5I6NA

Crystal structure of copper nitrite reductase at 100k after 11.73 mgy
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
b'DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 94
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6nA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6nA02
1OCOB 2Q9OA 2VMJA 1PNDA 3IEAA 1WA2X 1IBYA 3SQRA 5B1BB 3ABKB 1RCYA 2BHFA 1XB3A 3ABMB 5D4IA 4AZUA 4HCFA 4ENZA 1PZAA 2MRYA 3NYKA 3T71A 4FAAB 1BXAA 1UATA 2I7SA 2RACA 1NWOA 2GIMA 2PPFA 2BW5A 3G5WA 3QQXA 3FU7A 1YLBB 5I6LA 5PAZA 1PAZA 1J9TA 3T6WA 1TU2A 5I6MA 1QNIA 1IKOP 3ZDWA 3JTBA 4CSPA 1HFUA 1KYAA 4G71B 4N8UA 3TU6A 2DYSB 2IDFA 2AZAA 1OE3A 4RH4A 2Y1AA 4AKQA 1R1CA 1BYPA 1PNCA 1WAEA 3FU9A 3CVDA 3QJUB 1PCSA 1WS7A 3V9CA 1IC0A 4M3HA 1SNRA 1JXDA 2IDUA 3WKPA 1M9WA 5D4HA 3RYMA 3UAEA 3X1NA 2XU9A 1OV8A 4QLWA 1NDTA 2FT6A 2FJSA 2YARA 3FT0A 2VM4A 3PXLA 1CC3A 3CDZB 5E9NA 2FQEA 3T6XA 1OCZB 3OQRA 1BXUA 4KNSA 1SF3A 3AG4B 1E30A 3FQ2A 2PPAA 3MX0B 3QJTB 4BWTA 2XXFA 2YAEA 3ABLB 4E9VA 3DIVA 3N2JA 2DWSA 2EIMB 4HHWA 4MFHA 1ET7A 1ADWA 2XX0A 4A68A 1OCRB 1W6LA 3X1EA 3KW8A 4DP7X 2VW6A 3OM3B 1KDJA 2TSBA 3H56A 2VW4A 3FQYA 1PF3A 5ANHA 1FA4A 3NP3A 3UADA 1JZJA 2IDQA 4BXSV 4YSUA 1QHQA 3NSDA 4UAHA 3SBRA 4E9RA 2OJ1A 2VW7A 2IWEA 2BP8A 3PPSA 2XXGA 3WNIA 2BW4A 2HX8A 1ID2A 2QPEB 4A67A 1KCBA 1ASOA 1SFHA 1JZIA 4DP8X 4HALA 1AZUA 2PPEA 3MBWB 1J9QA 4YSAA 1AS8A 1ZDSA 5TK4A 2Y69B 3TA4D 2LLNA 1OCCB 4BWWA 4DPBX 1KBVA 2J5WA 3L45A 2JXMA 1J5CA 4K9JA 2Q5BA 2BP0B 4YSOA 1SF5A 3HEIB 4GYBA 4Q89A 1AZBA 2FNWA 2IH8A 3NSCA 4YVUA 3WI9A 2UX6A 4YVNA 4HIPA 1NPNA 1BEXA 1PLCA 3QJRB 5B1JC 3UAAA 4DP0X 3NSYA 1KDIA 1A4CA 1AAJA 5I6PA 1A3ZA 