5I6NA

Crystal structure of copper nitrite reductase at 100k after 11.73 mgy
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 94
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6nA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6nA02
1WA1X 1OE3A 4F2FA 2R7EA 1GR7A 2BP0B 3MBWB 2UXFA 2IWEA 5FC9A 3EHBB 1PZBA 4E9VA 6PAZA 1PAZA 2FQEA 2XXGA 2YAHA 1B3IA 1SNRA 4BDVA 1CUOA 4E9RA 3AG1B 2PCFA 5E9NA 4CSZA 5TK4A 3FU9A 3SBPA 2I7OA 2PP7A 3NJGA 5I6PA 1SDDB 2XV3A 3FSWA 4BWUA 3OQRA 2EIKB 1ET8A 1KV7A 1KGYE 3X1GA 2BZCA 1PZCA 2WO3B 3TASA 3UACA 3QJUB 1PCSA 2AVFA 2PP8A 4Q89A 2CALA 1AZNA 3FT0A 1A65A 1KBVA 2I7SA 5PCYA 2IH8A 2XWZA 1OOWA 1SF3A 4HCGA 2BP0A 1FWXA 3PAVA 3X1FA 1NIAA 1EZLA 1GYCA 1OV8A 2PPCA 4G7RB 4NB7A 3PAZA 1NZRA 1RZQA 2NRDA 2HX9A 3C75A 3SBQA 1AQ8A 3N2JA 4YVUA 1TU2A 2OJ1A 1GY2A 4M3HA 5AKRA 3FSAA 1L9RA 3QPKA 4YSUA 3EF4A 2UXTA 1NIBA 1AZRA 5B1AB 3TA4D 2FJSA 1URIA 4A2GA 2FNWA 3IN2A 3TU6A 1F56A 5I6MA 3ASOB 4N8UA 1J5CA 2HZHA 2E86A 3CVDA 4DP1X 2PCYA 1ILUA 2CCWA 2W88A 2B08A 4CSPA 4DP2X 5I6LA 4P5RA 3EH5B 3UAEA 3NJMA 1L9SA 4KNTA 4MFHA 3OM3B 2PPAA 4BXSV 1WS7A 1ZV2A 2PPFA 1AG6A 1KCBA 4TXVB 4HHWA 2AZAA 4HAKA 1ZIBA 4E9YA 3S8FB 4KO7A 3FYIB 1XB8A 1NINA 1AS7A 4NERA 5IY5B 5I5JA 3RYMA 3FQ2A 3UAAA 3PLYA 2N0MA 3PAUA 1ZDQA 1OE2A 1JVOA 1A4CA 2I85A 2BW4A 1M56B 2VW7A 3GDCA 3TBBA 4A2EA 4GP8B 3H4FA 2PPEA 1PZAA 1AS8A 2WO2B 3MX0B 4AKOA 2UXGA 2JXMA 4GXFA 3FU7B 1NWPA 2DY2A 2R7EB 4E9WA 3TBCA 2BHFA 1A4BA 2PLTA 1ASOA 3KW8A 2EIMB 2HRGA 3NJLA 2IH9A 4UAHA 2FQDA 1W8EA 1ZDSA 2Q5BA 2ZXWB 1ET5A 4BDVB 4BXVA 3OMIB 1RKRA 2IDSA 7PAZA 2UX6A 2GSMB 3JTBA 4DP6X 4KOCA 1GS8A 1CYXA 2XU9A 1VLXA 1TEGA 4GY4A 1GY1A 2BW5A 3PCYA 3AG4B 5D4IA 3WKPA 1WA2X 3QJQB 2XV2A 2JFCA 4YSDA 3QJVB 4KNSA 1NICA 3NJIA 2VW4A 3S3DB 4AKPA 4G72B 2MTAA 3FU7A 2JKWA 3AZUA 2QPEB 1SHWA 4W9ZA 3NP3A 4DP4X 2DYRB 3GYRA 4QLWA 1E67A 3ABMB 1E5YA 4QKTA 4DP8X 4W1TA 1HFUA 3FPYA 3AG3B 1A3ZA 3FYEB 5D4HA 1IUZA 4UF7C 1N68A 3H56A 5I5MA 1ASQA 1JXDA 4F7KA 2GC4C 1ZIAA 2YAQA 1EHKB 1YLBB 1J9SA 2IDUA 3BQVA 5B1JA 1IBYA 4A67A 1BQRA 1RZPA 5ANHA 3ABLB 4DP7X 3NSYA 1TKWA 1XB6A 8PAZA 3ABGA 2XVBA 2XYBA 4GP4B 2VM4A 2FT7A 5TK2A 4DP9X 2ZOOA 5B1JC 5B3SB 3NJHA 1OF0A 5EHFA 3D12B 3SBRA 4GP5B 2X87A 4YSSA 2IDFA 2BP8A 1OCOB 1NIDA 4K9JA 1NPJA 2GC7C 1HAWA 1KCWA 2J57A 3HEIB 2HX7A 3T6ZA 1CC3A 1I53A 1KBWA 5D4JA 4YSAA 3IBOA 2VM3A 2QDVA 4BWTA 2EINB 4P5SA 9PCYA 2J5WA 2P80D 2YAMA 1BYPA 1ID2A 1NPNA 2QT6A 4KOBA 1V55B 2A3TA 4DPAX 1PY0A 3NP4A 1GSKA 4HALA 3IN0A 3OMNB 4HCFA 4HHGA 4RH4A 3WNJA 1AR1B 2XXFA 2GBAA 3NJNA 1PMYA 1N70A 1NWOA 1QHQA 1ZPUA 4E9TA 5LDUA 1GS6X 2X88A 3NYKA 4DP5X 2HRHA 1PNCA 3ZBMA 1SF5A 2EILB 1HAUA 1NIEA 1ETJA 1BEXA 2BWDA 4A68A 2AFNA 1OE1A 2GB2A 2Q9OA 4YSOA 1NIFA 2YXVA 4E9SA 1J5DA 1JZIA 2QDWA 2YAFA 3FS9A 3QJTB 2J55A 2XX1A 1MG3C 3SQRA 4YSEA 2AANA 2W8CA 2LLNA 3BVDB 1TEFA 3ASNB 3DKHA 1AS6A 3ERXA 5I6NA 2YXWA 5I6OA 2HXAA 4HIPA 1E65A 1BQKA 1PLBA 2Y69B 2YQBA 1L9OA 3FQ1A 4WTQA 4BWWA 1PF3A 1JERA 2BWIA 3FQYA 1BQ5A 1AACA 3NSFA 1W6LA 2UX7A 3UGEA 5B1BB 3ABKB 1L9QA 2VN3A 2H3XC 1PNDA 1KYAA 1IBZA 2CUAA 4KO5A 1ADWA 3IE9A 5PAZA 3S8GB 3H4HA 1WS8A 2AZUA 3FPXA 3NSCA 3X1EA 2CBPA 3X1NA 2IWFA 7PCYA 1JZHA 1SFHA 2PP9A 4M4RB 3FSZA 1DZ0A 4UANA 5AFAA 6PCYA 4A2DA 2TSAA 2DWTA 1OCCB 1X9UA 1QLEB 3WI9A 2H47C 1ET7A 1T5KA 4JHUA 3WKQA 1IC0A 1M57B 4HCIA 1J9TA 5I26A 2XX0A 3JT2A 2GHZA 3NSDA 2B3IA 4PAZA 2BP8B 2FWLB 4YSQA 1MDAA 2VSKB 1AG0A 2VW6A 3DIVA 4F2EA 2HLEB 3WG7B 3NJKA 3PXLA 3OMAB 4DPBX 3QQXA 3UABA 1WA0X 1V10A 2PPDA 2IDTA 4FAAB 4EF3A 2EIJB 1AANA 1JZFA 3ZDWA 4YSCA 3CZUB 3X2QB 3CDZA 5A7EA 2OV0A 3CG8A 2DYSB 3S3BB 3FU8A 1CYWA 4AZUA 1L9PA 2RACA 2GIMA 3WIAA 3PPSA 4L0PB 3U25A 4DP0X 2IWKA 4N4YB 1JZGA 1KDIA 1MG2C 3AW5A 4YSRA 3V9EA 1V54B 1R1CA 3QJSB 3X1BA 2FT6A 2YAPA 1NTDA 3OD3A 3T71A 4E9QA 4X4KA 4WKXA 4AKQA 1FA4A 2OCCB 4KO9A 4HZ1A 2YARA 5F7BA 5F7AA 2XLLA 1PLAA 1MZZA 2BZ7A 3AY2A 2XV0A 1AZUA 5I6KA 3FSVA 1QNIA 1E30A 1AOZA 4DPCX 1XB3A 1JZJA 2P80A 3GXUB 4JHVA 3T6XA 1OCRB 1AZBA 3HB3B 1A8ZA 4AI7A 5B7FA 3T6VA 1W6WA 2IDQA 1SDDA 1AIZA 2VSMB 1X9RA 1GW0A 2H5UA 3EH3B 1SJMA 1NDTA 3KW7A 3S3CB 1JXGA 4KO6A 1ILSA 1L9TA 3CVCA 2TSBA 4BK5C 2MRYA 1JOIA 2XUWA 4E9XA 1JVLA 1UATA 1BXVA 1XMEB 4YL4A 4JKNA 1BAWA 2DWSA 2WSDA 2IAAC 1E5ZA 4A2FA 1PLCA 3V9CA 4YSPA 1KDJA 2DV6A 3UADA 3AG2B 1CURA 1ASPA 4AX3A 3EH4B 4G7SB 2YAOA 2ZONA 3CVBA 1J9QA 2BO0A 1DYZA 5I28A 1BXAA 3N55A 2CAKA 4ENZA 4FA7B 3T9WA 5B7EA 2FTAA 2CJ3A 3DTUB 2HX8A 1SHXA 5I5IA 3CDZB 4GYBA 1GS7A 1RCYA 2FQGA 3QJRB 2J56A 1A4AA 3G5WA 3NT0A 3WNIA 4KNUA 4ZK8A 1BYOA 1J9RA 1SFDA 4PCYA 1BXUA 4YSTA 4A2HA 1JZEA 2FT8A 4A66A 1JXFA 4G71B 1FFTB 3L45A 1IKOP 2FQFA 5AZUA 3ZIYA 2Y1AA 1WAEA 2YAEA 4G7QB 2ZWNA 3NJFA 3NJJA 1OCZB 3ZX1A 5B7MA 4NAJA 1AAJA 1AZCA 4Q8BA 5B1KA 2GI0A 3T6WA 2QPDB 2UXVA 3IEAA 2VMJA 4G70B 4YVNA 1MZYA 1M9WA
chains in the Genus database with same CATH superfamily
