5I6NA

Crystal structure of copper nitrite reductase at 100k after 11.73 mgy
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 94
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6nA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6nA02
2AANA 1L9OA 4P5SA 2IH9A 3ABMB 3H4HA 3X2QB 3CDZB 2XXGA 3GXUB 2AVFA 2BP8B 1SF5A 1GR7A 2XV3A 4YSQA 1SDDA 1KYAA 5B1KA 2H5UA 2GBAA 2PLTA 4UF7C 3KW7A 3IBOA 2FNWA 3UACA 2XX1A 2MTAA 4G7RB 4UAHA 1CC3A 2MRYA 3NJKA 1KDJA 1ZPUA 4KOCA 3U25A 3OMAB 3S3CB 4A66A 4YSSA 3SBQA 2BWDA 2UX6A 1AQ8A 4KNSA 3S8GB 5TK4A 1JZFA 3ABGA 2IWKA 1BXAA 4YSOA 4WKXA 4K9JA 2WO3B 3FT0A 3PAVA 1JZJA 1JZEA 1XB8A 1AS7A 5I6NA 2PPCA 3TASA 4TXVB 2N0MA 3EHBB 4HZ1A 3FU8A 2VW6A 4ENZA 2I7SA 3NYKA 2ZXWB 3T6VA 2J55A 1BEXA 3FU7B 2J57A 2BO0A 2DY2A 2I85A 3FQ2A 2PPDA 2RACA 3BVDB 2PPEA 4A2HA 1FA4A 3NSCA 2XU9A 2Y1AA 1GYCA 5D4JA 1ILUA 1AZBA 1A4CA 3NJHA 3X1FA 4BWTA 4FA7B 3ERXA 2AZUA 3SBPA 1OE1A 2PCFA 1WS8A 1ASQA 1OV8A 1J5DA 1NINA 4HIPA 4A2EA 1L9SA 1ZDQA 1SHWA 1M57B 2ZOOA 4KO6A 2J56A 3T6WA 2OCCB 1AACA 3V9EA 5LDUA 4DP4X 1NICA 6PAZA 1V55B 3FYEB 4GY4A 4YSAA 1V10A 4DP0X 3G5WA 2R7EA 3QPKA 2UXFA 1ETJA 4RH4A 1EZLA 4YSRA 1TKWA 2WO2B 2CJ3A 2YAMA 3T6ZA 3WI9A 5E9NA 1IBYA 2QDWA 1BQ5A 1GS7A 2FQEA 4F2EA 4DP8X 1NPJA 3MX0B 1BQRA 1KDIA 2CCWA 3GDCA 3UABA 1HAWA 1W6WA 4G7SB 3BQVA 1QNIA 4MFHA 2UXVA 1J9RA 4ZK8A 2DYRB 1WA0X 2XYBA 1T5KA 4DP1X 1RKRA 2X87A 2PPAA 3QQXA 1R1CA 2YAOA 1OE2A 3DKHA 2IDFA 1E5ZA 3OMNB 1ZIAA 2HRGA 1NDTA 4AI7A 2HX8A 4GP5B 3FSVA 1X9UA 3ZDWA 5I6MA 2HX7A 3X1NA 1NIEA 2CALA 1SFDA 3EF4A 2YAPA 3L45A 3ZX1A 4DPBX 1XB6A 1WA1X 2BP0B 2GSMB 2X88A 2YXVA 4BWUA 2LLNA 5D4HA 1AZRA 5PAZA 2VN3A 1J9TA 3CVCA 1NIFA 3NJIA 4KNTA 1W8EA 3T6XA 3NJMA 1A3ZA 3T9WA 1L9PA 1GW0A 4AX3A 3X1BA 3PPSA 2E86A 3WKPA 3AG1B 5B7MA 1VLXA 4YL4A 2IH8A 1AZCA 1PNDA 3AY2A 1GS8A 3CVBA 1PNCA 5IY5B 1J9SA 4G70B 3S3DB 1N68A 2P80A 2B3IA 2XV2A 3X1GA 4HCGA 3DIVA 4JHUA 3QJQB 3WNIA 4HHWA 3FQYA 2BWIA 3AG2B 1KBWA 1E67A 2GHZA 2VM4A 1FWXA 1PMYA 2FQDA 1FFTB 2CUAA 5I6PA 1SF3A 4DPCX 3JTBA 3ZBMA 3NSFA 3DTUB 4NAJA 1URIA 5I6OA 1QHQA 1ZV2A 1V54B 2FT7A 3FSAA 6PCYA 1F56A 2P80D 2BW5A 1PAZA 1ID2A 1A8ZA 3RYMA 2IWFA 2WSDA 1BYPA 1WAEA 2JFCA 3CVDA 1J9QA 2DV6A 1I53A 1N70A 3EH3B 1SDDB 3IE9A 4Q8BA 4G7QB 1PLBA 2FT6A 4GYBA 4EF3A 1OCZB 1GSKA 1A4BA 5B1JC 4FAAB 4AKQA 1XMEB 2I7OA 5AKRA 1ASOA 2AFNA 4F2FA 1OE3A 2XUWA 2H3XC 2XLLA 4KO5A 1E65A 1IC0A 9PCYA 1OCCB 1OF0A 1IUZA 1WS7A 2FJSA 1L9QA 3UGEA 2IWEA 2YQBA 3T71A 5A7EA 4PAZA 3TU6A 1A4AA 2PP7A 4DP5X 3IN2A 4UANA 4KO7A 1NWPA 1AIZA 1PCSA 5B1JA 4AZUA 3AW5A 1AZNA 1BQKA 2TSAA 2ZONA 3CDZA 3CZUB 1L9RA 4HAKA 4BDVA 2CAKA 3ABKB 3D12B 1KV7A 2FWLB 1E30A 2VW4A 2YAHA 3TBBA 3QJSB 2YXWA 2IDSA 2Q9OA 2BZ7A 2A3TA 3S3BB 2QT6A 3FU7A 3TBCA 1XB3A 3QJUB 1ET8A 3N2JA 3FQ1A 2YAFA 2PPFA 2Y69B 1SHXA 3PCYA 1DYZA 4HHGA 4NERA 1NIDA 2UXGA 2VMJA 2VM3A 3WIAA 2VW7A 1ET7A 1NZRA 1RZPA 5I28A 3GYRA 3PAUA 1OOWA 2BP8A 2QPEB 5D4IA 2FT8A 4BXSV 1RCYA 4E9WA 2XX0A 3H4FA 1HFUA 4M4RB 5F7AA 1AANA 2IDTA 4AKPA 3X1EA 2GC7C 2GC4C 4W1TA 1OCRB 1JXGA 1ZDSA 3OQRA 3WKQA 5I26A 1OCOB 3SBRA 3NJFA 1ADWA 1W6LA 5PCYA 2BW4A 4YSUA 1SFHA 1MZYA 3NJGA 4DP9X 4Q89A 1B3IA 1JERA 1YLBB 1TEGA 3NSYA 1AG0A 1PZCA 2OJ1A 5B3SB 3NJNA 1SJMA 5AFAA 5B7FA 3TA4D 3AZUA 3CG8A 4YSPA 4DPAX 1UATA 3SQRA 1TU2A 1QLEB 2PP8A 2PP9A 5I5JA 1IKOP 1KBVA 1PF3A 1HAUA 3UAEA 1CUOA 2HX9A 5I6LA 3FYIB 2GB2A 4YSTA 1JXFA 3PLYA 4YSEA 4YVUA 2VSMB 1PLAA 1J5CA 4BWWA 3QJRB 2GI0A 3JT2A 3QJVB 2PCYA 2JKWA 4E9QA 1GY2A 4DP2X 2HZHA 5B1BB 1AZUA 1BAWA 3MBWB 4JHVA 4KOBA 1NWOA 3FSZA 4A68A 1KCWA 1JOIA 1JVLA 4W9ZA 5ANHA 3NP4A 1A65A 2FQFA 3FU9A 3NP3A 4HALA 4M3HA 4WTQA 4F7KA 1BXUA 4PCYA 2XWZA 1PZBA 2R7EB 3PXLA 2HRHA 1JZIA 1JXDA 2VSKB 3FS9A 2FTAA 4QKTA 1E5YA 3FSWA 1CYWA 5AZUA 1PLCA 4G72B 2IAAC 3WG7B 4A2FA 1MG2C 2EINB 3NJJA 4A67A 1AAJA 3AG3B 2TSBA 4BXVA 1GS6X 2DWTA 1JZHA 1MZZA 2QPDB 1WA2X 2J5WA 3OD3A 4BDVB 5B7EA 3IN0A 5B1AB 4HCIA 3WNJA 2B08A 4HCFA 4N4YB 1PY0A 4QLWA 4BK5C 4YVNA 8PAZA 1AG6A 1M56B 1NIAA 2XV0A 4CSZA 2EIJB 1AS6A 1BYOA 1RZQA 2QDVA 1MG3C 1SNRA 2UXTA 4A2DA 1L9TA 3C75A 5I5MA 2W8CA 1ZIBA 2EIKB 1ILSA 3EH5B 3N55A 3H56A 1DZ0A 5I6KA 4GP8B 5TK2A 4N8UA 4G71B 2IDQA 4KNUA 4GXFA 2YAQA 3V9CA 3FPXA 3UADA 2BHFA 3KW8A 2H47C 2CBPA 2NRDA 3OM3B 3EH4B 4CSPA 4E9VA 2BZCA 1TEFA 3HB3B 1AS8A 2XXFA 3ZIYA 4E9SA 4DP6X 4P5RA 4GP4B 2JXMA 4E9TA 5EHFA 3NJLA 1MDAA 1EHKB 3FPYA 5F7BA 1JVOA 1JZGA 2W88A 4KO9A 3IEAA 1CYXA 1AR1B 3S8FB 3ASOB 1KCBA 4E9XA 3ABLB 2HLEB 1ET5A 2BP0A 7PCYA 2HXAA 4YSDA 1NPNA 1M9WA 4JKNA 3NSDA 4A2GA 1NIBA 3AG4B 4AKOA 1KGYE 2OV0A 1PZAA 3OMIB 4X4KA 2ZWNA 7PAZA 4YSCA 3ASNB 1NTDA 2AZAA 2DYSB 2YAEA 2EILB 1X9RA 2XVBA 2Q5BA 4L0PB 1IBZA 2FQGA 2DWSA 1AOZA 2IDUA 4E9YA 1ASPA 2GIMA 2YARA 3PAZA 3UAAA 3NT0A 2EIMB 5I5IA 4E9RA 2UX7A 1BXVA 3HEIB 3QJTB 4DP7X 5FC9A 4NB7A 1CURA 1GY1A
chains in the Genus database with same CATH superfamily