1BAWA 3ZIYA 1AZRA 2GHZA 5AFAA 1MG3C 2P80D 4KO7A 3GYRA 4KO5A 5B1KA 4UF7C 1ZIAA 1SHXA 1SFDA 2BZ7A 3FSWA 5IY5B 2YQBA 1PY0A 8PAZA 2UXTA 4BXVA 3EH4B 4G7QB 1ILUA 4E9XA 2HRGA 4BK5C 4DP9X 1MG2C 4QKTA 1J5DA 1WA0X 2H5UA 2TSAA 2YAPA 5B1JA 3WKQA 2DV6A 2EINB 1N68A 4GP4B 5B7FA 1BQRA 2UX7A 1AZNA 3X2QB 3BVDB 2X88A 4A2DA 2XV2A 1HAUA 1V54B 4G72B 5I28A 5LDUA 2PP9A 2HRHA 3QJVB 1TEFA 3HB3B 3SBPA 1A4BA 4AKOA 1ZV2A 4FA7B 3UACA 2PPDA 1GR7A 2FT8A 1CYWA 1T5KA 3ABGA 1CYXA 1GS6X 2UXFA 4DP2X 1F56A 2HXAA 3C75A 3X1GA 2VSMB 1L9PA 2CAKA 3AZUA 3FPYA 4KO9A 1JVLA 3FPXA 3S8GB 3ZX1A 3IE9A 3AW5A 1JZFA 3NJMA 2YAQA 4NB7A 2YXWA 1URIA 2AANA 2EILB 4YSSA 1OE1A 3OD3A 2QT6A 2PCFA 1ZDQA 2OCCB 2PLTA 3CG8A 1PMYA 3ASNB 1A65A 1GS7A 2QPDB 1KBWA 1NZRA 4AX3A 1J9SA 1AZCA 2PP7A 2WSDA 4YSTA 3ERXA 1GY1A 3EH3B 2X87A 1MZYA 3NJIA 4HCIA 3FU7B 4JKNA 5TK2A 1WA1X 2CCWA 4BDVA 2AZUA 4CSZA 4E9SA 6PAZA 2IWFA 2ZOOA 2R7EA 2UXGA 1RZPA 1GS8A 1GY2A 2XUWA 2IH9A 4E9WA 1VLXA 5B1AB 2MTAA 1PLAA 2VN3A 1SJMA 4YSDA 1NWPA 4WKXA 3OMNB 1KGYE 1A4AA 1DZ0A 3NSFA 1MDAA 4W9ZA 1JZHA 4DPAX 3CVCA 2AVFA 1AS6A 4KOCA 5I6NA 3AG2B 6PCYA 1X9UA 1KCWA 4Q8BA 2DWTA 2I7OA 2FTAA 9PCYA 1I53A 1NICA 2VSKB 1EZLA 3FSAA 1NIAA 1AACA 2XX1A 1ASQA 1X9RA 1W8EA 2A3TA 1J9RA 1BYOA 1ET8A 4GP8B 4UANA 5B3SB 3FQ1A 5PCYA 3FU8A 3UGEA 2CBPA 1GSKA 2AFNA 2IDSA 3NT0A 1JVOA 1PZCA 1M57B 1AIZA 1L9SA 5FC9A 3OMIB 3DKHA 2FWLB 2W8CA 2HZHA 2GI0A 2ZONA 3PLYA 1EHKB 1JXFA 3AG1B 1AG6A 3S3DB 2BO0A 2R7EB 3KW7A 1ZPUA 4WTQA 1SDDA 2PCYA 4F7KA 4HAKA 1V10A 2QDVA 1GW0A 2JKWA 2XV0A 4JHVA 3JT2A 4KNUA 4DP5X 2GC7C 2BP8B 3TASA 4E9QA 2I85A 2XWZA 3PAZA 4PAZA 4A2HA 3BQVA 3FYIB 1BQ5A 1OE2A 2FQDA 4G70B 2ZXWB 2NRDA 2XLLA 