1W0WB 1P7QA 1XGYL 4F2FA 1QFWL 3GINA 3RWHA 2D2CC 3NFNA 2FR4B 4PJBA 2VDQL 2ITDA 4HHAB 1FCGA 3K6NA 5DJ2B 1E9OB 4BFBD 1QSFB 4MKTA 1BJ1H 4YDJA 3L4UA 4CGUB 5HJ3A 3VH8B 1LK3L 2A9CA 3P4MA 1A9BB 1BMWA 1HI6A 3MUHL 4FG4A 1JWUB 3EGDB 1CDUA 2DLEA 3F00A 2CMRL 4N0YL 1MCPH 3IJHA 3DRQA 1KC5H 4NCDA 3MBXH 5LJYH 3IFOB 4YDVA 3VTTA 2FD6H 2PWHA 4C57C 2CIIB 2EDRA 4HT1L 1I9JL 4O2CB 4AM0A 4OCLC 5C9KA 4DEWA 4P3DB 1GGIL 2G2RA 2D3JA 2MTPA 1UD4A 3ETSA 4IHOA 2EE0A 3HMXL 4XX5A 3ULVL 1RK0A 3MXWL 1FWXA 1QPPA 1OWWA 3FT9A 1MW1A 2OBGA 5GISH 4LSSH 1G7QB 4AC4A 3VCLA 2VXTH 1Q9KA 2FX9L 4GJTB 4KJPD 4QJ3B 4DKEH 3LRLA 1CD1B 1BF5A 2Z0BA 3QI9A 3B7SA 4R7DA 5I2IA 3DHUA 3FUDA 3QYNA 1S6NA 5JUEH 3BAJA 5F97E 2EDBA 3DUHA 5BXFB 2X4TB 1A9EA 4K5MA 1I7RA 4L4TA 3HUJE 3LJ3A 2NZIA 3EF4A 4X4XB 2JQZA 1U58A 4NNYA 1EPFA 1UZ6E 3PWVA 1DJSA 2KZBA 1X7QA 4HETA 5M7QA 3UTSD 3ASOB 1QMUA 1LTXA 2G5RA 1Z5YD 3FTGB 1B88A 3ESUF 4NJ9L 2W94A 2R1WB 2V5YA 1TVBB 3QIWB 2XBDA 3GSXB 4RAUB 4X8CA 1N8OE 4FP8L 2ENYA 2FWOB 2PPFA 2HT2D 3EG9B 5E8EA 2XN0A 1MCKA 3KPRE 5LGJA 1IIIA 2J8OA 1NGWA 1ZIBA 4X6DB 2QV4A 2Q7NA 4F7TB 2D3NA 2LTQC 5IFJB 3QFJE 3SYQA 3VXQA 3PJNA 3ZKNC 1AS7A 4NERA 2WLKA 1YN7B 1BBDL 1N64L 5JZ7D 3VFSB 3EGXB 4XTRD 1ZDQA 4YHMH 3QYCA 4WFHD 3ZXAC 3NH7L 2B5IB 3QDGB 2HTKD 5LQBL 4WI8A 1M56B 3M1BA 4EDXA 3B37A 4YDMA 5M95B 1MCHA 4BCZA 1DUZB 1YECH 3R8BB 2M8XA 4OM0L 2WO2B 3QNFA 3CD4A 1T66D 2JKLA 5GGVH 4Y5VC 2XFGB 3F84A 1UB6B 2DQGL 4GXFA 3U1QA 2KBGA 3AQDA 3FU7B 3IWVA 3ZPDA 1W91A 5L6YL 3RWHB 4N0FA 1UADC 3WS6C 4PJBB 1L5GA 3WTUA 2ITDB 1SBSL 3NSXA 1PL3A 1Q72L 1W8EA 7FABL 4WGKA 4Z8FL 3BQUC 4KDTA 4DW2L 3OTTA 1UM6L 4R4BA 4NLAA 2HWZH 5HJ3B 1RUKH 3IKKA 4ZDHA 1CLOH 5TD4A 3TURA 4ZX3A 1HI6B 3UBXB 1CXIA 1R3HB 5BRZA 3T5WA 2WXKA 1JHKL 3VXRD 2EVIA 4R5TA 4YDVB 4DVBA 2NNFA 4M6MH 5JLZA 4XCNA 2EE9A 4AM0B 4NUJA 1RPUA 4ZXBD 3SOBL 1RZFL 2G2RB 3IAQA 3TBVA 1TJMA 2ZSWA 1AJ7H 3A24A 4IHOB 1IJNA 3BE1H 1RK0B 3RIFF 3CFDB 1AGBA 2NW3B 3VW3L 1F6AA 3MSPA 5BO1H 1U36A 1CFVH 4M6OL 1FLTX 1Q9KB 2EICA 3N1QC 4TQEL 5AW2B 4ZS6D 2IOMA 3FYEB 4I0PC 3QI9B 2V3DA 3DTDA 4M4PA 4OLZH 1RZ7H 5I2IB 5SX4I 4ZNEA 2IDUA 1FFNA 4Z3GA 1C8PA 1A9EB 5HVGB 1I7RB 2KUTA 2LFGA 3AS0A 3MLVH 4L4TB 2PABA 2B0SH 5FM8A 3IMWA 2D03L 5AKVA 1NC2A 2OL3H 3RY6A 4EN3D 3C6SA 1QYGL 4OCMC 3L5XL 3WKYA 2F19L 1X7QB 5ADOL 2FSDA 2NQCA 4LVOB 1JP5A 4M3JA 1S2EA 1U42A 3D0AA 3QQ4B 5DMKB 3TA3B 1ETZA 2QELA 3U30C 4A7GA 1EEYA 2MOQA 2WXQA 2X6CA 3LIZL 1FV1A 1FL6A 1W9XA 2VSCA 5EORH 2B59A 5LGJB 1QPKA 3BVVA 1NGWB 4OIIL 1ZHLA 1ZY9A 5DEGB 4GLRI 5K39A 4FJYA 3V7AE 3B7TA 4AJVA 5DLLA 5JQ6H 1PIGA 4UT9L 4PJIA 3MJ8A 3C8DA 4YFLI 3VG0H 3W0WE 3T6ZA 1CC3A 3MLXL 5JIPA 4DN4L 5GS2D 2DLGA 4OJFL 3IBOA 3QVAA 4TNFA 5JIMA 2ZG1A 4Y4HA 3VXPA 1RZKH 1TTRA 3BLPX 1BVOA 3KEHA 1ID2A 3TN0A 2ZF8A 3M1BB 4QXVA 4EDXB 3HE6B 3GUTA 3FNKA 1PY0A 1MRFH 5ESQA 4AQOA 4MQSB 3UBFA 5LN4A 4QRRE 5IV2B 2AABL 3C6EA 3CSFA 4OV5A 3FB7B 3DHJA 3QR1A 3ZE0F 3VXMB 1MFEH 3ATAA 4PG2A 3KPNA 1FIEA 2APBA 4LOVA 4S1SL 3QK0A 1L5GB 2E9GA 1NIEA 1NCNA 1BEXA 1EMTH 2VZUA 1G6VK 1G1OA 5DMJB 4OLYH 4R4BB 2EIDA 1F18A 3AVEA 4ZDHB 5KS9B 3C60C 3M86A 3EYQC 4AW7A 3D50A 3KPTA 1KG0B 2Y1VA 5BRZB 5D7IA 3QEQA 1FL5A 2CLVA 3D9AL 3EJPA 3HZYB 4Z5RA 1IMHC 1RFDL 5EFIB 4X4ME 1VENA 2UUDK 3BVDB 5DVNA 5IJKC 4DVBB 5JLZB 2R0WL 2ZG2A 4XCNB 1QQDA 5FM5M 5GGUA 5INCA 4DEPB 4P4KA 4G8GD 2PUQT 4HUCA 1AI1H 4NENB 3TBVB 4Y5YB 3HI6L 2BWIA 4ZOEA 4EI5A 5EEXA 2YOCA 2BSEA 5DUBA 2NX5E 2N7AA 1WAPA 1BJ1J 3NPZB 4L5FH 5IVOA 2O26U 4X50A 1FH5L 5T5FH 1S7VA 4D9RE 4X9BA 7PCYA 5K59F 1FFNB 4OSUL 4FZEL 1A3QA 2YWYA 1NC2B 4KTEL 3C6SB 4Y1AE 1EVUA 3CQFA 3WLWD 4JFVA 4UT6H 4PGBB 1K8DA 5CIPH 3U2SA 5LWYL 4B7IA 5K9OB 3L3DA 2A83A 1LD9A 1ETZB 3TPUA 1EEYB 2EXYD 3LMJH 3O8XD 2EDTA 1J9TA 1CR9H 2QKSA 1D9KC 3K46A 3ESNA 3ELAT 3NSDA 3Q8EA 3SD5A 4ICXA 2B59B 3VNYA 4PAZA 4HULB 5K39B 1ZHLB 5DRNA 2KC0A 1O9ZA 2UZYB 3DIVA 3S5LG 4PJIB 3MJ8B 3MA7A 4HBCL 4IBYA 5BZZA 2N0KA 2I9TA 4ODHL 3ULVF 2F6AA 1CBVL 1EJOL 4RBPH 5AVYB 3UABA 4Y4HB 3VXPB 4PGEA 2D0HA 3LS5L 3ZYIA 5JXAH 3MRDA 4XVJH 3GBMH 1TEYA 2DQUL 1JMXA 3F8UB 4JFEA 5CSZA 3BZFA 4OCRL 5E99H 4HLEA 2QGCA 3GUTB 4HLZH 5ESQB 2QSCH 4GKOA 1S7RA 3L2NA 4MXQC 4XNZB 1FORH 3QC6X 1I7UA 1S7WA 3VFOA 2IANE 3DO7A 4IRZH 3KPNB 4CVXB 1JZGA 1OIOA 1JTTA 2E27L 2NXYB 3MLRH 1QHOA 3PQYE 4ZTPL 5D1XD 1CGUA 4XNMA 1M1SA 3RKPA 1FGNH 3D39E 4NUMA 4HJGA 4Y4FB 1RZJC 3F7VA 4JKLA 5DUPL 4I2XE 1F58H 5ALCH 1T20A 3WFBH 3IXTA 5D7IB 1HILB 3L9RA 1FL5B 2CLVB 4Z5RB 2ZJSH 2PW2A 1NBCA 4HH8A 4OLXH 4ZNCD 4GXVL 1FZKA 5JHDB 3QDMD 1LO0L 1MCSA 1IM3A 4N3UA 5GGUB 2DQEH 1XIWD 4P4KB 4OLWL 2LGNA 4AGNA 2W07B 1DO6A 1BPVA 1NDMA 4CN1A 4AG4H 5DGQA 4QHMA 2V9RA 1CLZL 1FYTA 4H8PA 3WHXA 2R9HC 5DUBB 4HIXL 4Q58C 2E8ZA 4KGJA 3VG9C 3ZE2E 4UIKH 3EH3B 4HW6A 1OT4A 4U1NA 4ZAKA 1S7VB 1JZ4A 3QZWA 1OAJA 5KVGE 5SWZE 4BFKA 3GMLA 3EOTH 1VFAA 1MNUH 1LWRA 3BSHA 3DA0A 2N4IA 3AACA 2UZXA 1IFHL 3D52A 3CVCA 3SPCA 3C09C 1CVSC 3K5SA 3SJVD 4Y9EA 4E9XA 5MEPA 4MXWH 3MOAL 4JFYA 3WEOA 2CWRA 3U2SB 4LCWA 4Q2ZA 4P2YA 4M61A 1IL1A 2VDLH 5E6IC 1LD9B 4AIEA 2OMWB 4KQ3L 3BLKA 3AXLA 2X9ZA 2M1KA 2WSDA 2HLAA 4A2FA 1KB5A 5DF0A 1P4LB 3DXAA 3PL6A 4PJDF 4LLVA 2NY3B 5D8JL 4P2QA 3FTSA 4TSAH 1WF5A 2XXCB 3MA7B 1G9NH 2YAOA 4XT1C 3W39A 2QGDA 1DLFH 2ENQA 4TNEA 5FO8A 4PHXA 