 3KYKH 3VXUA 1FNGA 4YHPA 2VAAA 1EAPA 2MHAA 1LNUB 4RWYH 4LLWA 5D1ZB 1NC2D 1T7VA 4XCEB 3R06B 1FCCA 2J5LB 4HMDA 3P30L 4RNRB 4ZSOA 2V17L 5FYJD 4DWHA 3BKJL 4FQPA 4DW2H 1FZOA 2EEBA 3BMVA 3ZKND 4U6HB 4H0HB 2FEDC 2UY7A 1BQLL 3KXFB 2HVJA 3HZKA 3MLSH 3OPZH 1JNLH 1HSAB 5C0DB 3V5HA 2DOCA 3D85A 5FHAL 4EBQL 3OKMA 2WV3A 2XZAH 1JGEA 3D18B 5DEGA 1O5DT 4Y16B 2VIRA 2JB6B 5JDJA 4XPTL 3IETB 4X8JB 5DHYA 2KZWA 3EYFB 5IVXE 2QSCH 3W2DL 4OZHA 5CSZA 3RPIB 4IRSC 4MCZA 1TVHA 1V7MH 5EZJA 4EN3A 4GXVH 2ITDB 3RA7L 4BSVA 1SMAA 4M6OH 4H26A 1MJ8L 3EOAA 1OWWA 5DD1L 1DUYB 1C5DA 1E4XL 4KVCL 1UZ6E 4M1GH 4PG2A 5F6IC 3B43A 5TPWL 5JHDE 3VGAC 2EDNA 4FTVA 3IFPB 3QXWA 4H5SB 4O4YH 3HI5L 1ZWIB 4HEPG 5CWSA 3TN0A 1BF2A 4I0PD 2CQVA 5ETUA 5F3HB 2AK4B 4FXGB 4I3SH 4J3VA 5TE4L 4WGVB 3O3AA 1NAKL 4TYUA 1M7DA 5IBLD 4R0LC 5C0AD 1FDLL 4XWGL 5K9OA 3EOBB 3MRLA 4L3EA 3DGGA 2HA1A 2XN9D 1LE5A 1WC7B 3PIQA 1F4XL 1Y6KR 3TIDB 4WCYH 3C2AL 5GIRB 3MV8E 3MRBA 1MUJB 5B39B 2DQDH 1VSCA 2A83B 1NUFA 3V4PL 5T5NG 4JFXB 3FN3A 4ODVH 1U42A 3QUZA 4XZUB 1CICB 1NC4D 5HGDB 1S7QA 1CFSB 4FP8H 4DVRH 2HFFA 1DQDH 4GAYA 4P59H 2CJUH 2Z8WC 3LOWA 3ROLA 5L7XL 2LAGB 1YY9D 3BPLC 5FYLL 2XNAA 4ZQKA 2OTPA 5KVGH 1YEFL 1IKNA 4MZ3A 2K7PA 1IGYB 5AWNH 2A6DB 3BIAX 4NZUH 1U92A 2BCKB 1FL6A 3DX8B 5BV7L 2Q8BL 2VSDA 3O2DA 3FOMB 4K55A 2P8PA 4MLSA 3RZCB 5JW4N 5TE6L 2IBZY 1K4CA 3UO1H 15C8L 4V1DE 4K23H 1I8MA 4PP1D 4H1LA 1T1WA 4JAMA 4OM1H 3S98A 1NKOA 2YSSB 3HZVB 1UACL 5IROA 5JHDD 3FAWA 1CIDA 2BSED 3R0NA 4M1DH 2Z35A 4PRPE 1JVKA 4YHML 3CUPA 3WUWB 1HKFA 1OAQL 4P46D 1JK8B 1HSBB 3TA3A 4OQTL 5F1SA 2VLLB 3ZDXF 3MJ7A 2W0FB 2WK2A 5HHPA 1BZ9A 4LARL 3P4MA 1FYTE 1QACA 3ARFC 4NC0B 4MAUH 2FDBP 3KR3H 3RIFK 3LN4B 5C08E 1T5WA 1G7HA 3OB0K 4WTWA 2X89A 3MV8D 1VFUA 4WVRA 2OP4L 3MR9B 4LCUA 2ITCB 3U36B 3RGVB 4QHMA 3NCJH 1KCVL 3QXUA 3UTTB 3B9KC 3MUZ1 4M6ML 4NPYA 1FGNL 1LK3L 5GRJH 3CU7A 3UBXB 3WL9A 1AFVH 4OZIA 1IVLA 1QSEA 2HJFB 1FVEA 2C26A 1G6RA 1VACB 1ZA3A 4PJBB 4U4BA 3K8KA 3ES6A 2QJDA 4MD0A 1KELL 2Q8AH 4Q9BA 5J3HD 4GRLC 