2HX9A 2IDTA 4A2EA 2UXVA 3CDZA 1NINA 3IBOA 5A7EA 2H47C 2XVBA 2YAMA 1JERA 3T9WA 4W1TA 1IBZA 5I26A 1JZEA 2CALA 7PAZA 1QLEB 3NJHA 1FWXA 2N0MA 5I6KA 1GYCA 1IUZA 2WO2B 1L9TA 3EHBB 4N4YB 2OV0A 1NPJA 4HHGA 2YAFA 1FFTB 1L9OA 1OOWA 1DYZA 1XB6A 4GXFA 1AS7A 1M56B 4KOBA 1L9QA 1JOIA 1CURA 3T6VA 3V9EA 1NTDA 2B3IA 2B08A 2YAOA 5AZUA 1AR1B 3NP4A 1ASPA 1E5ZA 2QDWA 2CJ3A 4A66A 1A8ZA 1AOZA 3OMAB 4NAJA 4F2EA 2DYRB 1RKRA 4E9TA 1SDDB 3X1FA 5F7BA 1HAWA 4M4RB 1ZIBA 2GSMB 4DPCX 4YSQA 2FQGA 2WO3B 1XB8A 4DP4X 1PZBA 1E67A 5B7MA 3WIAA 3EH5B 4A2FA 3WG7B 3UABA 2J55A 2J57A 3S3BB 1NIBA 2BP0A 4JHUA 2CUAA 3CZUB 3NJLA 2PPCA 4YSRA 2HLEB 1N70A 4YSEA 5I6OA 2BWIA 3X1BA 7PCYA 3H4HA 2YAHA 3PAUA 4A2GA 5I5MA 2PP8A 4NERA 1ETJA 3H4FA 2GC4C 3GXUB 2ZWNA 1AQ8A 1E5YA 3WNJA 2EIJB 4DP1X 2FQFA 4P5RA 2P80A 3CVBA 4ZK8A 4KNTA 2IWKA 3FSVA 4GY4A 2H3XC 4BWUA 3FS9A 2HX7A 4L0PB 4AI7A 4TXVB 5AKRA 1RZQA 1NIEA 2JFCA 4P5SA 2GBAA 3DTUB 3QJQB 3EF4A 5F7AA 1TEGA 3NJNA 2XYBA 3IN2A 4HZ1A 1SHWA 3S8FB 1W6WA 2XV3A 1XMEB 5EHFA 1V55B 1PLBA 1WS8A 2GB2A 3NJFA 4EF3A 2VM3A 5B7EA 2BWDA 3NJKA 3TBCA 3FSZA 1CUOA 3IN0A 3AG3B 1ET5A 3N55A 3S3CB 2DY2A 1ILSA 3QPKA 4HCGA 4G7SB 4GP5B 3QJSB 2YXVA 1NIDA 3NJGA 4X4KA 4YSPA 1OF0A 2E86A 3D12B 5I5IA 5I5JA 3AY2A 4AKPA 3GDCA 3NJJA 3U25A 1KV7A 1AANA 4BDVB 2EIKB 1TKWA 2FT7A 3PCYA 4G7RB 4F2FA 1JXGA 1L9RA 4E9YA 1BXVA 2IAAC 3FYEB 2J56A 3PAVA 3ZBMA 5D4JA 4YL4A 4PCYA 3ASOB 3SBQA 4KO6A 3TBBA 4YSCA 2W88A 1B3IA 1MZZA 1BQKA 1NIFA 3T6ZA 4DP6X 1AG0A 2BZCA 1JZGA 1E65A
chains in the Genus database with same CATH superfamily
