5I6NA

Crystal structure of copper nitrite reductase at 100k after 11.73 mgy
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
total genus 94
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6nA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6nA02
1HAUA 2YAOA 4HAKA 3C75A 1V54B 2XUWA 5D4IA 2GI0A 2AZAA 2EIMB 3EHBB 2GHZA 1JZGA 5ANHA 2IDTA 3NSCA 5I6PA 2IAAC 3EH3B 3FSWA 3NSYA 2I85A 1A4BA 4HALA 2PCFA 1IBZA 3FSVA 2PP8A 2UXFA 3ZIYA 1L9PA 4YSCA 1GY1A 3S8FB 2QT6A 4A2DA 3FYEB 2HRGA 3QJSB 3X1GA 1WA2X 3AY2A 2H5UA 3MX0B 2WSDA 2VSMB 4DPAX 3OMAB 1QHQA 1OV8A 3X1NA 3QJUB 5I26A 2Y1AA 2PPAA 1ZDSA 2IDQA 4HCIA 4YVNA 3NP3A 1NIEA 2XV2A 1QLEB 4KOBA 1ASOA 1QNIA 4FA7B 1AG0A 1F56A 2DYSB 5PCYA 5IY5B 1KV7A 2NRDA 1PNDA 2BO0A 2YAFA 2GB2A 1ID2A 3X1EA 4DPCX 9PCYA 1BQKA 3HB3B 4TXVB 4AKPA 1OCZB 4GP5B 5I6KA 3QJQB 1JVOA 4P5SA 1TEFA 4W1TA 3DKHA 1KCWA 4F7KA 2EINB 3QQXA 1ADWA 2PLTA 4AZUA 1FA4A 2VMJA 1AG6A 3UAAA 3ASNB 3OD3A 1JZJA 4YSRA 3ZX1A 3IBOA 3AG2B 5TK4A 4QLWA 1A8ZA 3UAEA 2HRHA 5D4HA 1N70A 2H47C 4NAJA 2UX6A 5A7EA 1SDDA 3T71A 1AS7A 4JHVA 4AKQA 1JXDA 2OV0A 2GC4C 1W6LA 2QDWA 2VW6A 4P5RA 1MZZA 1RCYA 4A66A 1WA1X 3WIAA 1NIDA 2XV3A 2N0MA 4DP7X 1BYOA 2RACA 3QJTB 1ZV2A 2BWIA 3PAVA 3QPKA 1GSKA 2ZOOA 5I28A 4G70B 4F2FA 4HIPA 2EIKB 1AZUA 1J9RA 2BP8A 1WA0X 5F7AA 4GP8B 3FS9A 2H3XC 5B7MA 4E9QA 2VSKB 4GYBA 1SNRA 2IDSA 2EIJB 2FTAA 1BQ5A 4YSUA 2LLNA 3IE9A 3CVDA 1JZEA 5B1AB 1A4CA 2YARA 4GY4A 3QJVB 2IWKA 2HZHA 2CJ3A 4KNUA 4PCYA 1SHWA 2I7OA 4YL4A 3X1BA 3AG4B 4GXFA 3DTUB 2HX8A 5AKRA 4G7SB 4DP9X 2WO2B 2YAMA 1NIBA 1N68A 1ASPA 1KDJA 2XVBA 7PAZA 4WTQA 2VM3A 8PAZA 2VW4A 3GDCA 1JZHA 4HCFA 1BEXA 3T9WA 1ILUA 5FC9A 4ZK8A 3TU6A 4G71B 2BP0A 5D4JA 4YSOA 1DZ0A 1XB3A 2YAQA 4HZ1A 1PLAA 2UXVA 3CDZA 2FT7A 1E67A 1E5YA 1SDDB 3V9EA 2FQEA 3X2QB 4NB7A 2AZUA 1RZQA 1PZAA 2BW4A 5F7BA 1ZIAA 3OMNB 1KBVA 1NDTA 3CVCA 1HAWA 2IDUA 2OCCB 1ET7A 4AKOA 5I6NA 2YQBA 5I6OA 1AZNA 1OE2A 3ABLB 1URIA 1JZIA 1XB8A 2UX7A 2DWTA 1ZPUA 3FQYA 3FU9A 3FSAA 2Q5BA 3FU7B 1CYXA 4BWUA 2BP8B 4BWTA 2XV0A 1E5ZA 4DP8X 1X9UA 4AI7A 1M56B 3ABGA 3G5WA 3SBPA 3HEIB 2YAEA 3S3DB 2X87A 1M57B 1CUOA 2UXGA 3UADA 2HX9A 2PPDA 2B08A 1GS6X 4E9SA 1NINA 1JZFA 2UXTA 3BQVA 2Q9OA 4BK5C 1JOIA 1FFTB 3EF4A 3X1FA 1TKWA 4FAAB 3GYRA 3WNJA 1ETJA 3SBQA 3PXLA 3ABKB 2J56A 3S3BB 2FNWA 1EZLA 2QPEB 5I5MA 3KW8A 3T6ZA 1CURA 2PPFA 1NWOA 1GR7A 2PP9A 2AANA 2TSAA 1L9RA 1A4AA 1PLCA 3N2JA 1L9TA 4DP6X 1RZPA 4DPBX 3FQ1A 4HHGA 4G72B 3T6WA 2BP0B 3AW5A 4DP1X 1MZYA 3AZUA 1MDAA 2FQFA 2FT8A 2QPDB 4X4KA 2XLLA 5PAZA 1WS7A 2DWSA 3CDZB 5I6MA 3BVDB 3NT0A 4Q8BA 4YSDA 3D12B 1NIAA 4Q89A 2JKWA 2BW5A 1AZBA 1JVLA 4YVUA 5B3SB 2YAPA 2ZONA 3QJRB 3FU7A 4MFHA 1T5KA 3NJNA 1MG2C 3V9CA 2MTAA 4N4YB 5I5JA 3UGEA 3TBCA 4JKNA 2X88A 3GXUB 2DV6A 3FSZA 1GW0A 1J5DA 1DYZA 1OE1A 3N55A 2XWZA 3FT0A 1AACA 3OQRA 3WI9A 4AX3A 2R7EA 4DP0X 2CBPA 2TSBA 4KNSA 6PCYA 3JT2A 2IWEA 1IBYA 3U25A 2JXMA 1B3IA 2AVFA 1SJMA 2CUAA 3NJMA 3WKQA 4M4RB 3NSDA 3AG1B 1KBWA 1MG3C 4KNTA 2J57A 3H4FA 4BXSV 4YSQA 7PCYA 1JXGA 3CVBA 3PCYA 2E86A 4YSPA 4L0PB 1IC0A 4QKTA 1KDIA 3ASOB 2HX7A 3FYIB 5B1KA 1J5CA 1J9SA 1NPNA 4A2FA 4E9WA 2DYRB 3S3CB 3L45A 1NICA 1AOZA 1ASQA 3ABMB 3OM3B 2OJ1A 2XYBA 1UATA 4ENZA 2A3TA 4E9YA 4G7RB 1VLXA 4WKXA 3AG3B 2FWLB 3OMIB 1AZCA 1SF5A 4F2EA 1GYCA 4W9ZA 1KYAA 2CALA 1ZIBA 2WO3B 3FPXA 2PCYA 5B1JC 2XXFA 1BXVA 1HFUA 3IEAA 6PAZA 2PPCA 2ZXWB 3TA4D 2IDFA 1JERA 4BDVA 3S8GB 2BWDA 2XX1A 4DP2X 1YLBB 1CYWA 1V10A 2FQDA 2Y69B 2VN3A 3NJKA 1AR1B 3PAZA 4PAZA 4UAHA 4KO5A 1OCOB 1GS8A 1M9WA 1L9SA 1PZCA 1NIFA 2CCWA 1OCCB 2B3IA 3KW7A 4JHUA 2YXVA 3TBBA 5LDUA 4KOCA 3SBRA 3IN0A 5EHFA 3UABA 2I7SA 1L9QA 2BHFA 5TK2A 2VW7A 4BXVA 4E9RA 4EF3A 2R7EB 4E9TA 3FQ2A 5B7FA 3PAUA 2IH8A 1W8EA 1J9TA 4E9XA 2P80D 1ET8A 3IN2A 4G7QB 2IH9A 2XX0A 1CC3A 3EH4B 3ERXA 1PMYA 1OF0A 2J5WA 3ZBMA 1XB6A 1EHKB 1RKRA 2GSMB 1PZBA 1WAEA 3NJHA 1ILSA 3UACA 1AIZA 2VM4A 1X9RA 3H56A 3WKPA 3EH5B 3WG7B 4HCGA 3T6VA 1SFDA 2GIMA 2DY2A 2CAKA 4A2GA 4DP4X 1AZRA 1AAJA 1AS8A 3NJLA 3TASA 4YSAA 2J55A 1A65A 1BXUA 1PF3A 1W6WA 2PPEA 1BYPA 3NJJA 2IWFA 3MBWB 4YSEA 1NPJA 1E30A 1BQRA 3NJGA 1KGYE 1PNCA 1IKOP 1PCSA 2EILB 4A67A 1I53A 1PAZA 4BDVB 4A2EA 2FQGA 2PP7A 1FWXA 1KCBA 3FPYA 4YSSA 3PLYA 4BWWA 1NTDA 4N8UA 1TEGA 2YAHA 4DP5X 2W8CA 4E9VA 2ZWNA 3ZDWA 1SHXA 1TU2A 2FT6A 2FJSA 3NJIA 5I6LA 5AFAA 1A3ZA 3JTBA 1SF3A 5AZUA 2MRYA 1JXFA 2QDVA 3DIVA 4RH4A 1XMEB 1IUZA 2AFNA 5B1JA 3CZUB 4K9JA 3RYMA 2BZCA 1OCRB 4A68A 1GS7A 1GY2A 1ZDQA 3NJFA 4A2HA 4CSPA 4KO9A 1PLBA 1BXAA 1E65A 3SQRA 4CSZA 4HHWA 3NP4A 3FU8A 1L9OA 1SFHA 2P80A 4NERA 4UF7C 1V55B 3PPSA 4YSTA 2GBAA 3CG8A 2GC7C 2JFCA 4KO7A 2W88A 4M3HA 3NYKA 1AQ8A 5B7EA 2XU9A 1J9QA 3WNIA 5E9NA 1BAWA 4GP4B 3T6XA 5I5IA 2HLEB 1WS8A 4UANA 1OOWA 4KO6A 1R1CA 2BZ7A 1NWPA 3H4HA 1OE3A 1AANA 3NSFA 1AS6A 2HXAA 2XXGA 5B1BB 1ET5A 2YXWA 1NZRA 1PY0A
chains in the Genus database with same CATH superfamily