4XC3L 5BO1H 1YMHA 1F6AB 5IJKC 4WW2F 4UTBH 2PETA 5KZCB 4XBGA 3IDMA 2E5EA 5JW5B 5D6CA 2Z31B 1XH3A 1OAUH 5J9PA 4PS4H 4WTXA 2QEJA 4K7PX 3O3DA 1O0VA 2J4WL 2BVOB 3DV4A 4TUKH 1CL7I 1G9MH 3ZTJH 1AKJA 4EQ2A 4XNMA 1FZKA 5C2UB 3FB6A 5BOPA 4NO3B 2VXVL 1ED3B 4Q9CA 2W1NA 3J8F7 3OX8A 2EECA 3GJFK 5LG1A 4M7LT 3P0VH 2AJUL 4BQBA 4UT9H 3QI9B 4V1DD 2B0SH 3ME0A 4HHAB 3T0DA 2ADIA 2QR0B 2VH5H 2CLVB 4JFOB 1SJVA 1J87A 5C92A 3SE4C 5BRZE 1NC2B 4QHNB 4ZYKA 4Y0GA 4NYLB 2RB8A 1CFTA 2B5IC 5HVGB 5IFHL 3TBVB 1BFOB 2A77L 4PRPD 3C09B 3KPSA 4HC1A 4LQ1A 1EZVY 1DBKH 4XNYL 3VXSE 4ZFFA 5DS8B 2CKBA 4AEIH 4HZLB 5TQ0H 2X4OA 4G8FA 1JPSL 1JIBA 4JCLA 3KPRE 1FYTD 2OTUA 4FQ1H 4PV9A 1JNNH 4XAWL 4U1GB 5D7SL 1L7IH 2X9WA 4W4OC 5F7UA 4NP4L 2MTPA 5E2WH 2ADGB 3BP5B 4ZO8A 4IMLB 2MSPA 2IADA 3LQAL 3D69A 5JQ6L 1T83C 2YXMA 2ENSA 1T7XA 4WDIA 1OP9A 1EGJA 4OLUH 2BOCA 1YYML 3I3DA 3NN8A 4JDZB 2EDYA 4X4YB 5HDQH 4M7LL 2DD8H 4KDWA 3RDTA 4LAQL 4OGXH 4NGHL 4IDJL 4YH6A 4KFZC 3P40A 4OCYH 3ZDXE 2VDQH 5MHSE 3TBYB 4GJTB 1FORH 5DGRA 3QDMA 5LKNA 1YMMA 4YBLC 3OKNB 3S97C 4QHUA 4JLRB 4YHNA 3WFBH 4POZD 4MA7L 4WWKA 3DVGA 4I0PB 4HFWA 4OSUL 3WV0A 1E27B 4YDVB 4TUJB 2E6PA 3V95A 3GBNH 3OB0H 1IGCH 1KIPB 5I76B 4O02L 1GZPA 5JW3L 2VO5A 1MJUL 4UV7L 1XCQA 5D9SB 4PGBB 1TLKA 5GS0L 4HF5H 5DYOB 3KJ6H 4YEFA 1AXSA 3VCLA 1NGXB 5BRZD 1QFWL 4PJ9C 1E4WH 3QIBD 5HYJA 3CSPA 1XGUB 2Y7QA 3QIUD 2XG5A 4OLEA 3M07A 3VXSD 4V2BA 5F7EH 4LLMB 2BMKB 4CN6A 2F58L 4BQ6A 2VDRL 5TE7H 3QWOA 1NC4B 4P2QA 1ETZA 3KPMB 3VFSB 4W68A 3JWOC 2IH1A 4JM2A 1NCWL 1P9MC 3KPRD 3OB8A 2V5RA 1X5AA 3DX7B 4OF3A 1IAOB 4LU5H 1GSMA 3G04B 3LQAC 1RZGB 5C0IA 3L9RB 4N0UB 3FFDB 2FEEL 1I3VA 4ZNCD 4JO4L 4WFEE 3GJFH 3L3OB 5CJXA 2B39A 1A9BB 3HS0A 3OJVC 3CFDA 5JUEL 2EYSA 3O41B 5HTSA 3KPNA 4X5XA 3UPRA 2EXYD 1S7UA 1MRFH 4KUCF 3GSQA 5HYFA 2D03H 2O5ZL 1MWAH 3QZWB 4HJ0D 43CAB 1DFBL 4L4TE 2ZKHL 4UINH 1WJ3A 5MHSD 3PP3K 1SVCP 4RCAA 5DVKA 2DBJA 4X9HA 5EUOF 5JR1L 1HZHH 3QUML 1BFTA 1N8ZA 3L5XL 5JHDB 4L1DA 1AD0B 4LCIL 3NABH 3CMOH 1A6AA 1S5IH 3BZEB 