1ZT4A 2EVGA 1I9EA 4MLSA 3ZIMA 4IGBA 4MAUH 4PGEB 2BZDA 3AS1A 4BUHA 1FFRA 4NQDD 5CSZB 3BZFB 2VITB 2XN9E 2YMOA 4ORZC 1IGMH 2DM2A 3NABL 1OAZH 4QMEA 4IEFB 1S7RB 3NUKA 4QXGL 5DHDA 3MRKA 3M07A 1S7WB 1CG9A 3B9AA 2WZPD 1BXUA 3JZYA 1JZEA 1KJ3H 2P5ED 2WV3A 3NFPA 1CI5A 1KEGL 2XTJE 2FQFA 3VACA 3F7VB 1IC5L 3P3RA 4LPTA 4YDKL 1ZS8A 4OGAD 3MNMA 5C2BH 1T20B 1YAZA 3KGSA 4EUPH 3IXTB 3D8MA 4UDUB 4ANWA 1EQWA 2K0RA 3U4BH 1HQ4B 4G11A 4M62L 1FZKB 3CZKA 2ID5A 1Z3GH 2ATPB 5FA3A 4IRJC 4F92B 1WHPA 4XPAL 2BSSB 5GS3A 3QB7C 1NDMB 1CGXA 1Z5LA 3G04B 4QHMB 4AENA 3QJOA 2WMPA 5FYJH 1FYTB 3WHXB 2RCSH 3GRWH 1I4FA 3BMVA 4I77H 1BZ9A 2Q20A 3KWVA 1C5DA 4RGNB 3S5LB 1YNTA 2CLZA 5C0CA 1CTOA 1VB9A 2VRKA 1KCSH 4U1NB 2KKQA 2W9LA 3RDTC 1ET8A 3QZWB 3GMLB 1E4XL 1DBJL 5EMYA 1E6JH 3WLBB 3QHTC 1YQVH 2IDCA 2WO3B 2DBLH 3APDA 4L4JA 5IHBA 3KPSE 1KBPA 7CGTA 4MMZA 1LEKA 5GS0L 3HI1A 5MEPB 4BZ1H 4JFYB 2BY1A 3PHSA 5EEWA 1A7QH 1OT1A 3RJOA 3ARGA 4OFYA 2HLAB 1U8HB 1KB5B 4LSRL 4NFCA 4XO3A 3DXAB 2PTTB 3QUXB 4U6YA 2Z93A 3CGTA 4LLVB 3RBSA 1OAKL 1FAKT 5AKRA 5FYKU 1SUJA 4OZIF 3W39B 4YGAB 1BQSA 3O3DA 1ZT4B 5TDOA 1UOVA 4J3OF 1QD0A 2A6DA 3C08H 1T7WA 2DI8A 3GHBL 1TETL 1THAA 1NL0H 3CBKB 4OUUA 4RZCA 2C3WA 5TF0A 1I1AA 2QVFB 2RJMA 1J5CA 4NHCH 4PV8A 5JW3L 1DVYA 2BP5M 2A0LC 1AFVH 5EBWA 1GIGH 3MRKB 3CHRA 5DJAA 1HHIA 1CG9B 5GGQL 4MJ5B 4DSYA 5KJ7E 3G9VA 4PW4A 4HAKA 4OLUL 3QULB 3T1WA 1CGTA 1NINA 3NFPB 1QRNE 4QRBA 2HYMA 4ZPTA 3RYMA 3GBLA 5F8QC 1F42A 4AWJC 4Y16A 3P4NA 4IIZA 1XEDA 1PG7X 2EYRB 2G75A 2BJML 1A4CA 2VDKB 3O2DH 4OF0A 2P52A 5LAPA 2Y23A 3FO1A 2A9BA 3TBBA 2JKRM 2CR6A 4MJID 3UTOA 1ZJAA 3GIVA 3IF1A 3ZO0A 2JJSA 5FA3B 4PJBF 3K2KA 1W0VA 1RMFL 5DMIL 3KW8A 3HFMH 2EIMB 4JMNA 4HPOL 5IQLA 4RZKA 2HVBA 2W0FA 1Z5LB 4FNRA 2KS0A 3UCQA 2WMPB 3MRBA 3VMOA 3KPRA 3ZR5A 1MCQA 1I4FB 3ALPA 3L1OL 1SN0A 2AAVA 2UX6A 3VDCA 1BZ9B 1C5DB 4APQC 3T0EE 4YXLL 3BWZA 4QRPB 4FD0A 3WDJA 2DWEA 2Z31D 4FTVE 4ALAH 2LVEA 3HG0A 5GRJH 5JHLH 4JZNA 3CTTA 1JYNA 4NP4H 2O5ZH 3O4LB 4HK3J 2R29H 1MFVA 5SWQA 4F27A 1MQKL 3QJVB 2FH8A 4KNSA 4FQQA 5JIHA 1A25A 3NA9L 4AQZA 5IOPA 1Q0XH 4HUVA 1VCBC 3IFNH 2VXVH 2BSDA 3HI1B 1PLGL 2N7BA 4N8VG 3CX2A 4X9YA 2RA1A 3FUFA 3TZVB 3FKUS 4PJ5D 3LRGA 4U3HA 5F1OB 3CFJA 4QLWA 3T3MB 2BHZA 2FBOJ 5C08D 3ARGB 1UKSA 3II1A 4X7FC 1DJIA 3TF7C 4G43A 1M05A 4LKCA 2JNZA 4EZJA 4JRYB 1ASQA 3O3EA 2DWXA 5F7KC 3Q8FA 4U6YB 1X44A 2WBJC 3AXHA 1JL8A 3N5AA 5F9OL 3I6LD 4C58B 1J9SA 1NJ9B 3QUZC 1IBYA 4W6XB 2BSTA 1H6UA 3HNTL 1U95A 5F1IA 1D5IH 3O3DB 5TDOB 2A6DB 1CCZA 1BP3B 3BUBA 3LOWA 4O2EA 4XWOD 2XT1B 4OUUB 5HGDA 3THML 4NC1C 3VI3A 2H1PH 2FRGP 4RZCB 1X4ZA 3BKYL 2FIKA 2XVBA 1CIDA 5AVVB 1UD5A 1OF0A 2Y9RT 3LHPH 4KUCD 1WEJH 3DETC 1JRHI 1S78C 5DFVC 3SBRA 3ESPA 5EBWB 3NCXA 1HHIB 4N8CL 1NIDA 4Y9BA 2ZOKA 3JVGC 4GRWH 1P5UA 4Y2DD 3B5GA 5JYMA 1WCQA 4LEXH 1RULL 5L7XL 2X7LA 3H6AA 2YQ2A 1CU4H 4NQCD 2YKKA 1RY7B 5KYXB 1A4JB 1MF2H 2G75B 4P3WA 2QT6A 3ZN6A 2ICWJ 3FO1B 2QKIA 4DPAX 3CXHJ 2MH4A 3IN0A 1I82A 5FO9A 4M9PA 2VQTA 1OZUA 2D7OA 3D25A 2GBAA 3GIVB 4XMKH 4PIBA 3NYKA 2YLHA 4ZMPA 1W0VB 4BV1A 2ZAIA 4M1GH 1W72A 15C8H 2W0FB 1JWSA 1AMXA 2J1XA 4RETB 2BWDA 5HGHA 2EP6A 2AFNA 4UTBA 4MQTB 3MRBB 1QFWM 1XCXA 3KPRB 4YSOA 3ZTDC 4MNQE 2WLIA 3MRLA 4LPCA 3I84A 5JXED 3FTXA 1JZIA 4HMDA 4GI8A 1FYHB 4Q6KA 4KY1H 3W0WA 4K3GA 3WIHH 2PR4L 3WJJC 1KB5L 3CSTA 2IPKB 4JB9H 4RRPG 4XVTL 4Z7OB 3TTYA 4JZNB 1AS6A 3MBEA 4AITA 1P9MC 1W2KT 2VUYA 3BIAX 1HYRC 3HB3D 3MJ9H 4MCZA 3ZHDA 4C54A 4E5XG 5SWQB 3AY4C 3D0LB 3SIKA 1MHEB 4PSRA 2OTWA 4FQQB 3D4ZA 4ES9A 5D1ZC 2YQBA 3NCJL 4K7PY 5KBLA 1NC4A 5IOPB 4RSYA 3SDCA 2HUEA 3OSKA 5DHXB 4QRRA 2UUDH 5IWLC 4HWBA 4N90E 4Z0XA 4Z3TA 1XFPA 1PNDA 1UWGH 5I73C 5IQ7L 1TQCC 4YK4C 2WWMD 4G43B 1M05B 3S8GB 4LKCB 3R8QA 1XCWA 2NY5L 2GJ6D 3O3EB 1SLXA 4P5TA 4LPVA 2MNWA 1NH6A 4FQ1L 2RD0A 3V8CA 3WN6A 5EG6C 4Y2OA 2PP9A 5F1IB 1DSWA 1U95B 4EI0A 1UCBH 5C6TH 3ARDA 2P26A 1EK3A 1NGZB 4XCCH 4LCUA 3H1ZA 1UA7A 4AUYA 2EDLA 3GMRA 2ROYA 1RUAH 3QZOA 3VI3B 4JR9H 2QFPA 4DGYL 2FIKB 1QSEE 3OF6A 1TQBB 4FQXD 4WWNA 2VDKL 1BZQK 3BKMH 2WVVB 4PJ8B 3UAJD 3LN4A 2HTLC 2XX0A 2DAVA 4H0LC 3S2AA 1NCBH 2FL5A 3WKMH 3LQAL 2EH7L 2CCLA 4PJIF 3CH1A 1TQUA 5DJCB 1P5UB 5EF1A 2VW6A 4M5SA 3CV5A 5GXBB 1RK1A 5CEZL 3L95A 3BSZA 5HYFA 3TFKD 2G60H 3QQXA 4WI0B 1QASA 4XC3L 3SN6N 3LEYL 3Q13A 1K8IA 4ONGH 3WU1A 1Y6NR 1XGQB 2WWKT 1GYUA 1N26A 2QKIB 1ZHBB 4Z7VE 2ZCZA 5FO9B 1G9MC 4U1GC 4EQ2A 2F1EA 4Y1AA 4BHUI 2RACA 5EBLB 3FAWA 3UDWA 2DL9A 3CFTA 3V4VB 3WIAA 4N8VB 1LM8V 1BQLL 2YMXL 1ZK5A 2ZXEB 1QFWI 3UEQA 1U93A 1HJBC 1W72B 1J8HE 3CVHB 1JWSB 2O6PA 3RWIA 1EXHA 3C8HA 1A6ZA 5DD6B 4JG1L 4KHXH 1E8XA 4QGTA 3T71A 2VR7A 1OSYA 2WLIB 1J9CT 5AWNH 4FI6A 1MWAH 4M5ZL 2B1AH 5L0QC 2AK4B 5D7IF 3MC0A 3ZTCC 1INQA 3GBEA 3GSQB 4PRPE 5F7AA 2FUTA 1NMAL 4MMYA 1FIGL 2PWEA 3MRNA 1VACA 3MBEB 4C56D 1DBBH 2VJ8A 1TT6A 3NFSL 3L5JA 1KELH 1KB3A 4TTDC 4YN3A 3QFDB 3KDMB 1QNIA 3MJ7A 3SDCB 2BRRL 4QRRB 3BPNB 4FMVA 4XO8A 3RE0A 3U2IA 3WN5A 1JYVA 1NCAL 2IFGA 1WZ1L 2IANA 2W0PA 4QKXB 4MX7A 4Z0XB 2WXGA 3I85A 2JJUA 4IMKA 1GYWA 1QWNA 3F7LA 3PQYA 4AIZB 4XMPL 3G5YA 