2CG9X 2HKHH 3GB7B 3WTYA 2WK2A 1Q4NX 3L7FA 5SWQA 4BSWA 4ADJA 5D7IE 1T22A 4ECNA 1Z9OA 4OZ4B 2FO4A 1OP5H 4TNVK 4N9GA 4L48A 4KTGA 2VLRE 2Y07H 2Y5TA 2WKGA 2ZZUT 4UQBA 3ZKXB 2X3AA 4XPGL 5EF3A 1HI6B 4NZ8A 4CAGA 4OLEA 3SDCB 2AV7A 5D6CB 1FIGH 3I75A 5T5NG 5AB9A 4BEIA 3GNMH 3BUIA 1A1MB 1F4YH 2DQEH 2HVJB 4U1JA 5AB2A 4H25A 1P9MA 1BVNT 4NQSB 5DUMH 2PW2A 1JGDB 5C0GA 5EWIL 4MZ3A 1DVSA 5D5MA 4P4RB 3TCLA 1AC0A 2V7NA 4JPVH 1T2JA 3BVDB 3ULUD 3NACL 2CK2A 5HGGS 2K70A 3WHXB 4I18A 1YJDH 2WY3B 3IKCB 3MRIA 4N2CA 1BVZA 2FUQA 3ZTNL 2AXHA 3UP1A 5J7CC 1N7MH 2BHUA 3LZPA 3F04A 4S2SB 3WNLA 4P9HL 3ZMNA 4ZTPL 1YECL 3UZEA 2P5PA 4KJPC 5DD3H 4EZJA 1OAYL 1Y18A 4XRCB 2CR3A 3HKFA 4A2EA 1BA9A 5BW7A 3VE0A 2ZOOA 3PWVB 2A9AA 4U1MB 1H6EA 2CBQA 4PJGF 5K93A 4DP0X 3V7AE 4XMTA 5EFIA 4Q14A 5DZAA 1BVOA 5GGTH 2OL3A 2Z8SA 2ZX9A 4PSPA 4JUTA 4E41D 3D4YA 2H8PB 3M6DA 3T6ZA 2F54E 4L3EB 4LSRH 5F7LB 4P59L 3MACH 5HPMB 1VEMA 2NY4C 3BZ4B 2UZYB 4M6OL 4MB4A 5DZNA 4GAFB 4MHHG 4ZXBB 5IOPA 4FLRA 3MJ8B 1S3KH 4PG9B 4Z7WB 3TN0C 1QBAA 3LQAH 4UTAH 1IIKA 3BE1L 2Z31C 3RQ3A 5DLMH 3BJ91 1OGAE 4ZK8A 3F7YA 3RPBA 2DBLL 1WA0X 2X4OA 1FNLA 4ONGL 5LGHL 1MI5A 1CICC 3B9AA 1A02N 2ZYHA 4XNYL 1ZGLM 4Z78B 4WHYG 1ESOA 1IQDA 3OKEB 2YGNA 1IIIA 1BW8A 1EFXD 3W56A 5JYMA 2V17L 4YE4H 4XXWC 5E9DA 1N67A 4WFEE 5F6IB 3Q43A 3N43F 4LHUG 1WA1X 1XQ4A 4PUBL 5EU5A 3O2DL 2X88A 2G9KA 3EYVA 2LLNA 3LPOA 4JZOA 5FGRA 5IOKA 3JV6A 3E9UA 3VA6A 1I8AA 4GS7C 3X11A 5KJRL 3C2AH 3NJIA 2CLZA 4ZO9A 1ZHNA 1R6VA 4N8VG 4AX3A 3BD3A 4LSQH 1OTSD 5DSCB 3V4PH 2Y1YA 1ORSB 1GHFL 2ZQKA 2AJYL 2CK0L 5GRJH 4NOFA 3S37H 1FYTA 2VZ3A 3LN4A 4CNIB 4BZ2A 2C3VA 4CDGC 3AT8A 2GYSA 5CD3B 5IY5B 2HTLD 3VD7A 2A4ZA 4U7MA 3MC0A 5DQDH 1U41A 1ITCA 5EEUA 1CXLA 4RWHA 1BD2A 4DGYL 3WUZA 1N5YH 1YY9C 4JFYB 5J11C 1LEIA 3VFUA 3U79A 2R0LL 2K45A 1BFTA 5HGDA 5IMLA 5DVKA 1DVUA 3V7AG 1KT2B 1UWXK 1MVYA 4PVBA 5T3ZE 4KUZH 1OF2A 4BZ1H 4AGLA 5MENA 2Z9TA 3O3BB 4UT7L 5HHVH 6PCYA 3CQQA 1HNYA 2GSIB 5GHWL 4JFUA 4IRSC 3WBDA 3OVUB 4X98A 3T8MA 1NBYA 1IE4A 3AABA 3KPRB 4BFKA 2JFCA 5JMOC 4JLRA 5L2JB 1YMMD 5LB1A 1PKQB 2DEXX 1SLXA 4KXCA 3GSVB 4ZFOL 1DBML 3WMSA 1JHTB 4KVCH 4MWFB 1NCGA 3MRBA 5E08L 4XVOA 4AYBA 4LOUD 3P0GB 4BSWB 3F3HA 5ALBH 4EN2A 1XGQB 4NNXA 5EZOL 1JMZA 3DA0A 2NNAA 4IBLT 5KBLA 5TQ0H 3ZY7A 3BUYA 5BNXD 4OZHB 3UYRH 2IOMA 4LSSL 2NSMA 4MBOA 4UT9L 3VTTA 2NSXA 3QWQB 4F3FB 3S97C 1IV8A 2Q3AA 2YQBA 4ATTA 5ESVA 3UGUA 3GGWA 3HW7A 4I0PC 2I25N 4NCC2 3I50H 4FXKA 1KLUB 3KPSD 1ZK9A 3PU7A 3WLWD 1TQWA 2ZONA 4H25B 5KYNA 1ADQA 1T6BX 4TNEA 1C5CH 2NQCA 2PNDA 4ODUB 4LVHB 5MHSD 1S46A 2I60H 2WAHA 1Q8MA 2QJDA 2Q9OA 1WCQA 4MCYA 3TWCL 1C5BH 1IJ9A 4E5XB 4UM8A 4YHKL 2Y0SA 2UWEA 4R97B 4C54A 1DYZA 2E4TA 1DUYB 1R3HA 3H9HA 1E6JL 1I1AB 3NCCB 4G1EA 3VXNB 4RMSA 1MCFA 5DD0H 5IHLB 5DHDA 3GO1H 3Q8EA 4LHJB 4D9LL 4G6JL 1RIHH 4N3UA 2WZPA 4ACPA 1KBGL 3B2UC 5DA0B 1JZ3A 2ADIB 3EJUA 4ODWA 1CK0H 3HC0A 4PV1C 5DMGD 3IDYB 4DGWC 2EDJA 3FFCD 5FUOL 4PTTB 1F2XK 1KXTB 4M1DL 2HKFH 2B1AH 3DIDA 3D4ZA 1I85C 5LNEA 5AW3B 2BM3A 2HN7A 3NJGA 1OW0C 4WJKB 5CEYB 4R9HA 4F80A 1BQHB 3MJ8A 4PG9A 5FYLE 5B7FA 4KTYA 3U6RB 3FO9B 3ZOAA 1CK0L 3UAJA 1PZSA 2BIPA 2X4PB 1HE7A 2WTRA 5FUOH 2X05A 1LD9A 1TJMA 4L37A 2W9EH 4A6YB 1NBVH 4OB5H 4XHQA 3D08A 1QNZH 3OKEA 4C58B 1CLCA 4WWID 1SXSA 3BSHA 3GMPB 3KPMB 4P2QA 4NJ9H 4M93B 3PLYA 1XHHA 1QFWI 3FUHA 4AJWA 5AW0B 3GUFA 5CKGA 5CSGA 5JLZB 4MJHA 3BRGC 3DV6B 5AOJA 4YJZL 5TFSH 5J9PB 2E7CA 2X4RB 3KYNB 1KGUA 1RJYA 2C1OA 2A74B 3JT2A 4HWBL 3UBXG 2RH0A 4KKBD 4KRLB 2Y23A 3C08H 3L9RA 3N9GH 4TULL 3C5ZB 3VW3H 4QCIA 1V3JA 3RDTC 1ZHNB 4CU7A 2HJFA 2GJZB 1MCPL 5D71L 4ZQKA 1UT9A 3QXTA 2XY2A 1F2QA 1YQVL 1AE6H 4LRNL 4XOEA 2OTUB 5AALA 5I0WA 1QFWM 3NCJH 5ANHA 5JO5A 2EEAA 2XA8L 3L3HA 3UCRA 4AXWA 3TBWA 3K5RA 2AKRA 3CFQA 4F7KA 3SKMA 2WYZA 3ARWA 3NSJA 5AVRB 3QIWC 3U7YL 1AHWC 3TPUA 2WLHA 1NGZA 2HRPL 3OR7B 4XNAA 2E6PA 5I0DA 2F08A 4JFYA 1YNLH 3B1TA 4CADA 4YDIH 4N2GA 2AQNA 2WWMD 4CVXB 3CJJA 2VERN 4E0RA 2TAAA 1RK1B 3NJJA 4XBMA 3GBNL 2WYIA 4KITB 5E6RB 2WPGA 1XF3A 2X2HA 4XXWA 3MLRH 1B2WL 1A7QH 1HSAB 1N2RB 1OQOA 3FQ4A 1FO0B 4G8IA 5FV1L 5KVEH 4G6ML 3UC0L 3MAWA 4BDVB 1M7IB 1PKQA 4NGHH 1S9XA 5AVWB 2NY2D 4XH2B 1UOVA 3RGVC 3ZTEA 4JO3H 2BXYA 2Q87A 1ACXA 4N25A 3HE6A 1JZDC 3FFDB 1F3DJ 5BZZA 3QVAA 2IANB 4JHZA 1TQBC 1ZSDB 4OCWH 2GUOA 5JMRA 1KGXA 4QI3A 4PJEB 2VWEE 4DAGH 5CZVL 4OD2B 4UTBL 1Z9PA 4OZHA 3T1FB 3B5TA 1BYOA 4JRYD 3SBWA 3MGTA 1AKJB 2MPAL 2VLMD 4Y16C 1Q38A 1DZ0A 1T7WA 3EOBA 4N8UA 2JCCE 4GXFA 1KXHA 4M5YL 5BS0A 1PU0A 4X7CC 3V9CA 1K4CA 3C60D 2APXA 1MWAH 2AJZA 4IHOB 2ZUWA 4PSRA 1B4RA 2RALA 4K8RH 4IBTA 5AW9B 1AQKH 2YPLA 1MHCA 1UZ8A 2AABH 3BDYH 3IEAA 2L04A 3IJYB 3LS5H 4BHUI 4ODUA 3LYRA 4HISA 4KQ0A 4JFXA 1X5ZA 3FO0L 2RD0A 2OMTA 5J1TC 3L1OL 4AG4H 2YD0A 1WV7T 5FKAA 4BQBA 3TEWA 2AJVH 2ZUVA 5F3FA 4X5WA 2VAJA 4X6DA 2JF1A 3SKOB 1WUNT 2VDPB 3QNZB 5JA9A 3HHRB 2E75C 4A2LA 4NENB 4N5ED 3DX8A 3L9YA 2OR9L 3MRLB 3BH9A 4PJFA 4XXCA 3ARBA 3N04A 1T0MB 3SDCA 3S4SB 2AV7B 2C4FT 1CL7L 3ZKNC 2R15A 4X7TB 5J13B 2JKXA 4I9WD 4P57A 3L4VA 1AQDA 4MNQD 1MJ8L 2ERJB 2Z0UA 1KBPA 3K3QA 4H2AA 5GXBB 4H0IA 1QSFE 3PV7A 3RILA 4F9LA 3QAZC 1NLBL 3DWTA 3FUJA 3IFOA 1JGDA 4HIHA 5ENWA 1KTRL 1E42A 4Y19B 2A4EA 2UX7A 5DZJA 3HEIB 1IFHH 4F8PA 3PGCA 4DK6A 3FT3A 