3KH4A 2AEWA 4OVVA 4IKIA 4PWEA 4MNQB 4OKVB 4GAJH 3BDBA 2P5EB 3B7RL 3MRKB 3W2DL 4W9CC 1MFCL 1TFPA 4APQD 5TE7L 2R1XB 3NSCA 3EH3B 3HG1A 4W68A 3UTSB 3UZVB 1U3YA 4UAOB 4CW1B 5GZNA 4AENA 1IBZA 3MUGA 2XN2A 3ZIYA 1TU2B 5E8NB 3S8FB 4JBSA 25C8L 2O5ZL 1ITCA 2HRLA 3RURA 3OZ9H 4I4WB 4U1SA 1QSFB 1OF2A 1QYGL 3BN9C 4DW2H 3HN3A 4UTCA 1AKJB 1DJSA 2V17H 4XP4H 5DEFB 4ABVA 1OPGL 1JCVA 5BZWB 4HZLB 1PL3A 3T2PA 1DCEA 1G9NL 5CMAA 5KSUB 2CSPA 2R15A 4EVNA 3IKKA 4QRBA 1CT8A 2BVYA 5JR1H 4HPYH 5E6SB 2JI1A 3SDYH 3VSUA 4ZI8A 1QNIA 1LDSA 3QO1A 2QR0A 4BSVB 5I73C 2DYSB 5F1KC 1LEKB 3ZLQC 2DLTA 3BXNB 2BO0A 4JFXA 4NENA 4F57H 2GTZB 3ZHKA 3IMUA 3QXAA 5EU6A 2VL4A 4QRUA 3D3VD 4J8RA 3WHXA 1A1NB 2WTPA 5AWNL 4EDWL 2K45A 4MXVE 4WAFA 3KE0A 4Y1AE 3HC4H 3ATFA 1JPFA 5EZJB 5IJBC 2NY0D 3MLTB 3EJZD 1JZ6A 2ZUXA 2EVFA 4LNVA 1NEUA 3OV6A 2GJRA 1NBCA 5TF1L 4DT2A 3HG5A 4TQHA 3BDYL 5TK4A 1A8ZA 4AWJC 3QDAA 5F9WB 4WFGD 4AGQA 2ZYHA 3UO8B 4KU1A 5I0YA 3S7GA 3OXSA 3U30B 3VCLA 2NR6C 3DARA 3FT9A 2CDFA 4YDZA 2AAVA 4PCSA 4XO5A 4KKBD 2P44B 4ZMOA 3GSUA 4JO8A 5DSCA 4GRMA 4N9OB 3HG1B 1WA1X 2R0LH 4RETB 3V4VH 5H4YA 3GS0A 4EQ3A 4E5XA 4K0OA 2XQBH 4AENB 1YPZA 4PMFA 3WFZA 4HEMA 3H9SA 4FX5A 4PBWD 3MUGB 5EIIG 1KBBA 1XF4A 5T33L 3BAXA 1T4KA 5T1LD 1CTNA 3NTCH 4NP4L 4BFRA 4U1SB 4YQXL 1NGXA 1OF2B 3PDGA 4IRZL 4H26A 3T3MB 1CE1H 3GZPA 5DZVA 4UILH 1CK0H 2VSKB 3QWRD 2OW6A 3TYFA 4IIZA 5A2KH 3CHRA 4HAGA 4NFCA 4X80H 5CMAB 4YSUA 4EVNB 4KVNL 4FQIH 4MQTB 1CT8B 1VZHA 3BZFA 5B1AB 4G9FA 3ZT7A 1NMBL 5CHNA 3QO1B 2QR0B 2D0FA 2NXYD 1XIWC 1TZGH 2J4WL 4LSRL 4RSVA 4JFXB 4NENB 3D87B 4G8GD 2CJUL 4PVNA 5D1XC 1E8ZA 3QXAB 5FOBA 1QRNE 5EU6B 3X13A 1VKXA 4QRUB 4RZCA 4J8RB 3GXFA 1KJ3H 3WHXB 1LWRA 3VMPA 3ZO0A 4Z8FH 5ICXA 2HH0L 2FK9A 4X8GA 2Q8BH 1JPFB 3A22A 2P5PA 1RK0A 1YEEL 2UZPA 1H6TA 4OF0A 3FB8A 3RWDA 5CGMA 1Y1DA 1Z3GL 5H2BA 4YAQA 5E99H 1Z66A 4QXUH 5JIDA 1S7WA 4N85A 3LMJL 3ZKMC 4K94L 1WPCA 3OXSB 1IL1A 3VCLB 1T6VN 4BZYA 4YHOH 5D7JD 2CDFB 2WO4A 4KVCL 1E50A 5CCGE 1PZAA 2X70A 1AZVA 3V7AE 4BM7A 1RU9H 3GMOA 3GSUB 4HIEA 5CZXD 4S1DD 1IM3D 1KBVA 4GRMB 5SX5H 5DSCB 3TF7C 1E9OA 2HWZH 1OSYA 1AHWC 1JPSH 4XMPH 5BO1H 4KUZL 4E5XB 2WQAA 1NUFA 4N25A 2YPLA 3CZJA 1YPZB 4MXVF 1O7SA 2B4CC 3KJ4B 3H9SB 4K9EH 4LGPB 4NOFA 1ACXA 1XF4B 4U3CA 1F4XL 4FNLH 1T4KB 2CZNA 2AJ3A 3HJEA 2XBTA 1NGXB 2FL5A 4H26B 4DP8X 2YD0A 3L3JA 3QPXH 3TYFB 5KUKA 3ABGA 5I18H 4AC4A 3S3DB 1OZTG 5FYJL 4JRWA 1I4FA 3Q6GL 1GYVA 4JJOA 3HE6C 4F20A 3HVNA 5A2CA 3UCQA 3BZFB 2PPDA 4G9FB 4H0IA 3TZVD 2OX5A 1U2CA 2HLFD 3BQVA 4JKMA 5CHNB 3QIBC 1RPUA 1XEDA 4Y2DA 1J05A 1FIEA 1EXGA 3ABKB 2J56A 3EBGA 4ZXBA 3X13B 5FOBB 3NRQA 4RZCB 3QIUA 5GRWA 3WDJA 1VKXB 4WRLA 1MN4A 4WTXA 4CGUB 1I3GH 2EEBA 3O45A 5SX4I 5ICXB 1MCEA 5TH2A 1UT1A 3H54A 2MMXA 4NKOA 1RK0B 4PS3A 4YHKH 2NY7L 1RHHA 3FB8B 3RWDB 4YAQB 5H2BB 1OARH 3G6JA 1Q1JH 3DXAE 2R0KL 4GW1A 4MCZA 1S7WB 3ZJAA 4MLSA 2QPDB 4X4KA 2HCZX 3HC3H 1XTMA 2X2YA 4KY1H 1Q0YL 1IL1B 3LVEA 4FYTA 1EVTC 2TRYA 3C08H 2DQDH 2X70B 4P23A 4YL9A 4AJVA 2K6YA 1XF5B 3GMOB 4HIEB 4N1CA 6TAAA 2R27A 4P46C 2X05A 1E9OB 2R4SH 4FTVD 1DQVA 1JFQH 4RRPA 1CGYA 1M7UA 2YPLB 3TN0A 1AGEA 1QOKA 2VRAA 2YEVB 4P2RE 5AZ2L 2ITEA 3GXUB 3PQYE 4JHWL 2FNBA 2AJ3B 3Q1EA 5GRJH 4BYHA 4MHHG 2FL5B 5BMFH 3O6ML 5CR1A 4KZEL 4EZLA 3L3JB 4BQ9A 4XI5D 2HMID 1FORL 2Z0UA 5ALBH 3LXBA 2VDRL 4JZOA 1I4FB 4J4PD 5C0JA 2DQJH 4XPAL 3ZSSA 1T83C 3C5SA 3N85H 1SJMA 3WKQA 2WXFA 1P0SE 1BF5A 5CS7A 3SDCC 3ZTNL 2XTJC 3TVMD 4DN4H 2OX5B 1IAIM 3NRFA 1CGVA 4DGWC 4P4KC 1BDYA 4Y2DB 2G3XA 3FB5A 1J05B 4ZXBB 4Y88A 3QIUB 4JFED 4QOKA 3EHBC 1FVEA 3GS7A 4WJKB 4IIQC 1D2OA 3O45B 3TNMA 5F8QC 3S3CB 5TH2B 4B96A 2A9NL 1TTCA 4RESB 4OLUH 4NKOB 3RDTA 1RHHB 3GSRA 4B3VA 2XNAA 2QADB 1NCWL 1X5GA 3G6JB 4MCZB 4GW1B 1E3ZA 3V0EA 3AG3B 4R2GD 1YEDA 4OZIE 1AZCA 5AYQA 1BVNT 3P4MA 4UV4L 5G4MA 2ISDA 1BM3H 4MNQD 1R3KA 2P5ED 2WXIA 3IJEA 3IDUA 4TVPL 3GEFA 3MLUH 3RBGA 1RJYA 2WGNB 3BP5A 4N0CD 6PAZA 3AQYA 4G6FB 4P23B 4FE9A 1IMHC 3ZKNC 1XR8A 3BZ5A 1UB5A 3UTSD 3LEXA 4KTYA 1YLBB 1Z9MA 3UTTE 5AUMA 4LPWA 5BUGA 4KNQA 1ECYA 4M7LT 1YNLH 4W6YB 3TN0B 1Q72H 1AGEB 4H2CA 4QRRA 3C9NA 3A24A 3HE7A 3QUML 4I77L 3X3GL 3QULA 3KW7A 3U0WH 2YXVA 5IREA 4A1RA 2LFGA 1QSFD 2DIEA 3VD0A 2AQPA 2OYKA 3ULUH 4PV9A 1AKJD 3KLQA 4DAGH 3QEQD 4EF3A 1YMMA 4YHLH 5CJBA 5B38G 4YLQT 4RIRA 3QCTL 3BLKA 2VR5A 3AREA 4JZOB 5DMJB 1CG9A 1RPKA 2HTKD 5C0JB 4FXGA 3C5SB 3LB6C 4PIBA 5FB8A 2DLGA 4WI4A 5BNXD 2XN9A 1TTRA 2W9LA 4JR9L 3BFOA 5AKSA 1MRFL 4FLOA 1CGUA 4CRPA 5JW4M 4JRXA 2R1YA 2CKNA 2TAAA 3FB5B 3QNYA 2FHFA 3AJ7A 4S1SL 1NM4A 1KEML 1R3IL 3NEOA 5EORL 3T0EE 2AMGA 2LVEA 5L9DL 4QOKB 4R7LA 3WKPA 1FVEB 2VDLB 1UXWA 5CU9A 3WD5L 1BAGA 4ZFOL 3T6VA 3RU8H 3TNMB 1IIKA 1LQSR 3OMZA 3UG3A 4U1HA 2V5TA 5DD5L 2VDPL 1LE5A 3M7OA 4FKHA 3RDTB 3HAEA 2E9JA 3GSRB 4G5ZL 1I3RA 4KHXH 2XNAB 2AC0A 1DO5A 2B2XL 3TBWA 5JW3L 1YEDB 4YSEA 1RZJC 3EYQC 3P4MB 3B37A 5IR1A 1BFTA 4UTAA 1R3KB 2NYYD 5HDQH 4AW7A 3IJEB 1YYMH 4Z7VA 1QA9A 1RJYB 3BP5B 1TQCC 3QJOA 4CU6A 2V9QA 3TM6A 1TZAA 1F4WH 3CZKA 1UWGL 4A2EA 4FXKA 4DO4A 3LY6A 2PP7A 3HG1D 5C0ND 1MI5D 1XR8B 3ISYA 1UB5B 3ULVH 3ZE1B 3LEXB 5AUMB 1IBGH 1I1YA 3PWVA 1YECL 3GEWB 4DP5X 3LQMA 4UQDA 2MKWA 5E6ZA 4QRRB 3C9NB 1W72L 1JUFA 3HE7B 1SHXA 3QULB 4LLYA 4M8QA 5L88L 3OHXC 4C55A 