3LKQA 4HKXA 1X5XA 4UV7L 3T6VA 3FCSA 3KYAA 1R0AL 1KXVC 4TL4A 2BXZA 1WWBX 2G3ZA 4Y2OB 1UJ3B 4JDEB 3ARDB 1S9WA 3IDGA 3I3DA 5FKPA 3UZEA 4LCUB 3OR6A 1YEDB 3N40F 6TAAA 3GSNH 3WXWL 4XXCC 3SDAD 5IW3A 5KAQF 1MPAL 3JUYA 3DBSA 2VLRE 5BQDA 3S34L 2QBWA 4ZMZA 1TENA 2NNCA 3SCMD 3HG3A 3GMOA 3ZO9A 3HRPA 4JM2C 3B2UD 1AR1D 3IDMA 4PREA 2A74A 3X3GL 4KZDL 2DTMH 1BDYA 3EXJA 2FL5B 1LE9A 4Q4IA 2WXNA 3D34A 1U8PA 1BHGA 1RK1B 1NKGA 5T3XD 3BCDA 2JB6A 3BEWA 5HDRA 3MGOB 5SWSB 1ETB1 1FG2A 3DNKA 2D7TH 4Z7UE 3HG2A 3RKDD 1K8IB 3GO1L 4A7QA 3V6OC 2YPVA 2Y06L 2FQGA 4PJHB 1XH2A 2C9QA 2CZNA 2ODIA 1K4CB 1E5AA 3E2HC 3Q8CA 2DJUA 5A2IH 3L3GB 4GXUN 2VUOA 2HFGL 4J3OC 1U93B 5DZVA 2OR7A 5C0ND 4G71B 3LH8A 4YEEA 4IOFC 5E4EC 3BUQA 4WI6A 3RWIB 1GMIA 1XCQA 5DXWA 5IHUH 3DVFA 4QHNB 1R3JA 1ZTXH 4ZFOA 1G0YR 4EKJA 5I75B 2WUBH 3O9WB 1SQMA 4WVRA 1BMGA 1ZAGA 2ZCKL 1INQB 1F4XH 4FFYH 4HCRH 3SDDA 4MMYB 3RVXC 2RB8A 2LE9A 3TFBA 3VGGA 4HZLB 1EHLH 5JW4M 4ZQKA 5H35A 2D7QA 1T2JA 3HZKA 4J4PA 4C47A 1CDBA 1INEH 2XN9A 5FFLA 3SE3C 3MJ7B 5FGBA 4G6KL 3RA7H 5JPNA 1NANI 1RUPH 1PG7L 3WN5B 4XAWH 4HLZG 5G4OA 3APMA 1T6BX 1SHSA 5JNYA 4MX7B 4CVUA 3VQLA 3SBPA 3DV4A 2PP7A 1OWRM 4Y1SA 3G5YB 3LKQB 4HKXB 3CSYA 5JHMA 1MY5A 1P6FA 4XVOA 5CSGA 3ZE1B 1VFUA 4J8QA 1UWEH 2OXGB 4ZMXA 3NBNA 2HJFA 4UM9D 1NCJA 1S9WB 2VXUH 1NMCC 5FO2A 1AZNA 4UQ3B 1R24A 4YHKL 5BPPA 3OR6B 1X9LA 2ICCA 1J1OH 4KK8D 5FS5A 5PCYA 4JZJA 4NUQA 4AYGA 3CN2A 3B9KD 1FFPA 1U8MB 2F0CA 2Y07H 3Q43A 1E2VA 2CDEA 3D06A 3RGVA 1ZHKA 2H45A 4PREB 4RWYL 1SEQL 2H2SC 2QADD 2VXQA 2WN3A 3RL1B 1LE9B 5HHXL 4MS6A 4DWHA 4XNYH 3ZZSA 4BH8A 3VU1A 3QDJB 1W72L 3K7UA 2AXGB 2JB6B 3BEWB 1ZLVK 3CVHL 1FG2B 4NPJA 5J89A 4JQXA 3ROOB 5CJOL 4EQ3A 1PJ9A 3MVSA 4PWEA 4FQCH 3QI9C 1ZXKA 4H8HA 4JG0L 1EA9C 4Z7QB 2XDHA 3CLEH 1ZE3C 3ZGHA 1RJCA 1QZNA 2WN2A 1L9SA 5EWIH 1J05B 3OM3B 5ICXB 2NY6D 2V9TA 5FLVA 4OGXL 4KKAD 3F6JA 4TMPA 4KRPD 1TJGH 1B6UA 2NDFA 4QXTB 5DT1L 3NGBB 3UYPA 2J5LB 1XB8A 5KVDH 3EW3B 3VXNA 2DQMA 3DGGA 3INOA 1XCQB 4FXLA 4JFDD 1MCBA 3VWKA 4DCQA 3IGFA 4RSVA 4GAJH 4LASL 1DSFH 5L2KE 2Y3AA 4OCWH 2V6HA 4PJFE 4JO2L 1D6VL 2BOBA 1D3CA 1BIHA 2HT4D 3QUMA 1ID5I 3H2PA 2Z8WC 4XCEA 3A6OA 4CBZA 3LZNA 4ZSOA 2FAUA 4ZQKB 2DY2A 4KBPA 1M6OA 3FBKA 4LQ1A 4DGUA 5DS8A 5HHNB 1LE5A 3REWA 2QPUA 3A4DA 3EJSA 4PLJC 4WIQA 1L0PA 4XN2A 1OHQA 4BQBA 3P9LA 2J12B 4N1HB 3BT0A 1O6VA 1NOAA 3EDEA 1YNTF 1BOYA 1AR2A 4DVRL 5ID1A 3DV4B 3FFCD 4FFVD 3L1GA 1QRNA 1F3JA 3CSYB 5MI0B 3U83A 1D2OA 2JKJA 4KXAA 3BDYH 3ZJAA 1RQ5A 3WO4B 1MFBL 1QO3A 5B4MC 4PUBL 5AYUH 4WWID 4KDTC 1DQMH 2HJFB 4JFPA 4X8XA 1NGPL 1A6AB 5I74C 4PYGA 4YHYB 2NMSA 4GQRA 1F1AA 3BH8A 4LSPL 3S88L 1G7PB 1QACA 3I6KA 4JZJB 1VKXA 3T3MF 3FTUA 5FUZL 4BSJA 2WNXA 3QCVH 4TUKH 5HPOA 1PIFA 4MCMA 1JGLL 4DP8X 1K5WA 1HFUA 4I3RH 2CDEB 3EO9L 3QCUH 2VRAA 1U2YA 4RAHA 3ATBA 4Y2NA 3I6GA 1KXHA 3SDYH 3BQVA 1HHJB 1OALA 1W8OA 2VH5H 2XWJA 3M1CA 4YHOL 3GD1C 3T0EA 2WWKO 3A6CL 4DQOL 4PVLA 5C0BD 4FTVA 1MHPL 4H5SA 4FXKA 3GGWA 5KEZA 4ZD3L 1VERA 4GO9A 2YFNA 4HS6A 5IEKA 5BVPH 2FZ3B 2IO5A 1I8IA 1IQWL 2HVKB 4WW2A 5IBLD 3ULUE 3L4WA 4QR7A 2ISDA 3K6FA 3UBXI 1KLFB 4FNTA 5C0FB 3UPRB 1PKQA 4FNLH 1IZKA 3F7KA 4KJYA 1FF5A 3WV0A 1D5XA 3E9UA 5TF1H 1JGVH 3UTSB 4FFWD 4TUUA 2P24A 4FYSA 3VXNB 3RHWK 3MRJB 3STZB 1DUYA 4PRDA 4KZEH 2FBRA 3AUVA 2EINB 3H0TA 4P5SA 4N2BA 2J5WA 3AXIA 5DWUH 1PS3A 2QQKH 2RTTA 3HG1E 3ZY7A 4ZTOH 4IIQA 1J5HA 3RUGB 3RGHA 3BSGA 3QUMB 5EU7C 4HHGA 4RH4A 2BVEA 2IGFH 2XXFA 5D70L 2YC1B 4ZSOB 2L7JA 2WVUA 1M6OB 2XZQL 5K69A 4HS3A 4NYLB 5DS8B 1GAFL 3BH9A 2YN5A 5G5DA 2Q1EA 3LSOA 3TN0C 3L3HA 4TYUA 4A68A 3HC3H 4RMRA 3AT8A 3F04A 5IF0A 3H7LA 3S35X 1J5DA 1FPTL 4NOBA 5ID1B 2PKDA 2CK2A 2G9HA 4OB5H 1F3JB 3TO4D 4P99A 2E47A 3GTNA 1O75A 2CUMA 2W38A 3GBDA 3Q9PA 5HI5D 4Z7OF 1MN4A 3MUUA 4R2GD 2A4CA 1EHNA 2AEQH 1W80A 5TE4L 3INUL 4YDIH 5KG9A 2JQAA 4TVPL 5TGBA 1H3UA 4X99A 4BZYA 1HESA 1HYSD 3BAWA 5F7DA 1U8LB 3BH8B 4PWFA 5CZXC 3IFPA 2NY4D 4N3TA 5CS7A 5DYOA 1MIML 1AACA 1JGEA 1KCUH 3NSFA 1W6LA 4LFHD 4MA1C 5DFAA 5EN2A 3UGEA 2MCG1 5A1AA 4MNGB 4HKBA 2GQHA 3VXRB 4Q9QL 4PMFA 4E42B 4X6EB 5F1KC 1E0OB 5EO1A 1SMAA 2J1WA 1ZA3B 2FECL 3FPXA 4QWWD 4G8GA 1X5FA 3MUJA 2ZD0A 4H7VA 4OFIA 4ZXBB 5AAPA 3R1GL 4MNQA 4WV1B 3PYCA 4HJJH 4W9LC 5CEYA 5KSAA 5EEZA 2XWJB 1SYSA 4EI5C 4OGYL 1YEIL 1UT1A 2Z7ZA 2YBGA 3FB6A 3SYPA 5TE6L 6PCYA 4H5SB 2B4CL 3KZ8A 1DQQB 1JGUL 2WXHA 3VI3F 2EDMA 2HT3C 2VR8A 1KLGA 4LLDA 1S7QA 1TVHA 4HS6B 5CU5A 5E5RB 5IEKB 1K9TA 4QYAA 4NSKA 1NSNL 4QLRA 2ZXDA 1I8IB 2H2PC 5KW9H 2YJLA 4ZG1A 5C07E 2WSPA 1KTRL 1PKQB 5EU3A 2VTFA 1VEOA 1Z66A 1DQLH 4EN3B 3JZ7A 3AQYA 4NRXA 2FWLB 4YSQA 1D5XB 5E8OA 1RUMH 4KTDL 5BUAA 5E2UH 4FI8A 1JPSL 5A40E 1L7TL 5IIEA 2Q10A 1DUYB 1TQSA 1MJUL 4YX2L 3FZUC 4MVBC 1G7IA 1MCWM 4PTTA 4XBGA 2IPUK 3AREC 4OVVA 1UT9A 1A14H 4M4RA 4R26H 5EULV 3ZDWA 4G83A 3C9NA 4IIQB 5A7EA 1ZWIA 4AEEA 2OV0A 2X4NA 5EIIG 43C9A 4K07A 1U4FA 1ZEAL 4NKOA 4LSQL 5G55A 4HUNB 3E6HA 3D33A 4G7YH 2BVYA 4K3DH 3LAFA 4R8WH 2NW2A 4DKAA 4R5VA 2KT6A 1X9QA 3BH9B 5IFHH 1BW8A 3LSOB 3L3HB 1EUTA 4KU1A 1J11A 1UA3A 2ZQKA 4DGWC 1CFMA 4LHUG 4M7JL 