1KXTA 1C16A 3A6CH 2V7NB 1YEGH 1QUNA 3LIZL 1FQ9C 4OGYH 5BS0D 5C0DB 4N0UB 1Z6JT 2VR8A 4QRPD 4Z1PA 1FC1A 4A55A 4YDKH 1IC4H 3INUH 5CJOH 1T66D 4JRYA 4YNYB 3VTAA 3QK0A 4P4KA 1SF5A 1RP9A 1F3JB 1BZQK 3FQNA 5AD0B 2OCFD 5EZJB 3QYMA 3EDDA 6FABL 3SOBH 4NQQA 2C7UB 2FWOB 3V5HB 3VSVA 4AVIA 4ZPTB 3MJ6A 4WSJA 4G8EA 3U25A 4NUGH 1IRAY 5LG6A 1L9MA 4QWWD 3SBQA 3N44B 3QFJB 3TA3C 5FEBA 3HG3A 1YN7B 1AR2A 3QC6X 3VI4E 1EDYA 4FG0A 4KUCD 4S0SD 1SEBA 4JRFA 4BGDA 4ABWA 4Y5XB 4PFEA 4OZIF 1P5VA 3H9SD 3O0RL 5T5FH 3DRTA 2X4RA 3QUYD 4FFVD 3FCTA 1FG2B 4FQ2H 2C1OB 3PDOA 3BZ4A 2DTML 5E5RB 2WXPA 5GS1C 1TXKA 2JB6B 5A1AA 1KCUL 4QCIB 4LLUA 1R5WA 5E99H 4QT5A 4OKVA 2ZXWB 2AK4B 2R2HB 4TTGA 3ILQC 4JDEA 3MUJA 2Y2YA 2D03L 4ZO8A 5DEFB 1T1WB 3ARFB 1JV2B 5D93C 4Y9CA 1FA4A 3WN5B 2VDNB 2O26U 3ZDXE 1CF8L 1GYCA 4BK4A 3V5KB 1E40A 2G5RA 3T4AC 3K6SB 1K8IA 1MAMH 3VXQA 4HHAA 4TL5A 5JOFB 1BZDA 1U8QB 5E9DB 5FUCE 4WSKA 3HC3H 1MRDL 4BZ2H 4GFTB 1S5IH 1KCLA 1SHWA 2QV2A 4C4KT 3FU6A 5E24E 4Z7NB 3X11B 3MA9L 1AACA 2FUTA 4FNPA 3BH8A 4O9HH 1IFGA 3VX0A 1UG9A 5LDUA 1XH2A 4GY4A 2ATKA 2O6CA 1OP9A 1NGPH 3V95A 4G8FB 1MWAA 2W0FA 3QEGH 3WL9B 1HSAA 1N2RA 5F3BA 3X13A 3HCVB 5J4MA 3ISYA 3Q6FB 3EGSA 1S9XB 1J5OL 4CN4A 5IJVA 1VSCA 4MLSA 5IW3A 3S5LB 2DL9A 1KNOA 2X09A 5GSVB 3S9DB 1DANU 3KH4A 3AGVA 5DJZA 2FB4H 4RAVA 4X4MA 2W65A 1BQRA 1S5IL 3IK2A 3CH1A 2YZ8A 3IPFA 3WUWG 3L5XH 3CMGA 3B9VA 1ONQB 4PHXA 4U1LB 2MJWA 1HIMH 1PLGH 2EIZB 3V6ZB 1AH1A 4OD2A 2UXVA 3PHAA 3JXAA 4HETA 5CCJA 2KLRA 4BQ6A 2Y06L 3T0BA 4MJ5A 4NQCB 1T5KA 3TTYA 1Y07A 2X87A 4K8RC 4Y2DD 5E4AA 5JIMA 2I5YL 4JL1A 5CU9A 4YUEL 2UWEF 1UJ3B 3T8VA 1DQJB 3W5MA 1NFDE 2QKIB 4NCDA 4XCCL 3EJJX 3ESUF 4PJ7F 2RCSL 4YXLL 3VGHA 1HE8A 1XL4A 2FB4L 4D8OA 3DSNA 2BY0A 2WLMA 3CGTA 5DU7A 4UAOB 1XCQA 4Y2OB 3P2DA 1SUJA 3CVIL 3JWDC 4G43B 5PAZA 4E9LA 1CGTA 1NBCA 3N40P 4GW1B 1HHIB 3QDGB 3CSTA 1G0YR 3PPSA 3O2DH 1GJWA 3EZJB 4HH8A 5GRVL 1AGFA 1V3MA 3SYAA 2WNKA 1BOYA 1AO7B 5FKAB 1NMBL 4QOKB 4FA6A 1KFAL 5DD3L 5EU7C 4N2AA 2TRYA 3QI9A 4IMKC 2BVEA 5DHVH 1DBJH 4NENA 1HHJA 2HFEB 4JRWA 5HHOA 4AMKL 4FP8L 4QXWA 2FD6H 3VFWB 2O93L 3AG2B 1FCCA 1ZK5A 2ZX6A 3P73B 4GAGL 2D0GA 2DEYX 1A3RL 4R90H 4W6WB 4HG4K 1PMYA 1XXDC 4K5LA 3RA7H 1Q94A 4WNQA 5BUAA 2AQTA 2BH0A 2WGXA 3IMTA 1C9SA 3P4OA 1GGYA 1U8MB 5FF6A 2AGJL 3U7WH 4J3VA 2WIMA 4HU2A 2FEDD 4J3SA 5DURB 3T2LA 5DMGC 1NLDH 3PGCB 1AE6L 4KUZL 3BUDA 4DN3H 1A7NL 3T77B 5IP4A 1S7VA 1NC4B 1QUNB 4D0DB 4OV5A 1F4WH 1XCTB 2WCSA 4E5XA 1IM3D 3QISA 4MJ6B 4S1QL 1G6RH 1IBGL 4RMWA 1T1XA 4Z3EA 2ADGA 4AT6B 3D7PA 2D2OA 4WEBH 2X0VA 4YZWA 4RISH 3X3GL 1FL6B 4KHTH 5HHQA 4NX0A 3QRFM 3IFNH 4S1DD 4UQ3A 4RX4D 5FS5A 4OUUB 4XNDA 43C9A 5KS9B 3FDWA 4LPXA 2PWGA 3CFDA 1OCCB 1YCSA 3J27A 4X4XA 5AG8A 4ZPTA 3U0WH 2B20A 2ESVE 1U8HB 3C6LD 3LN9A 2ZKWA 1U9KA 2G2RA 1KCVL 3AGWA 4Y8AA 5DYFA 1X4XA 3ASWA 5BRZB 3GJFA 2R1WB 4RDBA 5E6ZA 5EU6A 3UTOA 4FG6C 2P3YA 2OJZL 5FFLA 4AZUA 5DVNA 2I07B 3GUTA 3O6FC 1XF1A 4AENA 1I1YB 1JFQL 2YRZA 4KXBA 3RY6C 3MLSL 2D4DA 3MQIA 1FFQA 4KY1H 4XCYB 4HGKC 1QR4A 1I7UB 1LM8V 2ATPA 3QORA 4KKBC 4APQB 1JPST 3ATEA 3WY2A 4BE5A 5T1LA 4LLUB 4ZI8A 1BIIB 2DN7A 3MNVB 3MRHB 5A2FA 4QT5B 5GS0L 2WLNA 4IBVA 2A3TA 5LXGL 4JDTL 4JO1H 3VYNA 2HH0L 2QHLA 2EZ0D 1HI6A 3T0AA 1N5YL 1A6WL 1YEEH 4H0LC 1H15B 3AM8C 1BFVL 4OD3H 2LVEA 1EIBA 3DVGB 5DUBB 4DEPC 1RZKL 1J10A 1SDAB 4YGAB 4YHYB 3SQBA 3UDWA 4NO2B 1R9FA 1P4LB 4AIOA 1JPGA 4NQVA 1VFOA 5J8OA 4WI6A 5EBMB 2CBMA 2VSCA 3S36X 5FYKE 2XIDA 4TPRH 4K94C 4L3ED 1BBDL 5E4OA 5DQJA 1B4LA 1V27A 4JFFD 5EBLA 5HGBA 2XTJE 3L9RB 1QO3A 3E9TA 5HI3D 2OA9A 4M4RB 4EQ3A 5HYJB 1ODAA 2A9ML 5KYUB 2GC4C 3MCKA 3POHA 4LEXH 1WT5A 3DYMA 4M4PA 5B3NA 1BFVH 3N41B 3WUWA 3V0IA 2YKKA 2B1OA 1A66A 5T1MA 3K2UL 3QG7H 2B0SL 3C5XA 1ADWA 5PCYA 1AO7D 1OSZA 2E9JA 3QO0B 4ETQB 1QFWH 4Q89A 4RGNC 1EWHA 2PW1A 3LKRA 3UYPA 2E4FA 3B9DA 1NGZB 3CBKB 3OR7A 3RVUD 1BXXA 2B2XL 4WKZB 1U3YA 1XGPA 3ZT6A 4ELMB 3EOYG 3VG9B 4UV4H 4HK3N 4Q7DA 4JHAH 4J1UA 4W9KC 4UU9A 2WVSA 4HV8B 4MJ5B 4NQCA 2YMTA 4ELKA 1AXTH 3AB0B 3MYJA 3CIQA 1PG7X 3P11L 3NABH 4XI5D 3P9WB 1JWSA 5KSBE 2KQMA 3PRZA 3NDZE 3FF7A 4E41A 5FDYA 5DJ6B 2W9DL 3EFFA 1JP5A 1RFDL 5E2WH 3T08A 5I1IL 2OSXA 4CSTA 5K69A 1D9KB 4BWWA 2BHZA 3IRPX 3KPLB 3LD8B 2NCMA 3ZE2B 3FFDA 2H0EA 1HN1A 3S5ZA 1AY1H 3VA2C 4FTVA 2CO6B 1E8WA 4XCEB 3S6CA 5TFSL 1HDMA 3EBAA 4GO6B 5FO7B 1AZUA 1N0LA 2DMBA 4JHVA 2BSEA 5L88H 4KOBA 4KJWC 2RAMA 4DKTA 4QOKA 1KCWA 1JVLA 3CN2A 3VVVA 4LQ1A 4XMKL 3TEYA 2IADA 1FNEA 2VXQA 3L6FB 1PFOA 3QI9C 4N0YL 1GGIH 4R8WH 5AQ0A 4A37A 4B27A 5KAQG 1TOXA 2JWYA 3LNIA 5T3XL 1K4CB 5C8JA 1IVTA 1D5MA 3EJYC 4IHOA 1MF2H 2NUTA 4BIKA 4H5SA 4XN9A 4JZOB 4ONFL 1HSBB 5I9QC 2MKWA 1BSIA 1E5YA 1N4XL 3FO2B 1JD7A 5AB0A 3U2SB 2E6QA 1RURL 3ZL1A 5I66A 3VFOB 2EC8A 2TSBA 4Y5VB 1UWEL 4UQ2A 3W57A 5I1GH 3BSZL 3QG6B 5E0QA 4Y1AB 5CD3A 5F1IA 2VLJD 4MQSB 4TQEL 3W9EB 5C0CA 1MCHA 4MQ7A 2O6EA 2EVHA 3EDKA 5CFAA 4YHPB 2ADGB 3KHOA 1T1YB 3FUMA 4FFWD 4XXCC 3SB3A 1SEQH 3GNML 2A6DB 3AUVA 1CO1A 1PIFA 3VXSD 3VGEA 4AV5A 3B2MA 3F01A 2IALA 4PP1C 1IGMH 4HPOH 4LASH 4POZD 1IT9H 4XX1G 1U2HA 2IQAA 