5AOZA 5IT2H 2MRYA 4U3SA 1EMTL 2IG2L 4PV9B 1KGCD 3MNWA 3GMQA 2YRLA 1T3FA 4L23A 4OZIF 2CXGA 1YMMB 4GRWE 4RIRB 4ZOCA 4K8RH 3KHOA 4ZS7L 5AVVB 4FQ2H 3AREB 2F7PA 1CG9B 3DPDA 3TEXA 3O2DL 5LGHL 4DQOH 4FXGB 5TGBA 4BZ2L 5FB8B 2ZKYA 1WZAA 4Z7WF 2XN9B 2NY4B 3NIFE 5IHBA 1UH3A 5GIRA 4JRXB 3MN8A 5ELIA 4HGWA 2R1YB 2GK2A 4HXAH 2P26A 3QNYB 1VFOA 4K4KA 3EGDA 4LSTH 4XB3A 3TJHD 1BIHA 1G6RH 3AS2A 5I1DA 4KRPB 2WTOA 1UXWB 2ICWA 1U91A 5DT1H 3PS6A 5I5IA 5MHSD 4U1HB 4S11A 4HIHA 4ZUTA 4S0HA 1LE5B 3ULUD 2KH2B 1JG9A 3HAEB 4MXQD 4U6VH 1I3RB 1E3FA 1AQHA 4NS0A 4UQEA 1SHSA 3NSFA 3TBWB 2GIYA 2IH3A 1AS6A 2V9TA 5I1CH 1JD7A 1HEHC 2WBJC 4ETYA 5IR1B 2RQEA 3VB8A 2VUYA 1MFBH 3RL1A 1GKOA 4O9HH 1QA9B 4Z7VB 2NSQA 1NSNL 3P73A 2IQ9L 3K6FA 4LPTA 5C6TL 1P4UA 4FXKB 4WK0B 3A67H 2ENSA 1GC1C 5I6PA 4NN6B 2CUIA 1L7IL 4Y1TA 4H44C 5EZOH 4XMXA 1I1YB 3PWVB 4WO4D 4WY7H 5IVXE 4MA1B 1ADQL 1UT2A 4FQQA 1JUFB 4FFYA 4LLYB 3NAAH 4M8QB 2BERA 2LQRA 3HOGA 4U3SB 1CF8H 2HRGA 1WJ3A 2RIKA 2XVKA 1F3RB 1XGYL 2J3SA 1KIRA 3GMQB 3MNWB 4RGMB 1T3FB 4KKAD 4F80A 3PL6C 2Y5QA 1YUKB 5H37G 4G9FD 5TGBB 4LHUA 5GRVK 1KGXA 2E8ZA 2ICEA 4JCLA 4KOBA 2R69A 2J8HA 1N0XL 5LBSL 3NZUA 1KTDA 5TE4H 1NOAA 4LSQH 1TMCB 4M6OL 2ZCHH 4L3AA 1KY6A 5GIRB 4HGWB 4HT1H 3ULVD 3EGDB 3I75A 4AKPA 4JKPL 5I1DB 4J2QA 2P45B 2IALA 1U91B 2ICWB 4Y2LA 3MLZH 4JQVA 2UY7A 4LU5H 4E0RA 4U31A 3IE4A 4AQ1A 4ENED 1U2HA 2BSDA 4HIHB 1FC1A 3C8HA 1G0XA 3AU0A 1ADWA 2BXZA 4R4FH 4OQTA 4PBDA 2JVUA 3GUTA 2GYSA 3HIZA 2IH3B 1NCGA 1FIGH 3ZX1A 3ZDZE 4K8RD 2F1AA 4QLWA 5TDOA 4UDUA 5KJ7E 1RHFA 4X8XA 1RZKH 5FGCE 4CC0A 4TNVF 3RL1B 2CXKA 5A6MA 5KBPA 3R0NA 3NIFF 1S3KH 4KXAA 3LZQA 2YOAA 4XH2A 3BKML 3P73B 1YC7A 5AB0A 4M3KB 2Z64C 4UZUA 3ESMA 1A6AA 4A66A 1UEMA 2VDLH 2XV3A 3SE8H 2YPLD 4P5KA 4Y4HD 1PVHA 4U1IA 2QQLH 1WZMA 3O2VL 5DUBA 4FQQB 1BEYL 4N87A 3W57A 3HLAA 1KYOJ 2AABH 5E8OA 3JXAA 3ILEA 4XN9A 5ABDE 5BPPA 2BP8A 1U6AL 4FZ8H 5J89A 3D39E 2COVD 2R2HA 1IC7H 1KIRB 5EUOA 5K9JL 4LCUA 4Q0XH 2Q2EB 2DI9A 3MAWA 2ADGB 2YZ1A 4AQZA 2EIJB 5K5YA 2EEDA 2VR4A 2H8PA 5E1GA 3KWUA 4YDLB 4OFPA 2OSWA 4H20H 3D08A 4LHUB 1UUSA 2A0LC 4EIGB 2ICEB 3CHXA 5DS8A 2FVNA 3QAZB 4F5CA 5T1MA 3O2WH 1FQ9C 1KTDB 1HDMA 2A4CA 3W56A 5EBGA 1UTDA 2PN5A 4NPYA 3O6LH 4M43L 3QIUD 4X4XA 3VDAA 2FB4H 3I75B 4JFZL 2KQNA 4PJ7F 5FYLE 2IALB 2XVBA 3ZKXB 1G9EA 2UY7B 5HI4C 4E0RB 3C2AL 1G9MC 4AQ1B 1BQUA 2Y7NA 4J1UA 2QADD 4NJAH 4AT6A 4ZS6C 4ZQTA 4N2DA 3GUTB 4M1DH 1HSBA 3TH3T 1FE8H 1H5BC 3FKUS 4C4BA 2FIKA 1KJ2B 2W91A 3LS5L 5KVGE 2E6QA 2NY3B 4MKTA 3CN1A 5TDOB 4UDUB 2NTFA 1ZHBA 2QKIC 3B2VL 3FQWA 1E4KC 1A9BA 2GJZA 4QHKJ 1DJXA 3Q3GA 3X3FH 1SXBA 2FQEA 2VLLA 1E9PA 4GAFB 3CVHL 4XH2B 4BV1A 2BW4A 2P28B 1DBBH 4EI5D 3DX4A 2K7PA 1A6AB 3WFBL 4POUB 3S0PA 2JTYA 2XQ0A 3TN0D 4P5KB 3D0VA 3GSWA 5JQ6L 4MDIA 4PJBA 4B60A 3UP6A 3AXIA 4LAQL 4U1IB 5DUBB 5I1KH 1ZPUA 4UV7H 3HLAB 4R4ND 3CFQA 2WVUA 4Y9CA 2J73A 1XR9A 5E8OB 4DZBA 3HAEH 2ESVE 2D8KA 2MTPA 2BP8B 5HDWA 2R2HB 3MV9E 3V0FA 3EFDH 5MEOA 2GJ6A 4LCUB 2AXWA 5HHOE 3AM8A 4TTGA 4XO4A 4HLJA 2X87A 2H8PB 3TC9A 1A3RH 4F7PA 4W70A 1RPQA 3R7RA 3UADA 4Q58C 4XPFL 3COOA 1JV2A 4RWHA 5DS8B 1OLLA 5T1MB 4ESKA 2R0ZH 2XWRA 4WI5A 4ADJA 1HDMB 5C09D 2EDEA 4QLRA 1RURH 3P11L 3QZPA 5E2TH 5DEGB 1KEGH 4NPYB 4GXVH 1GPOH 3RY6C 5FGBC 2VLKA 4L0ZA 4X4XB 4QOKD 3QUZC 3NIDF 4BFFA 3AUWB 3A0OA 1NGZA 2A9CA 3KW8A 3WS6A 3BRFA 1MAJA 4N5UA 4XC3L 5T3XH 2VL5A 4YBQC 1QLFA 1PEWA 4B6ZA 4J1UB 3RGVA 5SV4A 3RWHA 2FHCA 5IG7A 3HN5A 4AT6B 2QSVA 3G08A 1RH8A 1YSOA 1HE7A 1NUNB 2NQDA 3PHOA 1HSBB 4J3BA 4LARH 5FW7A 2FIKB 4TKWA 3NCXA 4YXHH 5GS1A 1FO0L 5C8JA 1CGTA 15C8L 2NTFB 5PAZA 1GOHA 1ZHBB 4AYBA 3FQWB 4L1SA 2GJZB 1A9BB 2BNRD 2V37A 4GUCA 3Q3GB 2H45A 4OJYA 1MJUH 2EECA 2IQAA 1E9PB 2VLLB 3FRUA 1U3ZA 5C0AE 2A5UA 4HGKC 5CLYA 5DHYA 2W9DH 1WG3A 1TTBA 3KBEA 3D0VB 3N42F 3GSWB 3EAKA 3P30L 4I9WD 4MDIB 3ZOAA 4DTGH 1EJOL 1F00I 3POHA 1XR9B 1F41A 5T5FH 4NCC1 4DZBB 4UINH 1A0QL 2JELH 3CSYA 1OE1A 4OF7A 1AACA 3ZDXE 2ZXAA 1OAZL 3ML8A 2GJ6B 1CL7H 4PRIE 5MEOB 4Q97A 3U4BH 4BQCA 2KZKA 3R8QA 3H8NA 1R5WA 4F7PB 3KEHA 4Z7IA 2APBA 1E5AA 3MRFA 2Z91A 3EXLA 1U3HA 3D5OF 1JV2B 2NY4D 2WSKA 1LE9A 1V3JA 2YJLA 4JRXD 4XP5L 5KTEL 1SVCP 4PB9H 1BQHA 2O61A 3PJNA 1MCNA 2VLKB 1PU0A 4N2IA 2DQIL 4FFYH 1V5JA 5DD0L 4KRPD 3CMOH 4KMLB 3QHZL 1NGZB 3B9KA 1F90L 2WPGA 2VL5B 3L45A 3P4NA 1QLFB 2F58H 1UWEH 3DSNA 3D2TA 2Y5TA 3PDOA 3RGVB 3RWHB 4DKTA 5C3LD 2NZ9C 5IG7B 5L2KA 3G08B 1WC7A 2DYPD 2YBRA 3BWAA 3STBA 4AVIA 4CC4A 3PHOB 1GGUA 1GJIA 1T1XA 5EN3A 4H0GA 5CLZA 4F2EA 1SBSH 5C8JB 4G59C 2R69H 2VDMB 5JXED 2IQAB 3FRUB 1THAA 3NZHH 3TTYA 4KK6D 5D7LE 3MRGA 3EOTH 5HJ3A 3OAYK 1J48A 4LO9A 5DHYB 2ZX5A 4JY4A 4ZFGH 2AJYL 3QCVL 1H9DA 4XPBH 2LAGB 2WLHA 3MTRA 1JI2A 3II1A 4M5SA 4CMHC 2UZYA 2Y6TE 3APDA 4NDMA 5BZZA 2B9BA 1J9CT 1VACA 4PJ9A 5DO2D 4D9RD 2B3IA 2MCPL 5LDUA 5T3XD 1E2VA 2I60L 1SYVB 4OW6A 4S1RH 3CSYB 5TTRA 1HZLA 1KJ2H 3QPQD 1JPTH 4XVSL 3V0JA 1HCZA 4QJ5B 2WZ0A 1R5WB 2APFA 4P2YA 1CD0A 4K73A 1KMGA 4HG4J 5E08H 2ZYRA 3MRFB 2Z91B 3QZBA 4Y8AA 5C0BA 2CHWA 1U3HB 2J43A 3V4UL 4EN2A 4ZMWA 5ABAA 1LE9B 3MJ7A 1SXNA 3UYRH 