4ZFFA 1OP9A 5F72S 3IXAA 4CU6A 1XBDA 3HAEH 3NEOA 1ORQB 3Q2LA 4PJ7A 2G9HB 3ECWA 5KN5A 5FYKE 4BQ8A 2WIMA 1KEMH 5EA0H 3NRFA 1E4WH 4UMSA 1QSVA 4IYKA 1FQ9C 2K3HA 2R27A 4OCYH 3VFRA 2VXQL 4FXGA 4NN6C 3U6RA 4X5RA 3AU1B 3FQNB 2F8VA 5D1XA 4BJLA 5DCCA 5ERWA 1E4XI 4JKPH 1GZPA 1MRDH 1U21A 4O9HL 5TGBB 3WNLA 4JREB 4FDWA 4D7PA 4Z7VA 5F7DB 1M7IB 2XTLA 4YPGA 1B0GA 3IFPB 3A47A 4LLWA 2AI0L 2JELH 5DYOB 4WO0A 1A64A 1H3WM 5EN2B 3UTQB 1R5WA 2A9NL 3ZKND 4MDIA 2FHBA 5C0AD 3LDBB 1KTKE 4N2HA 4QTHA 4HKBB 1QHPA 5AB0A 3KLSA 4LCCA 1FO0A 2YSTA 5EO1B 4NGHL 3V0WL 1X5JA 4WHYH 2CGRL 5E94A 4IBQA 4G8GB 3GEWB 3J2PA 1FNEA 2XVLA 5C09D 3QPXH 5LO7A 4G7VL 5TH2A 1L6ZA 1SYSB 2R2CA 1LP9E 3ZL1A 1JGIA 4A55A 1BIIB 3FB6B 3W9DA 4OD1L 5EIIA 5FHBH 5I1LA 4N2FA 1J0YA 3UYRL 2EDYA 2E0PA 1P2CA 1KLGB 4GQQA 5CBAB 4P2AA 4TSCL 5HYJD 2QHRH 3W57A 4NSKB 4ZAKC 5M94B 1CT8A 4LRIC 2YXMA 1TSHA 1BAWA 3BQUD 1F2XK 5KOVC 4EZMA 3EJUA 1HL5A 4XXDA 4DK5A 3QUML 2IG2H 4J3WA 3RIAK 5EU3B 3HZVB 5ALCL 5I23A 1P4IL 2Q2EB 4NRXB 3ULAB 2QL1A 3QHZL 4IW4C 4ZO8A 3O81A 1X5ZA 5E8OB 4CDHA 3MQIA 3A22A 3GPEA 2R69H 3WJMB 1IB5A 3L5IA 5FFOA 2N59A 1CFNB 4ONFL 1LQBC 2O1AA 3O8XB 2EADA 1X4XA 1R5VB 3RVTC 2E7MA 2F58H 4MAYC 3PL6C 5AAMA 2WZAA 3C9NB 1SHXA 3KJ4C 1J0KA 4P2CG 1ZWIB 2ZPKL 4CA4A 1IO4C 4RX4D 1BD2E 3QP3A 43C9B 4E41E 3LKRA 2G3XA 3BAEH 1WZLA 3FQWB 5DTFB 4NXSA 3E6HB 4B0MB 1A2YA 4LEEA 2VLRA 4KVCL 4IGBC 1SFDA 2NW2B 4I0PD 2AHIA 4Q9RH 3BPOC 1N9PA 3GLDA 4DGVH 4NN7B 4OTXH 1S3KL 5IB1A 3OAUL 1EO5A 2MCPH 1ULVA 3EYUH 3S36H 4JO3L 1I9RH 4HG4J 4ZFFB 5HHQA 4H26B 2NY5C 4NIYE 3NN8A 5JOPD 4PJ7B 1H19A 2YKLH 3VXTA 3IJ8A 1R4XA 2OJEA 3VVVA 1EXGA 2ZXGA 4UOQA 5E1QA 3UTTD 2P5EA 1B2WH 3MLTA 4Z7UA 3VFRB 5AW4B 4GUCA 4FXGB 3U0WH 3U6RB 4ACPA 1IKNA 5D1XB 4PWKA 3STBA 5KYNA 1A0QL 2GK0B 2X41A 4Z7VB 1R17A 1OGTB 4KI5E 6PAZA 4OD3L 1C1EH 3RG1C 2F61A 4S1RL 4MA8L 4LLWB 3U9UB 2V5RA 4HD9A 3SO3B 2EXWC 3QFGA 1R5WB 3GMMA 4MDIB 4Z7NE 2PCFA 3V6FA 3PP4H 1Q1JH 4QTHB 2ZE0A 4PBDA 1FNGA 3QDMB 1MVFA 2D7NA 4ZMOA 3GNML 1DBKH 4NWUL 3MXVH 5IB2A 5E94B 4QNPE 4YHZH 4KXZI 3TT3L 1FNEB 3KYNB 1AYRA 3CMGA 5EZOL 3O0RL 2A9MH 2AEWA 4QIRA 2AEOA 1BF2A 1TJIL 2AVFA 3GXIA 4JY5L 3H2WA 3W9DB 2CD0A 4X8GA 4AL8H 5EIIB 3LV3A 5I1LB 2J6EH 2GJZA 4MKMA 1UXSA 3WCYA 1FNSL 3I50H 1OM3H 4XRCA 2EDQA 1MQ8A 4A63A 2VWEE 5IT2H 3KPOA 3H53A 3S4SG 5IM7A 1MEXL 1CT8B 2CU9A 3BUIA 3PAZA 3ARZA 2RGSA 3QJZA 5EH1A 5I1CL 4HIEA 3FQXA 4XXDB 5BMFL 2WJ7A 1J0HA 3C60D 1IKFH 3CXDL 1FC1A 5E9DD 4MMZC 1FNLA 3SPVA 3N1FC 2HG0A 3SJVB 5EF2A 3FTVA 3AMLA 1ADQL 1TXKA 2WYHA 5KTEH 3QPKA 3ZE2F 1UB5B 3I75B 3P40A 2AK1H 3QUKA 4QRSA 3FCTA 4ZYKB 2ARJA 3CN3A 3WFDL 3LY6A 2AJYL 3RTQC 1KBKA 1VZHA 2PCYA 5EUOA 3NIGB 2GJPA 2W88A 2B08A 1U8IA 2WW8A 3EH5B 3JVFC 3KM1A 3LKPB 1ZLVH 3CHSA 3LKRB 4X5WB 2Y5EA 3PWNA 1JK8B 2P5WD 3ARFA 3CFCL 4U7SA 5H8DA 1A2YB 4PTUB 4JRLA 4LMQI 2AZAA 1FRGL 1JZ3A 1MAJA 4KO7A 3SGKA 4B3VA 1I1AC 1SXAA 4I85A 4M00A 2HFEB 1EDHA 4NQDB 5SX4H 3EIFA 5IB1B 4HQQH 1Q1PA 2OMBA 2ZWLT 2DS4A 3ESOA 3QQ3A 5F6IC 5HHQB 4NM4H 4JK0D 2PTUA 4PWGA 5GRXG 2ZICA 4OAWA 2JKNA 3VXTB 4HPYH 5AZEL 3NQIA 2OJEB 2P5EB 3MLTB 3FFCE 4WZ9A 4Y16C 3V5DA 2BHFA 2I25N 1D9KD 5DK3A 1IGCH 2EE6A 3FHEA 3JWDL 3B3IA 3PWJA 4GLRH 2FATL 3RIFK 1WE5A 2LAAA 4GW4A 2H4EA 4X2UA 2ZKWA 3DGDA 5HBBA 4XPBL 4WI7A 3SGJC 2ALWA 5HDOA 5FHAL 1MFUA 4PJFA 2XV2A 4MXQD 4N68A 3LKSA 4NZTL 1ORSA 3NJIA 2VW4A 1RSYA 1AQDB 2XNAA 2YJQA 3GMNA 3K81A 4PP2B 4EI6A 4WU7A 1IEAA 4XRCB 1K4DA 4YL9A 3HNSH 3S35L 1TQWA 3KPOB 4TQIA 1VEPA 2N7SA 1I3GH 1GMEA 1E5BA 2IBZX 3FTZA 3UJIH 4F7PA 3G6JE 4HIEB 2H32A 1NFIA 3AG3B 2BSBA 1P1ZB 3FQXB 3OXSA 2JCCB 4HIJA 3MYZA 3V5KA 4P2OA 1LGVA 2YQ3A 1BGXH 3IE4A 3Q1SL 4NZJA 4WK4B 3ILPA 3SEPA 3P11H 3PDDA 3QWOA 4PB9H 1CGWA 4PJ5A 3A6BH 1ZKAA 3LZFH 3QUKB 4QRSB 5C08A 4KXDA 3GM0A 2J72A 1NGQH 4W9EC 5EUOB 3U46B 4RGOH 4NDMA 4OZGE 1U8IB 5L4JA 4H8WL 4UOW0 3X12A 1GJIA 2GSGA 1BQHA 3PWNB 2DLFL 2WXFA 1AO7E 3I9IA 1WV7T 5LBSA 3X13B 1IILE 1RURH 4F8TA 4NCC1 3FFDA 3MKKA 5JDJA 1T1ZB 3BESR 5CFAA 5LBVA 2HX7A 2K45A 2QZ5A 1DANT 1QKZH 1YEHH 1LDPH 2VR4A 4RMVA 5EF3A 3QQ3B 9PCYA 5LHDA 1UCTA 1BPLB 3ZTJG 3RUGF 3WTYA 5ILTH 3NEEA 3TM6A 4OAWB 1DBAH 3ENEA 4FABL 2AQSA 3PU7A 4H0GA 3P0VL 2R4SL 5BZWA 3MRCB 4Y2DA 1HINL 3LRSA 4P59H 3P77A 4LSUH 5E6ID 2Q3AA 4I0KA 5LDUA 2B8OT 2YWZA 3LRHA 3S4SB 5D9SA 4PB0L 4AMKL 5IZ7A 1AVAA 5A6LA 3SD2A 1MCOH 3G3LA 2VERN 2F7RA 2YUZA 3PWJB 1FG9C 1WFOA 2FYYA 3ZDYB 2DQHH 2K8MA 4GW4B 3OKDB 3D2TA 4LAJH 4ZT1A 5FLUA 1IGTA 1Z2KA 6FABL 4D0DA 3QISA 5I1GH 1AIFA 1N7MH 3OJVC 4XGZA 1AOHA 3IDYB 3ASNB 1GZQA 3KLQA 4D0CB 3HG1A 4HSAC 1DFBL 4TTGA 2X4UA 4NLHA 3N1GC 2GFBA 1ORSB 1TPXC 3P0GB 2XNAB 3AJ7A 4EI6B 2PYFA 2MQ0A 1IEAB 1K4DB 4FQJH 2IFFH 2XTSA 3Q7JA 4LIQL 2EJ1A 3V4PA 4UILL 3GSNB 1BZOA 5I6XC 4PJXA 4KPHL 1HKLL 4XP5H 2H32B 3OXSB 4MD0A 4EPSA 1ZLUK 5MERA 3WNOA 4FLHA 3LQZA 4APXA 3B56A 2ZYHA 1DQVA 3BPNC 4M3KB 2ZWSA 3AT9A 1DL7H 2QHLA 3ILPB 4AGOA 4X7EC 3QWOB 4KKNA 3FSZA 4PJ5B 1KWKA 1YJDC 5AFAA 4L5FE 2F54E 4IRJD 4A2DA 5C08B 5GZNC 2R56H 4V11A 5CD3A 4WW2F 1MIEL 4M8VA 4Q9BA 4P5TC 4EXPX 4JHUA 1RP8A 2XZAH 4NDMB 3PDGA 4P07A 