4A2DA 4Y4HD 3VU2A 5I5MA 2P52A 1CXIA 2DI7A 2W8CA 5DO2C 2AF2A 4CBPA 1FVEA 1CR9H 3GRGA 4Y0GA 3MRQB 2P28B 5TH2B 2YFOA 3FMGL 5E9AA 3FPXA 1NOLA 2NRDA 2P47B 4Z7UE 1JHTA 8FABA 5EU6B 1UM5L 2W9LA 1L4IA 1J05A 2XXFA 3AMKA 3CFKA 2RQEA 4HKZB 3T0XA 5KYWB 5MI0C 4H88H 2X4NA 3DXAA 4LLYA 4KNQA 1R75A 2PKDA 3QO1A 3OQ3B 3WJJC 3BAJA 4F7CA 3X17A 1BGXH 3QHZH 2DMGA 2WZ0A 1GIGL 1IGIH 3MV8A 2ED6A 3P4NB 4P4KB 2AW2A 1BIIA 3AJ7A 3MRHA 4Z3IA 4AEHH 1NQBA 3UROR 3ILQD 1BQLH 4QUOA 3IKKA 3DYPA 1A9EA 4KKCD 1A7QL 1NIBA 2MOVA 3AG4B 4X9BA 1TTFA 4AQZA 3QUYA 4XOAA 4P5MA 4AGMA 5TDOA 4M03A 3CLWA 3WAJA 3OZ9L 1ROWA 2QMJA 2ENQA 4XN5A 5EBMA 2DYSB 4M8QA 1X5KA 4DVRL 4XNQA 4WI2A 1IBGH 2Q5BA 3FTYA 2EH7H 1VDGA 2F1AA 3ZRFC 3LXBA 4P2OB 1A6ZB 4NIKB 4XR8C 1U21A 1RK0A 4L1HA 5T33L 4XNXH 1FYHB 4V2CB 5AYTA 2EIMB 1TUPA 3BE1H 1Q9WA 1IBFA 2Q6WB 1NDGB 4FZEL 4PJBB 1LE5A 2V6HA 5SX5K 3WUWB 3FTSA 2GITA 2E8ZA 1LP9F 1LO2L 1BJ1J 1J8SA 4PJAF 3WN5A 5T1KD 5IG7B 4LCIL 1WFNA 1NCNA 5GZOA 5DT1L 3U0TB 3HS0A 2OX5A 4ETQA 2R2EA 3KL0A 1T21B 2BHYA 2BK8A 1PSKH 4K3HA 2B15A 1U8KB 2C8NA 2XQYK 5IB4B 4RGOL 1GR7A 4F7MA 5F0LB 4QRTA 4K5PA 5KYXB 4B60A 4ESKA 5ISZE 1G1OA 2NDFA 1GJUA 1DDHA 2GBAA 2J8UA 3KW7A 2EE3A 3L3GA 4Y1AD 3DLQR 4P9MH 5EO9A 1QVOB 4HV8A 4LLVA 4Y5YC 2CBOA 5D7IA 3NTCH 1VERA 4JZJB 3P0YH 3WS3A 4YHML 3GD1C 4L1BA 5DZLA 1UXSA 4I1RA 4BELD 4E41B 3S37L 5L8JB 5F3BB 3EFFB 2CSPA 1MQKH 1NUFA 4NC1C 4NSKA 4P46D 3SDCD 1MCJA 5CS7A 1BMZA 1UADC 4AVKA 1HZHL 2LGNA 3NGBB 4H13C 4Q4IA 3BVVA 4J6IA 3T0EB 5JPNC 1JZJA 4RGMB 5IKCB 3P4LA 3VTMA 4ZFFB 3JVGC 5MEOB 3U6RA 5CXPA 3KNBB 3MR9A 2CO6A 4TF4A 4XCEA 4AY0A 5FO7A 1FCGA 2KMWA 4NO3A 5EG6C 3CZEA 5CINL 4ZNEE 5GZNA 3MV7E 3S34H 5FB8B 3BRDA 4POUB 3NSCA 4PLKC 4NZTH 3NZUA 4ZOCA 1JHLL 2A6IB 2WSKA 5CHNB 1OIOA 4QY8B 4P2QB 4X5QA 3K8MA 1UJ3A 2DL2A 4XP9H 2MIZA 2OMVB 4D0CB 1E50A 1D5IH 2Q8BL 2JI2A 2EXSA 2X7LB 4G1MB 2DD8H 3S36H 1TITA 5ESQA 2WXLA 4M48L 3UX9B 4FABL 1P4IH 2HJFB 3S4SG 3ARQA 2F7IA 4P23D 5ALCL 3RFZC 5I66B 1V10A 1VFAA 4KQ3L 4Y5VA 1JJUA 4PJ5A 3UZVA 3QG6A 1UFUA 2XZZA 3JSSA 3RWJA 3FXIC 2VL4A 3TBWB 3QJZA 3HG1D 3TBYB 2BOCB 4QF1B 2A6KB 1NCDL 4UMSA 1ECZA 3MROA 1NJ9A 2ZKYA 4JM2D 3VFGH 1XR8A 1GYAA 1PIGA 4M62L 3VSQA 4UV7L 2YIHA 2HJLA 4JRYE 2P5ED 1X4YA 1W80A 1HINH 1MWOA 1C5CL 5IK3A 4AL8L 1U8MA 2D03H 4QHKI 3OMNB 1B0RA 4IBYA 3WKMH 1PD1A 4FQ1H 4S1SH 4ZOBA 1PX3A 2J88H 1M3JA 1MCLA 4D8PB 3VI4A 4XPHL 4XMKH 1CTOA 1KY7A 4KRNA 1VEPA 4APXB 1NA8A 3IVKA 1Z1WA 1KYDA 4FMKA 5HJBA 3LQZA 4D3CL 2J21A 4Z7QB 3GSRA 2QBWA 2BNQE 3V0AC 3I02A 3JQOB 4AYDC 3MGTB 4KJQD 4YXKH 1TSHA 4X6FA 2I9TA 2ZUTA 2OYPA 4LU5L 4N8CH 3ZYIA 4ZMQA 5I0YA 1AZCA 4L4VD 2ED7A 3EYSL 2IPUK 2VIRA 2AQRA 2OI9B 9CGTA 5GS2H 4G11A 3L3IB 4F8OA 3RDJA 1D5BB 3H9YA 2YQ2A 2GBUA 4XC3L 1E67A 3B2VH 3O2VL 3O41B 1FNGA 1HOEA 4IIQB 1UZ8B 2C9RA 4KI5F 4M8QB 1HNFA 1SF3A 4M3JA 2QZQA 4AENB 1KCKA 4NAJA 1QATA 2VDRH 2X38A 4M1GH 5D1ZB 1FZMB 1KCSH 1CDUA 4NQED 1ZV2A 5EOCH 3SJVE 1RK0B 4EEEA 1MFCH 1F56A 2P80D 1N6VA 2X4TA 5D7JC 1KXQA 5HDBB 4WW1A 1CPUA 3TXAA 4YX2L 1G7LB 1N3NA 2GEEA 5AW7B 5D1XE 3GIVA 5FWQA 1EMTL 2AAAA 3SN6N 3C5SA 2FECL 3MUHL 2Y07L 1WJ3A 4XCNA 3RWGA 2ARWA 1H15A 5FA4A 4MTMA 3O2VH 1KCRL 2QVMA 3HC4L 5IG7A 1EUUA 2VN5A 1KWKA 3V6OC 4KY2A 2N1KA 3L3JA 1ZPLA 1H0DA 2VDNL 1O7DC 1TQCB 3PGFH 3AQYA 2CDGB 1TEYA 3PUUA 1ZTMA 2G5UA 1VZGA 3MLUL 3WSQL 5CBAA 5KYXA 3RVUC 2P8MA 1OE3A 1TVBB 1FF5A 3TZVD 3UERA 4K55A 1NH6A 4Y19A 1HK6A 3MNWB 4RBPH 1EHXA 4YX2H 1PKOA 5CJ5A 2AS5M 4OLYH 1M7DB 2FJSA 4H26B 2CIIA 2UY7B 4YC2C 2YSSA 5KYUA 2CO4A 1CDIA 3O2WL 3DHMA 3V4UL 5IREA 2KZBA 3RU8H 1W0WB 5SX5H 4KO7A 2EYRB 3FOMB 1L7IL 3MBEB 5DLML 4JG1L 5T1MB 4XO5A 4IOIB 4HAKA 1L9RA 3A67L 4W9CC 2CAKA 5C0EB 1K6QL 1XGRB 4QO1B 2WUBH 3CSBA 1BCIA 5KVFL 2ILLA 5DC2A 3RBSA 4NKMA 3U46B 1VHPA 4CRPA 5KAQF 2X44D 1X7QB 1FFPB 1YJDL 3LRSA 2IPKA 3QPXH 5IMOA 2EACA 4Y9FA 3FCBA 1TF4A 3U36B 1FL5A 3OLEA 1H3GA 3DV4B 3AREC 1RUPL 4WWNA 3BP4B 5INDA 3GRBA 2PYFA 1GPOH 2VZUA 2JLLA 1Z9MA 2VUKA 3H54A 4BCYA 1LK2A 2Y69B 4GXVL 4RLDA 5IW1A 2BVYA 3LN5A 1ACCA 4LHQB 4G6MH 4JJ5B 3ARBD 2CKBA 1RZPA 4K71B 4N0CD 2ARJQ 3D39D 2K6ZA 3GSNB 3QR0A 2Z7YA 5H4YA 3OPZL 1KWGA 5CWSA 4UQIM 1OWRM 4K15A 5AOZA 1CFBA 3CLFL 2UYLA 3SE9H 3HRZC 5MHSE 1V7NL 3X12A 2IQ9H 4KJPD 4QGYA 1UVQA 4LAQL 3ULVC 4XBEH 1CDBA 1WISA 4PJ5B 3UZVB 4MD0A 1HH6B 5JHMA 1LDPH 3VRLE 3BRFA 2WN3A 4H20L 5IV2A 4YGVA 3SE8H 3RIFK 3HMWL 4OZIB 5FM4A 3SDYL 1I7ZA 1YAIA 4OLUL 3VXQB 2R29L 2WANA 1U8QA 2XPZA 2RBLA 1NC2D 4OIAA 2RFXA 2I26N 2G0LA 4LNRB 4FFWC 1OGSA 2IAMC 2IEPA 3MROB 1WF5A 4I3SL 4LNVA 3DX7A 2ICEA 1S8DB 3HNTH 5GZOD 1I8UA 2J6EH 1MIML 1CDJA 5EC2A 5DWUL 4AM0Q 4BJLA 4HUMB 5D1QB 2VXQL 1XSOA 2IMNA 4YDKL 3W2DH 4PN6A 4X4YA 1DBMH 2DM2A 4K73A 4UM9D 4XMLL 1DFBH 4R26L 5KSAB 3QIUD 1ZT4B 4JFFB 3T3MB 4Y1AA 2WKOF 3BD5A 4YSTA 3VCLB 1OKEA 2CMRL 2M1KA 3L3KB 3FQWA 3L4TA 4X83A 6FABH 4JFWA 4OCLC 1J0KA 4YVUA 1PLAA 4HKJA 3VFMB 3ZUNC 3FO1B 1VRSA 4HUUB 4LSSH 4OLZL 5D72L 5DHYA 1E0OB 1G0XA 3C60A 5GRWA 3F8UB 4U1LA 1S7TB 2H2PD 1I1RA 3ARDB 5GS3A 2P44B 2R2BA 4FJYA 1BF5A 1E5BA 1R33A 1JF6A 4RBPK 5E5MB 3QFDB 1U3JA 