3OGCA 3NIGB 1BQHB 1MCDA 2O61B 3OLGA 4IBWA 1ZK9A 2HFGL 1S7VA 3D07A 2WVVA 2UZXA 3B9KB 5EZPA 4NGHL 2DLFL 4YWGL 4PJXE 1P7KA 1MDTA 3P4NB 1FZKA 4QDGA 3DSNB 3PDOB 3KS0J 5L2KB 5IJKA 2QVTA 1SOSA 1WC7B 3VMOA 2PWHA 2R23A 2NDGA 1MCSA 1XD1A 2YBRB 3BWAB 4FF9A 1HH6A 2FO8A 4JL1A 4XHJD 43C9A 3ARVA 1X5AA 1T1XB 1NL0H 1NPJA 4X9GA 3ZK0A 1KCVH 1MUJA 2EADA 2O1AA 3ZYOA 4KFMA 2B4CL 4ZW6A 3K6IA 4F15C 1DQMH 1I53A 2ZP9A 2XJLA 2YXMA 3MRGB 4M3JA 5DVNA 2JKIS 5HJ3B 5D8JH 3D6GA 1CXHA 1NTDA 5JW4Q 4JY4B 4N8UA 2GEQA 2VXSH 2BDNL 4ZAKA 2HJFA 2LT9A 2BVEA 2UZYB 4NDMB 4E9VA 5JHLH 3ZDWA 1B4JH 1VACB 4PJ9B 1R19A 4OF8A 3M8OH 3RBSA 2HJKA 1GJWA 3ARBA 2DQCH 1Z3RA 3DTXA 4E41E 2HVKA 5BS0E 2QZ5A 3NJFA 4F8LA 4I13B 2D0HA 1QBMH 2OPCA 4MA7L 1I1FA 2W0KA 1QO3A 1QSEA 2FX7H 1IBDA 4ZBJA 4WTZG 4LHUD 2CMRL 5C0BB 5K9KA 3SE3C 4UF7C 3MJ7B 3LQZA 2BJMH 3OGCB 3QAQA 3AACA 5SWSD 7FABL 2DS4A 3B9VA 4IU3A 1S8DA 1J5OL 1J1XH 2ZP0T 3VU1A 1AQ8A 1NDGA 1S7VB 2WVVB 4XVUD 2UZXB 4XPHH 4FQ1L 3ZSTA 3HUJF 5E8EA 4HBCH 1FSKC 3WSQH 4APQC 4C59B 4OZGA 1P7KB 3ECVA 4IMLA 4PJAE 1FZKB 2YBGA 3FCBA 4RFEA 3OKLB 2C9XA 3WKYA 2R23B 4U1GC 3QIWA 4ABQA 2NY3D 1HH6B 3FU5A 43C9B 5JHDE 2XXGA 1OQOA 1PS3A 3LX9A 3PDDA 4N4YB 5C6WH 1TUPA 2ICWJ 1MUJB 4HEPA 1G4MA 4K3JH 4AGNA 1EXUA 5DC9B 4Z3EA 2A9BA 2EIMB 3UGUA 1M4KA 2Z93A 3GHEL 4R97B 4X9BA 1Q90A 3MOAH 3FSWA 4M1CC 2GJPA 3DUSA 1S3RA 2EC9U 2EXTA 4OZFA 4ZAKB 3GLDA 2HJFB 4RFOL 4F92B 3FSVA 2FLMA 4FLRA 5AAMC 3ATAA 4OGYH 1MIMH 4XXCA 1W15A 2VNCA 2HJKB 2XWBA 1SQ2N 3ARBB 3DTXB 1MNUL 2HVKB 2V9RA 4LPXA 4PLKD 1NA8A 4GO6B 1H3TA 5AYUH 3T0XA 3JV6A 1MHCA 2VDMH 3BC9A 4I3GA 3VAEA 1A6VL 1GGBL 1I1FB 1QO3B 1QSEB 4LRNH 4Z0BH 1J8HE 4FJ6A 1OL0A 2EIZA 2NY0C 5K9KB 3EJZC 1NIEA 3VXUD 3VWJA 1GGIL 3I2CH 1ASOA 4N8VG 3LQZB 2ERJC 3RIKA 3BP6B 3HS8A 3P77A 1K4CA 2BRRH 1D3CA 5D7SL 5B22A 4ZUWA 5FO2A 1G7LA 3NA9L 1MCWW 4IU3B 4DPCX 1S8DB 2OYLA 1CVRA 1NDGB 2YIHA 4AVHA 1KN2L 3SCMA 2MNJB 3P3SA 4P5SA 4YDIL 3FT2A 1NBYA 4KKBC 5E8EB 4OGXH 2ZOTA 4OZGB 1XBRA 4IMLB 2SEBA 1YEJL 1HK6A 1C12A 3UPAA 4K7PX 2PLTA 2HB0A 5LCVA 1HOEA 1NKRA 4JFPA 4Y4FA 3QIWB 2OMNA 2XQYA 3TIEA 3VYNA 3EO9H 4UQBA 3O0RL 3FH5A 2CBMA 5ANME 3U6XS 1GIGH 2KLSA 1EXUB 4NJ9L 4OCXH 5TD4A 5F7KC 3C60D 5TFSH 4OB5H 1QLEH 2K9UA 2EAEA 5E7FA 2IBZY 1MEXL 2Z93B 1IC5H 3O4LE 3W9DA 4P5RA 2J1XA 3RZCD 1EAPA 4G6JL 3DUSB 3GB7A 3Q8CA 1PZDA 4OZFB 3NJVA 3QJTB 1UM5L 2V3EA 5LAPA 3VXRA 4M6NL 3GXDA 3T1WA 3D25A 4HIPA 3UO1H 1J9RA 2XWBB 1H3WM 1WA0X 1NMCC 2IAMC 2GJ6D 5MENA 4CDGC 1EANA 1L7TL 1SN2A 2WAHA 3BEVA 4GQZA 4GYBA 1MF2H 2PR4H 3JV6B 1MHCB 3PWPE 4HQQL 2Y7SA 3GTVA 3TFKD 1FFQA 2IGTA 4XN5A 4LQFL 3D50A 4IS6A 2EIZB 4U7MA 4AQ8A 1DSFH 2XZQH 3VWJB 1B2WH 2FH8A 2WUCL 1H3VA 2HT3D 3KNBA 2F5BL 4BCYA 4J3SA 3P77B 1K4CB 4F8QA 4KKRA 4YHZH 4ZUWB 3MODH 1G7LB 3NG5A 1J86A 1OTSD 3RL2A 2I07A 4YHNA 2IPTL 3SCMB 5D7JC 3TF4A 3SQBA 3OSKA 1RZ7H 4PRDA 3FT2B 1NBYB 1RZJL 4FG6D 2J20A 4WTQA 2ITFA 1FBIL 5CZXC 2E56A 4PJDE 2Q3XA 3RGVD 4L5FL 2OTWA 2SEBB 4WWKD 1C12B 4KXDA 2QSCH 4UYPA 1H3XA 4BZ1L 2JQAA 1F0LA 2WM0A 3HZMA 1F42A 4JFPB 5JMRA 4Y4FB 4KKLD 4GSQA 5IFHL 3VG9C 1DZ0A 3OKNA 2ZXGA 3TIEB 4AG4H 2H32H 2RJMA 3UYOD 2OZ4A 5I6XC 4Z7QB 1CFVH 4HC1L 4WUKH 4FA6A 4NB7A 2D4DA 2DEXX 2V3DA 3EH2A 4GUQA 1BFVL 3CNKA 1MVYA 4PJEE 3W9DB 3PYCA 4QRPA 1EAPB 1HAWA 3GB7B 1RUPL 2GG1A 3APMA 1VA9A 1SN5A 2BP5M 3PU7A 4GQ9L 1MCLA 3TZVC 3VXRB 2HLFC 4C57C 5IV2A 3TV3L 3KWWA 3D25B 5DJ8A 3JWNE 3EYFA 5FAAA 5F9OL 4LDLB 3K2UL 4BWTA 5AOIA 4LRIC 5SV3A 4L05A 5M94B 4BFEA 5MENB 4R7XA 1YEWA 3BQUA 3BEVB 2VDOL 1X7QA 1JZ2A 3CFTA 1ZEAL 1BZDA 4DEPC 2C7UA 5DCCA 2GKIA 4LOVA 3L1OH 4IS6B 5D1QD 5E2VH 3SDXA 4M4RA 3ZTJH 4DN3H 1F4AA 4IBYA 4Y4KD 3I6SA 2B08A 2JJTA 5DJAA 2CGRL 3QFJA 5CP3H 5BV7B 1NINA 3OKDA 2Q9OA 3KNBB 2JXMB 2B0SH 4NLHA 3WJJA 1RIHH 5TF0A 2NUPA 3RL2B 4JFYA 2I07B 2X42A 3B9KD 4YHNB 4IOSA 2X4UA 3DK0A 2PPFA 3F01A 3SQBB 3A4EA 4PRDB 4QAWA 2AANA 2HVBA 3N2JA 3ARTA 1C5BL 3FB7A 2MQ0A 3BGMA 2OTWB 4XC1L 4J28A 1KCRH 3WFHA 4GKOA 3QXDA 3BW9A 3HZMB 1MPAH 3OLIA 1GVIA 5EO0A 3UX9B 3GIZL 1HTYA 1OPOA 1D7CA 1GC1L 3OKNB 4JO1L 4XX1E 4Y7OC 5GZOA 5C70A 5KSVA 4UNUA 4JFHD 4KK9D 4KHTH 3ZDYB 4TRPL 1CJYA 1UOVA 1ODAA 1XBDA 2D7OA 3VXME 1C1EH 4MZRA 4XI5C 1E4XI 2HMIC 4AMWA 1GRWA 4NBXB 4UIKH 5B3SB 1EZSA 4QRPB 4J4PC 5ALCL 3MJGX 3HC0A 2WLIA 2VDKL 2OMWA 3EZJB 7TAAA 1G7JA 2D3JA 3V9CA 4PJ9D 4A63A 3TVMC 4BGDA 5J6GA 5JMOC 5IV2B 3KWWB 1HI6A 2E27L 3NZ8A 5DJ8B 3RVVD 3EYFB 4JG1L 4XGZA 4WWPA 3VG0H 3BIAX 3N55A 5I19H 5K39A 4W9IC 2J6EA 1ZTXE 2PUQT 3V8OA 3TEYA 3MLVL 3BQUB 1FZOA 3T2QA 1X7QB 5FV2A 2E47A 2FATL 5EG6C 4GMTH 4K9EC 2OR9L 2C7UB 2ZQKA 2Q6WA 5I0XA 2VC2H 1MJJA 4XNYL 4URTB 3SYQA 1UURA 2X44D 3U25A 4ZX3A 1OOAA 3AT9A 4J6RL 3SDXB 4M4RB 2NY5H 1KBWA 4OFIA 1KELH 1YO4A 3MMEA 5DJAB 3T09A 3LHAA 3QFJB 1T6WA 1MXGA 3OKDB 1IAIH 2W9EH 1P7QD 3OAZK 4P04A 4X6CE 3U1SL 1UWXK 3K6SA 1CS6A 1WWBX 1TJIL 1TJMA 4ODHL 2J88L 2NUPB 4JFYB 4UIMA 1F5WA 2X4UB 4N0CC 4NOBA 5C7XL 3RJDA 2DYRB 1BQLL 4Y19A 5E5MA 1NCCL 1QATA 3QARA 4OTXL 3FB7B 2YD4A 3BGMB 2NSMA 3WFHB 3FONA 3QXDB 4UAOC 2BNQD 3BW9B 4XP9H 3RY4A 4ES8A 5I71B 3H2QA 5EO0B 