1A7OL

Fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) r96l deletion mutant on variant for chain l glu81->asp and chain h leu312->val
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
DIVLTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPSRFSGSGSGTQYSLKINSLQPDDFGSYYCQHFWSTPTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA D1.3 FV (LIGHT CHAIN)
publication title X-Ray Structures of D1.3 Fv Mutants
rcsb
source organism Mus musculus
total genus 28
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a7oL00
1NGQH 1MHCB 1T2XA 4RFEA 4X0KB 4I0PB 3MOBL 3SOBH 4APQC 4CUCA 4OSUL 1EERB 4JANB 1CLYH 3BXNA 5EU4A 2MSPA 1ZTXH 5BVJA 1U8HB 1AD9A 1T1ZB 5C92A 1PQZA 3RHWK 3MUZ1 5KSBA 1A2YA 3DXAD 3WD5L 3V79C 1IAMA 1ZWIA 1WBXA 3K4ZA 4YGAB 3MZGB 2E8ZA 4MDIA 4CNIB 1A4JA 4MXQD 4X6CB 5CGTA 5TDNB 1JYWA 2DQJL 3MLYH 4PV9B 1MFEH 3B2UC 3VWKB 2FX7H 5FYLD 4KK5C 1U91B 3RU8H 4HXBL 1DBAL 3IJYA 4D3CL 25C8H 4NZTH 2WSKA 1AGCB 4E41D 3H3PL 4U7SA 3VFMA 1LO0H 1KLGA 3HE6C 3BZDA 2P49B 1QPXA 2QQKH 2HT4C 3D0LA 1HYSC 1ZVYA 3PXJA 4IMKA 3MRCA 1HK6A 2EH7H 2ZUVA 1YJDL 2C3XA 4OFYA 4XVJH 2F19H 1IZKA 2HWZL 1AR1C 4XC1H 4ODBD 3L3GB 1HSBB 1D5ZB 1IGIL 4G80A 4LPTA 1AQDB 3BDYL 1MY7A 4EN3A 2ESVD 4NNYA 1OAYL 3BP6B 3W0WB 4X6DA 1CF8L 4BSVA 1HI6A 1IGML 4CADB 1LDPL 5C07B 4HIHA 5JOFB 4PGBA 2H41A 3T4YB 5BS0B 5I1DB 2BCKA 3MRHB 1IBGL 3ZKMD 4ZAKC 4MD5B 4YHNA 5LCVH 5I1HH 3Q3GB 4WVRA 5DJAB 2XWTA 3AM8A 5F70A 1M7IB 5EC2B 4MQXD 1RIVL 2DBLH 3CDCA 3S36L 2BSTA 4PIRF 15C8H 1S7UA 1FL5B 4XPGH 1A6PA 4M62L 1OCWH 5MI0B 3FQTB 5D9SB 2JB6A 4CVWA 4PJ5D 3HCVA 4NO2A 5DS8A 3S37H 2CH8A 4RWYL 3SQOH 1MFDH 4NO0D 1XIWB 3D85B 1HSAA 4QKXB 2DQGL 2BOCB 1XGUB 3EO0A 5BRZA 2YMXL 4Y7MA 1WFOA 1PD6A 5FV2A 5HVWA 1U3HB 1XGRB 1WITA 3RWDB 4GRLA 4WU7A 5EZIL 1JRHL 1DR9A 4L4VB 2P24A 5C0RH 3DMMB 1F8TH 2IADA 2Z0BA 5JLZB 4FABL 4LLUA 4Y2OA 5I1EH 1KIRA 1LO3H 3EJYC 3K4AA 1MFCL 1HIML 2PETA 2ZG2A 3TBVA 5IEKA 1T89A 2H26B 3RA7L 2W9LA 2ZPKH 4IDLA 1CGWA 4MB4A 3ROOA 3IAQA 4G8GE 3QA3B 2O26U 3VXUE 4NDMA 5IV2B 2ZSWA 5TDOA 1MY5A 3KGRA 4WUUA 5INCA 3RY6C 4X99B 3RWEB 3EYVB 2B1AH 2DQFA 1JHLL 4NWTH 1J86A 3ZZ1A 1MJJB 1WAAF 5IB4A 2H9GA 4YHML 3W11C 3WXWL 1U8PB 4TUKL 4KJYA 3QUXA 1QA9A 1U8IA 3DTXA 2HAZA 4NGHL 2BVQA 4UNUA 5JW4N 4K71C 5CJQL 5DD3L 3BZEB 1Q94B 1G7LB 1RU9H 3MJ9A 4IIQB 4K3DL 4XMLH 5FYKL 1P1ZA 3SGEH 4BSWB 5HYFA 1FYTE 3DO7B 3AY4A 1FGNL 2P5WD 3F5WA 2D7MA 1EHXA 1YEIH 5CJ8A 3WL9A 3MGTA 1F3JA 1BFVH 1TTGA 2H2PC 3SDDC 2EKJA 2QR0B 4GQ9L 1BLNA 4PJCA 5I16B 3JWOH 3M1BA 3LD8B 4ONOA 2MHAB 2YRZA 1ZK9A 3GNML 3KPNB 5B4MC 3BP7A 3TZVA 3BKJL 4PTUA 5EIIB 4DVRH 3HE7D 2OJZH 3L3IA 1BREA 5IFAH 4PRPD 1QD0A 3HA0A 3QNYB 3RWJA 2EC9T 3WUWG 4LRIC 2VKXA 4ZMAT 3ECBA 4CU6A 2NZIA 5EU5A 3DX7B 4DGVH 4MVBD 1A21A 1D5IH 1TJIH 2DI8A 4NN6C 3CFDB 2GTWA 3IDXL 1TQBB 3U48A 4KY1L 4UDUB 1YQVL 1NMCB 1UXWA 4EBQH 5C6WH 5HVGB 3ARWA 2RB8A 4R8WL 3LKSA 4M7JH 3RFZC 1OPGL 1F45A 1BQHA 2MNUA 3MCLL 5IB1B 1B0GA 1YNTB 5CJOH 4YPGA 3S5LG 4MA8L 4MNGA 4ZO9A 5SWSB 1AE6L 5GZOC 2ZZUT 1OF2A 3REVA 3IRPX 1IT9H 2NMSA 2OQJA 4XBGB 4Y1AA 1AGBB 3WNMA 3VA2C 1MCKA 2FECL 1RZKC 4AG4H 1R5VA 3EAKA 2F5BH 1MUJA 4U0QB 4NQUA 1MRDL 4WFHE 2R0ZL 3TM6A 1G7MB 3OB0K 1KIUA 3N0PB 4MMZC 3OX8A 1XF4A 3BKMH 3G04B 3TT1H 1IFHH 2CSPA 3VFGL 5K9KA 4WHDA 2C7UB 2CKBA 4Z0XB 3VWKD 3ES6B 3S9DB 4PFEA 1EO8H 1FLTX 3PE9A 3RBGA 4ODUB 1I9RH 2B8OT 3BW9A 3RBSA 1AXSA 1XMWA 2BY0A 3DROA 5D8JH 5ETUB 1JUFA 4IS6B 2BVOB 3EFFB 4PRHB 1WFUA 3ZHLA 5C1MB 1LILA 3QSKB 4PJ9A 4K07A 4I2XB 4XP5H 4ODSH 1CL7I 1ZHNA 4U31A 5CD5D 5K9QG 5IHLB 5HHXH 2Q3AA 4Y16B 4Y4HC 1ADQL 1HEZB 4NQDE 4NM8H 4ZG1A 3W0WD 2NY6B 3QBTB 1GZQB 1C5BH 4XHJC 1BQLH 2Q76B 3O6LL 5J6HB 2CDEA 5C07D 4ZFFA 1OSZA 4W4OA 4Z95L 2VJXA 5DF0A 5GJTL 5BS0D 1A6ZB 2AXJA 4QT5A 2EXWD 4MNHA 2DQDH 2CK0H 3GSUB 4QLRA 2DKMA 3UTPD 1MHEA 1U8KA 4CN1A 4HIXL 5F3BA 3BRFA 4OD2A 2KZWA 1ZLUK 43CAA 4P5TC 3CMOL 3QUZC 2A77H 1NC2B 5FHAL 2X4TB 5E03A 5KW9L 1DDHA 5EU3B 3H7LA 3UZEA 1XR9A 3NAAH 1JGLH 2BDNL 3MYJB 4HWBA 5J1AA 5IVNA 1RUML 5EOTA 2WBJB 4K3EL 3VFNA 1XIWD 1U9KA 3D85D 1Q9LB 3C5ZA 3U7YH 2DD8L 5E5MB 2ZJSH 3UJJH 2ADGB 1EAJA 4GT7A 3ARFA 3T0AA 2HT2C 4UB0L 3MRJB 2DOCA 1N59B 4FZEH 4XWOC 5KG9A 1I3VA 4ORZC 5CEYB 4E41E 5L0QB 2GCYB 3VXQB 2D31A 1UFUA 3LH2H 5TPWL 5IR1A 5BZWA 1FZOA 4PV8A 3DMMD 1HH9A 1NCDH 4WO4C 3T3MF 3BAEL 2EIDA 2LTQB 4K7FA 2I9LA 2OL3L 1NGZA 3MJGX 2DQIH 1A7QH 2QSCL 4JQXC 5TE7L 3TO2A 5DUMH 2O5YL 1LEKA 3EOBB 3QEGH 3KS0H 1XFPA 5IMOA 1GOFA 2ESVE 3HKFA 1CLOL 3MR9B 3OAZK 5FM4A 3K3QA 4YHPA 5GXBB 4JO3H 3UAJC 5I1IH 2HFFA 2YK1H 3HPLB 5E1AA 5IKCB 1KEMH 4TSAH 2C3VA 3PWPA 1TETL 4RSVA 4TNVK 5D6CB 2VR5A 3MRRB 3NPSB 5DC0A 4K3JH 1B0RB 4FXLA 3BMVA 3QDJB 1FFOA 4P3WA 3ZE1E 1A0QH 1KG0A 1XCTA 2DQTH 2NLJA 3MLZL 4DKDC 3AMLA 4Z5RB 1IVLA 1MAJA 5HHOB 2N7BA 3NFSH 2EDXA 3O8XB 1XGYH 3MQIA 1F4YL 4UU9B 3W39B 4G6AC 1MFBL 1FL3A 1BX2B 1PY4A 3I02B 2VLLB 4PJ5E 3X11B 3KPRA 2JCCB 4CAGA 5ITBH 3G6AA 4JM2C 4DGIL 5E5RB 3VFVB 1RURL 1UJ3C 3O45B 4NFBA 4TVPD 3SCMB 3KYOA 1DUZB 4CRPA 1CVRA 3MX0A 3QG7H 4ZD3L 4YC2B 3N50A 1H0DA 1ONQA 3LSOA 1DZBA 5CSBA 3QDMA 1Q9KA 1U8JB 3E8UL 1EXUB 