1DJXA 2VMJA 4R7NB 3GJEA 2EVGA 1RULL 5AOJA 1UC6A 1FGVH 4KGJA 4Z3FA 1U8NB 4JKPH 3V4VA 1EHNA 3L3GA 3L5WB 2F15A 4Q58C 1U3HB 3BUQA 2E0PA 3OF6D 3CH1B 1E9PA 3F00A 2G2PA 4FQCH 1YJDC 4MD0A 3V0GA 1LEGA 3ZK0A 1JZ5A 1LEIB 1HDMB 1I1CA 1NMBL 1FF5A 2IANB 1A6ZA 1ZRUA 1HILA 3D85A 3EJYC 3NRQA 3K8MA 4ICXA 3VTAA 3Q2NA 5SX5K 5EEYA 3MJ8B 4FQ2L 3AS2A 2ZX7A 3FCTB 4PS4H 4N85A 4Q14A 4WI6A 3DX6B 3HHSB 3ILQD 2VAAB 1G7QA 4A6YA 3AT9A 3LEYH 4R4FH 4B6ZA 5DC2A 4OZGF 5DVLA 2R4RL 4LAQH 3ENEA 2X9XA 1GYWA 1PZ3A 4HU8A 1W72B 1PNCA 2PO6A 3BAKA 2P5EE 1T3FB 4FNQA 1FRGL 3QNXB 2WXFA 2DMBA 5AOMA 1EJOL 1XDTT 2FK9A 2ADYA 1CL7L 4UU9A 3C2AH 2MNWA 3PGCB 4AM0Q 3LRGA 1OV8A 5IKCB 5DJZB 3UTZB 5A2CA 4DGVH 3W11C 1SLWA 5FYJL 1KB5H 1X4YA 5F7LB 5H37A 3VG9C 1TZGH 5ADOL 1MI5D 2XWTB 3POHA 1FFPA 3ECVA 3WIIL 5T5NG 3FQWA 4WEUD 4C56A 3QJTB 4GS7B 3VI4A 1VA9A 4BWTA 1RI8A 2YAEA 1QW9A 4GI9A 4U3SB 2VLRA 4XOAA 2FECI 4PV9A 1U0QA 2QV2A 2KLRA 3PP3K 2FEEI 3QWRD 5MEQA 3BWUF 1SBSL 4GQ9L 3TF7C 2P47B 3NSDA 2DKSA 4S1SL 4XHJC 3C6SA 5JDSA 5KVGE 3U2IA 2G4EA 2MCPH 2UZYB 1I9RL 1EJFA 1BFOA 3QO1A 4U3CA 2RTTA 4GOSA 1OPGH 2HX8A 2KYIA 4WI7A 4D9QE 3VQLA 4NQQA 4YDVB 2B0SL 2I60L 3O9WD 1AZVA 1CDJA 3T09A 2DMGA 4DN4L 3MLUH 1F0LA 2C1PA 3DMMC 3GIZH 3ARED 4DGIH 1N10A 3L3HB 4WUUD 4KRPD 6FABL 4P05A 1HCFX 1SXZA 5DQ9A 5DI8B 5C0AE 3TCTA 2E7HA 5I75B 2AK4E 4WFEE 1AQDA 1AZBA 3GMLA 5IVXA 4WENB 1DVXA 4RBPH 5C0BD 4BELD 2W0FA 1R3HB 3EYVB 4Q2ZB 2QMKA 1E27B 1BSIA 3QJRB 4K8RH 3MLXL 5C07D 3MXVL 4LRNH 4Y4FC 3KYNA 3QXWA 4WY7L 1A4CA 1BXXA 2Y7QA 4PJ8A 1B2WL 4NRYB 3P4NA 1N0XH 1BZ9B 1WYJA 3OSVA 4UF7C 3WFBL 4D8PB 4P07A 4GSUA 4LDOB 3RGHA 3CDCA 3QBTB 4HSQA 4ZUWB 2OMUA 1KY7A 4RNRB 4N6QA 3H2QA 1YY9C 1OWRM 1FGVL 2EYTB 2NY4D 3CNKA 3BP6B 3D9AL 1WA0X 3OXRA 4FTVB 3IDJB 2OI9B 4JKPL 2OTWB 4A7TA 3V5KA 