5ADOL 1NEZG 3ILEA 1X6LA 1OTSC 4WK2B 3NP4A 4PRIE 1BMWA 3GFUA 4ZSOA 4FMVA 2C4XA 2EDFA 3KZ8A 2NCEA 2ZUUA 1NBZB 1H3TA 1AOHA 3CMOH 3RB7A 4EO5A 2J6WA 3LEVL 3DJZA 4Z3GA 1IGCH 1JXDA 3VI3F 2A9DA 5FFGA 2FTAA 4FL4B 4M8UA 4J3BA 3GC3A 2LW3A 5AZUA 1KMGA 2IAAC 2DQJH 2WWKT 2FLRT 4P2YA 3WFZA 4KFZC 2QQLL 1F6AA 3FT4B 1A1OB 1U95A 5JW4M 4BXVA 4DO6A 3PWNA 2OMXB 1FLRH 3EGXA 3CHOA 5DQ9B 3EXJA 4Y4HA 2HMIC 3U82B 1S7UB 1B9KA 4G6KL 3F85A 4FMFA 3CU7A 3KLSA 3UTSD 4D9LH 5IQMA 4TLTA 4PRHA 5D70H 3TS8A 4JFED 5HYIA 2BIHA 5C09A 1PY0A 4HSAC 1EEQA 2ITFA 4QLWA 5FYLL 4NJAL 5DJYB 4BK5C 4HF5L 4I89A 3JV4A 4Y89A 3NA4A 3BWZA 2ALWA 1HCYA 3L95A 5IT2L 5BPPA 3VRIB 4S0HA 4YBQD 5E94B 3PE9A 1NAMA 2YAQA 1G9MC 4PLJD 2VKXA 4D0DA 3QQ3B 1XCTA 1KEGL 2FSEA 1DQTA 3RWFA 4HPHA 2Z1KA 2ZT9C 1WLHA 5AAMA 2D0HA 3MA7B 2AVGA 1JPFA 3T6QC 2X28A 1MDAA 3DSFL 5TE6L 3HS0C 1F3DH 4NZJA 4O58H 1U3HA 4LDOB 2HLEB 4U0QB 2BP0A 1QZ1A 2F53E 2A4CA 2HXAA 2DRUA 1FL5B 1TQTA 3EO1A 4GG6F 4JKNA 1DDHB 3BP7B 1U8HA 2B5IB 2XWTA 4XHJD 1Z0MA 5JDSA 1QVOA 4LLVB 4OZFA 4PJ7A 4Z7VF 4PWHA 4Q97A 2CXKA 5INDB 2OV0A 4WFFE 1TZOA 2P8PB 5A2KH 3VB8A 3HPJB 5HI5C 5FGCE 2J88L 4JKWA 1T0PB 2A83B 2I07A 2XWXA 3GUTB 2CKNA 2C5DC 1S7QA 2YGPA 2OMNA 2R1XB 3RPIA 2CKBB 4ZX6A 1AXIB 3RY6A 4LEEA 1ML0A 1QFOA 4GSDL 4JCLA 1NCOA 1XD1A 2QSQA 4JFEB 3VO0A 2F5AL 2KH2B 1I7UA 3NCMA 5C3LD 4PJFE 2L7JA 2PYED 3PHSA 5KG9B 3NCEB 3OLGA 1U6AH 4N0FB 3KNBA 3MR9B 4E9RA 2IWGA 2NUPA 2LLGA 3KWVA 4X80L 2HAZA 4A7TA 2WIIB 5FGBC 4Z5RA 1J0YA 4MXWH 1P1VA 4HWZB 1B88A 3SQBB 1BZ7A 3CU1A 4NN5B 1L9OA 4I0CC 1T03H 2FYYB 3T0DA 3CLEL 3X2QB 1EO8H 4L9LB 4F37F 3SCMB 2IPTH 3RU8L 4RFNB 3ARYA 4ABUA 2NLJA 4HC1L 3LKOA 4KKRA 3PWLA 3L9BA 3RTQC 2LFGA 3VI3A 2CM6A 2WXOA 4LCCA 4WCYH 5DRZB 5ANME 1JGEA 1XGYH 3MNMA 1OVZA 3MACL 5C09D 5LCVL 1OO2A 4MVBC 3CDCA 1KPVB 2JCCB 25C8H 2GJ6D 2BRQA 4KOCA 4MCZB 2H26B 1ZS8A 4F15B 5KSAA 3PIQA 3IJHA 5F0MB 5FGBA 4JFFA 2VJ8A 3RWJB 5FM8A 5B39G 1DLFL 3OV6A 3P0VL 5JA8B 1RUAL 3BP5A 1CXFA 1JNHB 2F68X 3A5VA 5FK9A 1IBHA 1EGJH 4J4PC 4JRXD 1ZWIA 4K23H 4K3JL 2QLYA 4HKJB 4UTBH 5F9WC 5IIEB 4HUUA 4PRNA 1YJDC 1GGCL 4HC1H 5DD5L 5A3IC 3QWNA 2NNXA 2PMZA 4P23B 2I27N 3VD4A 4KK5C 4ENZA 4Z7UF 2AK1H 5GGTA 2WXHA 3MV11 3TVMB 2BNRE 3J07A 4XNYH 4X7EC 3HAEG 1YMHA 3HUJF 2RACA 2JIXD 2B4CL 4ENEC 5DS2A 4TL4A 3EOAB 5BW7C 1F41A 1V7ML 4Z7OE 2YBRB 1AZBA 4MJ4A 2QFRA 5AENA 3VFPB 2LU3A 3HAEH 1H9VA 1A7NH 3EJCA 4N2BA 1ED3B 4ADGA 2BOLA 3GHEH 2ZOLB 2YO3A 4MDJA 1PSKL 3LZNA 1T20B 1EDHA 3GBML 1G7HB 4XNZB 3N06B 4QRBA 1Z32X 5EF2A 3RNQA 4XP6L 5L2KA 1ZVYA 4DQOH 3ROOA 2E9BA 3QPKA 3V6OA 2WWMC 3MV8E 1QLRA 2UVEA 1TKWA 3QNXB 3C8HA 5F6HJ 4DTGL 4EZMA 2WNGA 2Q10A 1TJHH 4GLRH 3MYZA 4X7SL 3UZQB 1D5MB 2Q86A 5HHVL 3UTSB 1VKXB 1KB5H 2X89A 2NUTB 4AIEA 1TENA 4YDVA 4YDJA 3MX0B 4XP1H 3I6KA 4HK0B 1HAWA 4G7YL 3WS6A 1BWWA 3TNMA 3IM1A 1IM3A 3OWRA 2WXNA 4TQPA 2A77L 3D18A 3ETBJ 1J1OH 2CO7B 4X9HA 1NC2A 2WZ6A 3IJEA 2DQGL 1WH0A 5F7NC 1I8LC 3TA3D 1NAMB 5E2TH 3G6AA 3MRMA 4PIBA 4PRPE 3CK0H 2VO8A 2WJ7A 3EG9A 2WQSA 1WFIA 5I6MA 4UT9H 4YHPA 3LPFA 4R7DA 4XVTH 1CLYH 4C55A 2YXVA 2ITCB 2OR7A 4PD4K 2G2NA 4JY6A 1NIFA 1ZTXE 3AWEA 3H85A 4DGVH 4V1DD 2X1QA 2CDGA 3RIKA 1F18A 5FW8A 5AKVA 5EULV 1F4HA 4FJZA 5I30H 4YHLL 4ANWA 1G7PB 4G70B 3CZLA 1I82A 1WTLA 1JXKA 5GRUL 4GXUN 2F8VA 3QJQB 4IGBD 5DUPL 4EI6B 4R4ND 1J05B 3CFKB 1KB5B 4Z3FA 2YQ3A 1PJ9A 2BWQA 2D7NA 4GBXB 3O3EB 5HHMD 2Y36H 1F11B 3KEHA 3DRQB 5FKPB 4O51B 4OFVA 3DHUA 1QKZH 3IGAA 4OZGB 1ZEAH 3UJTL 1NL0L 1NCWL 1JDAA 4HEPA 4N1HB 5C0BA 3LZRA 4I1PA 2YBGA 4GRWB 5D7JA 3ZKND 1C5BL 3E2HB 5DWPA 1GC1L 2CDFA 3FSAA 5EUOE 5I76A 4AK2A 4EBQH 3ZSSA 1IKNC 2IG2L 4N85A 3GDBA 1ZVSA 4H1LH 4K7PY 3R7QA 4BZYA 3KLHC 4UOQA 5IFAH 5FV2A 4WI5A 3BP4A 2NY6C 2YD8A 1RJLA 5AVXB 1KACB 1UHVA 2PYFB 1UENA 2Q20A 3QPQD 3KWTA 1LHZA 3OHXB 3ZYJA 2WBJB 2CR6A 4N8PA 1OCWL 2JXMB 1MLBB 4KPHH 5K1VA 2UV3A 4EZKA 1JYXA 2HFTA 3BFWA 4JJ5A 4PBWD 1KCRH 3HC4H 2IAMD 1XZWA 3PG2A 4OF6A 4HUWB 3LH8A 4MA7H 2JKSA 4PB9H 1HX0A 2BRRH 5HYJD 1A6VL 5CGYD 5L7XH 1QBLH 1NAKL 2AV1A 3L7EA 1J5HA 4JPIB 1N6QH 5GRYA 4P05A 4Z18A 3VXMA 3MCLL 5DK0B 1JZ7A 1MHPH 2YFNA 3BEWA 3R19A 3S5YA 1NGYA 3G3LA 5B4MC 1WZLA 5CP7B 5AVUB 3H9ZA 1QI5A 5KBKA 3QZWA 5ELIA 3F65A 4JPKH 3RWCA 1ZT1B 1M53A 5C0AB 1IAIL 1NBQA 2VW4A 1XF4A 2H2PC 3I75B 4KROC 1Q9LA 2ICEC 4GSDH 3K7UA 3S3BB 1USZA 1OTUC 3HUJE 5E6SB 5EN3A 4ABVA 3SKNB 1KIQA 1NCIA 2DM4A 2C9AA 5EUKA 4U0RB 3WS6C 3HMXL 3OC8A 3RVWC 4JPWL 3B2XA 5A40E 4EOWL 4QTHA 4XPFL 5CZXD 2VZVA 3RHWF 3HG4A 4A7UA 3BQUC 3BKYL 1PZUB 1QACA 1BECA 3VFMA 4TSAL 4Z6AT 1W0VA 4W9JC 4WFGD 3IT8D 1WZKA 3H2QA 4O58L 4PGBB 4X9IA 3PXJA 3TF4A 5E8PA 2H7WA 1HXKA 5L2KB 3D39B 4FRWA 1SXZA 1ZTXL 1G4MA 1PDKA 5CCHE 1WEJL 4PJDE 1PZDA 3SGJA 1TETL 3CSFA 4L3AA 1MPAL 5FM5M 3DO7A 1Y18B 4XRCA 1W6LA 3QUZB 1GAFL 4IK6A 1II4E 4MAZA 2BOBB 1PGRB 3AVEA 1NBZA 4NN7B 4DP9X 1KGCD 1V5JA 2I5YH 3QRGH 2X2YA 4OFDA 3FUDA 4PRBB 2OZ4H 3WIIH 3I6KB 2XT1B 4LSQL 4ANXA 4NIYE 2XV6B 5KVMC 3H0TB 4TSCL 5GGQH 5IBTH 4ZMTA 2EKJA 2Q7YB 2YMXL 1NC2B 4RGNE 1UCBL 1Z2KA 2AI0H 3NCXA 1U95B 1IKOP 1JN6A 2DLIA 3QS2A 4PJAB 4YBQC 3G6AB 