1FV1A 3EW3B 1H8SA 1U2HA 3P0VH 4N9GB 1MWAB 3X13B 1P2CB 4DFHA 5DZNA 1VEOA 3QH3B 5EB9A 4JR9L 5CZVH 1YEDB 3RWIB 1JTPA 2RR3A 1RZ7H 4R2GD 3BO8A 4IDJH 3VXSD 5CEXB 4KK9D 3RL2B 4M93C 4L4JA 3L7FB 3HC0B 3RIAF 1F6FB 4WV1A 5TE6H 5SWSD 5DMKA 3VXMA 3C87A 4WUUD 4WGVB 3VRLE 1QLEL 2PXYA 1Q9WB 1XGPA 3I6GA 4LQFH 1C08B 3NCJL 5ANMA 4ZDHB 5IIEB 2NXYB 4U1IB 4XWGH 2EYTA 4JFOA 4PR5B 4H25B 2V2TB 4H8WH 5CJXA 2CLVA 2OTWA 4HUWA 1EFXB 2EICA 2E6PA 5HJ3B 1KPUA 1U3JA 1JF1B 4J4PC 5CGYD 4M7LL 5HI5D 3GKWL 3HUJB 1BZQK 4U1JB 4L4TA 4MJIA 1HOCA 4JFHD 3CXDL 1F11A 4D9LH 2RIKA 1LE5A 1CGUA 2P44B 5C0EB 3P40A 4GSDL 5IQ9A 3F62A 4IHOB 1XGTA 2NW2A 1CICC 5JW5B 3LRGA 5FYKU 3SDYH 3MLTB 4PRHD 1YEGH 4FQCH 3C8DA 1A7OL 4HPYH 4ZFOB 5J13B 5E7FA 1OTTD 3C2AL 3ULUC 2VB5A 5D2NC 3UDWA 3EO1A 3U46A 5ACLA 4Y16D 4L3EB 1DLFH 4J3XA 4NRXB 3IS1X 3TPUA 3SE8L 1R5IA 2NY6D 3QT2A 3UBXI 1L6ZA 3ARGC 4ZNEE 2B4CC 3QI9A 3DX8A 4Q6IC 4KUCF 5DJYA 1MIEL 3MA9H 2EEBA 3L3KB 4QRTB 1RJZB 4M00A 1AGDB 1PDKA 4FFZL 4KHTH 4W6YB 3O11A 3GHBH 2MCG1 5C7XL 5KVEL 2NY3D 1NC2D 2CMRH 1CE1L 3JUZA 5C0BA 2R1YB 4NT6B 2AAVA 2JE8A 3FB7A 4MLSA 4LRNH 4JFEB 5TDPB 3IAPA 3IFLL 1A3RH 3KJ4B 5L2KA 1LK2A 5GS1C 3ILPB 5DJXA 3F8UB 2XKUA 2WBJD 5HDOA 1EEUA 4NQEB 3MJ6A 5GS0L 2R1XA 4OZFG 1WSST 3GM0A 4HS3B 2BVUA 3IDIB 1CBVL 3E0GA 3BMWA 2EZ0C 4HBCH 4I4WA 1DFBL 3MLSL 5DD1H 1SYVA 4YBHA 1KB5H 3MCKB 2D7TH 4D2NA 4JPVL 3GMOB 1NCAH 3BSZL 3CSPA 5DJZA 3T2NH 5HY9A 3N9GL 2BY3A 4JDZA 1QQDA 4CKVX 3UYPA 2Q20A 3MLXH 4NZRH 1BOGA 1QYGL 3HC4L 4XX1E 4AEEA 3CFCL 5KVFL 2VL5A 3STZB 1NCUA 4U6YA 5GIRB 5C0FB 2Y7QA 3W0WE 4J3OC 3CD4A 4WTXA 3X17A 3DUUB 3EFDL 5T3ZH 4UV7L 4Y4KA 2HKHL 1ZA6A 5C07E 3QEHA 2XA3A 5BS0E 3B5GA 4QHLB 3UJIH 4XVSH 2AABL 3QDGB 4G43B 3QDJD 1R3LB 3UTPE 3V5DA 3A0OA 3D1MC 1HHKB 4PJHB 4P2RB 5CJ5A 1VGKA 3DETC 3I9GH 3FRPA 3CH1A 1CN4A 1CE6B 1MCPL 5CHNB 3D25B 4XCCH 3O8XD 5AG9A 1YN7B 4U1KA 1I8LC 5EZJA 1C5DA 4KWUA 3MRKB 4OQTL 5KVDH 2DLEA 4G9FB 4H20L 3QR2A 5SWQB 1QBBA 1ACYH 3SCMD 4JKWA 3AAZB 4KRPC 4AT6A 2OZ4A 4P3CL 5EU6A 1A64A 4QY8B 2DM7A 3IDMB 4DUXA 3QUMB 5C9KA 4HF5H 3BE1H 5DR5H 5JXEC 1J18A 2K3TA 1E4XL 1IC7H 4X7SH 1ODAA 3HPJA 4L4VE 4OZIA 5ESAA 4KPHL 4JRYA 2CDFA 3QO0A 3QUMH 2GI7A 3B8YA 2QTEA 2FGZA 4JGJA 3BWUC 3OXSA 5EZOL 2VDKH 3PV6A 3GSVA 3PUCA 3B9DA 3G5YB 4PG2A 4XXDA 3BEVA 4P9ML 4OF6A 1NDMB 1WZLA 2IMMA 5J12C 4LSDA 1TVBB 4K8RD 3S96B 2FX9L 4JEGB 5EU7C 1CU4H 1NEZA 4LLQB 2R0LL 2X4NB 5T5FH 2B20A 3ABZA 5T1LA 5JPNA 3WFHB 2BVPB 3MRBB 2LU4A 2NXYD 2VTFA 4Z7WF 4FRWA 2HA1A 4TTDD 5DDHB 3BPCB 4QXGH 4P2YA 3DVGA 3GSQB 2UUDK 2Q7YB 1EFXD 4CDHA 2LQRA 4JO1H 1Z3GL 2XTJB 4NP4H 4XBPA 3QG6A 4JY4A 1G6RH 2DWEA 5HGHA 4BK4A 3D69B 1KXVC 1A47A 1J1XH 1FCGA 5FO7B 5JDSB 4I48A 2IFGA 1W8OA 3TEUA 2RAMA 4M43H 4F37K 1H5BA 2IPKA 3S5LB 3WBDA 3B9VA 1YMMA 4P3DA 2YD4A 4YHKH 3FQXA 5L8KB 3P4MA 4WEUD 4PJIA 1FJ1A 4Q9BA 2HJKB 2AKRA 4HIJB 3GSNL 1ND0A 5ACZA 5FUCC 5D1QB 4TUJB 4XPTL 4NCDA 4OM0H 1A7PH 5FCUL 5F7MC 3U9UA 3OHXB 5AZEL 4XT1C 3PNWA 1T2QL 4Y0GA 3VFRB 1JIBA 2RFXA 4L3ED 4OF0A 2F9BT 2UY6A 1RZ8A 5IESH 5IBLC 4XP4L 4YFDB 3ZE1F 5I8CB 4PRAB 3R06B 2AJSL 3M45A 1G9NH 2YXMA 4PRBB 1IMHC 5ADOH 1QFHA 4LSVL 5T1MA 4Q9RH 5DHYA 1S7XA 5SWSE 5J1TC 4AEHL 3R8BB 2BSRA 3GSRB 1QLRB 5E8OA 4YQXH 4GKNB 4NQVB 1KJMA 2Q87A 5BMFH 2G60L 2YWYA 3V9FA 3PWJA 4NBZB 5KANG 1UEYA 4XBEH 3KYNB 4JRXD 4RRPA 1YEKH 4JFED 2UZIH 1I7RA 1JZ2A 4XP1L 1Y0LA 5F7NC 3TN0A 4Q9QH 4OCYL 1FNLA 3MXWL 1G0XA 4NQED 4KMTL 3CDGB 1VENA 2HT3D 3SDAA 3TGXA 3IDUA 4ZS6C 5ESQB 3LPGA 3VG9C 1KJ2H 4PJ8B 1CLCA 1UXSA 2R0KH 1F4XL 4N5ED 2ARJA 3HC3H 1B4RA 5JA8B 4RMVA 1J88A 1NGQL 5F71A 4KTYA 5FK9A 4UTBH 4PRHE 3SOBL 4EI5C 1VACA 1F3DH 3Q0HA 2W1NA 1FNEB 1GZPA 3QZWA 3HI1B 4MZ2A 1EGJL 4UT7L 4I2XE 2ICWB 3U1SH 3VRLF 5E56A 5B38A 1KIPB 5D1ZC 3BIKB 3S34H 3O3EA 4AMKH 5DUBA 1NGYA 1P6FA 1XCQB 2EEDA 3UBXA 3WFZA 1LMKA 1U2CA 2DLGA 4UOW0 2DTSA 2YD1A 3TCLB 5E0QA 4LKCB 3LQAC 1FVDA 1M7XA 5IB3B 1TQCC 1IEAB 1U8LA 2XN9B 4ZTPH 4HLZG 3QDGD 4LOUD 2X1WL 5L9DL 2F74A 3U0WH 2PW1B 1K8DB 4OM1H 4NQSB 4P2RD 1NUDA 1FC2D 2YSSA 3MGOB 3NN8A 2HTKD 4IOIB 1MLBA 4G9FD 4OF7A 1OAXH 4YHYB 4XVJL 3KPPB 4XC1L 4GBXC 4M3JA 1WC7A 3FZUD 4B53A 4KKBC 2C1OB 3B3IA 4ELMA 1HE7A 1J11A 4XRCB 4LQ1A 5BJTB 1KENH 4M02A 3UTSB 2Z31C 1CGXA 3V0VA 3SDXB 2BHZA 5GISL 2W65B 3TT3H 5D2LA 4G9DA 4HH9A 5LCVL 3WIIH 1QR1A 4YDKH 4UAOB 3OMZA 1JGEA 3FRUB 1GJIA 2W92A 3P4OB 3WHE0 1EMTH 4HKJB 5T3XD 4C56B 1Q0YL 5CWSA 1KTDB 15C8L 1A1NA 2PYEB 1U3YA 2NY5H 4FQPA 1T0MA 3EZ8A 2AJZB 4OLVL 4UUJB 1S9WB 4U1LA 1BHGA 4TSBH 4APQA 3QIUB 1CDJA 4QHMB 3BPNB 2DLHA 5HPMB 4HQQL 4U0RB 3QJFB 5IFJB 4R6UA 3Q1SH 2XKSA 3QDJE 1IGFL 1KJ3H 5E7BA 3HG1A 3LIZH 1FVEA 1T03H 5CP7B 1XF5A 5CMAB 4BFIB 3HHRB 1W72B 2XTJD 4YLQT 4KXZH 5HHOE 4IOFD 1F8TL 4WGWB 1A7RL 2J8HA 3HLAA 3DX6B 4YR6B 5DK2A 5GRVL 3F7PC 1LO3L 2JCCE 4HKXB 1AXIB 5H2BA 1RZJH 1KCUH 1NFKA 1T1WA 1OWWA 4CJ1A 4F2MA 5IVZB 2VDRL 4RA3A 4JCLA 1WF5A 3BT2H 3HE6A 3QWQB 5FOBA 1TZGH 4JY6A 1S7WA 5DVNA 2EDHA 1VGEH 1JYVA 2VDQH 3SGKC 5I18H 4BA8A 5JIIA 2CUMA 4LAQH 4NWTL 3CLFH 2QBWA 5FO9B 4EEEA 2V9QA 2P5ED 2JTDA 5CSZA 5KN5B 3O6FC 3D48R 4KK6D 1QFWI 4O2CA 5IB2B 3S35H 2F8OA 