4GG8A 1EEZA 3UAJD 1FLRL 3O8XA 2ZCLL 1HSAA 5KSVB 1GW6A 1KTKE 3FPXA 3V7AG 5B1JC 4BCXA 3UGXA 1IM9D 1SMOA 1DBMH 4JFQA 1HNFA 4LFHD 1X7SA 4LZKA 4A38A 1GKEA 4ZAKD 2HTKC 4OV5A 3HC0B 3G9VA 2WLIB 4KO5A 1AO7D 2OMWB 4LASL 5KSBE 4YR6A 2F2HA 1G7JB 3DX1A 4JPKL 4EOWL 4PGCA 1L9SA 1QLRA 1A4KA 5C0EA 5J6GB 4LEOA 1LEIA 1IRAY 1HI6B 3NZ8B 5I1JH 2AXGA 4G83A 5K39B 1ZMYA 4IKLA 2I7SA 1DR9A 3BMVA 3GI9L 1FZOB 2ODHA 2ZF9A 5EIIA 2YJQA 4MLIA 5ECJE 2QVIA 3DOHA 4PWIA 3E3QE 1EO8L 2DWEA 1MJ8L 2Q6WB 3LPWA 1MJJB 5AZEL 4BUHA 2XA8H 1CDJA 3JV4A 1JGLL 4B0MB 2CLVA 1E6JL 4ILDA 3MMEB 1S6NA 2EYSA 1G7QA 2WXRA 4M5TA 5CINH 4LOUD 1XB6A 4MZ2A 1BMGA 3B6SA 1I8AA 1EDHA 1G9ML 1HXKA 1QW8A 5F9WC 3NJHA 3TO4A 1C16A 2WTRA 1WFIA 4LDEB 3K6SB 4G43A 3U30C 1IFHL 3BZEA 3GNMH 1X9RA 2NYYC 2EDHA 3PUCA 4UIMB 4KQ3H 3Q8BA 3SB3A 1OSEA 4P3CH 1FH2A 1O7DC 3N9GL 4YHIA 1DSYA 1QSZA 4Y19B 5E5MB 3CXDL 1DEDA 4CL7A 2WINA 3FONB 1G7PA 5GZNC 2H6UA 3QIWD 2XG5A 2ROYA 4HFUL 4GG8B 1EEZB 4JW3A 2Z3FA 1INDH 3O8XB 4A7GA 4MCYA 3GRWL 5E1HB 1HSAB 5LDSA 4HU8A 4HIQA 3NJGA 1A14H 1ZOXA 4CAGA 3L17A 3ALWA 3WAJA 4MMYA 5C08E 5HYJA 5IBLC 4JFQB 4JL2A 5JUEL 1REIA 2X6AA 2J8OA 1F6LL 5INDA 4OV5B 2BMKA 5EMYA 4YR6B 1A7OH 4KTGA 2DQEL 4K3EH 5I9QB 4PGCB 1QLRB 5C0EB 1A4KB 1KACB 5CEZH 1BPVA 4L9LA 3PP3K 4LEOB 5AFAA 1LEIB 2XN1A 3UDWA 3UG5A 4D9LL 3T8XA 1WH0A 2AXGB 4P9MH 2Y72A 4WI0A 3V0VA 3MXWL 1FYTE 3CZUB 4V2BA 3S35H 3LKPA 2KUTA 3TJHC 3GHBH 2QFPA 2UWEF 3E6FA 3QORA 1OCRB 5EIIB 2Q8AL 4ZQKA 4AMKH 4A7QA 5KBNC 1QWNA 2A9MH 2OZ4H 3AROA 4NHCH 2BS8A 2DWEB 2PYEA 1BXAA 1L3NA 1D6VH 4IRJD 4ZYKA 1K3IA 3VWJD 3JV4B 1U33A 3JZ7A 2DEYX 4MBRA 2CLVB 1PY4A 3F58L 4MXQC 2EYSB 4KXZH 1KOAA 1G7QB 2PW2A 2WZAA 3B6SB 3QO0A 3TO4B 2QL1A 4KFZC 5TDNB 1JPGA 1C16B 2WTRB 5TQ0H 4KMTH 4G43B 3BZEB 4KI5D 2XU9A 1J9QA 2F9BT 3WNIA 4B9CA 2DH3A 4YHIB 4JPVH 5IFAH 3M88A 4AJWA 3WNPA 2HPOA 3DHPA 2WINB 1G7PB 2EDBA 4LLDA 4TNVK 4Y4FD 3TV8A 2XG5B 4DGUA 3KJ4C 4WO4C 2F7QA 4N0YH 4KPHH 2ITDA 1S9VA 4P07A 2NYKA 2F7IA 4MCYB 2BSBA 4XHQA 5HTSA 4D94A 3NQKA 2JIXA 2B20A 4NN7B 4MMYB 5HYJB 4L8SA 3NOIA 1WVZA 2VLJE 4ZMXA 1H8LA 2CNZA 1A3QA 2E5EA 3W2DH 1MFCH 3VX0A 2YA0A 4HALA 2PCFA 1ZTMA 5INDB 2BMKB 2F15A 5F88A 3VXRD 1LK2A 2X53A 1FUNA 3A23A 4IBQA 2Y7MA 3ZE2B 3MLYH 4L9LB 4M7KH 2GY5A 1CU4L 1DJHA 4D3CL 2DWXA 2GITA 3T8XB 3ULVC 3FYEB 4WI0B 5F6IB 3V0VB 1T7XA 3T3PF 3X1GA 1PLGH 2H5UA 3LKPB 3E6FB 1X5HA 3QORB 4AQOA 3QYCA 4ZQKB 4ZMLA 3PG2A 4H8WC 4HMCA 2PYEB 1IEBA 3FCUB 4K7PL 4XBPA 3WXVL 4OR1A 4JY5H 4ENEC 2G60L 1CD1A 4ZYKB 1UCTA 3ARSA 1BBJA 2PW2B 3QO0B 3WEBA 3F7LA 1PNDA 1JPGB 2GB2A 1D9KD 1PZ2A 3GBNH 3RP1A 2F6AA 3JSSA 1BCIA 2NY2D 4PSRA 5GJSL 5GSRA 1FH5L 1TEFA 5IESL 5CEZD 1CF1A 5DEZA 1MCKA 1WGOA 4EDWH 5AWNH 1KCWA 1CLYL 2Y3NA 3OF6A 3B7SA 3HG3A 4LLDB 3N43B 3QWQB 4EZMA 5FDWA 1R9FA 2OP4H 1S9VB 4B9ZA 2E7LA 1GSMA 2MPAH 4ZO8A 1NCHA 5EOTA 3ZGHA 2JIXB 1E4WL 4NAJA 1EPFA 4RFNB 3BDYH 2WYZA 1DQTA 4CGTA 3BD4A 2D9QB 3TURA 4L8SB 2F1BA 4QRPD 2WANA 5L4JA 3ARXA 2OK0L 3O3EA 1MZZA 4QXTA 3P0YH 2NCEA 1X5LA 3F83A 3H9HA 2QLYA 2PCFB 3LAFA 3DJTA 2JCWA 1U8HA 2C5DC 3IMWA 4GAGH 5F88B 1LK2B 3RWIA 3APCA 3GO1L 5D96B 4PJBE 1MLCA 2C9SA 5C07E 1E4XL 2OMBA 1MFMA 3O6KL 4Y2DC 4L2LA 4XCYA 2GITB 4KV5E 1ZKAA 4ZXBC 1UXSA 3BQUD 3QIUC 5JIKA 3VXSA 3HFML 1OGAA 4UM9D 1JS4A 4YQXH 1Z5LA 4IRZH 3QXUA 4UTBL 4Z7UE 3T2NH 3VVVA 2AK4A 2C26A 4JO2L 1IEBB 1JCKA 4XBPB 1WZKA 1CD1B 2AEPL 3IU3A 5EF0A 5ABZA 2ZX9A 5B38A 2V33A 1Q4NX 2QADC 2YARA 2G30A 5I8OL 4PMEA 1D5IH 4KVNH 1BBJB 2OI9B 1J5IA 1FNSL 1NMBH 1FNGA 4X8CA 3ALPA 4IOSD 3E0GA 2J4WH 4LSRH 1GOFA 5GSRB 4CU7A 1KYFA 2WV3A 5DYOA 3HBZA 4P23C 2CJUH 4KZCA 4F93B 4N6RA 1JZ3A 1G1CA 4DKDC 4L4TD 4Z9KB 1JF5A 1XSIA 5CN1A 8PAZA 3HKZA 2PTUA 2AVGA 1N5AA 2O6PA 3R8BB 2HH0H 3FO1A 4UT9L 3TN0C 2YWZA 4BH7A 5FDWB 3IVKA 4J8QA 1KCUL 3IDGA 3M45A 5GZOD 4R4NC 5EOTB 3VSVA 4PHZA 4RMQA 2DKUA 1BAFL 5CEXA 3UBXG 3IU4L 4K94H 5DMIH 4G80A 2KZ1B 5KBLA 3P0VH 3O3EB 4KVCH 4QXTB 1OAYL 3FMGL 3H9HB 4FNPA 4D9QD 3CPLA 1JDAA 1U8HB 1RZKC 4EEEA 2DWTA 2L7QA 2XG4A 3RWIB 4OLZH 2ATKA 1EHLH 4G3YL 1MLCB 1F3JA 1N7ML 1EVUA 4RISH 5D6DA 1PBYA 4XCYB 2CCVA 1DVFD 3BEWA 1N4XL 4BFKA 5I0DA 5JQHC 2XV0A 3E7JA 1UXSB 2X4OA 3VXSB 1XH3A 2D3VA 3ZR6A 1HZKA 1F4XH 1FJ1A 1MIEL 1OGAB 3PNRB 3WDHA 4AI7A 2WKOF 1Z5LB 4PHXA 1MFUA 3QYNA 2RALA 2EKJA 5C0CA 4LDOB 2BSSA 3FQTA 2AK4B 3QH3A 3IU3B 1AGDA 5KYXA 3A6CL 5B38B 3UTPD 1BPLB 1RJLA 3FBQA 1I85A 4TL5A 1KUMA 5FKPA 5I1HL 1FNGB 1BVLA 1HL5A 3MLXL 4KK8D 1NGYA 3F3HA 4MD0A 4RLDA 3WYRA 3V0IA 1JYWA 4AYSA 1DVQA 3FTSA 4YDKL 5DYOB 2A1WL 2VZVA 4N6RB 1L9TA 5GHWL 4OV6F 3WTWA 4HCRA 2UY6A 1N5AB 3O6FA 4GUOA 3FO1B 3O8XD 4BH7B 5J9PA 3IVKB 1P4BL 3FOMA 3IDGB 1ORSA 4G6KH 4PRHE 3OR7A 5I6MA 1BWWA 1PJ9A 1XFPA 3A47A 3BVDB 4NAQA 5FYKE 4K55A 3ZZ1A 4DHLA 5CEXB 1JHLH 2P43B 5CLWA 3FFOA 1RLBA 2OL3A 3ZL1A 2F53D 3AREC 3SJVE 4G80B 5GXBB 2R83A 1KFAH 3QZLA 5I0ZA 4FXGC 4TUKH 2ATAA 5D2LF 3BSZA 5T5NF 1UFUA 3IT8D 1JXJA 3CPLB 4JKLA 2XG4B 1HNGA 2NY4C 1SVZA 2ATKB 4O02A 3MV01 5I5JA 4B7LA 1U21A 1ZLSL 1F3JB 3JT0A 5E6ID 3BEWB 2J25A 3B7UX 4GKZA 3L3GA 4HLZG 1F4HA 1HYRC 4P8QA 3U6RA 1JGVL 2X4OB 