4P9ML 1LO5B 4ZUSB 4P46B 4KTEL 2R4SL 3BUYB 4LEOA 1UEMA 3CFKA 4KXZI 3MBEA 3Q6FB 1U91A 3WS3A 5B4MD 2FX8L 4NN6C 4DFHA 4LDEB 3IXAA 1ADQL 4LF3B 3VFOB 3DRQA 1U8MA 3OF6A 3RY5A 4PGCB 5D5MA 2R1WB 2QSVA 1X5YA 5IHZA 4U1HA 5C7XH 3LEVL 5GGTH 1N0XH 2DMBA 3P4OA 3MV9E 4AQOA 4X6BA 1W8NA 1JV5B 2F54A 5JW4R 3O4LB 4HKBB 1KJ2B 3MLVH 1MCQA 2CR3A 1R3JB 2Z92A 1P53A 4AIZA 2VDOH 1A1OA 1WGOA 4EUPH 3MRRA 1JHKL 2PCPB 2R0LL 1AD9A 3SDYH 3ZKSD 5AAMA 3LEYL 4LCCB 4WI7A 2ZPKL 2V2WB 2IG2L 4OD2A 4DAGH 4CNIA 2K9UA 5F89B 5HYSA 3NH7H 2E7CA 4GG6F 5I8EA 1YEDB 4ODWB 2C1PB 1J5OH 2N56A 3BN3B 2JIXA 4KK8C 3ULUF 5C0FB 3KVQA 1QSZA 3CLFL 4YHZH 1WBYA 1GGCL 1SYVA 4E41E 4L4TD 4RFNB 1MFCL 2ZCKH 4HV8A 2GIYA 4J23A 1T0PB 2H26B 3JBG7 3LKNA 3IXTA 3VFVA 3ULVH 4NO2B 3L5WA 4HWEL 1M05B 3Q1SH 1G1CA 5DJ8A 4UIMA 2RJMA 2R2BB 1IGIH 1I1FB 3QUYA 1IAII 3CFEB 2GFBA 4LSSH 4NQDA 4PRPB 3AGVA 4PJ7F 2J2ZA 1VERA 2W0KA 4ZDHB 4NQXA 2DQEL 2WBJA 4X6DB 3TFKD 2ZOKA 2UY6A 4NUGL 1KTLB 1I3GL 1FYTB 1U8IA 1UWXK 3V7AG 1CGVA 5C08B 2QKIB 1DZBA 4YJZL 1S7XB 4Z5RA 3FQUB 3A6BH 3VGEA 3BO8B 4UOW0 1MSPA 1OLZA 3AC0A 4OFVA 2J6EH 5EUOE 5MI0C 4Q2ZB 4DW2L 1OSZB 3JUZA 3BFOA 5EZLB 2RHEA 3MV9D 4RGNE 3VXME 2XWJB 3NPSC 1XIWB 4HIHA 3MLSL 3OPZL 4FFZH 3VDCA 2FJFA 3V6FA 3C08H 3GNML 1HHIA 2LE9A 2XZAL 4FQLH 5EO9A 4Z76A 2V2TA 4HJGB 1E6JH 3PDGA 1MCWW 3MZGB 5SV4A 4OGZA 4RSVA 3MLWL 1GJIA 3S35X 1C08B 3U46A 2WIIB 2EE3A 3MRNB 5JA9A 1MCOL 2VE6B 2OQJA 4KAQH 1HILA 2WAHA 5I8KL 3VI3E 4MWFB 4M6OL 3TO4D 4PRNB 4HQQL 3NGBC 4MB5A 5K59F 8FABA 1WFNA 1YC7A 2XKUA 3O9WA 3H8NA 1A2YB 4M1GL 4NJ9L 3EHBD 1EO8H 4FQXC 4E41D 5CP3A 1HEZB 5C9KA 5EB9A 3TBTA 3RVVD 2QQLL 1Y0LB 3RU8H 1V3JA 1W2KT 1J86A 4I3SL 1FP5A 4HK0A 1MFAH 3MGAA 4HWNA 4IRJC 4X9IA 2OYPA 3W39B 3QIUB 1QKZH 1J8HA 1DVFC 2G9HB 1JZ5A 3V9FA 3VXSB 5F1NB 1T6VN 5ADPH 5J6GB 4GG6E 4QGTA 4OAWA 3NCBB 3SKJL 1TCMA 3GSNB 3ULUE 1JP5A 2F19H 1MH5B 3KPRB 4ZAKD 4KUCD 2DL9A 1IZJA 4WJ5A 1MFDH 4KZEH 3RUGF 2BSSA 5I16B 5FO8A 3ILQD 2FR4A 3AUVA 4O5LH 1JGVL 2FX7H 1D5MA 4ODVL 4A6YH 1JWSB 1HXYA 