1IAOB 4RQQB 1IM3A 1HILA 5EC1B 1YEHH 2XFXB 2B5IC 3BZ4B 5D4QA 1YEIL 3MV8A 4LCUB 4LVOC 1BFVL 4R9HA 2KZ1B 4RGNB 1IKFL 3D2UA 4KJPC 5D72L 1A6TA 1NAMA 2Y6SC 3BPOB 1BFOA 1RIUL 4MA7H 3QULA 3NFNA 4BQBA 5HYIA 1DLHA 3VFPA 5F9OH 4WY7H 2QADC 2OJZL 4FP8L 2R9HD 1AGEB 1JK8B 3VFTB 4G6KH 4RGMC 3RTQA 4LLWB 2FWOA 4OCXH 5CSGA 3VXNB 2APBA 3IDNB 3CVHL 2MQ3A 3NCMA 4PJEB 1AIFA 3C09C 5HYQA 1CFTB 1NFDB 3L3HB 4WW2A 5IBTL 3GJFK 3HUJE 5L2JA 2HRPL 5F7DA 5E2VL 4YBLB 1E4XI 3V6BR 3VFUA 2WUBH 4PJ8D 4MMXC 1A9EB 1DSFL 1RULL 2GITA 3VJ6A 3TO4B 4XCYB 2ADIA 4PGCB 2Z9TA 2AJ3B 1FNSH 3HTLX 5CJOL 1DL7H 3OKMA 2F54A 4UIKL 2VDPL 4FXKA 1DE4A 5CBAA 1C16B 2ORBH 4OCRL 4EUPG 3G5ZB 1IT9L 4B0MM 1XR8B 1JN6A 1H15B 3HZYB 4YX2H 3NABH 4J3SA 2AJVL 2HKFH 2FIKB 4OB5H 1V7ML 1X3DA 2VDOH 1F4AA 4L3EE 1VFAB 1UYWL 5MEOA 1SJEB 4P0DA 1A6AB 2XICA 3BESR 5GGRY 3RY6A 2C4FT 4KKAC 2H2SC 1FZKA 4OZFB 3IFNH 3PP4L 1I3GL 2XPGB 3ESVF 1IFHL 4RGOH 2X70B 2DRUA 2R4RL 2XN9D 4ZAKB 3WEXB 2NQCA 1EO8L 1A3QA 3QUYC 1UACH 3GBMH 1JWUA 1DP0A 5IJKA 3L1OH 4CGTA 3LKRA 4ZFGL 1CCZA 3EJZC 3VRJA 5FKAB 4EKXA 5GZNC 1ZHKA 1T5WA 5BV7B 5E2TL 1PYWA 4JFEE 2VAJA 3SDCB 1H3XA 3D87B 2VXQL 3SDDA 1ED3B 1S7SA 4IMLB 4XC3H 5I1LB 4XP5L 4F7EB 3BKCL 1P5UA 2PCPB 4NQEE 4XVTH 4S1RH 4Y5VC 4ZOCA 5DJ0B 3DUSA 2W60B 5I1AA 5BV7H 2CXKA 3QCVL 5MP6L 3ME0A 4B41A 2XZQH 4DCQA 2X10A 2YPLA 1CS6A 2WW8A 1ETZA 1QSEB 4LRIA 4JREB 5I17A 1I7UB 4HW6A 3IS0X 4NQCA 3MRPB 5FO8B 1J5OH 3KPMB 2HTLC 5H8DA 2YC1B 5HI3D 5I1KL 2DQDL 3AS1A 1FGVH 3PHQA 4D8PA 4HJ0C 4Y5XB 4HKZA 3MRFB 3PP3K 5GHWH 1U41A 4C56D 4P2OC 4ELKB 7FABL 4UQ2A 2GK0B 5D7JC 4RMQA 4NQXA 1MCRA 2AQ3A 2PYED 2Y4SA 3RHWF 4C57C 4J23A 2CIIA 3GHEL 4HWZA 3QIUD 3K8MA 4ZUTB 4QRUA 4XNZC 3BQUB 1R24A 1N26A 1BP3B 4P9HH 3TJHD 3QDGE 3EO9H 3UJJL 3TNMA 2G75B 3G6DL 4F7MA 3G5VA 2A1WH 2EC8A 4PJHE 5DJDB 4P2RE 3KPOB 1IILE 2BX5A 3PJSA 5C0CB 5DI8B 3LH2L 1FO0B 4HX1A 3AVEA 5GRWA 3VD4A 2X4SA 2X6MA 4G9FE 5CJBA 5AWNH 3VD5A 4CVXA 5BO1H 2BC4B 1L0YA 1CLZH 4LU5L 3TC9A 1FO0H 5DUML 1KLFA 3HR5B 4HZAA 4WHYH 5FGBC 3QEGL 3FQRA 4OGXH 5E94A 2BCKB 1K2DB 2CGRL 4GRWB 3GO1L 4K9EL 2CDGB 5C0JA 3DX9A 4ODHL 4X98A 4KVNL 5ENWB 2ZOLB 3E3QE 2YK1L 2UVEA 4WDIA 1OARL 1KEML 2IH3B 3MRGB 1BEYL 3IU3A 3X12B 5AYQA 4OZGA 3C60B 5B39A 3NTCH 2VZSA 4JZJC 2VLRB 3K7UA 3DV6A 3MRLA 3NZHH 5T3XE 4H88H 3CCHA 5FDWA 1T7VA 1NLDL 4MB5A 3B5TA 5DS8B 1JZ6A 5FHBH 4JGUA 5DRXB 3BWAA 1IGJA 4KHXH 5DGRA 4U1HB 4LGSB 3QB7C 2LU7A 2FEEL 3WYRA 4ZUWB 5FA4B 4D9RD 3VE0B 2XWJA 1OP3H 5ITBL 5E8EA 3Q6GL 3QEQA 1RZGB 3IF1B 5I1GH 4YFEA 2YD5A 3P0YH 4KKCC 1YEFL 3VDCA 4NBXB 4YXKH 3QG7L 5FV1L 3GI9H 1YY8A 4LKXB 3U2SB 3N85H 5DHVB 2ADJB 2XTJE 5GGTA 5FB8B 3TBVB 1JPST 1C7SA 1MFNA 3GJFB 3O6KH 5FECB 2BRRH 2J8OA 2G2RB 4KDTC 3FFCB 3CK0L 2JLLA 2IEPA 3B2UD 2ZSWB 3QUKA 2CXGA 5DHVH 4ZUUA 4M7KL 1NMAH 3K4DA 4IDJL 1KEGH 1LEGA 3GMLB 4Z0BL 3TO4D 3UPAA 1OAKH 3S4SA 5HYSA 4CMHC 1J8HA 4OKVB 2HT4D 3O9WB 4WO4A 4N0YH 4DAGH 1WUNT 2GW5A 2XY1A 3C5JA 3BP4B 4FQJH 4LQFL 1KTKE 1OAZH 2D3VA 4RFOL 2L4OA 4JQXA 3OR7B 4NZUH 1AR1D 3R1GL 3EBAA 4QRPA 2BNQA 4C4KT 2P5EE 2SEBA 2LFGA 1EK3A 1OAUL 4Y4HB 5CINH 1QVOA 1ORQB 5DRWB 3WS3A 1DQJA 3M1BB 3MJ9H 3P9LB 3V0WL 3CX2A 3SBWC 1LEIB 4LPUA 1CFNB 1BQUA 2Z91B 4F58H 1K9TA 3TZVB 3J8F7 1NEZG 1AY1H 4HGWA 3MUHL 2R2EB 4ZAKD 5DJ8B 3RWCB 4D9LL 2NX5A 4LPCA 1ZVSA 1LGVA 3NA9H 1HHIA 2F58H 4I18C 1Z9LA 2JCCF 2OMBA 1YNLH 4JKMA 2YD2A 5BZDB 3SJVA 1NDGA 2HFEB 1DBML 4JKPH 3I3BA 3QUZB 3HRZA 4KRNA 2WANA 5E95B 3LEXA 3MSPA 1MREL 4MAYB 4FQCL 4M1GL 3SDCD 2A0LC 1DQDL 4HPYL 5A2IH 3NMEA 4JM2A 4UILH 1UJ3A 5EBLA 3L9RB 4PJFA 1DLFL 1SEQH 3FOMB 1PLGH 1N6QH 5I75C 4Q6YA 1TFHA 2OR9H 5DVMA 1QSED 4OV5A 1I1YA 3JV0A 1MF2H 3IJSA 1A7NH 3P4NA 3JTSA 1M6OB 5IWLC 3H7BB 3MXVH 2F54D 4JG1L 1INEH 3ZT6A 1VEPA 2OTPA 4X7TB 4Q2ZB 1YYMH 4AL8L 1NL0H 3EJYD 4HLZH 3SKOB 4PS4L 2MQCA 1WWWX 1Y18B 3BVNA 3A6CL 5DYOA 1D5XB 1OT1A 4H26B 4M48L 3K2UH 5EBWB 1TENA 4A6YB 2OCFD 2E9IA 5JPMA 1WT5A 4DZ8B 3L95A 1TJGL 3AXLA 4LRNL 5HDQL 5HHVL 4PLKD 1AD0B 1A3RL 5ACMA 5LQBH 1MVFA 5C0AD 1SBSH 3BQUD 4M4PA 4N0FB 4O2EB 1JPTH 2A9NH 2XN9E 2NXZC 4U3HA 4YHZL 3HUJF 3OJMB 5DEFB 4HBCL 4UT6H 3RY4A 4NKMB 2W38A 4JY5H 5C0CD 3LQZB 5F1IA 1ZHNB 2FHCA 4IM8A 5HYJA 1WEJH 4J4PA 3T2NL 1EHLH 5ICZB 4XMKL 4HHAB 1NANH 5DT1H 3UX9B 3MLXL 4I13B 4UBDC 1MI5B 2DQUH 5B4MD 3LN5B 3PABB 1DANU 3GSXB 4MXQC 1CICA 3GSNA 1ZLWH 2VH5H 4MAUL 1I7ZB 2HG5A 2PTUA 3FQWA 3HZVA 4NZJA 4QT5B 1JNLL 2AXFB 1GXEA 2YPLD 4OCSH 4D0DA 5C0IB 3UTSE 4DTGL 5DD5H 1A6UH 2ZUXA 3OKKB 4NO5A 3SDXE 4X80H 2RGSA 4NQCD 2NY1B 5D5MB 5EFIB 3QFJA 3NZ8A 3UJIL 1LE9A 1NKRA 1YPZA 4OFIA 3VGBA 4LSPH 3BHBB 2UYLB 4LSUH 3ZKXC 1P4IL 3HI5L 3FCTB 1IQWH 4C83B 2PO6C 4MJ6B 2VLRD 4C56E 2KPNA 2AV7B 4WTZG 1XR9B 4H1LA 2KQMA 1CFQA 3ARGA 3PGDA 2PYEE 4XCCL 4Q6IA 4M8QA 4AENB 1G7PA 5KVDL 4J6RH 3ARFB 3P11H 4ISVB 3EDKA 4HWBH 2VAAB 4YAQB 2WWKO 5GZOD 3ULVD 4XNQA 4Y2DB 2Q1EA 4HIIB 5HTSA 5BXFB 4HF5L 5DR5L 1MFAL 4MQXC 4U1MB 5E9DB 4QYOA 3ZE2E 2L7JA 4XH2B 5GS1A 2E9JA 3TO2B 2Y36H 2GJZA 3FFCD 3H9SB 2GT9B 2XZCH 3DRQA 4JCMA 3I84A 5F9JB 1W0VB 3WO4C 2HFFB 5I6XC 2QSTA 3M17B 3IFOB 3QRFM 4J8RA 1EGJA 2FX8L 4YZFE 3ZT5A 1OGTB 5ILTL 