1XH3B 4JHWH 2HFEA 4LAJH 3OQRA 1FJ1B 4FLSA 4KRPC 3OXRA 5ITBL 5C0CB 3JT2A 1EV2E 2A77L 4ACPA 5IUCA 1P9MA 2BSSB 3FQTB 4PCKA 1AD9A 3PHAA 3V0WL 3QH3B 4EIBA 2B5IB 1AGDB 3NN8A 5KYXB 3VH8B 2J57A 1RJLB 4FYQA 4X5WA 4XPAH 3G5ZA 3TO4D 5JA8B 4P5TD 5FKPB 2NUTA 5H37A 1BVLB 1DP0A 4FFVC 4PJ5A 1NGYB 2EKSA 4MD0B 4Q6IA 4HIXH 1K8IA 1YZZA 4R8WL 5FXCH 1FF5A 2RB8A 4NEHB 4CVXA 4TLKA 3O0LA 4FXKC 4XRCA 1OGPA 2D03L 5T3ZL 3ZY7A 4NN6C 4TOYL 5FUCE 3HNVH 1RULL 2UY6B 2D3LA 4LT7A 3O6FB 3OX8A 4MA1C 1A66A 5J9PB 4R96A 4O5LL 2FWLB 2OJZH 3FOMB 4EIZC 1ORSB 3UC2A 3CFBA 3VFSA 1NCWH 5EU7C 3OR7B 3E80A 2NPLX 2XSKA 4RGMC 5HYJD 4UV4H 5JA9A 1H3UA 2X4NA 3MOBL 3QPQC 4GAJL 4HS3A 4JB9H 4YJZL 4BDVA 2OL3B 2NNRA 3IPEA 2EO1A 2L8AA 1B0IA 3VI4F 5D2NE 2DQTL 4R83A 3HMXA 4HJ0D 4JM4H 4IBLT 1HKFA 4ISVA 5EIQA 1T5XA 4O02B 1SM3L 3DGCR 4MJIE 4RGNE 3WY3A 3MRPA 3QUXD 3QS2A 5HHPA 4GKZB 3L3GB 1WFNA 2BFGA 3GLEA 3U6RB 3QORD 2HFEB 2ZXDA 3OXRB 2V17L 4XP4L 1VF5C 4E9TA 3CSTA 4W93A 1T0OA 4KJWC 4FCHA 1AD9B 3DGGA 1ID5I 3BO8A 3RJQB 4G7QB 3NN8B 2I69A 2K9FB 1J0ZA 5IHHA 1OF0A 4X5WB 5DHMC 2FX8L 4HPYL 3G5ZB 2NUTB 4B5ZA 1WP6A 4AXWA 4PJ5B 3RNKA 2EKSB 2VM4A 4Q6IB 4YBLB 1K8IB 1NGWA 3OHMB 1MRFH 4F57L 4WEBL 4GMSL 2VZOA 2NMSA 3EH5B 3IJ9A 4S1SH 3E8UH 5D7IF 4TQ8A 3WJMA 4CVXB 4DESA 1FAKT 2E7CA 3FFDA 4XRCB 5FS5A 3WD5H 3HC4L 2RQ8A 5CJQH 1AS8A 3AC0A 4WFGE 4YSAA 1A65A 3OX8B 2F8OA 2VDPH 5G2NA 3CX5K 4R96B 4MQ7A 2V8LA 3NCWA 5DF0A 4G5ZH 2C3VA 3CFBB 5AVXB 3VFSB 1M9SA 5JW3H 4ZRGA 3KH3A 4MBOA 4UDTA 4BFNA 5BZDA 2X4NB 3KLSA 4HS3B 5SWZD 2Q87A 2AS5M 3NDZE 4BDVB 1R6VA 1G94A 4YDLC 1ICTA 5E4AA 4HAFA 4Z7OE 2WQUA 1UGNA 4UOQA 1YNTA 1TEGA 4QRSA 2R0LL 3V4VL 2ICEC 1W8OA 3QAZC 4ISVB 4HPOL 4XP6L 1M3IA 1T5XB 3OG4B 3TEZA 4JAMA 1A3ZA 3MRPB 1LWHA 2C3HA 5HHPB 4QJ4B 1W72H 5I8CA 5E8DL 3RVTD 3NTCL 1RP8A 5LNGA 2K8QA 2X3BA 1EMTH 3LZNA 2IG2H 1CK0L 3J7HA 3ZKXC 4YK4B 5E5LA 1HXMA 1A21A 4JQVC 4A2HA 4KO9A 3MNDA 3BH4A 4AQ1C 3DGGB 4OBRA 5IP4A 5JHBA 3BO8B 3I85A 4X80L 1T4WA 1L9OA 4XMKH 2X6VA 4G8GE 4FQIL 4A2MA 4BZ2H 2NY3C 2OCFD 4BGLA 4AXWB 1N6QH 4MJ5A 4GOSA 4KO7A 2XFGB 3RNKB 1NGWB 3RPKA 1KG0A 3G5YA 3ARZA 5IWLA 3WJMB 3C6LD 3FFDB 1B0WA 4BD4A 4NUMA 4Z3GA 3KPRD 4AM0Q 2DN7A 1TVHA 1PZ5A 5K93A 3EGXA 4M5YH 4U2YA 3SZ6A 2KC0A 1DQIA 3GMPA 4GKNB 1OE3A 2VRQA 4OLYL 4FOMA 4MQ7B 1UEYA 2DIAA 2VR6A 5GGTL 2C3VB 5JNYA 5BVJA 1MRDL 1R5IA 1ULVA 5B3JE 2IIJA 2QEJA 3RUGE 1CXKA 1VEMA 3LZLA 4H1LG 4W9LC 4U4BA 1HOCA 4UDTB 5BZDB 4X42A 4XBEL 1PY9A 4PWJA 3CMGA 1OANA 1WICA 4IBUA 3WELA 3QNFA 5IMOA 5ANHA 2Z7ZA 1AR2A 1YNTB 2IQ9H 4QRSB 2HWZL 1ECZA 2RTTA 4OF6A 1SPDA 1NBVH 1YYCA 2PP8A 2XC8A 1AR1D 3FQUA 3GZQA 4K9EL 2VDQL 1DLHA 4JAMB 3N44F 4GG6F 5I8CB 1Y18A 2UVFA 1EBAA 3CFCH 2AITA 3T2OA 4X83A 1F8TL 3HJ0A 1U0QA 5AVSB 1HXMB 1XGYH 2AK4D 3OMAB 5FM4A 5I18L 2PO6A 4GW4A 5IB2A 1O0VA 3GMRA 4PJGF 3S34H 3EXJA 2LOEA 2NT0A 4DUVA 5DGRA 5HYIA 3N50A 2G9HA 2QSTA 4NP9A 3BSZH 3QE5A 3IS1X 3MYZA 1N0XH 3DVFA 4YHYB 5I17A 4MJ5B 3AGVA 4W6XB 2XI9A 4O02H 4XCCL 1OCZB 5J8OA 1KG0B 3G5YB 3GSOA 1LTXA 3TYGH 2QGCA 1CZ8L 2X12A 4JKPH 1I3GL 1D5RA 4YDJA 2JWYA 4KKNA 4CADA 1JK9A 1TVHB 1PZ5B 2RMNA 3EGXB 4NQDD 2BS9A 4YHKL 3GMPB 3OD3A 1Q1JL 4H8VA 5HDBB 5JNYB 5BVJB 3Q05A 2C4FU 2ETWA 2HRHA 4RBPK 2P9RA 1R5IB 3HC3L 1HOCB 4ANXA 4KY1L 1IBHA 4P05A 3AM8C 3WTSA 4F91B 2DQDL 3FZUD 4TQEH 5IMOB 2I5YL 3L9EA 2VW6A 4OCSL 3GBMH 5FK9A 3L4CA 3QISA 3S4SG 3QDMD 4UNVA 3FQUB 4HIJA 1CLVA 3UZQA 5I28A 3GFUA 4F2FA 1DLHB 4AUUA 4D0BA 3ECQA 1BEYH 1Y18B 3TCLA 3T0AA 2AJZA 1XAKA 1OTSC 5GRJL 2OXHA 5EPMA 5C0CD 3ARYA 4NWUH 2PW1A 3DYOA 4BFGA 3OB8A 3UH8A 5K9JH 1KY7A 3RUGF 2PO6B 4GW4B 2B39A 4FG6C 5IB2B 3GMRB 4M48H 4PTUA 4OD3L 3ROLA 3RGVC 4NZ8A 5K9QG 4BRVA 1QFWI 2DQJL 4J3OC 1JZEA 1A4CA 1IVLA 3QR2A 2G9HB 5DDHA 3QJHA 4DN4L 12E8H 2BOBA 3LRKA 4X7TA 1FFRA 4PS4L 4M4PA 3DVNA 1UKSA 4YL4A 3RJOA 3HMXH 5I17B 1PEZA 3VYOA 3VXQA 3OC8A 3GSOB 4M43H 4KJQD 1DQDH 5HYQA 1BD2E 1K4DA 5F7LB 1I1CA 4JFZH 4EIUA 3BUDA 2OSXA 4BELD 4ELMA 1NC2A 4YDJB 4CADB 1JK9B 1NCJA 3K1DA 3MBXL 4IW4C 1WF5A 3OPUA 4OLUL 1IQDA 3C2AH 4AM0A 2D7PA 2ZKMX 4YSOA 3NRPA 2YD2A 1KC5H 2VN4A 3BKJL 4PG2A 4XT1C 5TE6H 2EP6A 3S5ZA 3RWEA 3LS5H 4UNTA 2WB7A 3TS8A 3GM0A 2R2BA 2VN7A 3B2VH 1E28A 2DB8A 4H0HB 4FHKA 2QHRL 3F7YA 3OMNB 4GQQA 2MCG1 3RVXD 1QKZL 3MCLL 3EDFA 3CVHH 4PQXA 4NRYA 5FK9B 2FWSA 5I6NA 1H3GA 1U3HC 3ABLB 1RJZA 5JPMA 4MB5A 3Q2WA 3C8DA 4RMSA 1YNLL 4HIJB 3QEQE 4N2KA 1Q72L 3MBED 4NC2B 3UZQB 3FSAA 1A7QL 2OTUA 4ODTH 3U0WL 1MCFA 1VESA 3FC8A 3HS9A 2E4FA 1E5ZA 2AJZB 3PV6A 3TCLB 3RHWF 3TBTA 2OXHB 3B9KC 1WV7T 3KPNA 5EPMB 1KB9K 5LUMA 2PW1B 3WEAA 4YHLL 2YAEA 3ES6A 5E70A 3GIVA 1LGVA 2BWQA 4WW1A 1DDTA 2YQ3A 1CUOA 4PSPA 4PTUB 2F68X 4WI6A 3ROLB 1WT5A 4MA8L 5F96L 2HX9A 2HP4A 4CC4C 1XF3A 5EF3A 2X2HA 3CLWA 1QR4A 1GS6X 4P59H 4R7DA 5DDHB 5KJRH 3QJHB 4KTDL 4MMZA 2BOBB 4LSSL 4X7TB 4NZUH 4PJ5D 3CFKA 3Q8FA 3DVNB 4WTZA 3WE6A 4G5AA 3KBFA 2H6OA 2CRZA 4KK9C 1JYNA 4XCNA 5DHVA 3VXQB 5DFWH 3VNYA 2G5RA 1MCWM 1G87A 3UROR 5HYQB 1K4DB 3KLHD 4ELMB 3RU8L 2Y9RT 1NC2B 1UFGA 2E7BA 1R0AH 1XCTA 4NQEA 3RWCA 3TJPA 1KLGA 3FQ1A 3VDCA 1IQDB 2Z1KA 5GS0H 