4JVWA 4NWUH 3O3BB 4RGND 3VXMD 1FAKT 3MMEB 3MROA 1MFEH 3BW9A 4JZOA 2H32H 5HHQB 1J0YA 4M43L 4PJ7E 4XP1L 3QFJE 4BFEA 5D7KE 2P4AB 4JB9L 1MLBB 3QWRD 5AWNL 5DR5L 3HAEA 3L3DA 1BJ1H 2F15A 2NXYC 1KGCE 3VG0L 2GT9B 3MRQB 3GHBH 4G9FE 1G7LA 5IEKB 4GT7A 3CH1A 1U3HC 4A2LA 1U8OB 3STLA 1IC7L 3MXWH 4MLIA 4NHUB 4JHWL 4MD4B 1Y18A 4M93C 1H3WM 4YWGH 2VQ1A 3TT1H 3PWUB 4BKLB 1IT9L 5EC2B 5D1QC 4PJCE 2EE9A 1HOCB 3B6SB 4K23L 3G6DL 4LHUD 4WHTA 2W0PA 4XP5H 3AS3A 3QG6B 3HE7A 4I3RH 4OM1L 4DOHE 3IDNA 3I02B 2P5EE 2PO6B 3U2SA 1B0WA 3HRPA 1AQKH 5GGUA 5LXGL 4ZUVB 3BZ4A 2HFEB 3MNZA 5D2LA 3KJ4B 3E1F1 2DQFB 5DGQA 1I8IB 4RZCB 1S7RA 1R3LB 2GY7B 3EFFB 4ISVB 4M62H 1QBLH 4NZJA 4ZODA 4JFYA 4XVJH 1UJ3B 2DLGA 1QRNE 4QXWA 3KR3L 2K3TA 4ERSH 3LZFH 2O26U 4YR6A 3DVIA 1CK0H 3ULUD 3HNSL 2M2DA 3PQYE 4QXTB 2VL4A 2HT2C 5K59E 5DRWA 1QPXA 5K9JL 1YNLL 4QHKI 2YPKA 5T3XH 4J6RL 1LEGA 4R26H 5E8OB 5FECA 2DTML 2G5BA 2JJSC 4LSUH 3W81A 3VU2A 2OXGA 2XYCA 4HS8L 3SKOB 1EVTC 1FH5H 4Z7UE 1DP0A 1I9JH 1LILA 2VL5B 3DV6A 4JQXC 1RZ8B 3QFJD 4XVUC 5D7KD 3TH2T 2AJVH 4HFUH 5C3TA 1SY6H 1T21B 4TQEH 4Z7WA 3OKDB 1OAUL 1J12A 1KGCD 1YN7B 1Z3GL 4G9FD 2JJWA 3ARGA 4TUKL 3WD5H 1G9ML 3H0TB 3RUGE 5JIIA 2ZG2A 2P8LB 4U7MA 1D9KA 4S1RH 4LRNH 1ZS8A 1PYWB 2AXJA 3MNVB 3P0VL 5IKCB 2A74A 4FFYH 3QEQA 4ENEC 2B0SL 1KPRB 1GAFH 4OKVA 4TVPE 2DYPA 5DD6A 2VH5L 1ZHBB 2BZDA 4DN4H 2UWEB 1JHTB 5GS2H 5MEPA 3HZMB 1ROWA 1NCTA 2P5ED 3S3JA 5SWZE 2EXWC 3GDBA 1X5HA 43C9B 3AFLA 3DX9A 1KIUA 1L9NA 4DZ8A 3UTOA 2MFNA 4GS7C 3QJFB 4M48H 1N64H 3VE0A 1DBKL 1ZHKB 2NX5A 2Q3ZA 4YXKL 4XVSL 4AEIL 3WIFA 3BP6B 3MV9B 4PRAB 1F4YH 1I7UA 3Q0HA 1YC8A 2ICEA 3BVNA 1A7NL 3TCLA 1S7TB 4RMTA 5JXEA 2FSEA 1N6QH 1LO3H 4JG1L 3MCKB 2OJEA 5C2BH 1H3XA 1BGXL 1L7IL 2EDLA 4JY6A 5LBSH 3PQYD 4EDXB 5BJTA 5ENWB 1MIML 1MLCA 5IOPB 3FT2A 3L3IA 4OLUL 2IFFH 5JOFA 3RVXD 2JK5A 5HDQL 4XXCA 1X5GA 4U1NA 5H37H 5D8JL 1H15B 4NO0B 2K7QA 3BDYL 1XMWA 2E27H 3OTTA 4OCYL 2G2RB 4OCXH 3TO4B 1DN0B 3AREA 4IHOA 2EKJA 1FORL 3CCHA 3KGRA 5TF1L 3OAUH 2VDLH 1OCWH 4CJ1A 