3O9WD 5I76A 3LKOB 3IXTB 3L6FA 1Q9OA 3AU1B 2Q86B 2W91A 4LMQI 4PPTA 1IGTB 1EDQA 1P7HL 5C08A 1T3FA 1U93A 2A74A 4M5YH 1X5XA 4TNVF 2GQHA 4HFWB 4P2CG 1CT8B 4QXGL 4JJ5A 4Y4HD 4HS8H 1UZ8A 4HIEA 5AZ2H 4JHZA 2X4OA 3NACH 2IJ0C 4PJHF 5IB5B 1G6RL 4ZTOH 5B8CC 5JO5A 5JQHC 4FFYH 4D0BA 1WLHA 1J1XL 1WIPA 3GSWB 3VXOA 1WZ1L 3ARBC 1V7NL 4RGNE 4XB8A 4PGEA 5J11C 3T77B 5HHQA 2OJEB 4XGZA 4M43L 4P23B 3HN3A 4JFZL 1MHPH 3C5SA 4ONFH 3C8HA 4P5TD 1AHWB 3QUZD 4EUPB 5HHNA 3K1KC 3IU4H 3GEWB 4JPWH 4PTTB 1XF2A 4X6EB 1BZ9B 3W81A 4PJEE 1D6VL 3FAXA 4HDIA 1NFDE 3QWOB 1I9IH 2VR9A 4YXLL 4OZHB 2OK0H 1DVFB 4JPIA 1HZHL 4GW4B 4LP4A 4YHOL 2BVEA 3QXTA 1KCVL 3EGSB 1ZHBB 1JWSA 4JHWH 2DM4A 3GKZA 2PTTB 4XWOD 4AJ0A 5JXEA 3N1GC 1TZHA 3RWGA 5I0DA 2BRQA 3ZMRA 2BJMH 4OCNC 4FQ1H 4XCFH 3FO2A 3HE7C 3SE9L 4WO4D 2AK1H 5AAWA 1GOGA 4Y4FB 4HUWB 4K3HA 3JWDC 4BZ2H 3DRTA 4PJBA 3DV4A 1MEXH 4OI8A 1A4KA 5HGAA 3MUGA 3CVIL 2FATH 5K9OB 4KFZC 5EWIH 5BMFL 4WI6A 4MVBC 3RUGB 2NY7H 3CZFA 2P8PA 5E08L 4XBEL 3MODH 4DEPC 1YEKL 4MDJA 4RFNC 1ZXQA 5LWYH 3VG0H 1PKQB 4QRSB 1PW3A 3STBA 2IFFH 3PWVB 2V17H 4EDXB 4L8CB 2Z35A 4P2QA 4R4BB 4P46A 5EO1B 1QFWM 1FSKB 2OMNA 3CLEH 5DMJB 1M71B 1XGQA 4CN6A 1KJ2L 4I0PC 1OWRM 1GPOH 1JNHA 3WFBH 3DBXB 2VO5A 3WSQH 4PJAE 5D6DA 3F58H 3SJVD 5F88B 4XVUC 4UTBL 1VADB 3T2PA 2GTZA 2YEZB 4ORGA 4DK6A 5CEZH 4WFFD 4GAFB 3ZDZE 2R0WL 4G6AD 4AH2A 5IHBA 5D7KD 5IVOA 1LO5B 1MI5D 1M05B 4X83A 4EOWH 4YIQB 1S9VA 4KRPB 1FL6A 4Q0XH 2E8YA 1YNKH 4NUJB 2BY2A 4LEOA 3TCXA 4L8SC 3VWKC 1QSEE 1MJ7H 4S2SB 4LLDA 2O93L 2MCPH 2CLZA 1UB6A 3OG6B 2NY1D 4OLXH 4UDTA 4JB9H 5KSVA 5FYLL 3FO1A 2OSLA 2A6DA 2RCSH 3MOQA 4OM1L 4DQOL 4O00A 4BH7A 5CD5C 3L5HA 3PWNA 5GGRB 5J3HC 4JFFB 4UINL 2ENSA 3D3VB 4YHIB 4XZUA 3ZDYE 4HBQA 1OAXL 2X7LB 1ZLSL 3RWFA 1WCBB 3C6SA 4ZOAA 2HFGH 4OKDA 4MQ7B 5DK3A 4Y2DD 3SN6N 4OBRA 3FMGH 5F89A 3I85A 3T65B 3P73A 1G9EA 3SO3B 4E42A 2I26N 4O51A 3IETA 5E9DD 5C0CE 4NRYB 4NHUB 4ZS7H 4P4KB 4GXUM 3P77A 1CXKA 3PQYA 2V7HB 3W2DH 2R56H 4J4PD 3VDBA 3U6RB 3VI3E 2VN4A 4EI6A 3H9SD 4LSRH 5CP3A 2Q6WB 5MI0C 2JELH 1LNUA 3EKCA 2DN7A 4KU1A 4Y4KB 1JPGB 3LEYH 4KKLC 1E6OH 4OCWL 3QEHB 5T33L 1CZ8H 1KNOB 3MV01 4DJMA 1XIWC 4GRWE 2YD6A 4LNRA 4Y5YA 1J12A 5TF0A 4LCYA 1TCMA 5GSRA 1ZT4A 1R3IH 4R97C 2XY2A 2AJUH 3AFLA 1U3HC 2M2DA 5D96B 1OQOA 3WJLC 2QQLH 2YKLH 1D6EB 3MLVH 3ULUD 2LE9A 2IANA 1T7XA 3E6FA 4MSWB 3DMMC 3TIDA 5D1ZA 2E5EA 1S7TA 2VLRE 1T03L 3BUTA 3MRMA 1MCWW 3MNVA 2W0FB 3VH8G 1KFAL 4JN2B 4WI9A 3U79A 1IGCL 1IGYA 2PR4H 1Q0XL 2GSIB 1Q1JL 3KYKL 4G8FA 5DQJA 4XP9H 5IF0A 4CW1A 3ULVE 4YDLC 1BIIA 5F3HB 1Q72L 2XZZA 1FNAA 4P23D 4OJFH 2OZ4H 4MA3B 5IK3A 4YNYA 4JRYB 3DARA 1EFQA 1TZGL 2Y5TA 3DYOA 4GAGH 3QO0B 1RJYA 2Z93A 4U4BA 3CDFA 3INUH 3CXHK 1VGEL 5IW6A 4MWFA 3SPVB 1T4KB 5I18L 4LIQE 2LVEA 3JWOC 3PGCA 1NUNB 1WAAA 3SDXF 4GBXA 2YA0A 4CVZA 3FFCE 1ZSDB 4V2BA 1DVFD 2DF3A 1A6VH 4AEHH 1JMXA 3O4LA 4PGJA 4OV6F 4QHUA 2EZ0D 4NFDA 1IJ9A 4RA0C 1FORH 3LD8C 3L3OA 1FG9C 1YEHL 4Z78A 4Z77B 4OSUH 5KVGL 5FF6A 3RKDC 4N8PA 5DRZB 4JVUA 2OXGA 3T0EC 1FRGL 2I07A 2ZCKL 5DVLA 4A2MA 4EI5B 2ED9A 5EUKB 4ODTH 3UMTA 3WD5H 1RFDH 2EKSA 5A43C 5I8KL 5C09B 3PWUA 2OTUB 4KQ4L 5C08D 4HUNB 4X5LA 3MV7B 2GY5A 3REWA 3MV9B 3SGDH 3QEUA 3V6ZB 5F1SA 1TQBC 2UVFA 1NMCC 3EDDA 3KPSA 4HV8A 4HXBH 4KK9C 3H9HB 1HXMB 3TBWA 3ZE2F 3H3PH 1P4BL 2VQ1B 3P4MB 3VXRB 5GGVL 1IE5A 5EPMA 2RQ8A 2FHFA 2P8LB 1UWEL 3TBTB 1YJDH 5DMGC 1AKJA 3U9UB 1F13A 5T1KB 1FNSL 1NJ9A 1QBLH 1CIUA 2DWDA 2HWZH 1DL7L 3FFDA 2CUIA 2V2WB 3D0VA 4XAWL 4YZFF 1IGIH 2VRAA 2AQ2A 3BDYH 4JO4H 3FTGB 4MD0A 4V1DB 3OV6A 3VFWB 1KT2A 1CF8H 5CKAA 1UENA 4HC1A 1IGMH 3R0MA 1LDPH 2VDOL 4KRPD 3EYSL 5CGYC 5INDB 1L4IA 3OZ9L 2YOCA 2DYPB 4NC1E 3KLSA 5GS3A 3S4SG 5E4IA 5IOPB 3W9EB 1NLBL 2Z31B 5JXED 4G3YL 1G7QA 3IFNL 1YZZA 5I2IA 1NBZA 5L7XL 1RIVH 1RK1A 3S36H 1KJMB 1K5NB 1JZ5A 3MJ7A 2MWCA 4N0UB 3R0NA 2X40A 4UIMA 3IYLW 4JFPA 1KCLA 1RPQA 4ODWA 2VYRE 4QXTB 1MCQA 3DPBA 4P4RB 5C8JA 4YDVB 2H32B 2BXZA 4RWYH 1H3GA 4JFFD 1RSFA 5JHDB 3ARYA 2XNAB 4IRJB 4ZPTB 2DQGH 2HN7A 3D3VD 2G9HB 2YMXH 5TH2B 1EO5A 3ARXA 1L7IL 2NY6C 4JAMA 2H32H 3NCEB 1GGTA 4G6JH 4OD3H 5EZIH 4YDIL 1JRHH 4X4ME 4G6ML 4JFDB 1NFDF 3LOWA 2XZQL 5JOPD 4FABH 3O2WL 1VACB 2PYFA 2AXGB 1EX0A 1VKXA 1HHGA 2VXVL 1MFCH 5DEZA 1HIMH 2EYSB 1ZS8A 3FB8A 4EIGB 1DN0B 4WFFE 1CG9A 5C0NC 1P9MA 4JHAL 3S3JA 5D7KE 3UTZB 3ARDC 4RCAA 4LSQL 1MI5E 1G9ML 2A6JA 4KI1A 5IVXB 1X5IA 2WBJC 1JHLH 3PXHA 5ESVB 5HYEA 4QRQA 4JRWA 3V4PL 1JV5A 8FABA 4YHMH 3V7AG 3WXWH 1CTOA 4WHCA 1Z0NA 2C4XA 1IAIL 4G8EA 4NGHH 1BJ1H 3MOAL 1C8PA 1D5BB 3OR6A 5D5ME 4JKKA 1RIHL 1I8KA 3I75A 4P9HL 4WU5A 2X4QA 4K3DH 2WAHA 1U8MB 5FYKH 2YXFA 1FGNH 3HAEA 4RIRB 5MENB 3KXFD 2LTQC 3O6FB 4TUOA 1NAKH 3O81A 3K8LA 1PEWA 4PG9B 2GAZA 4GJTB 4KVCH 3GNMH 2X44D 3IDYB 1T5XA 4PJAF 1LDSA 3MV11 3RRQA 1FAIL 4GG6B 4LVOB 3DIFA 3RX5A 4RMWA 1GHFL 5BO1L 1A5FL 3ZDZF 3QUYA 2EYRA 3B43A 1SJHA 2QADB 4WUKH 5JQ6H 1CXFA 1D9KA 2H3NA 4RMRA 3DO3A 4F57L 2XKNA 4X4YA 2FJFA 1BZ7B 1AQKH 3IDXH 4OIAA 5E9DE 1NBYA 4KY1H 3V5KA 5DTFB 1KLUA 4I77L 4QNPE 5C70A 3C09B 4R8WH 3T04D 4HGMA 1OPGH 3PQYD 4PP2A 1S7QA 2GSGB 3O8XC 5SX5K 3H9SE 1S8DA 