1UUSA 1IT9L 1RIHH 4XMLH 4QJ5B 2WSKA 4YQXH 1SN5A 1U41A 1YYLH 4GEJA 4K4KA 4BUGA 3IFLL 2WGXA 2NY7L 4J2XA 2OSXA 2WXLA 3N0AA 3RDTD 1JNNH 3ETBF 3FT1A 1U8JA 5DD5H 4G3YL 1WA0X 2CXGA 4GAGH 4GAYA 3W37A 4NQQA 3WY3A 2R0KH 3ET9F 2Y4SA 4LNRA 3PF2A 4JRXE 1PX3A 1OGSA 3KMDA 4Y2DB 3DTXA 1JPTL 5F70A 3VUAA 4WK2B 5EU6E 1MJJB 5D71L 3CLWA 3FQTA 4PJCE 5CGTA 2B16A 1M3IA 2Y3NA 2OYPA 5EOTB 3W11C 3OKNA 3MNVA 3DV6A 2FYYB 2OQJA 3DECA 2P45B 1JPGA 3UDWC 1ZLSH 1KFAL 3LX9A 1IGTB 4HXAL 5FWRA 3EYSH 4P46C 2GCYA 2AXFA 4XX1G 1AIFB 4HXBL 1O5DT 4G5AA 3QZBA 4U1HB 3K8MA 3VFPB 1GZQB 2A0LD 5DA4A 2BSRA 3UGUA 5AYTA 2C9SA 2X4UB 4OF7A 1DQKA 5AYQA 3V55A 2CLRA 1N6QL 5J56B 2FO1A 4S2SB 2ZCLL 3VRIA 1KXQE 2FSEA 4JO1H 4HD5A 3KNBA 4MQXC 1XDTT 1IX2A 1I1RA 3SE4C 2VLJE 4PJXB 4C56A 1RLWA 4K9EH 1MW0A 4JFZL 4MD0B 3HB3B 4JQIH 5DYFA 2IDQA 3CE1A 4RRPM 3HBPA 1CTNA 4KVNL 4XPFH 2OR8A 1MJ7H 5JPMC 4IBLT 4F7EB 3SY0A 4DQAA 5KJRH 1AGEA 5CD3B 2AJSH 2GJ6B 5FYLE 2AQPA 1OGAD 3IJ9A 1HNGA 4MYPA 3OSVA 3SKNB 4JKNA 2NCMA 2W92A 4X7SH 1S5HB 4NWTH 5CCJA 4JHWL 2L7UA 4LB8A 3POHA 3V9CA 2D0FA 4U6VH 2YO3A 3MLZH 1AMYA 4MB1A 4APQD 3BC9A 3EFOA 2MQCA 3BUPA 5D7LE 3V2AR 4YHLL 5MHSD 1MH5B 4N85A 3SDAA 1NMBH 3NCFB 3IRZA 3QHFH 2YBRA 4X6BA 3F7QA 1DYZA 1OB1B 3FDWA 1IGYA 3HI5H 4FQXB 1U8JB 5DRXA 4IMLA 1BXAA 3LPWA 4MD5B 1MREL 1KFGA 1QEWA 4GAYB 2A74C 5DD3H 1NCCL 1LP9A 3KR3L 4LNRB 1JS4A 4BFIB 3QZPA 4C8XA 5E1HB 1DEEA 2NNAA 3BT2L 4WUKH 3HJEA 4A6YH 2XJKA 1QEXA 3U1SH 2JKSA 3DTXB 3BP5B 1KB9K 4TNWF 3KVDD 5D7SH 4OZIE 4N2NA 4LK4A 3FQTB 2Y5TA 3M7OA 4A66A 2WBJD 4Z3IA 4RGMC 3QUZD 3ML8A 2BVPB 2R4RH 2ZP0T 3OKNB 3K8KA 3MNVB 2APVA 2OQJB 3DV6B 3NJJA 3TJPA 3ZYZA 3VSTA 5BV7C 4PJ7F 2A5UA 1JPGB 3GIZL 1AAJA 2WP3T 4R6UA 2VMEA 1DDHA 2QFRA 2ZKXA 4KKLC 4LEOA 1BVZA 3DETD 1ZANH 1S78D 2GTZB 4X83A 5DFVD 4ECNA 5AD0B 1OAXH 4Z7VF 3OKYA 2J2ZA 1UURA 4B9YA 4E41A 5F71A 4XVSH 4PY8J 2V2WA 3CLFH 5KBMA 3VRIB 3SDDC 3H9HA 4OCSH 2ZT9C 3KNBB 5CN1A 3UTPD 4AZ8A 4C56B 4Z3EA 2WWOA 3MV11 1CL7L 4L2LA 2EH8H 4P9ML 1OW0A 3WFEH 2CO6A 5LBSL 2UVFA 5FGBC 5FYJE 1A7PH 3X1GA 4PJEB 3V0JA 5JPNC 4UINH 5GZOC 2BH0A 4JY4B 3UACA 1MHCA 5A2FA 1F3DH 2PP8A 2R0ZL 1PSKL 3MLYH 3NQKA 4HMCA 3T4AC 1J5IA 1A65A 4X42A 3SY0B 1X6NA 2AITA 3HAEG 2Z7UA 2I7SA 3TNMA 2XTJC 3D3VD 1SF3A 1X5YA 4M93B 1EBAA 4OLEA 3UXFA 4ETQA 4DUWA 4JPVL 2DIAA 3CVIH 1R9FA 2Q3XA 2OR9L 1GYCA 1MFAL 2CDFB 2F68X 3R4RA 5D7KE 1SY6A 2QLYA 4J23A 2I26N 4K7PH 1UGKA 3V6BR 3C2AH 3APFA 4NO0D 1WBYA 2FB4L 1V8HA 3N2JA 4J6RH 1FHGA 1TMQA 2J21A 4JZJC 2OX5A 2JWYA 3SDAB 4UAOC 4X6BB 3B9KA 2YBRB 1M1XA 1QOKA 3KCPA 1IGYB 3SCMB 1YNKL 1URIA 3AUWB 4KAQL 4PGCA 4QRAA 4UYPA 5DHVH 1QEWB 3RGVC 4LL9A 4GG6E 3NIGF 5D1ZD 4OLVL 4JFUA 2JXMB 3G5XA 4WHYG 5EU4B 2DMCA 3T0XA 1ILUA 4KMQA 4ELKA 3D48R 1DEEB 4XAWL 4XP1H 4WJ5A 4ABQA 4MFHA 1KCVL 5F7EH 1TNMA 1FH2A 1BLIA 1T1YB 3L7FA 25C8L 1WFJA 1XGRA 1AG6A 5B39G 5K9QG 3WSQH 4JQXC 4UZGA 1KYDA 1D2PA 3S8FB 2E56A 2VKXA 1GPOL 1UZ8A 3BVNA 2ICEA 3I9GL 4KK9C 5AVZB 3T1FA 5H94B 3BUYA 3G6DH 2ZAHA 1V7NH 1G7HB 1QX1A 3ILQC 2A6KA 1KZQA 4HIIA 1QBML 2XZCH 1I85C 2I5YH 4JN2A 4GSDL 2CO1A 2HH0L 1LLAA 3UPAA 1NFKA 4A2EA 2NYYC 4P9HL 5J6GA 3RPBA 1ESOA 5B3JF 4Z7UF 4N28A 4W4NA 4LEOB 5F9WC 3CPLA 1PX4A 3WAKA 5FDYA 2D4DA 3ARRA 5F0PB 2HTLD 3VWKC 2J2ZB 4Y19D 5EZIL 3MV7D 3SKJH 4ODTH 2EYSA 2V2WB 2Q5BA 2XFXA 4FF9A 1CO1A 2BFVH 2QQNH 4L0ZA 3NMEA 3EJCA 1EFXD 2X6MA 2Y7MA 3WDIA 4WI2A 1EERB 3PJSB 2UWEE 3Q06A 5I1KH 2GBTA 4ZX4A 4IDJH 2P43B 3WEMA 1XCTB 3P3YA 3PCYA 3FTYA 3WKPA 2J4WH 5D5ME 5E51A 1WA2X 1OCWH 4CUCA 3DJZA 4OJAA 1QVOA 4P8QA 2A2QT 1MHCB 3P2DA 4J3BA 1C12A 1Z0NA 5FAAA 3S3DB 3FFCA 1FSKB 4G72B 5EOCH 4ETQB 1KTCA 2IQ9L 3WELA 3MKGA 4DO5A 1VZIA 3V10A 4WF7A 2YEZA 3U7YH 2J88L 4LCIL 4UM9B 4F3FB 1SOQA 3FQUA 1F5WA 2WUCH 1ECZA 4IJ3C 5IQOA 5ICUA 4UOJA 3DIFB 3BHBA 2EEFA 1C08B 3EBGA 4HJTA 2QR0B 4PCTA 3TLRA 3B9KB 4QHKI 4TLUA 3V0AC 1M1XB 3KCPB 2H6PA 5GRWA 4XE0A 5EO0A 4QGYA 2C3HA 2ZNXA 5AG8A 1DBML 2WNWA 3OKEB 5EUOF 4TTDD 3B2MA 3G5XB 3KBPA 3NA4A 4DP9X 4TULH 5HXMA 2QADB 4M6NH 4RESB 4ELKB 3V4LA 4F8QA 4WJ5B 3T0EC 1P7HL 4AEHL 2EACA 2BNRD 1K72A 5B38A 1XGRB 5TPWL 2FUQA 1JIBA 2QSTA 4FXKC 5C0BA 3ZT6A 4L8SA 4KUZL 4K9JA 3MLPA 1SMOA 3GSOB 4HX1A 1UZ8B 3OR7B 4AY0A 3BUYB 1EDQA 3HEIB 4JN1L 2C34A 4WW2C 4RA3A 5EC2B 1IAIL 2A6KB 3UGXA 4N24A 4MQ7B 3JWOC 2P80D 2EE2A 1VPOH 2NY6B 4V1DD 4LFHG 3GKWH 2JE8A 3ZU8A 2YD4A 2W5PA 5A2CA 4KRPB 5J6GB 3I2CL 2WBXA 3IMVA 4WW1A 3STLA 3JXAA 3HAEB 1TO4A 4L4VE 3B2XA 3OVUB 1N70A 1NWOA 3CFIC 1BOGA 3U48A 1UWXK 2HKAA 4JM2D 4JFDB 3T8MA 1P5VA 3BAKA 5C3IA 1MCJA 3OKOA 4OZGA 4HWZA 3KGRA 1T1XA 2EILB 4ZUUB 4KH9A 3TS8A 4ESKA 1MVUB 2OL3A 1EAOA 3CDYA 1O5PA 1AO7A 3ZDYF 4BK5A 2GB2A 2DYPA 4G42B 2GBUA 1NIFA 5KVFH 2J44A 3HS0C 4LOFA 1I3RB 2BS71 2CO7A 1Q9OB 1A1OB 3PS6A 1P7KA 3GK8L 3EOAB 4JJ5A 1MCWW 3MV9D 2XICA 2ZOUA 3ERXA 1K5NA 4PJFF 3CHXA 2JI1A 1M71B 1QVOB 5C92A 5LGHL 3F7RA 4HU2A 5DGRA 1UQSB 2V8MA 4KROC 4J3XA 2AXWA 1XGYH 4ZFZA 5HVHC 1JERA 3FFCB 4J3OD 3OHMB 2BHUA 1QFWH 1C5BL 4BRVA 5B39B 3CFKA 1JGDB 4IOFD 2VDQH 5E08L 3DARA 1KYAA 3QIWD 5I1IL 3VD4A 3I3EA 2ARWA 2YEZB 3IDXL 