3CDGB 2HLFD 4NKOB 5GS1C 4MJIB 1T20A 3NCYS 2CDEA 3L3HA 3C6SB 1YEHL 1CLCA 3WFBL 2FO1A 2DM3A 2VERN 4BUGA 1FN4A 4GXUN 4ONFH 1PLGH 5L88H 1ZLUK 5KAQF 3PGFH 4Y88A 1G7MA 3ARTA 4EDWH 1N0LA 4NQED 2E7LA 1C16A 5FUZL 3V6OE 2VZ3A 2IWGA 1IGCL 4F7EA 1IGTA 4KI5C 5DLMH 5F93C 1GYAA 5GGRB 4M9PA 3VRIA 2C1OA 3W11C 1LK2A 3P9LA 4ZO9A 1IQDA 4TVPD 1SEQH 5CKAA 1EH9A 4HF5L 3VXPA 4ZOAA 5CBAB 4GW5A 4D3CH 1T5XA 1FRGL 1CLYL 3PWLB 1KXQE 3P9MA 4UDUA 5SWZD 1DLHB 2WUBH 3D0LB 4HUXB 4OB5L 1ORQA 1NQBA 3H9SE 3T0EE 3UMTA 5IB1B 1T1XA 2EEAA 5F7EL 5EUOB 1HHKB 3FQTB 5GXBB 3QXAA 2ZUSA 4J1UB 2H1PH 1CLZL 4TOYH 2EDBA 5KOMC 4IDLA 2YKLL 1SEBA 3SDCD 4CKVX 4Y4KA 1KC5H 1NBVL 1QLFA 4OCMC 4O2EA 3T0AA 3S34H 5FGBA 4HW6A 1TJGH 3CVIL 2Y06H 4K94H 1L4IA 4EI6B 1Z9LA 2KKQA 4PGDA 5EC1B 4F9LC 4Q6YA 1I8KA 3LMJH 4KRNA 4F7TA 1A7RH 3LPWA 1G9NH 2ZCHH 3NCYP 1IC4H 1MRFL 5CP7A 1FVDA 1UM4L 3QQ9C 3T2NL 3VH8A 2D03L 3D85D 3DSFL 4U6YB 2I25N 1MWAL 2QHRH 1PKQE 3IVKA 4MB3A 2V5TA 3O6FC 4Y4FB 1A5FH 5KW9H 4ZFOL 4LBEA 4DKDC 4G6JL 4LHUB 3EO0B 1HZHL 2XKNA 2CRIA 4R9HA 5HDBF 3ARYA 2EDDA 4X7CC 1KN4L 3EYVB 1JF6A 1QTYT 3CMOL 3ESVF 3NABL 3GZKA 4BH7B 3WN5B 2ARWA 1JYVA 5DJCA 2VDNL 2PTVA 2BHUA 1YEGH 3FT4A 4PJIA 4CMMB 2BNQB 1FFRA 2HJLA 2Y36L 2DQUL 2PXYC 3RX5A 3UYOD 5I9QB 1FL5A 4RAVA 3SKMA 1CL7H 3QCUL 2NY1C 3Q3GB 4U1SB 2ICWJ 5E5MB 3N1MC 1NDMA 3OJ2C 1BFVH 2LQRA 2FATH 1I9RH 4GG6B 4C56A 5IMOA 1H8SA 2XQBL 3RL1A 5JHLH 3MNWA 5L2KE 2A6JB 3O4OC 4KUZH 4U1JA 3KPPB 5C0CA 1YNKH 1YNTA 2Z8SA 1T0NA 3B2UC 5DA0B 3KPTA 2IAMA 4EUPG 3WDHA 4IJ3B 1N0XL 1WUNT 3L3GA 1GH7A 3VGGA 3H9SD 3T0ED 3FN0H 5TDPA 1NMBH 1Q94B 3EO9L 5EOQH 3IF1B 1KBGH 5DRNA 4PV8A 3V5DA 5HYEA 2AEWA 3VXQA 3IT8D 3T4YB 2VDOL 2YD6A 1XFPA 3SKNA 2V6HA 2MCPH 2ZJSH 5CS7A 4G6KH 3G6JF 5FUOL 2J5LC 5IMMB 2AJYL 5EU7C 4YPJA 3RWDA 2QQQA 4P0DA 3PXHA 5A2FA 4OZIE 1T1ZB 4X80H 3VRJA 1CXIA 3VFNA 2QADD 4HLZH 4OI8A 3NH7L 4FMFA 2X40A 1QFUL 5TH2A 4JHAL 5A2JH 1MRDH 4YHLH 1J5OL 3A67L 1JJUA 1TETH 1J0HA 3I3EA 3NACH 4XBEH 2EDEA 1PZ5A 1D5ZA 5GRWA 1CG9B 4NSKB 4NKDA 