1X5GA 1MELA 4KGJA 3ZLQC 2CLRA 4FN0A 4HZLB 4U1LB 4O4YL 4MA8H 1AE6H 3IVKA 4K23L 1K3IA 1ZGLB 3ALPA 2HRLA 1T22A 4RAHA 2DQHL 4LLVB 5DQDL 1SMAA 4YC2C 3GB7A 4EI5D 3PWLB 1UKSA 4TVPL 4AQOA 2OS7A 1MRDH 4P2OA 3CUPA 5C09D 3ZDYF 2R0ZH 1AFVH 3ULUE 3MV7D 1UA6L 2P7TB 3KLDA 2AV1A 4FHBD 3VFGH 1NFIB 3O41B 3T0WA 4WI7A 2EDRA 2NTFA 1I9JL 1I1AB 1YN6B 5F1NB 4EDWL 4RWHA 2JJTC 3O6KL 2BRRL 2BNUB 3FHAA 1BFSA 5C0DB 2ZSVA 3NBNA 5HI4D 2EC9U 5C71A 4LHUG 3VXRD 1G7HB 2CIKB 4H8WC 3VI3F 4HS6B 2O5XL 3KYAA 2R2HB 1N7MH 5C2UB 3V6FB 2HJFB 5BQ7A 1U8QB 1YMHA 5T1KD 2VABB 2YN3A 4GW5A 2NXYC 4N0YL 5DJ6B 4TTDC 4GRWF 3O0RH 1J0KA 4FQJL 3FOLB 32C2B 12E8L 4NKDA 4V1DD 3GSOB 4NZUL 4E5XB 2EDDA 2A6KA 1I7TA 4XNUH 5JW3H 5FGBA 3SEPA 4OZHE 4GBXD 3QNZB 4Y5VB 4O9HL 4Z95H 4GKOA 1FVCA 2V5TA 2DYPD 3JVGA 2X89A 4JZNA 4NBYB 5GJTH 3EYFB 4X5XB 4P5KB 4XXCC 5C9JB 2Z31D 3ZE0E 3IJHA 1IL1A 4NJ9H 2P45B 3QULB 4PRIB 5KJRL 4HIXH 4HKBB 2ICEB 4NRZB 3TVMB 2DTMH 3FO9A 1JZ3A 1BVKA 1MCOL 5J89A 4Y8DC 5FHAH 4ZFZA 1OVZA 1B9ZA 2FB4H 4JZJA 2KKQA 3BEWB 1DCLA 3TESA 2I5YL 2F58L 5KW9H 1QEWB 3ULVF 3RWHA 3S37X 2BDNH 3N1PC 3AS3A 5IG7A 5D7JB 3RUGE 3IKCB 3NFPA 4WFGD 1LP9B 5HYQB 4DKAA 1RUMH 4DUWA 4BH8A 4CBPA 5JHDD 3LPFA 2HMID 4IRJD 4G8GA 3WCYA 3O2DA 1KN2L 1RK0A 1U6AH 2DD8H 3NCBB 3VXUA 35C8L 3VXPB 1PKQE 4D0CA 3KPSD 5ISZB 4XNZB 2FO4B 5AUMA 2OL3B 2ADIB 3HS0B 4YWGH 3T4AB 4JFDD 5TPWH 2AS5M 3ZKND 1KJVA 1PSKH 3LKNA 5CEZE 1OLZA 1WQVT 1EAPB 2VDLH 5DO2C 4FMKA 5DFWH 1NGXA 4HK0B 1ZT7A 2QSCH 3AUVA 1QFPA 5TE7H 3UPRA 1UH2A 2O5YH 1WTLA 1FYTA 3MXVL 1S3KL 3AMKA 4M1DL 1INEL 4KDTA 5D93B 3JTTA 1YYML 3RDTB 1JGVL 4EVNA 1A9BA 3SO5A 1I85A 4QRRD 1CGSL 3KJ4C 2OR8A 4YK4B 3CFKB 3EOTH 1PZ5B 3MTRA 1TETH 1U0QA 2WLZA 3O3DB 4GW1B 4L8DA 1QOKA 1IEBA 2A2QT 2C3WA 4OF5A 3E2HB 1CFSB 3U82B 3MLZH 3RVUD 3OKDA 3WLWD 1P84K 1AO7B 4AIZA 2DL2A 2CKBL 2BVYA 2PTVA 4LPWA 3QQ9D 1MHHB 1CD1B 2R8SL 1ZHKB 3O3AA 5MEND 1F4YH 5KSUA 3O6FD 4PY7A 1MFBH 5FYJD 4F3FB 4WJ5B 4FQQA 3V95A 1I3RA 4HUXA 3SBWA 4OBSA 4JFFE 4I3SL 2HLAA 3D18A 1EHLL 2AK4B 4DOHB 1L9NA 3D3VE 2P43B 3F12A 4KK8C 1Z9OA 1C12A 5EU7E 2JJSC 4KJPD 2Y6SD 1T83C 3DJ9A 5I17B 4I18A 4CMMA 3WJJC 5BW7C 3E8UH 2VIRB 3MNZA 4QOKB 4Z7NF 2QADD 5JOPE 5ERWA 3U4EB 3MROB 5LBSL 2DAVA 4JR9H 4OTXH 3B5HA 3GJEA 2J8UB 1OT2A 1JCKA 4UV4L 3QIWC 3VH8B 2HTKC 5JW4R 1I3UA 2B1HL 1UWXH 5DK0B 1MVUB 1VA9A 3MREA 1QO3B 4R3SB 1QLEH 2YZ8A 4M1CC 3UZQA 1HQ4B 3CSYB 3FJTA 1KIQA 2JB5H 3NCJH 2D7NA 5IWLA 3V5HA 3EYOB 4MD4A 4HWNA 1HHHB 1BECA 4HWBL 1GCFA 5FUCE 3X3FH 4KI5C 3E3QC 2DDQL 1BVLA 4L3CA 3O4OB 4Q74A 1A6WL 4M7LH 3RNQB 4I5BA 5HBBA 4NSKB 4LNVA 2IH1A 3C2SA 5GRYA 4JGMA 2IALB 1I1AD 3CXDH 3I6KB 4NQDA 3RZCA 4KKAD 2H2SD 2HH0L 1JHTB 3QWRD 3DECA 4GSDH 1DQQA 2Y36L 1CWVA 2ED8A 5JHLL 5TGBB 2DJSA 3WE6A 4NYLA 1YDPA 2X9YA 3VRIB 1IQDA 4PB0L 1U58B 1X7QA 3TF7C 2CRIA 1K4CB 2FSEA 5SWZB 1A7BA 2ATPB 3C2AH 4N8VB 3IU3B 3JWNC 4K8RL 5K9JH 5GZND 2JK5B 3DXAA 4P5MB 4L9LB 4TSCH 1AR2A 2ZP0T 3UJTH 1DUYA 1QSZA 2ITDA 1K6QH 3SE8H 2XTJC 2YPKB 5D1XB 4GS7C 1N5AB 4RZCB 4YH6A 2EE9A 1MCFA 4Z7WA 5D5MF 3BZFA 4HK3N 2J6EL 1QKZH 1NCNA 1MIEH 1HH6B 3BYTA 5AZ2L 4QGYA 2R2CA 4DVBA 2EE3A 2Z92B 3H0TB 1KB9J 1EBAA 4PRID 4FFZH 1A02N 4E41A 5JXAL 4WHTB 1RI8A 1K3ZA 3TVMD 3ALXA 5KVEH 5ICXB 1CE1H 3NCFB 4G6FD 5C09E 4X8XA 3MV7E 4LGPB 5D1QC 3MV9E 5IMMA 2DS4A 3FAWA 3IFLH 2GJ6B 4M61B 1U8OB 3F7YA 5D7JD 1MCLA 4HJGB 1G9NC 2BHUA 4LARH 1KPVA 2BOBA 5GS0H 3KPLA 4E0RA 2ESVA 4ZFOL 1LEGB 1CBVH 5ISZD 3CFJA 1DFBH 2OK0L 2NXZB 2J7LA 1WBZB 3MRIB 3KDMB 4QNPF 3VXRE 1WCQA 3BSZH 3N9GH 4JHWL 4FMFA 4Z7VB 1JI1A 1H3PL 2GUOA 4R26H 3QFDB 4X4ZA 4OCLC 2V5MA 3HC4H 1QYGH 4FQ1L 2DLIA 3CFCH 4IOSD 4R0LB 3MRQA 2R9HC 3LN4B 3QO1A 5KVFH 1T7WA 3MJ8A 5FA3A 1NC4B 3WLWC 3P30L 2K1MA 1GGCH 1P5VA 4PGZA 2FL5B 1JZ4A 3LS4L 4L3AA 1Z0MA 4V1DE 1AH1A 2FATL 3LN9A 4PJ5A 2NY4C 4UV7H 5F7HA 2HKHH 1QFWH 4U1GB 4NO0A 3KS0J 3ULUF 1ZOXA 3MODL 4LCCB 4MJ5A 4NCC2 1MCEA 5I66A 2QKIB 3FB6B 1MLCA 4PJ8C 8CGTA 3IFPA 4KMLB 1Q38A 4NQTA 4JQIH 4FTVB 4N0UE 2WQRA 1MCPH 4LASL 3U0PA 1FN4B 2PO6B 5HSFA 5IM7B 1RUPH 2X41A 3SE3C 1JFQL 3R8QA 3WSQL 2Q8BL 5J9PB 4WFGE 4QXWA 2BERA 1MCIA 3GGWB 3GMPB 2D4FA 5JHDE 3OGCA 2AK4D 4XCNB 3HMXL 4P3CH 3BYYA 3TH3T 3VXUD 1UVQA 5F1KC 1KULA 4J12A 3STLA 2P8MB 4X9GA 1I1YB 4KKCD 1J05A 1G0YR 5A40E 4ZOBA 1E4XH 3M07A 1YNKL 2P46B 4JFDE 4KPHH 5EO9B 2VZTA 3PIQA 4OZHF 5T1DL 5CLTA 1MJ7L 5F7FA 3KR3L 5FUZL 2MCPL 1T7ZA 2NPLX 4OLXL 1FFNA 5EZOH 3ZE0F 4JB9L 1F02I 4LBEB 1IM9B 2PKDA 1RY7B 3T8XA 2RCSL 3U36B 1J1OL 3BD5A 4QF1A 4X5WB 1S9YA 4QRRE 2L0DA 4MYWB 4YHYC 2FX9H 2VITB 4GKSB 3TH4T 4OZ4B 5FXCH 5IVXE 1DEEA 2XOTA 3BUYA 1JL8A 3JV6B 2R0LH 3FONA 5MEPB 4GKZB 3HE7A 4WEBH 3RUGF 5E00A 4PRPA 4NZDA 5DD0L 2AEIT 2N7AA 1D5MA 4M5ZL 1C5CH 1RHHA 2D03L 4Z7QE 3SKNB 5GRVK 1I8MB 1MAML 3QQ4A 5TF1L 2AEQL 2I27N 4WI3A 3OKEA 5MENE 2NY5C 5J6GA 4YGVA 2FIRT 3SE4C 2VXUL 1N64L 1UQSA 5DJ2B 1INQA 4ZS7L 4X8JA 5B8CB 1JWMA 2VLKB 5DQ9B 3D39B 3H42H 2R69L 4PY8J 2GK2A 3LMJL 4GG6E 4ZNEA 5D7IB 3ARBB 1CL7L 4LSRL 4ALAL 5T3XL 5GS2H 1MHCA 2JELL 1E4WL 3QXDB 2D2OA 4X0KA 4I0PA 3LEYL 1FH5H 1E6OL 5DRNB 3QIUC 3BPNC 5CFHA 1X5ZA 3GSNH 4JANA 2R2BB 3DVNA 5SWZD 