4LLMB 4L3CA 4IEFA 3BN9C 4W9KC 1ZLVH 4P46B 1LP9E 2JH2A 4FQCL 1G6VK 4MZIA 1SHMA 4L5FH 1AZNA 1MFUA 3FUDA 3VD1A 1VEMA 3OKMA 5A2KH 4XXWA 1OPOA 1ZD6A 1OQXA 2H2SD 4FEIA 1MRCL 4RDBA 3LEYL 4JZJB 4X6CA 1V05A 4R4FL 4Y9BA 5HYJE 5IZ7A 4Y5VC 1KTLB 4WWID 2QFRA 4I9XA 2COVD 1JUFA 4EI5C 4BK5A 2X4NB 4HMCA 1HEHC 4XBMA 2VSMB 1O9VA 1H0DA 4LSRL 2X1OA 1UKTA 4G8GA 3FPYA 2YD5A 1YYCA 3BDXA 2APTA 3DXAB 3BWUC 4POYA 3LRHA 4H20H 3UBXI 4I0PC 2DRUA 1WAAF 4HYTB 4OFPA 5FYLE 4JEGB 4MYPA 4K3HA 3VRLE 2R2BB 3LXAA 3L3IA 3SGDI 4AUJA 5JHDE 1M2VB 5LJYH 2XWJB 1C12B 2CJUL 5K9OB 2QPDB 4PJ9A 1MKFA 2VQUA 3MBEB 1DUYB 5J6GA 3COOA 3F84A 3GRWL 1R46A 3SKOB 1FORL 1YHPA 5HHOE 5F9JB 1PD0A 3BLBA 2F8OA 3I75A 3BQUB 3R7QA 2IWGA 2Q2EB 1MZYA 1E4KA 2BWQA 3LVEA 3PJSA 4OQTH 4B9GA 3OKDB 3QPXL 4WU5B 2HLFD 2DLGA 2XICA 1T1XA 2AV7A 1CD9B 3ZDYB 4PJBB 5L6YL 4XO9A 4NQSA 4DVRL 1WO2A 1BX2B 1IGCH 5J6HA 4BH7A 3P9LB 1FAIH 4OJAA 2V17L 1MNNA 3OXSA 1VLXA 3G5ZA 4N22A 3M17A 4PY8J 3TBTB 4J4PC 2ZCZA 2GITA 3MRDB 4MMXB 2FR4A 5IVOA 1OPGL 3WNPA 2A99A 1M7UA 1A4AA 3EBHA 1QWNA 4JFQA 4L23A 2XZCL 2DLFL 1ACXA 3IGLA 3O6LH 2AKRB 3V4PH 2AVFA 4JHBA 2DJMA 1FBIH 2E7BA 2D03H 3MLUL 4PTUB 3DVFA 4JCWA 4ZFFA 3GIZL 4DGIL 4KY1H 1BW8A 2QQQA 3F83A 3I9IA 1U8NA 2DWTA 3ZE1E 3S4SG 4R90H 1G7MB 5AALA 3RPKA 2O6EA 1BWMA 3DI2B 1MIEH 5KVEH 3AU1B 3QEQE 1E7VA 4MB4A 3ARFA 5MHSD 2PNDA 5H35B 1QBLL 3BSZH 5EOQL 2E4FA 1LEIA 1U8IB 2J20A 1HDMA 3NZ8B 3NT0A 4PM1A 4L1LA 4EI5B 1ACZA 5EUKA 2OR9L 1QVOB 3FCTA 1P4IH 3HHSA 3FONB 4JDVB 2JNZA 1KYUA 2RCSL 2YS4A 1N0XL 2Q86B 4RMTA 2J88L 2CMRL 4N2IA 4R26L 4K8RC 2CGRL 5EG6C 3DUSB 1G7PB 3UJIL 1W72A 3ZJAA 1YO4A 4IMKC 1S9YA 2JKWA 2Q76B 2YUVA 3QNXA 4XWOD 2C4FT 