2ZCKL 2ESVE 4PJCB 4OF7A 3H9ZA 1G7PB 1ONQA 2V9QA 1HIMH 3TPUA 1C8PA 4RFEA 3NZ8B 4DOHB 1UB6A 1U8LA 4EIGB 4RMVA 1IGIL 5C07A 4LSSL 3OGOE 4QXGL 3FO1A 1WLHA 1XR9B 3PHSA 5DZNA 3DHMA 2JCCF 4R7NA 2DKMA 4P4KA 2X4SA 1JNHB 2OZ4A 1PEWA 4U49A 5CEYA 4MNHA 1WIUA 4NKIH 4UIKL 3RVTC 4MD5A 1OF2A 3EGSA 1QRNB 4MXWL 3GMLA 5FKAB 1LDPH 1RHFA 3DRTB 3KPSE 5L2KD 2YUWA 2GY5A 3A6BL 1QBML 4YHIB 3MLRH 3HE6A 3PQYB 5BQ7A 3C5JA 4M9OA 5IW1B 4NHCH 3K81A 4X99B 5C9JA 3HNVH 4OBSA 5CIPB 5IHUH 5HDBE 4JFDA 1N6VA 4Y4HB 1DTUA 4YBQC 1RZ7H 1BLNB 2AJZB 3WLWC 2OLDA 4NNXA 4F8QA 1HNGA 3MOAL 3U30B 4Z7UB 3UBXG 1I1CA 3KHQA 3X14B 1KB5H 5C6WH 2ZNXA 3SY0B 2P8MA 5MP6H 3OL2A 4OFYD 4JO3L 2N7BA 3GGWA 5HI3C 1F00I 3WFHA 2AXFB 2NY2D 5T3ZE 4KAQL 1A6ZA 2IQAA 2BC4B 5D5MF 3GSVB 3RUGB 4AK1A 5FB8B 1AIFB 4UNUA 4KJQC 5SWSE 1AR1D 1A02N 2IGFH 3BP4A 4EXKA 1HINH 1NCCL 3T09A 3HR5A 4KKCC 3WDIA 2ESVD 4LKXB 4ODSH 3DO7B 1YJDH 5C0EB 4PLOB 3RU8L 1HCVA 1AKJD 4G8EA 3G6JE 3BQUA 4LIQH 1R0AL 2BVPA 1A64A 5I19H 2NW3A 3VMNA 1F6FB 1KG0B 3RZCC 1RK1B 5JPNA 3F65A 1YPZA 1UXWA 3FRUA 3VXUB 1FNGB 4YHPB 1EAPB 2MHAB 4LLWB 3OXRB 4UBDD 4WI6A 1SYSA 1DLFL 4WW1B 1T7YA 3TBWA 4KZEL 4ZSOB 1A3RH 2BY3A 1UH2A 2DS4A 2FX7L 2VYRE 4NJAL 2Q7NA 1JGDA 4P2QE 4JQIH 1FZOB 4A6YL 3N1QC 4MQXC 3ULSA 4NWUL 2SEBA 4P57A 3OKYA 3JV6A 2FIRT 2CR6A 3CFBA 1XZ0A 2HVJB 2UUDH 1MFEL 3RIAF 2FJHA 1HI6B 5CJOH 3SE8H 5ACZA 5KVFL 3CC5A 3V5HB 3D85B 1YEIH 1JGEB 2IBBA 2JCCE 4JKPH 4OTXH 3PABA 5JA8B 4OGAC 2VIRB 2Q6WA 5DHYB 3BPOB 3OHXA 2V5SA 4LHJB 2FX9H 2DM7A 3RGVC 2X1XR 3GHBL 5BZWA 5I66A 5CSZB 4MCZB 5E8DH 2HMID 1G7IB 5FIEA 3RDTD 3RTQA 3QDGE 5EZJB 4J3TA 3MXWL 2DKSA 3SCMC 1W72B 5T3ZD 4YWGL 1R5WB 5ISZA 3EOAB 1J0ZA 1CWVA 1ZHNA 4QOKD 4FZEH 5SWSD 4D94A 4OJFH 4CU6A 1TNNA 1JF5A 5HVHC 1OB1A 3QQ3B 5KSVA 3C6LD 1MCLA 5CWSB 3TN0B 2YD8A 3HUJA 4HGKC 1YEEH 3K46A 1CGUA 1FLRH 4RMQA 3DGCR 3VG9C 1M7DB 1KB9K 5CUSH 3ROOB 3H9SB 3T0EB 5K9OB 4M62L 1KLUA 4L3EB 3DGGB 4XVJL 1LE5B 1HYSD 1PJ9A 3PIQB 5I18H 3QI9C 1IAIH 1JGUH 1PG7H 2AKRA 4ONGH 1EPFA 3BE1H 4NQSA 4ERSL 