3VRJA 1KPUA 3FQUB 2NXZC 5HDBB 4BGDA 1UYWL 5T3XL 4ODXA 3M45A 1LK3H 4EJ1C 4HLJA 1F8TL 3BRDA 2X4PA 3RVXD 3TO2A 2CMRH 1VZGA 3EUDA 1B9KA 3HC2A 3HNVL 4K71C 4N0YH 2UY7A 2H6PB 1ZLUH 4CU8A 3FN9A 5EO0B 1ZGLA 5KVEE 3TT1L 1F3DJ 2VXSL 4R84A 4HT1H 1I9JH 1T80A 3A67L 3LZLA 4EXKA 5KSAC 1G7JA 1GC1C 1MFDL 3QRFM 3HMXH 2ROXA 5I71C 2PO6A 2V9QA 3ULVH 3MXWH 1JTPA 1P7QD 4ZRGA 4BQCA 5EO9A 5C0BB 2XA8L 5HI3C 5BS0D 2PW1A 2QV2A 2FX9H 1M2VA 1QW9A 4DOHE 4MLIA 1A6UL 2WP3O 3MRPB 3EJZC 2ESVE 3CBJB 4JGJA 1H3GA 5F7FA 1WJ3A 4KUCF 3APNA 4A7SA 1QAWA 1T22A 4KX8A 3M7FB 4M7ZB 2CBMA 1AANA 1WUNT 1JZFA 4QXWA 3S3PA 1XTMA 4L29A 3FAXA 2F53E 3MGTB 3F58L 4R0LC 5DJ6A 2F54A 2KYIA 4WW1B 3STLB 3RTLA 4J3UA 5H2BB 4A2MA 2ZUTA 2YD8A 1BOGB 3N9GL 4NJ9H 3KWUA 4ZOBA 2ZOLA 4N6QA 4O5LL 3SPJA 3NCWA 2GVYA 1P5VB 2CNYA 3OL2A 4OZGB 5D7EA 3IMRA 4HWZB 1T1XB 4N4YB 2H2SD 1NCDL 3TC9A 4OW6A 3DMMA 3L81A 3UG5A 1OTSC 4OM1L 1X5GA 4UT6A 3QS2A 3WYRA 5CIPA 5JIQA 4D9LL 1FA4A 1BBDH 5GSRB 3QI9D 1N64H 4F15C 3S98A 1NGXA 1SY6L 4CSSA 1P7KB 3O6KL 3NH7H 1ZV9A 1K5NB 1VADA 4JJHA 5LQBH 3FHQA 1Q0YL 1O6TA 4MJJA 1AZUA 1G94A 3Q01A 1YMHA 2XY1A 4OGZA 1TTGA 4MA7L 4OM0H 3RVVC 3UAFA 4N2MA 2DQGH 4ZFZB 4JCMA 3EF7A 4K3JL 2CM6A 2VO5A 3AS3A 3HJ0A 4XMTA 3DX6A 3CFKB 5EU6A 5AKSA 5L6YH 4PJXF 4IS6A 4R2GB 1SBSH 4PJCA 1Q72H 3OZKA 3T6XA 1CD9B 7FABH 4CW1B 4Z8FH 4DW2H 4IKIA 1UM6H 2XHNA 1SDDA 1KPUB 3AQZA 3GTVA 4HU8A 1I3VA 3GXNA 5ISZE 4H1LH 4ODXB 4KV5F 3VWJC 2NY4B 1F4YL 2X4PB 3TO2B 3T2NL 4KDVA 1JHKH 1ZGLB 2UY7B 1BVLB 2DMGA 2FBJL 2J25A 1A6TA 4LCCC 2LU3A 4R8WL 5CP3A 4B0MM 1HJCA 5KSBE 3HS9A 4L1SA 2GYSA 4YR6A 3Q8AA 1B4RA 4FQ2H 4PLJD 1AC6A 3SOBH 2B9AA 3QZNA 1YY9C 1RZFH 1TJXA 4FX5A 4O58L 5EOCJ 1NANH 2GI7A 3ALWA 3NIFB 5E6YA 3LPFA 3N91A 4XP4L 4Z78A 3GM8A 1AY1L 2UVEA 1KXQA 1A5FL 4AYEC 3RX7A 5I30L 3VW3H 4A38A 2VZ3A 2PW1B 4M6OH 3MTXA 1GKEA 2X4OB 1M2VB 3MOBL 2KI6A 2H7WA 2XRAL 4TQEH 3WS6A 1TZIA 4I1RA 1CXKA 4WNJA 3P4LA 5CN2A 5AOLA 3AWEA 5B4MD 5HYJA 5IHZA 2B1HL 2MNUA 2NSQA 4XHJC 2WOYA 3N55A 1AH1A 1WSST 3BX7C 3VXSE 2MCAA 4D9QE 2FTAA 2AJVL 3AS2A 2D03H 2KZKA 4IKLA 4L29B 5I5IA 5T1LA 1FHNA 4BZ2A 5J6HA 1QYGH 3GBNL 3L5XH 5DJ6B 4F5CE 2F19H 5ADOH 1MCCA 2BY3A 2ZOLB 3TJHC 4PCYA 4UI2A 2LOEA 2BMKB 4NI3A 3LIZH 5AAMC 4R4NC 2WTOA 3EOBA 1GYAA 1AZZC 4GG8A 4P0DA 4PJAA 3NK3A 4BFGA 4UU9A 5DRWA 4OIIH 1HWGB 1OCZB 3FBQA 4AOFA 2PWGA 4UT9H 5C6PB 4DERA 4MWFA 1F4HA 3QPQC 3MLXH 3ZMRA 4DN4H 3LEXA 4OJFH 4L1DA 2OMTA 2C7FA 3D6GA 1IE5A 1GH7A 2VQ1A 3NJVA 3IDUA 5KUMA 2YPLE 5ITBL 1WA1X 1ZTXE 4Q14A 4I48A 2CXKA 2BP0B 4HUXA 1NCIA 1YMHB 2C5DC 2DMKA 3BP6B 2VDRB 2AABH 1H3TA 1PYWA 4S1SH 4IS6B 5K1JA 4PJCB 1IKNC 2ADYA 3QCTL 3V52L 2CDGB 3HE7A 3ARTA 4FQLL 1SDDB 5HGGS 5D2NE 2X40A 3COOA 4P5MA 4BWUA 5HYSG 3R4DA 2VDMB 4NUGL 1D5MA 2LTQB 3LNDA 4PV1C 5E1AA 4UQDA 4LDCA 3D9AH 5AZ2L 1RFDH 5DRZA 5E8DL 5C0AB 1P0SE 3T3PE 1A6TB 2YA2A 2GW5A 4MZRA 2R0WH 4W6WB 1J8SA 2MPAL 4HCGA 4YR6B 3UG3A 4DGVL 2IV9A 1NIAA 3TN0D 4ZUWA 4GEIA 1XF4B 2JCWA 5C09B 1SDAB 1OM9A 3OQ3B 4EUPA 4K3EL 3IETB 4LAQL 3HI6H 3W9EA 4ELME 2I07A 4Z78B 4J3OH 4Y5VB 1OPGL 3MN8A 2DM3A 1TU2A 1HL9A 1NDGA 1DQIA 2VJXA 4M3HA 1YY8A 1U8CA 1I3UA 3F7PC 2XY2A 5HYJB 3FC8A 3GMPA 1Z9OA 1BVKA 1FH5H 1NIBA 2C1PA 5B1AB 4X5QA 5IHZB 2V2TA 4P3CL 3BQUB 2OAAA 4OSUH 1ZMYA 4FZEH 1ACCA 3IJEA 5CZXD 2CCWA 4KTEH 5E9DA 3FHAA 3QEQD 3DJRA 4XMUA 3Q8BA 3HN3A 4KNTA 1TTFA 1HIML 1Q9WA 2FHFA 2Q86A 5IJKA 3QXWA 1WS7A 5ANME 5LWYH 1AKJD 3B3BA 4ADGA 3VE0A 4FQPA 2OW7A 2EDXA 5E2VL 2UV3A 3BIBX 1CDYA 3EOBB 1Q0EA 1GJUA 4EI5D 3CIAA 4PJAB 5CBEA 2ORBL 4UU9B 5ESAA 1SXSA 5TFSL 4BZ1A 5HYSA 2BSED 1BJMA 4AL8L 2AV1B 3MRIA 3ARFC 4LT7A 4TSBL 2B15A 4HBCH 3VI4E 1OPOA 2HT3D 4ODHH 1CBVH 1EJOH 2OMTB 4I0PB 5KVDE 2Z8VC 3D4CA 2VQ1B 4AEIL 3MX0B 3LS5H 2H2PD 2DQUH 2NSMA 4OCRH 3G9AB 1JV5A 2OMVA 43CAA 2M26A 2VLMD 1WFMA 5FGCE 3L3JB 1C7TA 3RZCC 3SPGA 1PYWB 5E8NA 4U2ZA 2I69A 4N0CC 3MCKA 4HKJA 2VR5A 3ZSSA 2P47B 3UTTB 1KTLB 3FZUD 4MVBD 4ZTPH 5I0VA 4W93A 3U30B 5IB5A 2ADGA 4JO4L 3ARED 4AVIA 1GY1A 1D9KA 5DUPH 2J8UA 1D5MB 3CC5A 2MHAA 4NKMB 3L4CA 1R3KB 4G6JL 2P7TA 3IJSB 1MVYA 4YSDA 4YXHL 1IGFL 1E9PB 1DJZA 4AYBA 4GXVH 5AALA 1JXKA 4AKPA 1LO0H 3VFWA 2ZX8A 4OLWH 3BRGC 4JFED 4ZUWB 2BLFA 4A39A 1JZ6A 4Z76A 1E5YA 1FVEA 2D3VA 3WMSA 2BNQE 3W9EB 4MYWB 2I07B 3RX9A 1A3ZA 1CLZH 1EVTC 3KWWA 1C16A 2I9LB 1ZIAA 2L0DA 3MRMA 1NCOA 1TU2B 4HIXH 1EHKB 4R97C 1DHKA 4HK0A 3UO1L 4O4YL 3JV6A 4IHBA 1NDGB 1NKRA 5I66B 5J0BA 1BG9A 1YY8B 3BZ4B 2ZUWA 3PDOA 4UT7L 2UWEA 1ZVHA 3GMPB 4QRTB 1BVKB 2C1PB 5BUPA 3NRPA 4HYTB 2R51A 5D5MA 2K7PA 1WISA 4P2OC 5K1VA 1A66A 3M1OA 4QEGA 3C60B 3RWJA 4UBDC 5E9DB 1EGJA 3OJ2C 2C4FT 4GP5B 4IK6A 3DOIA 3MOAH 1JNHA 3VA2C 5JHLA 2COVD 1IM3D 2BP8A 1OCOB 1YN6A 1H3VA 4PYHA 1N19A 2J57A 3MROB 3K5RA 3TBTA 2VDRL 1RZIA 2EDFA 5CBEB 3O6ML 1PW3A 3OJMB 5D8JH 5B1CA 3RQ3A 2E9JA 4JFTA 3F6IA 3SGDI 5F1NA 4OFPA 5HYSB 2P5WB 2Y72A 1GL4B 2BIMA 3MGAA 2XV6B 1USZA 3NZ8A 3QDAA 4DUXA 4ZAKD 3PWUA 4IU3B 2IALA 1WIPA 2E7CA 3IGUA 2XQYA 2VDML 3P73A 4AYFA 1JV5B 4HWEL 43CAB 3AWGA 2RMNA 3NABH 1AXTL 4QXGH 3FK3A 5E8NB 1SLUA 2Z0UA 5CMAB 1OE1A 3MRFA 4HSCX 