4AM0B 1IU1A 4KHXL 4HWZA 3J8F7 4PJ9C 1O7DE 1T03H 3RVUD 3RVVC 3RWEB 1MI5E 4MD5A 4WKZA 1WRFA 3O81A 4WFFE 5HVHB 2ICWI 5HDQL 4Q8BA 4YSDA 4M6AA 5DRWA 5AW2B 5A2AA 2C34A 2R2BB 3BE1H 1E28B 1N6UA 3D34A 4XBMA 1OGTA 3U0TA 3FQNA 4AMXA 3F7YB 5I66A 3KWTA 1F4WL 2Y24A 1TVDA 4R9HA 2NNCA 4NRYB 1UKTA 3FU7A 2HKAA 1RJZB 5JPMB 3MC0A 1CL7I 4JQIA 2MTAA 3AT0A 4HPHA 2XWCA 4H8WL 1LHZA 3P30H 2XCMC 2OTUB 5FPIA 4YIQA 5IT2L 4XB7A 1GZPA 2FAUA 3QJXA 2MOGA 3PV6B 2YGQA 4NRXA 3TBTB 3KPNB 1ZGLM 1MW3A 2R7EA 3BAEL 3B9DA 1NAKL 4P57A 5IMMA 5JIIA 2F54E 3ES6B 5FF6A 3GIVB 1DUYA 1HWHB 1OAZH 2W1NA 3IJSA 4S2SA 4WW1B 2NQ3A 1P7HL 3NCYP 2AI0H 4FLHA 2IV9A 3NJMA 5IJKC 1CDGA 4DQOL 1H8OA 1XF3B 5LLIC 4YSQA 4R7DB 4XXWA 4MNGE 3CFKB 3WE6B 5MHSE 4Q52A 4PW4A 1J9SA 4I3SL 5KTEH 5F1IA 5GGVY 4XCNB 5DHVB 1MQKH 4N8VA 3ULUE 5I76A 2WZPA 4R97C 5DD0H 4PYGA 3QHZH 5DT1L 4QTHA 1I3VA 4UBDD 4LEXL 1XCTB 4NQEB 3RWCB 3JTTA 4ZAKC 1KLGB 5FEBA 4E9YA 3H3BC 4U6VL 4HWZB 4LVOB 1Z9NA 4KX8A 2VLRA 5HHME 3IRPX 4OSUH 3ARBC 4MD5B 2VZ3A 2PCYA 4QHLA 4WKZB 5BXFA 1BXVA 4PY8J 1MFBL 4OI9A 5DRWB 2J2ZA 4XWGH 3TONA 3U0TB 1OGTB 5HYSG 3FQNB 3TO2A 4BKLA 3S97C 5I66B 1QPKA 3A67L 3GXPA 3P4LA 4JM2D 4HOXA 2ZPKH 4Z3IA 5AG8A 2IXQA 3JWNG 4JFDE 3QCVH 1M9WA 1DE4A 3FQ4A 2W0LA 4LOUC 1U8IA 3QDGA 2WLNA 3NAAL 3HBGA 4JFWA 4YIQB 1GZPB 2CU9A 3L4ZA 1CF8L 4NRXB 2MCPH 2Z31A 1PKQE 2GSGA 5KVMC 1QWHA 2R7EB 4XO3A 5GS0D 4P57B 5IMMB 3FFCE 5B7FA 1E5UI 4PJCE 5FF6B 4M7LH 3V5DA 1DUYB 3IJSB 4JFTA 4S2SB 1HZHH 3N0PB 3ULVE 1V27A 5GJTH 3QIWC 2WB1A 4Y9BA 5KS9A 3PXHA 3B5HA 1EHKB 2HRPH 1SEQH 1YN6A 2R2CA 4YDVA 1WBYA 3T3MF 4LSQL 3N0AA 4HT1L 2X10A 3VA6A 1HHIA 2HFFA 5F1IB 4B9PA 2J1KA 3UZEA 4N8VB 5H94A 5I76B 3FTYA 1Y6KR 3BN9D 3LIZA 2HFGH 4HH8A 5C9JA 5DVKA 4QTHB 3MLZL 4LU5L 2DLFH 3JTTB 4JRYA 5DUPH 4XX1G 3VD5A 2ICES 1BYPA 4XXCC 1SXSA 2VLRB 2H41A 1NDMA 2W38A 4QHLB 3WJLA 2AEQH 5BXFB 1ROWA 1RZKL 1IKOP 1TTGA 2O6DA 1XGPA 1Q9WA 4FLQA 3CU1A 3RFRA 3VD1A 1YAIA 2J2ZB 1S3KL 1W0WA 1AMXA 4BKLB 3TO2B 1PIFA 4NYLA 2B4CH 2ZICA 4HD5A 1IQWL 5E95B 3ULUF 2VDLL 3KLDA 3VWJC 2IXQB 4H88L 2ZWNA 1G84A 2YGNA 1DE4B 2BDNH 2QQLL 1TG8A 2D0GA 1RI8A 1U8IB 3QDGB 4YE4H 2EC9T 2P5WD 5KBDA 4FZ8L 1S7SA 2VYRE 4KI5C 2Z31B 1UZ6F 4YFLI 5D1ZA 3SCMC 3V4PA 2C1OA 2GSGB 3PABA 1GY2A 2PO6D 5DZLA 4Q0XL 1XSKA 1Y07A 2EH8H 3V5DB 3WUZA 3ARDA 3UMTA 2IWGA 3PJLA 1Q1PA 5JIHA 4MA7H 2P80A 1USQA 2MSPA 3IFLH 4Y4FC 1SMDA 1V55B 5KS9B 2GHWB 3PPSA 1K2DA 2KLRA 1ZT4A 5AVZB 2CK0H 2Q7AA 5BQDA 1YN6B 4YDVB 1WBYB 3O6LL 4Q56A 3VFOA 1HHIB 1KLFA 2HFFB 4YZFE 1QFWL 3QR0A 3GGWA 2FB4L 3LRMA 7FABH 3WXWH 5H94B 1CCZA 4OFYD 1ZGLP 3CLFL 3WL9A 5I30H 4NBZB 3AT8A 2CRMA 5C9JB 3LIUA 3VD4A 5FW8A 4Y1AA 4JRYB 1CYGA 4U4IA 3D51A 3U7AA 3KYNA 3WENA 3ESVF 2HXAA 1FE8L 1ET5A 2IGFH 2Z9TA 4P3DA 5DQJA 5E9DE 4KC3B 2XIIA 3ULVF 1NDMB 1R75A 1IT9L 2EIEA 3H2WA 2B1HL 1UG9A 1Q9WB 1XGPB 5IROA 4FI6A 2YFOA 4XMTA 1W0WB 5D1XD 4FNUA 5HD8C 2ZF8A 4NYLB 1H6EA 4NSKA 4WSKA 1N9PA 1T0PB 2I85A 1DVUA 4AQ8C 5IGXL 5J57B 4Y2OA 5BRQA 1CFNA 3S5YA 5BV7C 2GABA 3FOLA 3KYKL 3V6ZA 4D8PA 2QPUA 1IX2A 5I1KL 4RFOH 3LN4A 3JUZA 4M9PA 4PRAA 3MYJA 3IYLW 1FYHB 1S7SB 1LK3L 3V4PB 2NY2C 2ZYIA 5D1ZB 4Z7NE 3I50H 1LLAA 1U58B 2C1OB 3PABB 5T8IA 1C08A 1GXEA 5DS1A 4YGVA 4HD9A 3DMMA 5AW4B 5AB2A 1MNUH 4UTAL 3CH1A 3ARDB 1T66D 3QHFH 5C09E 2VDNB 1JI1A 4ZTEA 1A6VH 2HA1A 3Q5OA 2XV2A 2HLAA 3NA4A 1AG0A 1CLZL 1F56A 1TNNA 5IW1A 3LRGA 1K2DB 4M02A 1ZT4B 2R0ZL 1GGIH 5FGRA 3ZW3A 2ZUWA 1ZJAA 4GXVL 2WKGA 3VFOB 1U4FA 1KLFB 5EOCH 3GGWB 5D7SH 4YDMA 3VE0A 3QJQB 3NA9H 1QRNA 2P1YA 4W1TA 3WL9B 1NC2D 3W39A 1EGJA 2CG9X 1KN2H 2OA9A 4MZ3A 4UQ2A 4Y1AB 4KKPA 2C9QA 4AZUA 3JBG7 2BNRE 3KYNB 1VFMA 3U2JA 2D9CA 1MHHA 4P3DB 5DQJB 1AQKH 3HG0A 3EJSA 4QHUA 2YRZA 3SKJH 1GHFH 3QIBD 3E2HB 3BQUC 4BHUA 4HOMA 1MJUL 3DLQR 1TZ8A 3TTSA 2RBLA 4BEIA 4BKSC 4NSKB 4W9JC 4YZFF 2EXSA 4FQJL 2W9DL 3G6JF 4Y2OB 3F62A 5F0LB 4F1ZA 1CFNB 2JJTC 3NEEA 3I3DA 3FOLB 3V6ZB 4FG4A 1FNEA 4D8PB 4DTGL 1CXFA 3RX9A 2Z92A 3WJJC 1KN4H 3LN4B 4I18C 5HHVH 1UM5H 2J8UE 5IZ7A 4PRAB 5T5FL 1OHZA 4M6NH 3MYJB 4YPGA 2JELL 4U3XA 2WWNA 4HKXA 1VCBC 1MVFA 4OJDH 5DR5L 1A6UH 3KPQA 2QLVB 1C08B 5CU5A 1CL7L 2ZCZA 4YGVB 2YMOA 3DMMB 4U0RB 5KANI 2FLRT 4P48A 1T89A 3CIQA 2X0WA 2H0PA 4EE2A 5I71C 2AJXH 1S46A 4P46D 2QHLA 4R6UA 5IW1B 4N24A 4HP5A 5GZOC 1SHWA 2I7OA 3BUQA 5A1AA 3BVVA 4XVJL 5EB9A 2WUCH 4ODVL 4G7SB 3UJTH 3VTTA 1V3MA 4FFYL 3VE0B 1M3JA 4NRZA 4IK7A 5D7EA 5DMGD 1QRNB 4JDEA 3CWGA 3W39B 4UWQB 1FZJA 4LL1A 4NQED 2IPTH 4OJAA 3M1CA 2VWEE 1NOFA 4UQ2B 1HJCA 1MW1A 3BCFA 2F58L 1RZJH 5HI3D 1L0YA 4GKSA 4L3FA 3T9WA 3TU6A 2EVGA 2BP0A 4YNYA 4L5FH 4ICXA 4NM4L 4GQPH 4KQ4L 1WHPA 4W9FC 1BMWA 1GA2A 1MHHB 3DXAA 2H2PD 4PJFE 3OGOE 5IW3A 4QHUB 1SBSL 2UXVA 4DKEL 1DVFC 2ALWA 2K4WA 1E67A 2DD8L 3CDFA 2R69L 1CB4A 2UUDH 4N1EA 3V9EA 3ZU8A 2MIZA 3NZHL 2IPUG 1AXSA 3GMNA 3JV0A 4APXA 2IDUA 4L1HA 4AKOA 1BFVH 5T3XE 3DIDA 4ZFGL 5IB5A 1JZIA 3DVIA 3LIZH 5F7UA 4XPBL 3VI3E 2ZUVA 1QABA 1FNEB 4OH2A 2Z92B 1LVEA 2FO1A 5GPRA 2KLTA 1CYXA 1OY3B 3CK0H 5E9AA 3N06B 4NQCD 2Y0SA 2DM7A 2V5SA 3PQYA 3QG7H 4G9DA 4KK8C 4OQTL 3K4DA 4S1RL 4HKXB 