5JPNA 5F88B 1Z5YD 3FYIB 2IF7A 2GIYA 4MXWL 4LCYA 2Z31A 1IKFH 4YS4A 3FONB 2VQTA 2CJUH 5I1AA 1S7XA 4PJ5D 5CJ8A 2ITCA 4C56E 1XEDA 1XR8B 3MZGB 3AFLA 2QQKH 2F8XC 3EF7A 3OPZH 3OBAA 5GJTH 3GMMB 2FATL 2EZ0C 2EEDA 5FA3A 2ZCKH 3GSXB 4PYGA 3TBTA 1DJGA 5T8IA 4HGMA 1LL1A 1D7FA 1R3JB 4UOW1 4Z3HA 3V0JA 4PUBH 5LDSA 1UH3A 1RUML 1ACYH 3MV9B 5I74B 2VM9A 4L18A 2MQ0A 2IVFC 1I9JH 2X4SB 3WTWA 5DSCA 1P5UC 4BFOA 5EIIB 3A4AA 5FOJA 2YN3A 1MEXH 4FERA 4X9YA 4APXA 4NFDA 2R29H 4BGLA 2XN2A 4HIIA 1TJHL 3LIZA 1F11A 4UZUA 3G6DH 1QWUA 3QYCA 4R96A 4BKSC 1F4WL 4C4KO 2DH2A 2K4AA 2VN4A 2H3NA 3HUJB 2NW2B 2W07B 5D1QD 5E6YA 4EE2A 2CDFB 4R7VA 1U3HB 4FYSA 3QDJB 4ZW8A 3BLBA 4MD5A 2WM0A 3T3MF 4H8QA 4RFOH 1DP0A 3CPLA 1H5BB 4OZFB 1JTPA 1NAML 4LLMB 3II3A 4MMZB 1OAUL 3L4ZA 3FNKA 1BZ9B 3E3QC 3FQUB 3S7GA 3TPKA 2X4UB 2HVKB 1RUQH 3QXAA 3RPIB 1FZKB 3CNKA 4OGAD 2DLFL 3AT9A 4MXQC 1AG6A 4HCRH 3WELA 4XC1L 5HYQA 1SYSB 5L2KD 1O75A 2QDVA 3C75A 1J8RA 3QUMA 5F0PB 3N55A 3EH5B 4WW1B 3VVWA 3ZTJH 1HQ4A 4DKEH 3P1VA 4GP8B 4HF5H 5I6KA 4KKLC 1ND0A 1SJEB 1V3KA 3I6LD 3QIBB 1NEZA 1ZHLA 4IRZH 5C0RH 2A7BA 3Q7JA 1QAWA 1FRGH 3EKCA 1XIWB 4HPYL 2AERT 4TLSA 3SGEI 2NY3D 4MZ2A 1N8ZA 4WW2F 3MOBH 1INEH 1UT1A 3R0NA 1AD0B 2BC4B 4MJIE 4X6BB 2A6JB 4KO9A 3OF6A 1RIVL 1AHKA 1LO0L 4HBCL 5AL0A 3RHWK 4PJ6A 2P5WD 4Y9BA 1XCXA 4RIRA 2VJXA 1QBMH 2IXQA 1KLUA 1H3PL 2XYCA 3UTPD 3HHSA 1KIQB 1EZVY 4LCCB 1YUHA 3VQLA 5F3HA 1AMYA 1U8JA 5J1SC 1CL7H 4XBGA 2EE2A 2OK0L 1NFIA 5IMMA 3OMIB 1TPXC 5E1QA 1UD2A 3ZQ9A 4UQDA 1XZ0B 2H26A 1A6UL 3O8XC 5KW9L 2H6UA 3ML9A 4MCYB 1W8NA 3CXDH 3MJ7B 4AYID 3MI6A 5IIEA 3U46A 4WENB 4IMKA 12E8L 1CU4H 2FJGA 2NQDA 2EDRA 5FYKD 1EVTC 4UM8B 3A6CL 5ECGA 5EF1A 2R4RL 3EUUA 3UAAA 3JWOL 1XSJA 4NBZB 4JAMB 1NBVL 1SYVA 1YO4A 2CNYA 2Z4TA 4OCRL 4OB5L 4PU2A 4DO5A 4YLCA 5ITBL 2VL5B 5L2KE 2BNQB 5T3XH 4U3SA 1PDKB 4HIQA 2N0KA 2EDKA 2DYPA 2Q1EA 3DJSA 1GY1A 1LK2B 1EAQA 3OR6B 1HHHB 4JKPH 5JUEL 5BJTA 2OAAA 1JV5A 2NNCA 3QUZA 3RUGE 1MFCL 4XMVA 3IU4L 1E9OB 3QA3B 4PG2C 1WGVA 3LB6D 4Z7NE 2G75A 4DZ8B 4PI2A 4HS8H 3PREA 3STZB 2B39A 2QGBA 2DDQL 4L8SC 3PXHA 5AVSB 2X9XA 4GQZA 1YQVH 4TQEH 3QDJD 1B0IA 3G6JB 3EBHA 4P2RA 4QXGL 5D8JH 2YWYA 3MRGB 3QR2A 4P2OD 3X14A 3V4VH 4NEHB 1IAIH 4A66A 5CJBA 1N64H 1GZHA 3AAZB 2DQFB 3HLKA 1M1XA 3LZOA 3QXDA 4UUJA 4RDQG 1A9BB 3ZK0A 4KHXH 3UAJD 2XVKA 3D52A 1WIPA 1KCUH 5I1AB 2R0KH 3DETC 4R7LA 1YYML 3K80A 4EN3B 2NX5D 4KDTC 2EDLA 2PPCA 4QXUL 1YYLL 3MV9D 2WHVA 3MLPA 4JDVA 3TIDA 1C5DB 4J3OF 3PL6A 3IAGC 1IM3B 4XX1E 5J12C 2QL1A 3OWEA 3BKML 1W15A 2VZ1A 3KYNA 2NY1C 1U92B 3LRLA 3BGMA 3WXWL 3BAXA 5IB1B 3L3KA 1BG9A 2R0WH 3FT1A 3C08L 2X4SA 2VRAA 3COOA 3DX0A 3KYKH 2ITEA 5EU3B 3TYFA 4R7DB 3C60B 5JXEC 2AEWA 2ORBH 1JAEA 1IM9A 3BWAA 4JY5H 5JZ7D 4B9IA 3MV7B 3KS0H 3L3HB 5IFHL 1CMOA 4N68A 3QH3A 2HVBA 1NOAA 2FD6L 2VXSL 3QRBA 4KU1A 3K4DA 2NW2A 2W07A 1HKFA 4HG4J 3AROA 3LKNB 4YO0B 5TE4L 3VGGA 4PWGA 4N90E 4R4FL 1HTYA 3WD5L 1MREH 1X5LA 4WJ5B 2BFVL 4ZSOB 1CLZL 3GSUA 2BZDA 4WI8A 1RLBA 2VXTL 3VACA 5H37A 2X6VA 1IGML 4LCWE 4CVXA 1IBYA 2GT9A 2A5UA 2QDWA 2XN9D 3OKDA 3VM5A 1IC5L 3QPQC 2CUIA 3MZTA 1XF3B 4IW4C 2CCWA 4CN1A 3QJFB 2XXCB 3BQVA 2NX5B 1BF2A 3TESA 3PJNA 2DYRB 5CAYB 4OQTA 4K3EH 1J9CT 1GYVA 2DQCH 3NIGE 2J71A 3PWJA 4K7FA 2YAOA 1LYQA 2R1YA 3EGXB 5BQ7A 2N4IA 5D7SH 3VGBA 1J1OL 5D9SB 1TZGH 3SDCC 5CZVH 3T1WA 2J8OA 4UOJA 3DTDA 4XO3A 4HKBB 2OQJA 2PCXA 2ADJA 1S5HA 2V5SA 2NT1A 3IDGA 1WHOA 3D50A 5C09B 3CXFA 1MH5B 3MJ9A 2VN3A 1OEZW 3F84A 5IUSA 1ERNA 1TZIA 4OJCA 1DCEA 5IM7B 5A2JH 2O6FA 3B56A 5FYJD 1NKRA 2DJUA 2OTPA 3K0WA 4PRPB 4R4BA 5HD8D 5LGHH 2N3JA 4KMQA 1WITA 4RESB 2RA1A 2DIAA 4FXGB 4R7NB 5AUMA 4ZFZB 2DIEA 4GI6A 4MX7B 4R2GC 1IGYB 4PJEE 3S3DB 4AJ0A 2XV2A 3TV3L 1UM6H 1Z5HA 3I2CL 4IQHA 3I6GA 3FTZA 5FUCC 3VXMB 3FCGA 4CVWA 4PR5B 4KVCL 1JFQH 1BM3H 2OMTB 1M7UA 5IHUL 1YUKB 3HBGA 4FX5A 5I6PA 1RK7A 3CCHB 5JHDD 2YHGA 4OD1H 2JSFA 3LKPA 3JYCA 1AJ7H 2MNWA 4Z3TA 4IU2A 2XZCL 5KSBB 1Q1JL 1UOLA 2FT7A 2IV8A 3RWCB 4QRPB 4KJYA 3HNTL 1XF4B 4S1QH 3RTLA 1PKQE 1Q9LB 5SV3A 3ZE1E 3KPSB 1OZUA 1HT6A 5EUKB 5J3HD 4PJIE 2V2XB 1UD6A 5IB2B 3OKNA 3DOIA 4M61B 1CGXA 1R5IA 2ZSVB 3AS1A 3DUHA 4BV1A 5T5FL 3DBXB 5FYKL 1YEJL 3F62A 2P8LB 2ZOUA 2VDOH 5ENWB 4S11A 5J6SA 1I4FA 1FLRL 5LNGA 2JJTA 5AKRA 2NYYD 3STZA 2WVUA 3KPPA 1WD9A 5I1JH 2G5BB 1YDPA 4JE4B 5G4MA 1F02I 4KO5A 5C2BL 4OAWB 2APTA 1WS7A 3U1SL 5GJSL 3CN1A 1BVLB 3FF8A 2O6PA 1DSFH 4KXDA 4I85A 2WB1A 2R23B 5D7KE 4M00A 1YNKL 2DLEA 3D39A 4GO9A 1EZVX 4QNPF 3VH8B 3TU6A 1H3PH 1TTRA 4Y9GA 4BUHA 5HHME 1E7VA 4ZNEA 3Q5OA 3HG0A 2XZAH 1RZFL 2G3NA 3NIGF 4HT1H 4L9LA 3RX5A 4I48A 5T3XE 1E43A 3ABKB 5JPMB 4PTUB 2COQA 3LEVH 2HH0H 4Z7QE 4JPQA 1CICA 4TQIA 1ORQA 2WXGA 4JDVB 4JN1L 3TIDB 4DUXA 4P06A 3PL6B 2G9HA 4OD3L 4XP4L 1YN7A 1QI4A 3WTVA 3NQKA 4NQTA 4YZFF 1XB3A 4YEEA 1KPVA 2JCCA 4FI6A 4AQ1C 5K9QG 5BS0E 1SJXA 1ZS8B 4HWUA 4MXVE 1CYGA 2XQYG 1N5AA 5E00B 3VWJA 4P04A 3DTXA 3BPLB 3BXNA 1L9NA 1FN4B 3SKJL 1VAHA 1KLFB 2GTZA 2RHEA 5L88L 3ESMA 2HTKD 4FDWA 3ZDYE 3QIWA 1WT5C 3FRUB 3WIHL 4NKDB 4UM9B 3Q44A 2CKBH 4PJEF 3RRQA 4ZTOL 2EXTA 4PRPD 4Z7IA 