3LZFL 5D5ME 4LPTA 2DQGL 3MRBB 4RMRA 5GGSY 4MJ2A 5J13C 4XPAH 2DWEA 3QH3A 4LLQA 5MEOB 3GK8H 4HAGA 1D5BA 5T3XL 2RR3A 4LGSB 3IU4H 4YDIH 3C09C 4Y2OA 2R4RL 4LSUL 4HPYH 4P2QD 1S7QB 4AENA 4BK4A 1CTOA 2QADB 2HFFB 3FOLA 3L7FA 4HIXL 4L8BA 1K4DA 1GHFH 1WITA 1AR2A 3EO1B 3LCYA 4U1MA 2BDNH 5BZDA 5EA0H 2XNAB 4GBXD 4ZQKB 4TTDD 1F02I 4ODTH 4TSCH 4U1GC 3LPGA 4D8PA 1H8OA 4LLUA 5D2NA 5F7KC 2AJVL 4HFUL 5BVPL 5DC9B 2YZ1A 4KHXH 4TQEL 2I07A 2ZUUA 2X1OA 3EYSL 4NQVA 3QZWG 1DBML 4JO2H 1FL6B 4F58H 1MEXL 1G7QB 3L3JA 4OZFA 4S1RL 3QDGD 4LRNL 2H9GA 2P8PB 4I48A 4HUUA 4KK6C 4ZS6C 2NY0D 3SJVE 1I8MB 4FFYL 3FQWA 1T1WB 1GAFL 3RWGA 2X1WL 4N0FA 5HGHA 4LQFH 3I75B 2ZUVA 1N4XH 1Q9LA 5FDWA 3S8WA 4KWUA 2NY7L 5DF0A 1U3YA 2Z35B 4XXDB 3CUPB 3WXWH 1M1SA 4M48L 1N64L 3OV6A 2NY4C 4Q6IB 3SE3C 3TA3B 1S9XA 5EBMB 2VXSL 3C60A 3SDDD 1U36A 3MJ7B 1A7PH 1IJ9A 1QNZL 3ETBF 5HHPB 1BZ9B 5L2JB 4K8RL 3QHZL 3RZWA 4JY4B 5KSAD 4ZOCA 5I6XB 4PY8I 3LKSB 1LO3L 1T5WB 3OF6D 4K3DL 4LGPB 5DO2C 2IPUK 2CO6B 3BWAA 5J1AA 3VD4A 5LBSL 4M5YH 2DQJH 5JZ7C 3C5ZD 2XQYK 2LABA 5C09E 4QHMB 4X7FC 2IFFL 5KSUA 3ZE0F 3BGFB 4NPYB 4XX1G 4OZIB 2IH3A 1FAIH 3B3IA 2NY2B 1ZA3B 3ES6B 4TSBH 1KJ2L 2E27L 1NBZB 1OP3H 3BGAA 3E8UH 1RIHL 5F8RC 1EO5A 1YMHB 3DPBA 4DVBA 3W82A 2FIKA 3WUZA 4WI4A 4I77L 2LFGA 3OAUL 3G5YA 4XBGB 2VDLL 1OCWL 3IDMB 4B7IA 5FO7A 2ESVB 1XH3B 5J9PB 4WI9A 3O3DB 4OBRA 3T08A 3DV4B 3RJDA 2X4QA 4ONFL 5L88L 2JIXD 1AKJB 5IQ7H 1FZKB 3FB6B 1IFHL 4EDWL 2YPVH 3I50H 5A43C 1F2QA 3K4ZA 3OX8B 5TQ2L 3NZHH 3ARXA 1TVDA 1XT5A 2X4RA 2C5DC 5DLML 4NQTA 1CFNA 3SJVD 4Y5VA 5I1HH 1KB9J 2ADIB 1KJMA 1FSKB 3MA9H 4G8IB 2MQCA 4GRMA 5EU3A 4Z6AT 2CLZB 5D4QA 4ZPTA 2O93L 1CFTB 4ZTPL 3ALXA 4APQC 4IRSD 4J4PA 1FPTH 3KPSB 3UJTH 4ZFFB 5CEZH 3PL6C 5L0QB 2APXA 2CKBB 1A7QL 4K8RC 5F9AC 4Z7WF 4ZD3H 2X4OB 4G8FB 4Z78A 3DBXA 2H1PL 3KAAA 1OM3H 3U7AA 4PRIE 2OTUB 1H3GA 4ELMA 3EOTH 4YE4H 2PW1A 4JFPB 1RJZA 1KSRA 2BRRL 3S34L 1QSFA 2IADB 5JIPA 3D69B 2Y06L 5AYQA 3SPVA 2EIZA 4MB4A 5E6YA 4C4KT 4WDIB 5C09D 5ICZB 3P73B 2BOCB 2EH8H 