2IBZY 4KMQA 4XPTH 4WRLA 1NKOA 3FN0L 5DD6B 1U8HA 5FCUH 3TJHC 1PX3A 1T1ZA 4HUUB 4D9QD 3TNNB 4LPYA 5AZEH 1R3IL 3F7VB 1ZA3B 1DEDA 2KL6A 3LRSB 2EO9A 3MLVL 3AB0B 1RZJC 5D1XD 4CNIA 1X5FA 3SHSA 4MNQB 5ID1B 4UT9L 5TDNA 4LSVH 4PV9A 1LHZA 1GC1L 2XT1B 2VDML 3VWKA 2BZDA 4PLNC 1U91A 1EPFA 1MCWM 3GRWL 5F96H 1CK0L 3GMRB 4KZDL 2B4CH 4LHUB 5J4MA 4ZO6A 1AGCA 1OSPL 1G1CA 2XZAH 2IBZX 4G42B 2E7BA 3BH9B 3O3BB 1P4LB 1MJ8H 4GAYB 4F80A 3HAEG 5DLML 1NGPH 4QYOB 1II4E 4U6VH 3E6HB 4CN4A 2GJ6D 5EORH 2VISB 5LGHH 2EIZB 4XP1H 3INUL 1HSBA 1D5ZA 3L3GA 2C1PB 1AQDA 4KMTH 5AEAA 4DEPB 2LU3A 2IPUG 1SY6L 2O61B 4NQDD 3BP6A 3W0WA 3ISWA 4OIIL 1FYHB 3ORJA 3F65A 1F4XH 1SBBA 5C07A 5JOFA 3T4YA 5I1DA 2NXZD 5BS0A 1VB9A 4B7IA 3MRHA 4TNWK 4MD5A 3KNBB 2JIXB 5EUOB 1WICA 4RGNC 3Q3GA 3QHFL 5CLWA 1FORL 5DJAA 3BPOC 2PUQT 1M7IA 4UOW1 3EYUL 5EC2A 4UT7H 1EGJH 3HZKB 3BP5B 4LCIL 2CO7B 2GFBB 1FL5A 2E7HA 1ORSB 1HHJB 4ODTL 1FG2B 4LF3B 1RFDL 3FQTA 5D9SA 1QBAA 2QSVA 3TA3B 4UBDD 4RAVB 5IMKB 4GOSA 3BGMB 1XIWA 3D85A 2DKSA 2MPAH 1OL0A 2BOCA 1XGUA 2YPVL 1UCTA 4L8SB 1PBYA 4NHCL 4YBLC 5LJYH 3CZJA 5L9DH 4PRIE 4LEXL 1U3HA 4F7TB 3RWDA 3TO4C 1EUTA 3AROA 4L4VA 3EZJB 4O5LL 1RZIA 1E0OB 4WI8A 3SKMB 3JV5A 2EH8L 3DMMA 5JLZA 2PO6D 2V5RA 3UC0L 4YFLF 4O2FB 3X14B 2H8PB 3QIBB 4QHNB 5KZCB 1WZKA 3QQNA 1LP9E 2H26A 1QBLL 2ZCLH 4J3UA 2ED7A 2EDKA 1KB9K 4KRMB 3QA3A 5IV2A 1SM3H 4JO4L 5EIVA 3ZYZA 4KTEL 4R4FL 4QHKJ 1MSPA 4KJWC 5ISZE 2NTSP 3WHE1 5HD8D 1MRFL 4X99A 4XNXL 3ROLB 4DKEL 3RWEA 3EYVA 1I1FB 1RD6A 1NUGA 4J1UB 1A3LL 1MJJA 5GISH 3ETBF 1U8PA 1GIGL 4FQ2L 1KOAA 1MCSA 4GG8B 3DHMA 5KOMC 4ODXB 3MUGB 2QJDA 1Q0YH 3BZEA 3FQNB 1Q94A 1G7LA 4IIQA 2MMXA 4BSWA 3DO7A 1IM9D 5DC9B 3CZFB 3CFEB 1A14H 1I8IB 5BV7C 1V3KA 3MFFB 2MKWA 1GOHA 3OBAA 3SDCC 4OLVH 2QR0A 3LY6A 5F9WB 5I16A 1NSNL 4OCMC 2MHAA 2ARJQ 3H6JA 4HQQH 1PAMA 3KPNA 3OJDB 1X9QA 1F3RB 5EIIA 1H3UA 3FN9A 4P46B 1IGFH 3RAJL 4R97B 3QNYA 3RL1B 1XH3B 4JREC 4G6JL 4OD3L 1AO7E 1X6LA 2C3HA 4MCYB 2AP2A 3DX7A 4AYFA 4BUHA 1FAKT 1UB5B 1A7RH 3EHBC 3CFDA 3L7EB 4Y5XC 1T66C 4UDUA 1ZT1A 3WDIA 3VXSA 1FNGB 4FXGB 5CAYB 1JYXA 2AK4E 4DOHE 1B88A 2VDRH 2WP3T 4DN4L 5CKGA 1HNFA 5IB1A 3ARBD 1YNTA 1YUHB 5SWSA 4PLKC 1JHKH 4YDLB 3JV4B 4KZEL 1OTUC 1VFMA 4P57B 3BQUC 4QOKE 4PRNB 4XBGA 4XP6L 1AGBA 3L5XL 4YO0B 1U8NB 1BIHA 3HNSL 1EEYB 2J5LB 5D71L 2J8UE 5JMRA 4LHJB 1OP5H 1G7MA 1CYGA 4J7RA 3PWNB 3ZHKA 4MNQD 2L7UA 4BZ1H 2W9DH 4ZSOB 1R3HB 2C7UA 3B9KB 4EN3C 3MACL 1KC5L 4Z0XA 2DI9A 2FJGB 3ES6A 5GRUL 4Y19B 5ALBL 1NAKL 1IKFH 2H6PA 5D72H 3V8OA 4WNQB 5CBEB 5GPRA 1RIUH 4P48A 4KVCL 4ODUA 1LQSR 4JFYB 3IB4A 3CVHB 1OP9A 3T0EB 4FP8H 5ETUA 3IGAB 4JPKL 4UMGA 4IS6A 3RX7A 1KUMA 4OFDA 2FYYB 3EFFA 4PRHA 3AM8C 2JF1A 1A1OB 4R96B 3CVHH 5JQ6L 2AGJL 4I2XA 4WUKL 2AVGA 5KSAB 2APWA 5IBTH 3PDOB 3C60C 4Y16A 2HRPH 1AQKL 3P2TA 4PP1C 1HEZA 5E2VH 1Z5LB 3RQ3A 5GGSY 1KCKA 4ZYKB 1GZQA 1DSFH 1RULH 1N8ZB 43C9B 1MOEA 2Q76A 5J6HA 3G08B 3G5XB 1A6ZA 5CP3H 3PDDA 2JIXD 2QHRL 3GSUA 4UIKH 4I0PD 1V5JA 3ULVC 2VDPH 4U6HB 4QTHB 2YA2A 5SWZE 5SX4H 4OCRH 4GRLC 1IZJA 3Q6FB 3RVXC 2AJVH 5IVXF 2EE2A 4XVUD 4D9QE 1V7MH 1NC2A 2XQBH 1ROWA 2X4TA 5A16B 1B2WL 5LAXB 1UYWH 4XHQA 4FS0A 1R6VA 5EU3A 3TA3D 1R5WB 1AFVL 5IFHL 1WBYB 1ZKAA 4TVSa 3MYJA 5HGGS 4AEIL 4U1SA 3PP4H 1I3GH 2WBJA 4HWEL 4U7KA 4Z7QF 4TYUA 4X7FC 1L9MA 1Q9LA 1U95B 2R4RH 5E5MA 2ADGA 5DUPL 2ICWJ 3KPQB 3MRJA 1N59A 5GJSL 4P59L 5CEYA 5F6HJ 2GCYA 3VXQA 3W5NA 1TTFA 2A83B 1RJYB 4ZFGH 5DZLA 3O9WC 4HCRL 3QUXC 2A73B 4GG6F 5CS7A 2DIJA 2R4SL 3QIBD 5E2TH 1N7ML 2RHEA 5KZCD 2VXQH 2GJ6E 3RZWA 1QRNB 3BKCH 3AY4C 3EOBA 1AJ7H 5J3HD 4BM7A 3VMNA 5I8EB 2AI0H 3IDGB 5CCKL 2XG5A 3EUUA 3O0RL 3QCVH 5MP6H 4EQ2A 4U33A 3ARPA 4PUBL 3MR9A 3MRNB 1JJUA 4XNUL 2C9AA 5JW3L 4UQ3B 3HPLA 4GMTL 5J06A 2GKIA 5IKCA 1GRWA 3TZVC 2HFTA 5KAQF 5D6CA 2DQEH 1P69B 3MRRA 4R7DB 1B0RA 5I1KH 3QDJA 4Z7VE 1FZJB 2DLTA 4NJ9L 4MA1B 1X5AA 5F21B 4Z5RA 1TCRB 7FABH 2DTML 5HHOA 1S7VB 3O8XA 4OLUH 5IROC 4WENB 1NAML 2FB4L 1JP5A 1G7IB 1GAFL 4MAYC 4UU9A 3W39A 1HQRB 4WIQA 1N5YH 2C4FU 5L88L 3ARDB 1BX2A 1TPXB 3I02A 2VLLA 3X11A 2JCCA 3GHEH 4KKLD 5EA0L 5MHSD 1VPOL 4ERSL 3VFVA 3O45A 3SCMA 1ZMYA 3CGTA 3T1FB 3N1FC 1DUZA 2NNAB 5EBMB 1U6AL 2ZNWA 2FEDD 4NC1C 5L6YL 3G6DH 1YY9C 1U3HD 1U8JA 1Y6MR 2JKXA 3MBXL 4L4VD 1IAIM 4FTVE 4YWGL 1EXUA 2ZWLT 4PRDB 1PSKL 4BKLB 4N9GA 1MWAA 3ULSB 1P2CA 1T0PB 2VDLL 4HJJH 3HNTL 3X13A 4BUGA 2ICCA 3QH3A 3LKQB 3RWIA 3T0VA 5EN2B 3RL2A 5KS9B 2JJTA 4LU5H 4UNVA 1QLFB 3L7FA 4AM0B 2P48B 3HC0A 2CGRH 2BNRB 3GO1H 4H5SB 4ZPVA 4K9EH 3AREB 3TBSB 2EDFA 4ODHH 3T09A 3QQ3B 1EUUA 4KVNH 1Q9WA 3V7AE 1C08A 1RK1B 3ESUF 1OARH 3WDHA 2ZOKA 1WJ3A 3EOTL 4FQHB 1CVSC 4ZDHA 2X1QA 2DMCA 4U1IA 1KF9B 1FPTL 1BEYH 4H25A 2V2TA 1UCBL 3HI6L 2J6EA 3LPWA 4AQ1B 3WN5B 3PL6B 4F7CB 1XF3B 1EFXA 3S35X 4LCWB 4PJ9C 1NLDH 5FUOH 2EDLA 3HMWL 5K9QI 1R3JB 4JFQB 1K8IB 5HJ3A 4Z76B 1JF1A 1AGFB 5GGVY 2CR3A 3RPIB 3HUJA 2ILLA 4U1JA 4GMSL 3ZL4L 3KLAB 4Y19D 4XXCA 5C0EA 1EVTC 1O7SA 3Q6GH 3TPKA 3WV0A 1KELH 3RP1A 1E27A 3SY0B 3RKDD 4IHOA 3GMQB 3IT8D 5FGCB 1YEFH 5JW5A 3T0ED 1LP9F 3C8KB 2YBRB 5C3TA 3MLTA 1MAKA 2PYFB 3GDBA 3OKLB 1DQTA 4XNMB 4W68A 