4LU5H 4N8CL 1ZSHA 2D3LA 4Y4KB 4LIQE 3K4ZA 5F97E 1AANA 1G87A 4JB9H 1G7QB 4AKPA 3K6SA 3UTQB 3V6BR 1WHPA 5JOFA 3GSXA 1JXGA 4L8BB 4AVJA 3IFLL 3NK4A 4HJJL 1IBDA 2QHRH 4N2NA 1KYOK 4NO5A 4DHLA 4QOKD 4ZBJA 1KTDB 2VDRL 3EW3B 4M1GL 3MA9H 3VRJB 3F5WA 3GXMA 4LLAA 1KUMA 3N91A 2ALAA 3S96B 3CC1A 3LRKA 3NJNA 1S7SA 4FN0A 3F00A 4HIIB 3VM7A 6TAAA 2ZG1A 3CG8A 2VJ0A 3ARSA 3BT2L 3DIFA 3QQ4B 5DJ2B 5E56A 3UBXI 5IJVB 1UQSA 1XAKA 1MUJA 4OIFA 2PTTA 1BQSA 3MLYH 2PO6D 4HXBH 2MQGA 1A1NA 2X41A 5BQ7B 1CUOA 3CH1B 5BUPA 3QDJA 5D9SA 4G8GB 1LQBC 3Q8BA 4JGMA 1MCKA 3JUYA 4AGQA 5C9JB 2NY3C 5E8EB 4HKBA 1IBBA 3PYCA 4FCHA 5JQ6H 1Z9LA 3IDGB 2GI0A 3QJVB 5JOEA 3EJSA 2JB5H 3RIAF 5CLXA 3HI6L 1WAAE 1KTCA 2XWBA 1H9DA 4JQXC 2J8HA 3PV6B 1TZIB 4HS8L 4TSAH 4XAKD 3SSGA 5IM7A 4NZUL 1EXHA 3VXRD 3Q5YA 3H9SA 5AVVB 3BVTA 3ARED 1DVFA 1EA9C 2XWCA 5C07A 2ED9A 1QNZL 5LNDA 4X0NA 2Q76B 1B2WH 2I9LB 1E5UI 3L9EA 1BXUA 2OYLA 2Q8AL 4NUJA 1B4JL 2VXUH 2BNUB 4JRXE 1T4WA 4MAYA 4Q2ZA 1DJSA 1NCTA 5CEZD 4RMVA 4WO4B 1CYWA 3QHZL 4P4KD 5DUML 3V55A 5DFVC 1UXWB 3HN8A 4X8GA 4BFFA 4LQFH 5IB5A 4JR9L 1Q1PA 1YHPA 3VXUA 3VMPA 3ULVD 4LRNH 1FFRA 3L5WB 3OJMB 4HGWB 4LSPH 4AMKH 1BLNA 4RIRB 5AW5B 5DD6B 2KLSA 2WKLA 1WA2X 2VCOA 2CHZA 5BV7L 4K4KA 5I6XC 5IHBA 4WCYL 5I1EL 4U6VL 1FBIH 3N1FC 3WSQH 2Z34A 1L0XA 4U1NA 2JTYA 3EIFA 1NFIB 3KHQA 1P53A 4LPVA 1FSKC 1W8OA 5I0XA 4J3WA 3QJOA 5KSBF 5BRZE 3M8OH 1S2EA 2EEFA 3TC9A 4HWNA 1S7VB 5IVNA 2Z1PA 1HKLL 5I76B 4UQAA 2QGDA 4PRAB 5BQDA 5K9QI 1A6WH 2ITDB 1ZVSB 2VR7A 5TK2A 2PYEE 1EAOA 4AYMC 2AK1L 3C9NA 4WGVB 3KLAA 3O6LL 2D9CA 4EDXA 4WDIB 3FFOA 3KW8A 2APWA 1AI1H 3V0HA 4BH7A 1Y0LB 2ICWA 3HB3B 4ZUSA 4BSJA 1FGNH 5BO0D 1HHHA 2JXMA 4E9TA 2F7QA 4I48B 2VAAB 1SJVA 4M6OH 4IU3A 4WFFD 3TO2A 1AP2B 1OSEA 3VFTA 5J1AB 2D73A 1CIDA 4DN4L 4EXPX 3PY9A 5FO9A 1HKLH 2YK1L 5IFJB 4OCYL 4J27A 3UPAA 1CXHA 1DJIA 1CTMA 1RZ7L 3OL2A 5FDWB 1USQA 5A2BA 1S7WA 3BPOC 3L7EB 5DA4A 2BVPB 2NXZB 4FLOA 5HHOE 1LO5B 4PJXB 1I1YA 5AOMA 2GVYA 1T7XA 1Z5LA 4OLZH 5D72H 4X0KB 3JTTB 1J7VR 3VWJB 2FGWH 2FIRT 2BX5A 3FAXA 3LHPH 3FFCE 2OJEB 3MNVA 7FABL 2GKIA 2Z6FA 3QIWB 1BJMA 1FL3B 2XVBA 4FQIH 1JHLH 1MRCL 1UB6B 5C7ZA 2AJ3A 1ZOXA 1VPOH 5JZ7C 5E08H 1ASPA 5ERWB 4HDIA 4HCRL 4N2DA 4OLVL 4O00A 1HS6A 5EC1A 3RL2A 3QHFL 5FGCB 2W9DH 4LOUC 1HXMB 4NB7A 1O7VA 3WFCL 3CXHK 4WEMB 3SE4A 4QTHB 4YMPA 3Q6GL 3KWWA 2Y6SD 3BVWA 1LWHA 3ZN6A 4P2CG 3BN9C 3LH2H 1KTDA 4AQ8A 4P5TC 2O5NA 2JK5A 4FQIL 5EDXA 2L7UA 5INCA 1MFNA 4QHLB 4D9QD 1CLOL 1TQBB 4WWKD 2UY6B 2XI9A 3C6EA 4ICWA 3RFZA 3BAWA 1NGXA 1IJNA 5KZCD 2XQBL 2YRPA 4MAYD 2ZJSH 2VMEA 7CGTA 3I3BA 3IDXH 4IRJB 2A9BA 4PLJC 1SMDA 5ABAA 1R3KB 2Z65C 1VIWA 1OTTC 3GLEA 1CG9A 4RMRA 2X12A 2WXQA 3ZR6A 5C9JA 5H35B 2F19H 4Y88A 5ITFB 4WKXA 5I8OH 2R8SH 1WD8A 4K9JA 2XPYA 4HKXB 3FT0A 5I17B 5SWZB 1JZEA 4ELKB 1M6OA 5ALBL 2OZ4A 4X4ZA 3S34L 4TXVB 4RWYL 4XODA 3EHBB 2BCKA 2F74B 1JWSB 3QNFA 2AITA 3BDBA 1OQXA 5CF3A 5I15H 1IE5A 4XTRD 4WO0A 1DQMH 2V9RA 4NUQA 4AUYA 1OK0A 5DZ9A 2GEQA 1GC1C 1NGWB 1WBXA 4RDQF 1JN6B 3NRQA 2IGFH 4H0HB 4QTFA 4BSVB 1PYWB 4LSUH 4FC3E 1CVRA 1NSNL 2GIXA 1KLGB 1HDMB 1P4IL 4L9DA 1MLCB 1U4FA 5KUKA 2RQ8A 4IHBA 1DVFD 2H3KA 4WGWB 4UINH 2WXMA 2QHRL 1C12B 5C6WH 3W39A 5ABDE 3SDDD 4B9KC 2HSIA 3IE4A 5HHXH 1OCWH 3DX3A 1WIOA 3HOGA 2FX8H 4DP4X 2YR3A 1V55B 1HYSC 4JN1H 3LS4L 2IGFL 3EYSH 4PJ9A 4WUKL 3SKUD 3CZKA 1BLNB 4ZX3A 2V9UA 1R3JA 4KTEL 3VX1A 7TAAA 2WGNB 5JIIA 5LBGA 2CJ3A 5T5NF 3ZL4L 3RDTA 3EOTH 3FO2A 3B2VL 3AY4C 4PJHE 1NPJA 2RIKA 1HL4A 2WNXA 4IRSA 5A43C 4OLXL 4F1SA 4YEFA 3D0VB 1ZLVK 4Z8FL 3AQZA 3DMMD 4HFWB 3MRRB 2H3NB 4PGZA 1YYLH 1ZA3A 4L8DB 1KBGH 1TZHA 1ZJAA 1HYRC 4WWPA 4AQOA 4B50A 1QA9B 4J8QA 5IQNA 4MD5B 4JCWA 1E5ZA 4QRSB 2QEJA 5KSUB 4PJ9C 4FQHB 1ZIAA 4GEIA 1MVFA 1SZNA 1ZLWK 1H3WM 4MB5A 4ZX5A 5BVJA 2IALB 3EF4A 1BYNA 4L1DA 3HLAA 1XB6A 4P48A 3R1GL 4FTVE 1SMOA 2GSMB 5E51A 1OSPL 2ZSVA 3MPCA 5F7DA 1AGDB 3O6FD 1AZRA 3SDXF 4NN6B 2VQ1A 3O3DB 5DZVA 3T6XA 3U7YH 2H2SD 3N41F 5IGXL 2RTTA 3X1BA 5E4EC 4ZYKB 2BSED 2C9XA 3F7QA 5GS1B 2AQPA 2PR4H 1RMFL 2CM5A 1I31A 2LOEA 4YDNA 1CD9B 2Y4SA 2AXGA 3JWOC 4MYPA 4OAWA 5D7LB 2ENJA 1JF5A 4HXBL 2XACC 1T22B 3ZJAA 1FH5L 2B3IA 3MNDA 2ZOKB 1RHHA 1JK9A 3Q3GB 4EKJA 3IDMA 3QO1B 4IS6A 5IQ7L 3Q8AA 2ZOTA 2XETA 1N8ZB 4PJCF 4LGSB 2F53A 2AXWA 2DQIL 1K6QH 1AD0A 4X6BA 1F58L 1KPRA 4QJ4B 4JQXA 1ZHKB 2ZG2A 3GMNB 4K2UH 5EO1B 2BS9A 2G30A 4N6QA 1OD7A 3DROB 1IGFH 3BPNC 4B95C 5IBUG 3SD2A 5IVXF 1QHQA 5ERWA 4GSRA 4DKAA 1TO4A 2OSLA 3FHAA 2VLJB 3BOVA 3GINA 5FM5O 1LEKA 3NEEA 1PAZA 1ID2A 4Q6IB 1RU9H 4FCAA 1MEXL 5F3HB 5IESL 3GI9L 2G3XA 1AXSB 3CVHA 4WWKB 4F8QA 1ZJBA 4ZT1A 1N70A 2KDGA 3APFA 3EH3B 1DBAH 1P2CB 1KJ2B 2VDPH 4CL7A 3IE9A 4Q56A 2FT6A 4EF3A 1FN4A 1CE1H 1GSKA 1XF2A 4GI8A 1XMEB 2H4EA 4G9FB 3LDBB 1E6OL 5D1XD 4ZMYA 1LE5B 1WP6A 3X3FH 2GITB 1VZIA 4YE4L 2GPZA 3G9VA 3TIEA 4JAMA 4JUSA 4HSCX 1CGYA 4XMZA 4KK9D 5I1JL 1JNNL 3MREB 4DFHA 3RTQD 3BAYA 3D09A 4PHZA 1T21A 4S2SA 3D48R 4GINA 1G94A 5HVHC 1RIUH 2ESVB 4B6ZA 1KV3A 1QABA 3B7SA 3KH3A 4F7MB 3HPLB 1GZQA 4HS3B 5BZWA 1PCSA 1DTUA 4PI0A 5C9KA 2W81C 1LMIA 1ZGLA 2XCMC 