4IHBA 4YPGB 3TV3H 5F9OH 1K9TA 1KJ2L 3NPZB 3KPQB 3QWOA 2VZSA 3SBPA 4EI0A 4FQXA 3IDIA 5I8EA 4CDHA 1YY9C 3MREA 1V7MH 1S9WA 5E08L 1ZEAH 3ZKND 4ZMZA 4C8XA 4X7FC 3LNHA 3O8XC 2ICCA 2GI7A 2Z6FA 1I9RH 4W9HC 4N2GA 4M62L 2OAAA 4LSUH 2CGRH 3VGGA 2Y3AA 2X3CA 5JYLA 3AWEA 1QTSA 2XWXA 3ML9A 5D5ME 1EZLA 2WZPD 2YUWA 4NRZB 5CGBA 3R7QA 2J8UF 4JDEB 1GR7A 4H8UA 4QT5A 1FZJB 1L9RA 1NCUA 1RD6A 2IFGA 3V4PH 2VXQH 4UOW1 4PRPD 4ZFFB 4GKSB 4FS0A 2BP0B 4G2AA 4YNYB 5I9QC 3I6LE 4XMWA 4FNQA 4DKAA 3HTLX 4I1NB 5F7MC 1VFBA 2VDNH 4FTDA 4U2ZA 3DXAB 1O6VA 1X7TA 5GS2H 1NL0L 4OZIA 3GIZH 4PREA 3NACH 4JO1H 3CDCA 3WE1A 4XNZC 1AXSB 3Q06A 1DQML 2BC4A 3I84A 4OCRH 3H42L 1HCYA 1E8YA 2YAPA 3BSHA 1TQUA 2ZONA 3GMNB 3QJRB 4KROB 4PEEA 5D8JL 4APXB 5BRZE 3L4WA 3M17A 4DQAA 2CKBA 4JZNA 3NJNA 2VXSL 5F71A 3PRZA 5IB5B 3UTTA 1NC4A 5I0VA 1NGPH 4UOZA 1JAEA 3MU3A 3TO4C 2VDKH 1B4JL 3AQXA 1NH6A 2VM9A 4I88A 3M8OL 4P2RB 4G9DB 3PQYB 2DQCL 4JG1H 3EG9A 2YUZA 4IBSA 3BT2H 3QWOB 4PJFF 3WIIH 1IAII 4FQXB 3IDIB 5I8EB 1UA7A 3NEXA 2H3KA 2IWEA 4B3EA 5GGQL 1CGWA 1RFDH 1HN1A 3MREB 3RKDD 5SWSE 1S9WB 1QNZH 2OR9H 1MG3C 5F7YC 1X6LA 1WEJL 3VB9A 4J6RH 4LCIH 3NK4A 1IAMA 5JIMA 4NN7C 5LO7A 1XGTA 1J1XL 3V0DA 2Z7YA 2HKHH 1E4JA 2CIIA 3BZ4B 4OBSA 1TJIH 4D8OA 3T0EA 4HKBA 4XPHL 3ZE0E 4ZPVA 4EPSA 3S35X 1D6EA 1T2JA 4QT5B 1UOLA 3WSQL 4HBCL 1NQBA 4JRYD 1ASQA 4N2LA 5C7XH 2A74A 2NLJA 1BQLH 4LQ1A 4ENZA 1NCCH 4WVRA 4OTXH 3PAYA 3RB7A 4EZKA 1GTNA 1QFUH 3H0TA 4L9LC 2ITCA 1VFBB 4PRBA 1X5ZA 3UDWC 4IMKA 2WGXA 4O2EA 1QX1A 4PJIE 4OZIB 4PREB 5F6IC 1MREH 4U1MA 3QORC 2YD3A 1Y6NR 5H8DA 2BWDA 2BC4B 2G3MA 1ZY9A 4NCC2 4OIAA 5D7HA 4PIRF 3U4KA 1LDPH 3L95A 3PAZA 5FWQA 3M17B 1ZPLA 2CKBB 4JZNB 1MCBA 2E7MA 1EGJH 2BHYA 4LCWD 3UTTB 1NC4B 5C3TA 4XMVA 2E9WA 1BA9A 5T1KA 3RX5A 1ZVYA 2IPKA 3TBBA 3MRCA 1A9VA 2Y2TA 1MIML 2ZWKA 3Q0HA 2FYVA 4XOEA 2WBKA 4Q4EA 3UABA 5A3ID 2BHFA 5CEYA 2WBJD 2NCMA 4O51A 3EG9B 3MA7A 1DQLH 4ZSOE 1NLBH 3VXUE 2DRUA 3ARDD 4E9XA 4OUUA 2WXLA 2C9VA 2GEEA 2VDML 5DZPA 4N9GA 1L5GA 3NVQA 2P80D 2M1KA 4Z0BL 5GS2D 2O5XH 2VB5A 5HHXL 3GD1C 1MJ8H 1JF1A 6FABH 5DMKA 5AZEH 3EYSH 2ID5A 1NFDE 4M5ZH 4X6DE 1E6JH 3D52A 3DECA 1AIZA 4QMEA 1CTOA 2BRRL 4RFNC 4RRPM 1OT1A 1G9MH 4K23H 3P54A 1XGTB 2WQRA 1R17A 2VJ0A 4L8SC 3T4YA 1A7RL 2CIIB 3T0EB 3WG7B 5FM5O 4HKBB 2V3FA 1TYJA 4ZPVB 3ZUCA 1D6EB 2XV6B 4A7VA 2ZX7A 1S7UA 4OGXL 1OAXH 2OSLA 5E4OA 2A6KA 2A74B 2NLJB 1IKFL 1SMAA 4MCNA 3CXDH 2XRAL 4LMQI 5D96C 3H0TB 2ITCB 4PRBB 4HFUH 5IMLA 1KCKA 4LF3A 5IJDC 1RMFH 3L5WA 4IRSA 4O2EB 3EO9L 1S78D 3VRIA 3FUHA 3IS0X 3GRWH 3RVTC 4U1MB 1GIGL 5FYJU 3H7BA 5IROD 4P99A 3TOPA 4A67A 3BHBA 3P9WB 5K59E 5IOKA 5TQ2L 2R9HD 1NAMA 4OB5L 1TF4A 1T7WA 5AD0A 1IC5L 2VRKA 3QXWA 4Y1SA 3TH4T 3WO3B 3L95B 1IZKA 2I26N 3R18A 3UBXA 2WYIA 3SE9H 3S2CA 3H7LA 3ORJA 2OI9C 4FP8L 4GSRA 4IYKA 5T1KB 5IVXA 2IPKB 3MRCB 1TMQA 3LPPA 3MRHA 1KIQA 5CEYB 3RWFA 4O51B 1QSVA 5LXGH 4ONGL 3MA7B 2ZD0A 3DMMD 2YN5A 3GINA 3US9A 1MAMH 4OUUB 2PR4L 1PLBA 2AXHA 4GRWB 2DQHH 4N9GB 1YNKL 4FFWC 2IO5A 1XGUA 1OGSA 3KD4A 1L5GB 3WIHH 3IGLA 1E4HA 1KBPA 2EE9A 1H6FA 2ZKHH 5CZRA 2OYPA 4B27A 1JF1B 1HE8A 8CGTA 2RGSA 5DMKB 2XZQL 2E7LC 4GBXA 1B2WL 2GBAA 3F58H 3NIFB 1A25A 2C9RA 2I25N 2VUKA 5DURB 4YHZL 3ZT6A 3BN3B 1YQVH 3T4YB 2Q10A 2J1YA 3EDDA 4UQ9A 1QFWM 4UANA 4LLVA 1RZ7L 4N2BA 3ECWA 1S7UB 1UWFA 4DGYH 3PWNA 1A7NL 2EDKA 2DMBA 4OF3A 2OSLB 4X4ME 3WDIA 1FCCA 4LGRB 4L0YA 1T22A 1RP9A 2A6KB 3VD2A 5KSAA 3I9AA 2V7NA 4HSCX 2WCSA 3IDXH 4PJ6A 5IVZA 2X5PA 3FL7A 4DZ8A 1NCBH 2A0LD 3JVFC 4DEUA 1U8LA 5IMLB 3LEVH 4LF3B 3L5WB 1ZJBA 4IRSB 4AG4L 3UXFA 2APWA 1O6TA 2MFNA 4OZHE 4G8IA 3VRIB 1SXAA 4GO8A 1CFVL 3IGUA 4X6DF 3BHBB 2YGVA 1IC1A 4JFOA 1WAAE 5FKAA 1NAMB 3QQ9D 4QRFA 4P2QD 5AD0B 2DBLL 2ADYA 4N5EC 3WTYA 2APTA 4DUXA 3UBXB 4IDJL 5E6YA 5HI4D 1AH1A 1A47A 3IMRA 3K71A 4IM8A 2UXFA 1R3JA 5IVXB 1AGBA 4OJEH 2Z0BA 1II4E 2EDYA 4D2NA 4EDXA 3MRHB 2EC8A 4MA3B 2WXJA 1KIQB 3RWFB 5E00A 4D3CH 4YFLF 5D1QE 3D39A 4TLSA 4DPAX 1L0QA 3SE4A 1CXLA 2CLRA 1MSPA 4P0DA 1XEUA 2ZUQC 1XGUB 5A6LA 4AGLA 2WLLA 4YVNA 3C5XA 4G8EA 3L1OL 3F7QA 2X0VA 5KYUA 5E2VL 1ETB1 2DDQH 5DMYA 3KCWA 4JMNA 4GBXB 1EJ6A 2BHUA 1IBBA 1DEEA 2CKBH 4DVBA 3EJCA 1HL4A 2B0SL 4V1DE 5F93C 1QEWA 1RIHL 3QRLA 4LVHB 4O2FA 1CDYA 1JWSA 4AY0A 3U36A 4LLVB 3FZUC 4KDTA 4NIYE 3EOBA 4P2RA 4QKXB 3PWNB 2ARWA 1YY8A 1T22B 1KCRL 5CCHE 1JV5A 5KSAB 4GSXA 4GAAA 2V7NB 4JFHE 5IVZB 1CLYH 1WO2A 3SIKA 1Z9SA 1E0OB 5D6DC 4DZ8B 2WWOA 4Z3HA 3D8MA 2ZUYA 1U8LB 1KV3A 3ZDZB 4G8IB 3UEZA 5KVFL 4KHTL 1E4WH 5FGCB 4JHVA 4AKQA 1I7UA 2K70A 3L2NA 4JFOB 4LKXA 5FKAB 1C1EL 3QUZD 2X1PA 4KROD 1K5WA 3DC0A 3BX7C 4Z3TA 4J3OF 2B5IC 4TSBL 2NZ1A 4G1EA 3SGJA 3LZFH 2Q7NA 2OK0H 4YBQD 3RHWK 1I85C 4AQEA 3K71B 1GSKA 1R3JB 1U41A 1AGBB 2PNDA 1AZUA 1G43A 4P2RD 4EDXB 4QTFA 1YEGH 3RILA 2LVCA 3T8VA 5I19L 2ESVA 3O6KH 5E00B 1QWUA 3D39B 3F7KA 2LABA 3BPOB 3MV9A 4ERSH 4KJQC 2CLRB 5HHOA 3EYUL 2XY2A 3L54A 4GMTL 4CMMA 4UTBH 5IHLB 3O6FC 2JCCE 3CVDA 2WLLB 1DCLA 4G8EB 5KYUB 4K7PY 3NSJA 1KJMA 1KELL 2AEPH 2YD1A 4J3UA 4B9GA 1JXKA 4PUBH 4KNUA 5I8OH 3GSQA 1DEEB 4DVBB 1JJUA 4PGJA 1QHOA 3WY2A