1UWXH 4P2RE 4F9PC 1JUFA 4LCWD 2WLHA 2YAFA 1XH3A 1KEGH 3ECVA 2PYEE 2ADGB 4WFFD 4K94C 3RVTD 3TEXA 1EUUA 4YZFE 1B0RB 4MAYD 1D9KB 1IC5H 2L04A 3PL6D 4YDKH 3ULUC 5DS2A 2J8UB 2XJLA 4P2QD 5H37A 4NQXA 5I6NA 2YXWA 3HZ3A 2P7TB 1F2QA 4OI8A 1E65A 1I75A 5K33A 4QOKD 4C59B 4M62H 3DROA 4OZ4B 4WTQA 4G8IA 4IGBD 3DJ9A 3VFWB 1Q8MA 4XPAH 1R6VA 4X4YA 5DSCB 2VAAA 2FX8L 2X42A 2SEBA 4AQ1C 1RERA 3JYCA 3QNZA 4AJWA 4PVMA 4BZ2L 8FABA 4U1IA 1FFQA 1I1FB 5HDBF 4WHTA 4NXKA 4XPTL 2DIEA 5C0JB 3MRMB 2DI7A 2F74A 1T5WA 1MI5E 5FYLL 3GHPA 4Z77A 3PDOB 2IPTL 3QORA 1KCRL 4LSUL 5F9JA 2F8XC 4RFNC 3DX9A 4KMTL 3LS4L 3B1UA 3LPPA 1E4XH 1DBJH 5I8EB 4CNIA 3VFTA 1FBIL 5DI8B 2EDWA 3TIEA 1LK2B 1YC7A 4NJAL 4YS4A 5GS0H 2EXWD 5JW5A 4O02A 3WJLA 5B8CA 4FEIA 3MJGX 2K3TA 1YMME 2BP8B 3WIIL 5DHEA 2UZIL 1YN6B 2LFEA 4IRJA 5E00A 1QTPA 1I7TB 5CEZD 4LSRH 3TBTB 4U1KB 1GJWA 3VMPA 2C9VA 2XACC 2XWBA 4XO5A 2ATKA 1OAKH 3AADB 3ME0A 4N6RB 4FAAB 1PJWA 3CBRA 2DKSA 2ZP8A 2EIJB 5DWPA 3HHMA 4DKFH 3FU0A 4JFQA 2JLPA 3ES6B 3VG9B 3NZ8B 5C0CD 2ADIB 3IAGC 3GHBH 1TETH 1A7RL 2WKOA 4Y1TA 2GIMA 2QMJA 1QR1B 2B9BA 4OZGF 5DEJA 3P73B 4AYFB 2L4OA 4V2BA 5JW3H 4NP9A 3CQPA 5ABAA 1PTZA 3CHQA 3V9EA 2H9GA 3C09B 3WDHA 5GGQH 1R1CA 1UJTA 1VGEL 2K1MA 5F93C 1ZOXA 2FT6A 2YAPA 4PFEA 5MENE 3MRFB 4OLUH 2WAQA 1JUFB 4X4KA 4AKQA 1M7DA 5E6IB 1XH3B 4ILDA 2OZ4A 3UL4A 2BIOA 2OCCB 1N2RA 3ZZLA 3RTQD 3BN9C 1IRAY 2H0FA 5AENA 3IGLA 2BJMH 4MGXA 4NQXB 3FXIC 2WINA 4ZODA 1QRKA 1GOGA 2F53A 1U3ZA 3FTWA 3X11A 3DROB 4G8IB 4R7NA 3QA3B 5KZCD 3NCMA 1J7VR 3J27A 1I1AD 4X4YB 5ESVA 1RMFH 5DMIH 3GXTA 4LSTL 2SEBB 4HPOH 3GFUA 3QNZB 1LO2L 3D85A 4X98B 8FABB 3OPZL 2BXYA 4IRSA 1W6WA 5HYEA 4WHTB 4XCYA 1GW0A 3E0GA 3L1OH 3VU2A 4M5YL 2F74B 4POZC 1T5WB 4ONHA 3WL9B 3SE8L 3VQMA 4G6AC 4YXLH 4AGLA 3ZDXE 4Z77B 3J8F7 3ECUA 4U6HB 1NUFA 3DX9B 4OJDH 4Y16D 3T09A 3OBAA 5ETUB 3N1MC 3PUUA 3QGVA 1IBHA 4GUPA 3I3BA 3HHRB 2YOAA 1MQKH 5IESL 2IOIA 3BEVA 1XMEB 1G5GA 3NA9H 4KX7A 3NIFF 5DHVB 4XZUB 5F7UA 2L7QA 5JW5B 4RMQA 4GW1A 1PLGH 1A21A 2JTDA 3HBZA 5I1EH 3DLQR 3KLAB 4OQ1A 1B9ZA 3MU3A 5AOMA 2Y5QA 4IRJB 5E00B 3L3IB 4XBPA 4M93C 4PHZA 4AQEA 4XPHL 4UTAL 2BOCA 4P57A 3EH4B 4BH7B 1CURA 4FLOA 2ZONA 2ENSA 3CVBA 3O0LA 4KXZH 4PG9B 4D2NA 2XWBB 5F9OH 5ISZA 3ZW3A 2ATKB 5DUJA 1N0XL 3QXDB 4KHTL 3WEAA 1KPRA 4P4RA 1KGIA 3FUNA 5EC1A 3HNTH 1DQJA 3QFJD 2F5BL 4BKSC 3PWPE 1E3XA 1V3KA 2GITA 5D6CA 1SJHB 3VFUA 3ZRFC 4APQA 1IAIM 1T21A 4RLDA 4EOWL 3THMH 5KSBA 3BKYH 5L8JB 3RDTB 4LDOB 3QO0A 4AGPA 2VM9A 4OJCA 2NLJA 2O6DA 3MDJA 4PRIE 3EYFA 4N8CH 5HPMB 4HISA 5IVXE 3DRTB 1RULH 5L7XH 1N2RB 1XGPA 3MV8E 2KDGA 2UXVA 1G5AA 2E9WA 4QO1B 4OZFG 1VCAA 2WBJA 4N86A 3ZKXC 3VXSA 4BINA 5IGXL 1OE3A 1J86A 5F44A 4BSVB 1GR7A 2P42B 2WINB 4TS6A 2EVJA 4H0IA 2KPNA 4N2AA 1RU9L 5FC9A 4F5CA 3X11B 4E9VA 3MRQA 4NX0A 1WTGT 1NAMA 5E1GA 3OWEA 5LLIC 5JW4R 4FL4C 1RZJL 3CX5K 3MREA 3KGTA 4PJCF 4E9RA 3H9SE 3F64A 1GGYA 3L2LA 3BYYA 4OFQA 4FNQA 1ZT1A 1T04A 4IRSB 1EGJL 3F3HA 4U49A 4XCYB 1MHHA 1PAMA 3QIBC 1Z9LA 2V37A 3O2WL 4NRZB 2QVMA 1WFTA 4WO4A 1MLBB 2A7BA 2HLFC 2PR4H 5AB2A 1G43A 1KB5H 4XVTH 3LYRA 3Q3GA 2APFA 3HPLA 4H8VA 2XWZA 1OOWA 1Y0LA 2ED8A 4GUPB 1PQZA 3PAVA 1HE8A 2PETA 3TWYA 5KBPA 3BEVB 5AOKA 1DE4B 3NCJH 2E6QA 1RZQA 4M8RA 3JTTA 3NESA 4HCRA 1FE8L 2JVUA 3WO3B 3LNHA 3C75A 2VMCA 3SBQA 3L3KA 1VRSA 5KBKA 4GINA 5ID0A 1FSKC 3CFBA 4GMSL 5IQ7H 2BOCB 1L9RA 1YEWA 2RQEA 2Q8AL 4JFFE 5EEVA 2NY5H 2X1WL 1JF1A 5ISZB 4FQ1H 5D2NA 4KI5C 3RVWC 4DGIL 1IAII 4OZFA 4F7CA 2ZKYA 1KPRB 2IBZY 4P4RB 1I8MB 1F56A 5IROA 2AQ1A 4U33A 5EC1B 1DQJB 3QEUB 3CVDA 4XVSL 1FNFA 1U8QB 4APQB 4H1LG 1EO7A 3E3QE 3VFUB 3W0WD 1T21B 1EAPA 1D5RA 1E8WA 1CFSA 3V0VB 1ZT7B 1KJ2B 3WJJA 4F2ME 4LARL 4DGYH 4LBEA 4TXVB 1S9XB 1P9MA 5LBGA 2VDKH 2GTWB 2APTA 1BAFL 3QO0B 3AY4A 3QRGL 5JIKA 2V5MA 2NLJB 1NC4D 3L4TA 4PJAF 4ELMA 4H25B 3HHSA 4QRRD 3EYFB 1H0DB 2AEPL 3LQAH 2EH7H 3L9YA 3T4YA 5IWLA 4NO3A 2IAMC 3RU8L 4Y4KA 5CEZH 1QUNB 2I85A 2VWEC 4PRNA 1KPVB 2OKMA 3VDAA 3WTTA 2ZSVA 3MRRA 5GZND 2P4AB 5HHVL 1WO2A 1XR8A 1VFBB 2ICEC 1NAKL 4P5TD 3PHOA 4W9JC 4XC3H 3BJ91 2WBJB 2JSFA 3LEYH 3VXSB 1EDYA 4B9IA 4E2OA 3HC0A 3QIUA 3R0MA 2X53A 4PMEA 2PNDA 5CR8A 2XPYA 4GSXA 3ZDZE 3KJ6L 3MRQB 4GBXA 3LKNA 4R5XA 1P7BA 1NAMB 3NTCL 5DZLA 1BQLH 5J11C 3QYMA 3RNKB 2YMXH 3MREB 4NEHB 4YE4L 1LDSA 7PAZA 2YIHA 3E6FA 5DDHB 5FKAB 1TJHL 3QEGL 2QGEA 2XA3A 4KOCA 2XU9A 1T04B 4JG1H 4O02L 4D7BA 1MHHB 5LDSA 3HLKA 3O45A 3B7RL 4L37B 5GRZA 4YBLB 4OD2A 3ULSB 2HMIC 4M5ZH 4PV9B 2NX5D 4ABVA 4JZOA 4WO4B 5LAXA 3VI4A 4WSJA 4B27A 2PCXA 5HHME 2EC8A 1NMAH 1KMGA 1IGIL 1FIGH 5C0DB 1NPUA 1EFXA 3T65A 3GI9L 5L4FA 2PXYA 4D9RD 1H8NA 2EUWA 2VABB 1PQZB 1HCZA 3AZUA 3NFSH 1U8OA 3OGCB 4HK3N 3VYOA 3CN4A 4G9FE 4LXFA 2MMXA 3W11D 2BRRH 3QXAB 3VQ2C 4MB3A 3JTTB 5IVZA 1WT5C 4Y1AD 4M7LH 1S8DA 5TQ2L 1H6TA 2ADFL 3C5JB 3H56A 5KVEL 3RFZC 1NCAH 3L3KB 1WZ1H 2YZ8A 4BQ9A 1UGNA 2LQRA 4N8PA 2F7PA 1WG3A 2WVSA 4EO5A 3CFBB 4NKIL 2FHCA 3MV01 4J1UA 4P46D 2PWFA 1T6VN 4XOCA 4XMPH 3D3VB 4JPWL 4UV7H 1QPXA 1FNAA 3HRZA 5T3ZE 3H9ZA 4DP7X 4ZUSB 1R0AH 2X5PA 3OZLA 8PAZA 1J48A 5HI4C 4OZFB 1MFCL