1HXYB 4PGDB 2NY1C 4ZFOA 3HZMB 3U7WH 5HHMB 1SHMA 4QXUL 3MLRH 2FGWH 3DVFA 1F6LL 5KSAD 2ICWI 4IJ3C 2V5YA 1MCNA 3CK0H 4HLJA 4L3EA 4OTXL 5F6HI 5FOJA 1ES0B 4NRXA 4M7KH 4X4XB 4WFED 1F00I 2VLKE 4ONHB 3D39E 5H35B 2X4UB 4PJXB 5D7IE 4Z0BH 4QRQB 2MJWA 5IW1B 1P7QB 3L3KA 3ARFC 3MBEB 4QRTA 3T3PE 3VWJB 1RJZA 1AGDA 4PLOB 2EECA 3QNXB 4XB7A 1QSVA 2JB5L 5DMGD 4KDVA 4RFOH 4PJDB 4Y2DC 1GGYA 3R1GH 3GZKA 4DZBB 5J1SC 4NT6A 1EA9C 1OAUH 3VFOB 4JRXA 4N1HB 3X3FL 1EJOL 2WUCH 5TDPA 4JFEA 2APTA 3V0WH 3ILPA 2ZUTA 3VCLB 3I3DA 4MNQE 3HAEH 1UM6H 5CGMA 4NQEA 5CIPA 1JPFB 1RJLB 1ZLVH 4HS3A 1TVHB 3TBYB 3IDIA 2X05A 1LVEA 3K8KA 3MLUL 4LDEB 4F33B 3EIFA 4FQXB 3QPXH 3MCKA 1DBMH 2NY2B 3GMOA 2IF7A 3QPQD 1BD2B 1MREH 4IRSB 3VI4E 4J3VA 3HMXA 4M1GH 4WI2A 1DQDH 5E4EB 5I71B 1KLUB 4YDJA 4MB3A 3SGJC 1QRND 5K9JL 1RV6X 1ZHLB 2CPCA 4QTIL 5GIRA 5C0FA 4C4KO 4TSCL 3UJTL 1TZIB 2JJSA 3EYQD 1EH9A 1K6QL 1T83A 3LV3B 5CZXC 1AP2B 4LVHB 2J8UF 3WJJA 4QCIB 5BW7A 4JFXB 1IAKB 5EO0B 1EZVY 1QKZL 2IQAB 4QHLA 5DEGB 1F2QA 2CRMA 5EUOE 3QDGA 4G43A 4KXZI 1CGYA 1R3LA 4JG1H 3S3PA 4JZOB 4HUKB 2Z4QB 5E6IB 1HHKA 3FT2B 4PJHA 4P2RA 4P23C 4AL8H 3Q48A 4PS4H 3A6CH 3TYFB 2D7QA 1CE6A 1AHWC 3VFSB 5CHNA 3D25A 4M48H 4XMPL 1YN7A 2BY1A 5C0ND 1J87A 4PBWD 3GFUA 4ZQKB 3MRKA 1G7JB 1TJGH 5HDQH 3ARDD 1T1XB 3ARRA 4G9FA 5HHVH 3MO1B 2G5BB 5SWQA 4X6CE 1FZMB 3AAZA 3UYRL 1DVFC 2HJLB 4LARL 1AXTH 2VSCA 3CMGA 1KB5B 3RNKB 2VUYA 5FKPA 4QY8A 5GGTL 1EZVX 2QQQA 4YHZH 3IDMA 3QUMA 2BSED 3RGVB 3ZYJA 1S5HB 5IJVB 3FL7A 2PXYC 3WKML 1NCWH 5EZLB 4LGRB 3N1MC 5DHXB 3ZSSA 3TV3H 2BP3A 3D5OF 3GIVB 5I8OH 1R0AH 2VKWA 4NKOB 3G6JB 4X9IA 4KROC 1SEBB 5CJXC 4Y4FC 4XMKH 1XZ0B 5IT2H 4R26L 4MS8C 5DA0B 5DVOA 1SMOA 4M8VA 5I1JL 5E8DH 1NDMA 2WM0A 4MAUH 1GGCL 5LGJB 2F5AL 2BNRD 1JNLH 1TVBA 3C6LB 3S96A 3ILQC 1ZGLP 4DTGH 4PJGB 3F6LA 3OPZH 4LLQA 1QFWL 4A6YL 1CDIA 2X4NA 2DJUA 5IMLB 3WFHA 2BVPA 3MRBA 1F58L 2YRPA 1P4IH 1FSKC 2X09A 3HI5H 4KGLA 1C7TA 4XI5D 5HGDB 3S98A 3GSQA 3PL6D 2Q7YA 3VXTB 4HUVB 2V2XB 4LCWD 4ONGL 3OKNB 4JQIL 1U92B 3CNKA 5HHOD 3GRWA 3QIWB 1UWGL 4KAQH 1GH7A 2FBJL 3D69A 4RAUA 1RUPL 1JGUL 5FO7A 1GGUA 2OBGA 5MHSE 5DC4B 3MMEB 5KTEL 3UCRA 3OAYH 1J9CT 3S5LA 3WS6C 1QSFB 3O2DH 5MEQB 1U42A 2HJKA 1MFAH 2O5ZL 4HIJA 3WHXB 3THML 4JLRB 5D1QA 4TUJA 1SY6A 1HKLL 4GUPB 2DBJA 5HHMD 3OKYA 1FYTB 3OHXA 4HWUA 4S10A 2FR4B 1FQ9C 3RPKA 3AGVA 2P5EA 3VFRA 4YHLL 1WFNA 5DFVC 4WHYG 1W0YT 1A9BB 1M4KA 1S9XB 5JUEL 4Z7VF 3MRDB 5I8CA 4PRAA 4U6TA 3R06A 3CFBB 1NCTA 3UTTB 4XPHL 2FX8H 3GUTB 5ILTH 1P7QD 4M6OL 1T1YB 3MA7B 3MBED 4TOYL 3C9NB 2G5RA 3VWJD 4I3GA 3GSRA 3N1QC 3TH2T 1QLRA 3AC0A 2A9ML 4GKNA 4NQVA 3UTQB 3LRHA 4WEBL 3U4BL 1VHPA 1G6RB 1OGAB 3WUWB 4DGYL 1C5CL 3FT3B 1X6NA 3LZFL 3SO3C 3KYNA 5A1AA 3ZKSD 3L3JB 2IAMB 5ICYB 3RIFK 4GS7B 1UT9A 2BFVL 4P4KC 2I9TB 4ZSOE 4OUUB 3CDGA 1WZ1H 4ZUVB 1V7NH 4Y19E 5ESQA 1C1EL 4U6XB 2ARWA 4PJ8A 2FLRT 4Y4KC 5EOCJ 3GK8H 3H42L 4JFZH 3T0EE 3WDJA 4FQXD 1T21B 5JR1H 1QHOA 2NY2D 2P42B 5EBGA 1BD2D 4IRSD 1FH5L 2YWZA 1ERNA 1QFUL 3V6OA 1FNEA 1WK0A 3HI1A 5D96C 1NEUA 1D6VH 2ICWA 3SKUD 5CILL 4WW1B 1KIPA 2MOVA 5A2JH 3BIKA 4YXLH 4BSJA 1XCQA 1HZHH 3M8OL 4PREA 1G1YA 4G8IB 4YHOH 1KCVH 7CGTA 1MH5B 3ULUL 4WFEE 3V7MA 3TCLA 2OM5A 4LKCA 2PN5A 1IEAA 3X3GL 4MD4B 2XN9A 3AS0A 3SE9H 3CPLB 5DO2D 3QRGL 3T1WA 4R7NB 3I50L 3OKOB 5E6ID 5F96L 1UM4H 3MLPA 2PW1A 1K8DA 2B4CL 4BFBD 4NQSA 2WIIB 3MGOA 3CVIH 2XZAL 1R3KB 4L8BB 2UWEB 1JGDB 3BOVA 4TN9A 3SKJH 3RVTC 3DHJA 1MJ8L 3DGCR 5E08H 4IOIA 1T20B 4OLYL 1NGPL 1B4JL 3W5MA 4U6VL 4OFPA 3U4AA 4FA8A 3LB6D 1KJ2B 2NY4B 1KBGL 5EORL 3KPPA 4MCZB 5LGHL 2ITCB 1G84A 4PG2C 4XCEB 3QYCA 4HFUL 4MX7B 2FJHA 2VXTL 5JORB 1T0NB 1LO2L 1PVHA 5CD3B 4XRCA 3RGVD 4AIOA 1HYRC 3UTSA 3V4VH 4POZC 3UP1A 1CXHA 5IEHB 3SDXA 4Q9CA 1EEQA 2BSSB 2W65A 2COQA 2FBOJ 4XPAL 1E28B 1X5HA 5D7IF 1NCBL 5GGUB 1LD9B 3FRUA 3DXAB 3SE4A 2VNCA 2R0WH 2XWBB 3P4OA 2NW3B 1DUYB 4HKJA 2VLJB 4C56A 1KTDA 5T3ZD 1OAQL 1QRNE 3T3PF 2IG2L 3BGFB 1YEJH 4Z7WB 2A6IB 5GGSB 3BZFB 2EDTA 2PYEA 2AJZA 4KK8D 4F7PB 1NH6A 2XIDA 2X4RB 1DQML 4KKNA 1S9WA 4UUJA 1BQHG 1TMCB 4K94H 3RGHA 3QIUA 4QHMA 5HPMA 1BFTA 1H5BC 3MGAA 3QJFA 1YJDC 2MPAL 4YBQC 5IFJA 2NZ9C 5DXWA 2K9UA 5HI4C 3D9AL 5FYLH 1E6JL 4XTRD 2VE6B 5CP7A 2WINB 3A6OA 3RJDA 4BFIA 4FFVC 1W72A 2W0KA 5HHPB 4ZUSB 4DQOH 2FZ3B 3QIWD 1WIUA 4KQ3H 2DLFH 5C0GB 1FFPB 4UINH 4GRMB 1K4DB 3DX6A 5I19L 4YR6A 1KTLB 4HKXA 1TVDA 4NO3B 1BBJB 1UZ6E 1ZLSH 2ZUQC 1T04B 5MERB 2ZCLL 3VI4F 4M1CD 2Q8AH 2R39A 3LKPB 3ALWA 5IVZA 3JSSA 5D7LB 3VDAA 1QSFD 1SM3L 5EOQL 3FB5B 3DGGB 5JIPA 4L29B 1V3MA 5ID0B 3NIDE 1MJUL 2D0FA 3VD3A 3QXAB 4KI5D 4LK4A 4MHHG 5FO9A 3WFCH 2W9EL 1N3NB 3GI8H 1F6AB 1MCDA 4Y89A 1VDGA 3LQMA 5KN5A 5EUOF 2MQ0A 5KS9E 5IB2A 1IAOA 2VC2H 4RQQA 2EIBA 3OTTA 4OCWH 2J88L 4S1SL 5EC1A 2XFXA 5ITFB 5T33H 3TN0C 3BZ4A 3UTTD 1A14L 1X5KA 1W0WB 2BNRE 2R15A 4Z7UB 4X9FA 5I66B 4IRJC 2HMIC 4J2XA 4LCUA 3SDAC 4ZXBB 5DMIH 3L3DB 4O02H 5E8NB 1S5IL 1IC5H 5J56B 2F53B 4WWKB 2YHGA 5IGXH 3NH7L 1OGAD 1AGEA 1JK8A 2VDNL 4JDVB 4X6CF 3VFTA 3ZKNC 4F9LC 3RKPA 4LLWA 3GMMB 2EE6A 3VXNA 4LCWE 3IDNA 1KFAH 3WO3B 2IAMD 5IHZB 3KWWB 1CD8A 1HDMB 1FFQA 5E8PB 