3FHQA 4DKEL 2X6CA 2VZSA 2VLRD 2CGZA 2NT0A 4LT7A 1M6OB 3PWPB 2A9NL 3D25B 5IEHB 2F1BA 3SE3A 1QSEA 4OTXH 3IGLA 1QSED 2BY3A 2OS7A 3O9WC 3T4YA 1ET8A 3VFVA 4F8TA 4F9PA 5DZPA 1KCVH 5CEZE 5BO1L 2DQ6A 5LBSA 1KIPB 3SPIA 2VLRA 1UOKA 1UXMA 1VADA 1U30A 2LE9A 5ISZB 3MRFA 1PQZA 2OJZH 1DQLH 4G8AC 3QBTB 4RMBA 4FYTA 4NERA 3R4RA 5DJDB 2O6DA 1HNGA 4ENED 4QRRE 1ZANL 3LTVA 2VDOB 3T5WA 4ZMWA 4KXZH 3TT1L 1T83A 1CXKA 4HMDA 5E70A 4P8QA 5DMJB 1C12A 3RTQA 4CW1A 4FD0A 2Q7NA 1RCYA 1I8MB 4OCSL 1R24B 4JFDE 3VXRE 2LV4A 2ARJB 3FN3A 4S1RL 4PCTA 4WFHE 4G42B 3GO1L 5G55A 3X1EA 4YHNB 5HDLA 3CPUA 1OCRB 3WKML 4PJCB 5I1DB 2JH2A 2XWDA 4BZ1A 3OQRA 4MAUL 4M7ZC 5ESQB 4NO0A 1MCCA 2JJVA 4GW5B 4NZDA 4JO8A 1ORSA 1RFDH 2OULB 4ZAKB 3MDJA 2VLKA 4WV1A 4L8CA 3HG1E 3D0VA 4MAYB 3O45A 4Q2ZB 4EBQL 5A6IA 1UA7A 1XX9C 1TZAA 3GJEA 1JK8B 5C71A 3MTXA 3WFDL 1Y6NR 1F90L 3M17B 2UUDH 4PP1D 4IDLA 2BOCA 4NKOA 1KN2L 4Y4HC 3VXUB 1QLEB 1LDSA 3L5WA 4HGWA 4O4YL 3NIGB 4QRSA 4FQHA 1NJ9B 1SVBA 2LFEA 2X5PA 3HI5H 5DD6A 3LPPA 2Z7ZA 2XQYA 3MRDA 4NKIL 3NIDB 1MJ7L 4KZ0A 2VSMB 3HZ3A 4LLWB 4WU5A 4DUWA 3V4VL 3IGFA 2VDMB 3D07A 3OKLB 5F7HA 2NX5A 1B2YA 2NZ9D 4KKAD 4NPKA 4UB0H 3G5XB 5B1BB 1H3VA 1E6JH 4UT6H 2W60A 3W9DB 2YGVA 3S35H 3ORJA 2R1YB 2VUYA 2ZAIA 5EF0A 4HU8A 3VI4B 3CVHL 3BSZH 4N28A 5HI4C 3NEXA 3O6FA 4BH8A 3B3IB 1EJOL 1HQRA 2C3HA 1KELH 1OAXL 5K9KB 4ZW6A 3ZTDC 4B7LA 1RZKC 1WAPA 2HTLC 3G5VB 2SEBA 2B8OT 3TL5A 1Y0LA 2ICWB 2JMRA 3FS9A 4HJSA 4X6FB 5DHXB 1F45A 4Z76A 4MNGA 3OAYH 4UB0L 4DO4A 4R4NC 2E56A 2JJWA 1G1YA 1Y1UA 2B1AL 3H7BB 1GRWA 3ZO0A 3SGKC 4J39A 2XN1A 3QZLA 1A4JA 3G04A 3ZDXB 4TNGA 4Y1AE 2QQNH 4G6KH 1JZHA 2ZUQB 4XVSL 4GQ9L 3ZMRA 4OIIH 4ODHH 4Q0XH 2WNWA 3A4EA 2VMCA 4WLCA 3OAZK 4AEIH 1NM4A 2F8IA 4GRLC 1NKGA 2GK0B 5BV7H 2ZSWB 4LBEA 1O5DT 2FX9L 5ID1A 5F44A 3RPKA 3BN9D 4R4FH 4PVMA 4J4PA 4L0ZA 3V0WH 2QSCH 3LKPB 5CUSH 1G7LA 1N3NB 3GTVA 4G9FA 5GGUA 2H1XA 3S88H 2OMYB 1HZLA 1WEJH 1W0YT 4DNLA 3VQMA 2Z92A 4NDMA 3WOVA 3H56A 2HJKB 4EIBA 4KNUA 3RVXD 4Y4FC 2JIXB 4I77L 3OKNB 2KI6A 5DR5L 5TPWH 1R5IB 2NXYB 3EH4B 4UWQB 2B77A 1GZQB 2DBLH 4UOZA 4EVNA 3ZIYA 3ELAT 1E4KC 2EAEA 1RZGB 3VDBA 3WTXA 2YD6A 5F7BA 5T1DH 1T89C 1JPTL 3LD8C 3PWPA 4EOWH 2Q8AH 4YDIL 3K1DA 2IQ9L 4ZTPH 4FLQA 4AMWA 4EPSA 1O6SA 3WJMB 2D31A 5JYLA 4DWHA 2VRKA 3LVTA 5JHDE 4V11A 5H94A 2EYRA 3FOMA 3T4YB 3VFVB 3S35X 2DQTL 4JO4L 2IV9A 2J20A 3FUEA 2XVLA 4HWBA 4ZFGH 1RZ7H 4GAAA 2X1OA 1LNUA 1RUAH 3WFHA 5E6UB 4NKMB 3CHQA 1R3KA 2LHAA 3TO4A 4MMYA 1OP5K 2IFGA 4HUXA 4DN3L 4PV9B 2X4PA 4YHIB 5SWSE 3QUML 3VD2A 2AZAA 2H6PB 4ZFOB 3GK8H 3MRCB 3DV4A 4QDGA 5CZXC 4I3RL 1CICB 1IGTA 1JWUB 1MJJB 3MRKB 1J11A 5GGSA 5LHDA 2ZAGA 5HGHB 4U1GC 2MNUA 1ZAGA 1A3QA 1V7MH 5K5YA 1VGKB 3BKCH 4MMXC 4CDHA 3CLEH 4PJCA 5I1DA 3IETA 2P1YA 1E28B 3STLB 4ELMF 4RMUA 4F2ME 1UD4A 1U4EA 4NHUB 3UO1L 3Q1SL 4Z7WA 5CCGE 5AOKA 3FULA 3FRUA 1RIUL 4B3VA 1DQIA 4ZQKB 4FOMA 4OGAC 1G6RB 4M5YH 5I5RA 5AZ2L 1TVHA 4MD0B 1MHHA 3AWGA 1KIRB 1JF1B 4A2MA 2EIBA 1ZRUA 3C6LC 2JCWA 3TOPA 4PJ7E 2PLTA 3VFSA 5HYSB 4U1HA 3IBOA 4KY1L 4NKOB 4IGBB 3KBPA 2E76C 3L1OH 4AG4L 4ODXA 5HSFA 2CA4A 2DIBA 1PCXA 3IGUA 1TJGH 2EP6A 5D1XA 5E9DD 3TPUB 1EGJL 3MN8A 2QQKL 5SV4A 4DN4H 1WVZA 1KB3A 3LKSB 1EDQA 4HX1B 1BXAA 4EI0A 2EDNA 4YSOA 5EU6D 5ADPL 4LLWA 1A6PA 5D1QA 3EXLA 3L4WA 5KSVA 4IRSB 2XG4A 3EO0B 2YJQA 1RPKA 2BVOB 2I7SA 2IANE 4IRZL 5CJQL 2WO4A 4CNIA 5B1CA 3VCLA 2J55A 1NGQL 2EO7A 3FBKA 1SBSL 1UB5B 3LZFH 2CMRH 4HWEL 2WCGA 3K8LA 4H8WL 3FQRA 1A1NB 2XU9A 1SN5A 1OK8A 3VQ2C 1QA9A 4TNWF 3EADA 4G8GA 2VLLA 1MFEH 4FEIA 5EMYA 2ZYRA 1G7JA 1R3IH 3FKUS 4FNRA 4M8VA 4GG6E 4TOYL 3ZQWA 3KPNB 3D69A 1AKJA 1NINA 5HI3C 3QFDA 4GOSA 5B21A 1GYUA 1AGBA 1MFUA 2GSIA 1AGDA 3L5JA 1TCMA 2WKOA 1NAMH 2VERA 1H6UA 1VFBA 1IVLA 3CBRA 3KLDA 4U1KB 5EU4A 4BZ2L 4EDWH 1A47A 2J1WA 4UNVA 5C6TL 1ETJA 1L7TL 2GHWB 4GXUM 4L4TA 1UEYA 4RH4A 4Z77B 1MHCB 2YPLB 4UV4L 1JDDA 1SM3H 3MRBB 3RWDA 2CE6A 3BW9A 4OT1L 1AXTL 1QRKA 2XFGB 4LKXA 5SWSB 3VWKB 3WI9A 3KBHE 2EVJA 1GS7A 3QUXA 4RA3A 2AP2A 1RHHB 2BXZA 3RG1C 1YNTA 3HI5L 1FO0H 3P40A 4M48H 2A77H 3ZYOA 4I88A 3UABA 1X6NA 3L1GA 3ZYZA 2XZAL 1L3NA 3BESR 3HA0A 5D1XC 3V4VB 4R3SB 4XI5C 3FN9A 4PRIA 3U4EB 2OMYA 4OLXH 3T04D 2CRIA 3T2PA 4DP1X 2PPAA 4GFXA 5K39B 4MKTA 5F21B 4RETB 3IF1A 4Y5YB 5IQOA 32C2A 5J5EA 3UBGA 3ARGB 3W11C 3IJ7A 4MAUH 1NIEA 5EORL 1I3VA 3DETD 4YXHH 4WU7A 1U33A 4XMUA 1RSYA 3VSUA 2K1MA 4QJ5B 3SGKA 3RURA 3FH7A 1MCRA 2GJPA 2NY0B 4PBDA 1WCBA 5D4HA 1OW0A 5IBLD 1N10A 1L6PA 1WG3A 2YKLH 3LSOA 3FRPB 1KJ3H 5AL8A 3DHJA 3IDJB 4YAQB 1UYWH 4YBLB 3WIHH 4RFEB 1FHNA 1QBLL 1ADQL 3WJMA 3AG1B 5LWYH 2WUCL 5B7MA 1Z3GH 4L0YA 1BD2E 4IKLA 1VLXA 2IH8A 3AY2A 2DQUL 4FQ1L 3EJYD 1J9SA 4IBQA 2MEJB 5F7MC 3H9HB 2P80A 4ZUUB 3RIAK 3HJ0A 3L2LA 2YOCA 1CT8A 4N9OB 4PGCB 2J12B 5FUZL 4ZUSB 1MXGA 2DH3A 5GGRA 5ACLA 1K5NA 3MOAL 3ARBC 4KUCF 2ADIA 2NR6D 4GRMB 4ODWB 4XPBL 3BP7A 4UDUB 5HJ3A 2BDNH 3U6XA 1OPGH 3BGFC 1D5XB 4ELDA 4F58L 3V0GA 5J57B 3QFJA 3QUKB 4MS8C 4PVLA 5GGSB 1OD9A 5FWRA 25C8L 4BK5A 4IJ3C 3EFDL 1SEBB 4BFNA 3L5XL 3CVDA 1VGKA 4E68A 4G83A 3U9WA 2A74C 5FUZH 1KIPA 1KIUB