3F6LA 3ESPA 2XWZA 4C58B 4QRRA 1DANT 1OD7A 4PAZA 4EDWH 4GJTB 2WY3B 2ESVE 4GKOA 1ZT4B 3PGCA 3WJJA 4LB8A 5DJZA 3UTZA 2X2JA 5GPRA 2IDTA 1BFTA 1KJ2H 3AS3A 3I3BA 4Y2DD 5CEZL 4XMLL 1QTPA 5E6SB 3FOMB 5IESL 3KD4A 4L5FL 3JTTB 3BAYA 2W07B 5D6DC 3SCMD 4WU7A 5I6KA 1GYCA 1IUZA 2WO2B 4TKWA 4DUVA 3NRFA 4MJ2A 4U3SA 3K2MC 3EXJA 4MXVF 1WWWX 3WELA 5JXAH 4AJ0A 5E8PB 3RFZA 1L9OA 2JKNA 2VN4A 4TNVF 4XI5C 3RLSA 1OOWA 1XB6A 3PHOB 4M56A 4FG0A 3WNKA 4JR9L 3ZL1A 3HE6B 2XN9E 5DRZB 5ITBL 4M7JL 4LEEA 4FXGC 5BW7A 2PWFA 4NUMA 3U82B 3V9EA 5AW1B 1BIHA 4HKXB 4PRAB 5E6ID 2Z92A 4GO8A 3BD5A 2UZYA 5IG7B 5FGSA 1THCA 1QSEE 3N41B 2QDWA 1L0PA 5HI4D 1EFQA 4X8JB 4YDVA 2ITFA 3QUGA 2HPOA 4OF8A 3QK0A 2OMXA 3B2PA 3HVNA 1V3LA 1U2HA 4KDTA 4AQ1C 3JQOB 4U1LA 4P5TB 1E9OB 4WIQA 5CF3A 5BRZE 5A6LA 2APXA 3G3LA 1JFQH 4YSRA 4KKCD 4M1CD 4AIZB 5I5RA 5IOKA 3MOAH 4IKNA 1Q4NX 3X1BA 4Q2ZA 1UB6A 1E27A 3APFA 3MZTA 3ATDA 4N2AA 1IGCL 1HNYA 1MW2A 4PS8A 1QWHA 1F13A 1JTOA 5HXMA 2GY7B 2EIJB 4PJEF 4NRYA 3APCA 1BZ9A 1YPZF 5C08B 1TZIB 4BV1A 4D8PA 4HKJB 1PY4A 2Y2YA 2ZP9A 3AUWB 4OLEA 1WFJA 4X5LA 4ZUWA 2DQUH 1IX2A 2ADJB 4MNHB 4B9IA 4P5SA 1NIEA 4RNRA 1FBIL 4TV3A 2D03L 3S7GA 2HMID 1IM3B 4X7SL 4HZ1A 2Z6FA 5I76A 1RY7B 3MRRB 4KY1L 4TLSA 1JNNH 1MY5A 3V6OA 5EZOH 4ELKA 3QJFA 1F4WH 5LHDA 4OZIF 4R90L 1DN0A 3SE9L 5KVFE 1IC1A 4HJ0D 2DMCA 3PWVA 5KVDE 2ZUQC 5E94B 3CMOH 2ZWZA 2DY2A 4IBYA 4QO1B 3HE7D 1A9EA 3BSZL 4P46A 4I2XE 3SE8H 1U4FA 4G7SB 4LESA 2IPTH 4CC4C 3LD8C 4F33B 2E86A 4N5UA 2YD2A 3E3QC 3GDCA 1OP9A 4B9ZA 2YR3A 3TBWB 3OTTA 4I4WA 4JZJA 5DUMH 1ZVYA 1MVYA 1JI1A 2YEVB 5HI3C 2X4NA 1QSFE 4Y16D 4HF5L 4XB8A 1E8ZA 2J4WH 5D4JA 4XNZC 3NSJA 3CIAA 2Z8RA 3CH8A 4Y19B 1QLFB 