1DQLL 1ZVHA 2CRYA 1IGCH 1CFTA 1Q0XH 1NFDA 3L3HA 4F8TA 3VU2A 1Q1JH 1Y6KR 4NPYB 3KYKH 3WIFB 4WCYL 4HCRA 3F7QA 4ETQB 1A9EA 4URTB 1Q72H 1J0YA 5FGCE 3TO4A 4X6FB 2BMKB 4XCYA 4PGCA 3OGOE 3PIQB 4JO2H 4G5ZL 2AJ3A 3CC5B 3ZT7A 4Q58C 2HYMA 2KBGA 1JHKL 1C16A 3G5ZA 1XR8A 3L5WB 2HVJB 1H15A 3HZYA 1QACA 4HT1L 5D1QD 5HHME 3RVUC 1RVFL 4DKFL 2FIKA 1P7KB 2P5WB 3WLBB 3QJHB 1VFBB 3T8XB 3QQ9C 1VFAA 3DOSA 4BFGA 1SJEA 4PJ7B 1A6AA 3B83A 1QBML 1KPRB 3P9MB 5IHUL 1CD0A 3IDJA 1DEEB 4PJXE 2IBBA 3A6BL 4L1HA 4OZFA 4U1NB 2DKUA 2XPGA 2IQ9H 1OP3K 5KVGH 3IDYC 4BZ1L 2W9DL 2ATKB 4UZGA 1CFVL 4PRPB 4ZAKA 3TIEB 1N2RB 1FRGH 1FBIL 1M7DB 2ZCKH 5DFTA 1RHHB 3KG5A 5HGBA 2R23B 5GSVB 1BWWA 5I8KH 5LGKA 4NNXB 4KQ4H 4PJDE 4PJAA 5JW4M 3MNWA 4OGZA 5FKAA 3WFEL 4X6BB 2X4PB 4JN1L 5CZKA 3SDCA 2FH6A 1ED3A 1GGBL 3NGBB 1NGWB 2NY4D 1BGXH 4HAFA 4OAWB 5I1LA 4F7EA 3SQBA 2IC2A 2PCPA 3PHOB 1YEEH 1OD7A 5DJ0A 2W60A 1P4BH 2EEAA 2X1PA 1NQBA 1Z9SA 2V7NB 5KVMC 1DBBH 5GGVH 1YA5A 4PD4K 1S7RB 1QSEA 2ZCHL 4L1DA 1I7UA 1UWEH 3DVNB 2PW2B 3MRPA 5FO8A 2F15A 4B5EA 3KPMA 2R1WB 2YC1A 1BF8A 1BD2E 3NIFE 4XAWH 4Y5XA 3MRFA 1PFCA 5H37H 2VLJD 1F42A 1VEMA 5JTWA 3VGEA 4ELKA 3B6SB 2GK0A 1A1MB 2XQBL 1FNFA 5F6IC 2D7PA 3ZYIA 2VERN 3EYSH 3OZ9H 1GYAA 1I1AC 4NNPL 3BH8B 3WKNA 4ZUTA 1NLBH 1H8OA 5H94B 4G3YH 5C0AA 5L7XH 3BQUA 2UY7A 5DJCB 5FCSH 3EOAB 2AJYH 2G75A 5DJDA 3LQAL 3KPOA 4B50A 3DURB 3KAAA 5TJWK 5C0CA 5DI8A 3VMOA 1FO0A 1QG3A 3ZHDA 3Q5TA 4BELD 2R29L 3U0TB 4Z8FH 1B90A 2BC4A 5KOVC 1L7IH 5E2WL 3HR5A 1AJ7L 3W9DB 5D7LD 2VOTA 4KH2A 3U9PL 1RHFA 1K2DA 2AI0L 4YDIH 2WBKA 4G6MH 2CDGA 4RFEB 4J3WA 3O2WH 3S97C 5ENWA 3UTSD 2ZOLA 5IQ7L 3BXNB 5EU4B 2WWMD 2IH3A 1BM3L 2VXVH 5BVJB 1AD9B 2DQEL 4FFWC 3G6JE 3MRGA 3TVMC 4TNWF 3RTQC 1PQZB 3X12A 3V2AR 3C60A 5KSBB 1A2YB 5DWUL 3QCUL 2VLRA 4JHAH 3LEVL 4TULH 1YC8A 1ZWIB 2J3SA 3CX5J 5T3ZE 1WBXB 3BRDA 4LSQH 1ZANL 4MDIB 4PLJC 1G9MH 2EXYD 1EHAA 1A4JB 3KVQA 4OGYL 4WW2C 2DB8A 1TJHH 4OLUL 1WGOA 5DRXA 4QWWD 2XACC 2E7CA 1S78D 4RMSA 4U1HA 4YXHH 1NBVL 1N5YL 3V4PH 4ZXBD 4ZUWA 4PJGE 5FA4A 3IXAA 3VE0A 3IJYB 1IAIH 1RZGA 3IF1A 3MOAH 2F53D 4WWKD 1RIHH 1RZIB 3VFMB 1KLGB 3VGFA 2DI7A 3D0LB 3L5IA 4LKXA 3U2SA 1N6VA 2VWEC 1JNJA 3B2VL 3MRCB 5HXMA 1MCCA 5DHVA 2ADJA 5FB8A 4LPXA 2XQYG 3GJFA 3DI2B 5I15H 5FECA 4G80B 4HJJL 2G2RA 1I9EA 3FFCA 5D93C 1FAIH 4W81A 4EN3B 4NNYB 1ZLWK 3RDTC 1GHFH 1A5FH 4DK3A 4X6DB 4BSVB 3GMLA 1HI6B 3WFDL 1FNHA 4OD1H 2ICES 4YK4C 4HIHB 1QSFE 4PGBB 3DYMA 4OKVA 4YHNB 3O9WA 1MCJA 4F57H 5FDYA 3OJ2C 2XWTB 4HC1L 3BP4A 4KI5E 4KV5E 3E2HC 1OB1A 4NKIL 2BSTB 4NM4L 2WNGA 5TQ0L 3OR7A 1S7UB 4I77H 1HINH 3CIQA 1DBJL 4D94A 1CDUA 4Y4HA 1TNMA 1ORQA 3VD7A 5DRWA 4O4YH 2JB6B 3QXVA 2YS4A 3P9LA 5FUOL 3HCVB 4NO2B 1QTYT 4K23H 1LEIA 1CFNA 3UTTE 3WXVH 4GFTB 2Z91A 3QXWA 1KACB 1HSAB 3CDYA 2ZG1A 3EO0B 3KLHD 2DQHH 3WNPA 5FYJL 5BRZB 2R2EA 5D70H 3ARUA 5DJ8A 3RWCA 4RGND 5DQDH 1H3VA 4KTDL 3HB3D 1KCSL 1KELL 3LHPH 3O6ML 4TVPH 2JJUA 2NR6C 4GRLB 4WU7B 4LLYA 2P24B 1UZ6F 5HPOA 5BZDA 1OGAE 2HFEA 4P5TA 1UA6H 2IADB 1ZEAL 3MZTA 4NC0B 3QUZA 2NCMA 4LLUB 5IROA 3U30C 3FRPG 4MAYA 1KIRB 1ZT1B 1JNNH 4R2GB 3JBG7 1I9JH 3VXSB 1DBKL 5IEKB 3A67L 3U7WL 3TWCH 3NIDF 4EDWH 5K33A 3MLRL 2FGWL 3ROOB 4JM4L 3H2WA 3L9RA 4NDMB 3FOMA 3KJ6L 5TDOB 2EDJA 5TE4L 2RBLA 4WUUB 5INCB 3TFKC 2O5XH 4XPBL 2DQFB 5J7CC 4HXAL 5KS9F 2J4WH 1M6OA 5JZ7C 5IB4B 2H9GB 3I6LD 4K7PH 2APXA 5B21A 4ODVL 4KJYB 3QUXB 1QA9B 1U8IB 3DTXB 3H7BA 3UO1H 2NY0C 2BVQB 4X7TA 4Q2ZA 3SKOA 12E8H 1Y18A 5IUSA 2E6QA 1P1ZB 1D5XA 3O4OC 4H26A 3F5WB 5EBWA 2XV6B 4A6YA 3WL9B 3MGTB 1F3JB 4O9HH 4DZ8A 2WUCL 1XF1A 4GAJL 2H6PB 1FLRL 4KJWD 1BLNB 4PJCB 1AD0A 4EZMA 3S36X 5KJRH 3BP7B 1UM6L 3QP3A 4N0FA 4O2EA 4BJLA 4PTUB 3L3IB 4X4MA 1G6VK 1GGIL 5BOZG 3RWJB 1MCOH 2CK2A 4RNRA 5DEFA 4NKMA 2I5YH 3ECBB 2UWEE 2LV4A 3LQZA 2ZG3A 5EU5B 3QPXL 4DW2H 4KUZH 2E6JA 5ICZA 3O3UN 2GTWB 4HHAA 5I9QB 1KN2H 4L9LC 1RMFL 5F7EL 1UXWB 1AI1L 35C8H 3OXRA 4I1NB 1MI5A 3LKSB 5D1XC 1H3TA 2V5SA 3LN5A 3PABA 1DN2A 3GSXA 1BQHB 1I7ZA 1B0GB 4YPGB 2AXFA 4MNGB 2YUVA 5C0IA 4HEPG 1OF2B 3REVB 1TIUA 2OR7A 3OKKA 5SV3A 2OQJB 5E2UL 5D5MA 5EFIA 5BVPH 4Y1AB 3ZKQD 4PJXF 3BHBA 2NY3B 2UYLA 4NJAH 3DXAE 3FCTA 1R5VB 3EHBD 1S3KH 4C83A 4M1DH 5E99H 2EDOA 4MJ6A 1MUJB 2EIEA 3OAUH 4OLZH 5GS0C 2VLJE 2OP4L 1T66D 2AV7A 3PGFL 1JGVH 5DVKA 2EO1A 1MQ8A 4GQPH 4Z7WE 3OSKA 1CGSH 4U1SB 3OX8B 1XF4B 2D0HA 5K9KB 6FABL 4PJDF 4AENA 3FO0L 5FYLE 2CKBB 4ISVA 2VAAA 4YAQA 4FZ8L 4YFLI 1OTUD 3BI9X 3BW9B 1AXSB 3DROB 4WWID 5D7SL 1AXTL 4Y2DA 4HIIA 2CKBH 1JUFB 3H9ZA 2E7LC 5BXFA 2B0SH 2R8SH 1NCWL 1BJ1J 4OFYD 3TV3L 4U1MA 5E9DA 4NWUH 4PJ9B 4GLRI 4XH2A 4RRPG 5I8OL 1R0AL 4R0LC 3QAZB 4I3SH 1BJMA 2E27H 1J10A 3H9SA 2GT9A 4EN3D 5IT2L 2H1PL 4X9HA 3CAFA 3NIFF 5F9JA 5JNYA 1W0VA 4MZ3A 3M17A 3IFOA 5D7LE 1YECL 2CDEB 5E8DL 4U1GC 4ZFFB 1OSZB 3CU7A 4M6AA 1OGTA 3DSFL 4CU7A 2FRGP 4LCCC 4MNHB 3LKOA 3BD3A 3IXTA 3QCTH 2H45A 3AU1A 1MNUL 2Q86A 5SV4A 4E9LA 1MHEB 1U8KB 1UC6A 3OPZL 1IGTA 5LBSH 3SGDI 5A2LH 5F3BB 4OD2B 2DICA 3WNNA 3SGJA 43CAB 4CVUA 4POUB 3QZWG 5D2NA 4HFWA 4UV4H 4IJ3B 1CT8A 3C60D 5B38G 5C6TL 4PP1D 2B1HH 4M9PA 1DDHB 2CKNA 5FAAA 1WIOA 2XQYK 4JG0L