3NN8B 3LMJL 1A7RL 4ELKA 3RDTB 1IC4L 4DN3H 3MRPA 4G3YH 1GGUA 2MKLC 5SV3A 1N6UA 5TDOA 5IV2A 2BFVH 3MCLL 1OPGH 2Q76A 5GISL 4X6CF 2QQNH 1PX4A 5SX4I 3SOBH 4H20H 4JFHE 1NCAH 3QDMB 1A5FL 5SWSB 1P7QA 5GZNC 1X5ZA 4MX7B 1YMMB 3EYUL 3K8MA 4ZG1A 4QHUB 2PNDA 3TNNA 4YHNB 1ZXQA 1B4JH 3GJFA 3DVGB 5AYUH 2RCSH 1I9EA 3NA9L 3LSOB 1J0JA 4GG8A 4HFWB 4OZGA 5FYLE 1A8JH 3G6JB 1EEYA 2FB4H 5CEXA 1QO3A 4X0KA 1EIBA 3G9VA 1YUHB 4OLYH 5EU5A 1MWAA 1CL7L 4CUCA 1GZPB 4K71C 4ZFOA 4RFNC 3DMMA 5BOZG 5E56A 1AXTH 4XPBH 5JHLL 2BJML 3S36H 2R1YA 3VCLB 1YNKL 4HK3N 4ONOA 1VEMA 1DBJH 1RQ5A 2C3VA 4GKSA 3QYCA 1ZLVK 2Y7QB 3REWA 3WJLC 1VFMA 3ZYOA 5IW6B 3HA0A 3HC0A 5FYKL 3QWOB 4P2QB 2IH1B 1FO0H 4JM2B 4HLZG 1FLTX 2KBGA 2PYEE 3T0BA 3DI3B 2VDKL 4PRID 3TGXA 5EFIA 4GBXB 4XB8A 5ESAA 2ZJSL 3VDBA 4UU9B 4G6KL 3GSNL 4P5MA 5C0IB 4JPVL 5JIKA 1OAYL 4PTTA 3E6HB 4KV5E 4B41A 5TDNA 5GGTA 1M71B 1RMFH 3HS0B 1H3TA 2EYSB 4KK9C 5E9DD 1JFQH 4H0GA 4ODUB 3KPNB 4X5XB 2CH8A 3TCXA 3UPRB 4P48A 1B9ZA 1XIWC 2VLRD 1TETL 5SX5K 1I1RA 3ARFD 4XBEL 5KVDL 3BSZL 5DUMH 1KTRL 1KCUH 3PP4L 1N2RA 4Z7WE 2NY0B 1RK0B 5GGSA 1ZT1A 4JFHD 3UCRA 3FMGH 5CGMA 4NRYA 4ZXBC 3H7BA 1HIML 3TO2A 4XVTH 4J12A 3UYPA 4R96A 2FH6A 3S96B 3LKRA 5GGQH 4UAOB 2PUQT 3B9KD 4WU7B 1IARB 2FGWH 5DC4B 4O2FA 5FYLD 4JRXA 3TNMA 1NLBH 1EFQA 2NLJB 1LO0H 2YN3A 2D7TL 1IAKB 3MBEB 2FHFA 1UWGH 4RMSA 4GRLD 3WS3B 1H8NA 3O6LH 5GZOC 4F7CB 2HTLD 4P23A 4Y5XC 5KSAB 1LP9A 1DJSA 3DXAA 3MACH 3DRQB 1U8MB 4RX4A 3DROB 1U8QA 1HQRA 5D5MB 2GSIB 4X6CE 3MJ9H 5IHZB 2XXMB 3QXDA 3FHQA 3MLRL 2DIBA 4XMLL 2ZCLH 3LRSB 4U1HB 3SGJA 3C5ZB 1QLRA 4YDKH 4QYOA 4NHCL 2YBRA 5I30H 3P4OB 4HH8A 2B4CC 4X6BB 3DVNA 5F1IA 4M8QA 3V4UH 5FYJU 4Q58C 4PJEA 3PHQA 5FEBA 1NJ9A 1P1ZA 2DIAA 1FQ9C 2XPGA 4WTZA 2LAAA 1Z9MA 2F9BT 2PTUA 4G7VH 2Z92B 4D9LL 2PYED 4AIZB 3AS0A 5CLWA 1A1OB 3MRRB 2KL6A 3OAYK 4PPTA 4DCQA 1Y6MR 1AGFA 1A14H 2GK2A 2VC2L 2J6EA 5D72H 5MP6L 4KMTH 3HPLA 4OD2B 3BEWA 1Y6NR 4CNIB 1XGRA 3B2VL 3EAKA 5ITFA 5HYSB 3L1OL 1GGBH 5I8EB 5DUPL 2JIXB 2ORBH 5DI8A 4YAQ<