2AJ3A 2IADB 4LAJH 2CPCA 3DXAA 1EGJH 1X6LA 4NNXA 2NLJB 2EAEA 4K0OA 1B3IA 4Y9EA 5FYKD 1MZZA 4AQ1B 4EDWL 2DQFB 1ZHKA 2CUMA 4ZOAA 2X9WA 3H54A 1CD8A 4XNDA 2G5UA 2R2BA 4LPCA 3SO3C 3IXAB 1A7QH 1KJ2L 1OCOB 2ADFH 3FT1A 4ZG1A 5T1LA 5CINH 4L4VB 2XWJA 1C12A 2WWNA 1BQLH 5K9OA 3MBEA 1DUYA 3T65B 3QDMA 2YGQA 3SKOA 5F9JA 3IFNH 3BQUA 4EQ2A 3P0YH 4JM2C 5TPWH 4PJCB 3G5WA 1TCRA 1J11A 4Z18A 1JPTH 2AQQA 4NHCL 1T7YA 5DFVC 3NAAH 1HJBC 4PJBA 2DQ6A 3QCTH 5HY9A 3HBQA 5HDBB 4XRCB 4HWEH 5CJQL 1U2YA 2OSYA 3JZ7A 5IHWA 5L9DL 4LF3B 4M48H 3SGEH 1RUKH 4C4KO 1CE6B 1IBFA 2EIEA 3TBTA 5B8CC 1FFRA 3BH8A 1QD0A 2FWOB 3MRDA 3ARQA 4KXZH 1TKWB 4MMXA 2R8SH 3VG0L 4LVEA 2K8QA 4HULB 4F2MA 2DQGH 3B9EA 1R1CA 3HUJE 3L4XA 2V2WB 4IOIA 4FMFA 2AKRA 1R9FA 1ZMYA 3FOLA 3L48A 4NZRH 5G4OA 4IOFC 3LDBC 2BIQA 4PWGA 5IQLA 4PTUA 2FB4L 1FVDA 3VX1A 2E5EA 5E99H 3HZKB 5I1AB 3C09C 3HJEA 1SXAA 2K3HA 5LNDA 4A7GF 5KBPA 4QLWA 3F12A 5BRQA 3IMSA 2NY6B 1G7MA 2RB8A 3VFMB 2VRQA 3BDBA 3AU1A 4XPBH 1JZ8A 2PN5A 3H9SD 1JFQL 4OGYL 3VACA 2AXWA 3C60B 4IIQB 3L4TA 5H35A 1W0WA 4WSJA 3MOAL 4JKKA 4MZ3A 5FUZL 2P24A 4ZS6C 1KUMA 4NN7B 2CXKA 4AYMC 3MX0B 2FO4A 1XF1A 3VFGL 3MA7B 3HZMA 1FNEA 4YHIB 1LO4H 1F2XK 5F6IC 3DX0A 4G6KH 4FL4C 1QVOA 3SKJL 4F15B 3GXFA 1NEZB 5FV1L 3FONA 4W4OA 3EGDB 4P3WA 2XQYA 4GUOA 4NQED 5BVPH 4Z77B 2VW6A 3KAAA 5CZVH 3EYQD 3DUSA 1G7PA 1KFAH 5DUJA 5F3BA 4O2EB 4OZFG 2N7BA 3JUYA 5C0DA 1X7TA 4XMKH 1AD9B 4YAQB 2F7QA 3MRQB 2QKIB 4YDJB 3BHBB 2J8UF 3QORB 5EZOL 1NCUA 1LO0L 4YN3A 2PO6D 4PW3A 1KJ2B 1NCCH 1NCHA 1KWGA 5M94B 3GKZA 1J9QA 4WUUE 3FOMA 3SE8L 3JTTA 4DPBX 4UTAL 2W07A 1KBVA 1YEFL 3GRWA 1J5CA 2X1PA 4I77H 4AENA 2BP0B 1T2QL 2R56H 5C0BE 4GYBA 5AOIA 1CMOA 5E8PA 4K23L 4UZSA 3RZCA 3H8NA 5DUML 4RETB 4Z7VF 5C07E 5IB1A 4HKBA 4OD3L 3BGMB 4C56D 4C4BA 3VW3L 2WXRA 2R39A 5FO2A 2HH0H 3IETA 1TCMA 2JF1A 3M86A 5FLVA 5CIPA 3EO0A 2QR0B 1VGKA 4X9BA 1AZRA 2GHZA 4PRAA 4ZAKC 3A24A 2YD3A 2ZXGA 4R0LB 3WFZA 5FECB 5IG7A 1IGFL 3GYRA 1MEXH 2V7HA 4NO0B 1H9VA 1SMAA 1E5CA 1NDMA 3GXNA 4PJIE 3Q13A 3C09B 4QTFA 4X8JA 1J8HB 2YOAA 2QADC 3CBRA 3D0LB 1JTTA 2KL6A 2YPKA 1A7QL 2ADFL 2ZIDA 4OFVA 5C3TA 2KKQA 4QYAA 5C70A 3QI9C 1FFQA 3D48R 1ILUA 4KX9A 3S3JA 3PQYA 5ETUA 1VSCA 3ES6B 3B56A 1E9OA 5LWYH 2ZX6A 2MSPA 5DJCB 4GMSL 5GGQH 3IFNL 5J1SC 1JYVA 3P0YL 4TSCH 3LNEA 1NA8A 5TPWL 3U1SH 4XMZA 3VU2A 3DX9B 3LB6D 4LNVA 5DXWA 4AIZA 5FO7B 4AVHA 3OV6A 4E9LA 3X2QB 4YC2C 4ERSH 2QMJA 1CGXA 3BH4A 3NAAL 4OI9A 1IO4C 1WFIA 3TURA 1OSPH 4HWEL 4LLUA 2WAQA 4KKNA 3AJ7A 2HKFH 1JWSA 1FL6A 2FGWH 2GI7A 3ZE2F 5CSZA 1GW6A 4FMVA 4LPTA 1TTUA 3K8LA 3GSNH 1GZHA 3QUXB 5FUCC 4ZZFA 1YY8B 4XX1G 4DP2X 2R8SL 4HKJA 4BFNA 1CXHA 2HXAA 1M6OB 3IGAA 3QXVA 6CGTA 1KJMB 5AKSA 3UGXA 4LDLB 2A74C 2ADJA 4MNHA 5CU9A 2WZPA 3CQFA 3DX3A 2R9HC 4GI8A 4OFQA 1WFMA 3MRRA 1JGUH 3R06A 5F7DB 2AANA 5LVEA 1Z7JA 3OD3A 2EH8L 3JWNE 1G6RL 2PLTA 4KMLB 4XPBL 5E94A 4BQ9A 5TF1H 2WQXA 4QO1A 5DEFA 3WXVH 1J9SA 1AZCA 2EYSA 4F33A 4LEOA 4CUCA 5TJWK 2AMUA 1LO4L 1K4DA 5GGTH 1NCWL 4QIRA 1M3IA 2B77A 3UIZA 5MERB 2DKMA 2FUTA 3FU7B 4B3VA 1PG7X 2B2XL 3IJEB 3SE3A 1RUAH 3QDJB 4YNYB 1UQSA 4N2BA 4X6BB 3BUIA 3H9YA 2ARJA 5FKPB 3ZZ1A 5MENA 1ODUA 1QFWH 1QLFA 5C0CB 2IADA 5DZNA 3VH8B 4C83B 4IDJH 2BC4B 3ECWA 1OGSA 3HN8A 2VH5H 4G43B 1ACYH 1AGFB 1TVBB 2F7RA 4CVWA 4GRLC 3NEOA 4IRSB 3V7MA 3FU5A 4D7BA 1ZSDA 2UY6B 3LPPA 4UOW1 5HI5D 2Q87A 3KNBB 3AMLA 1KCWA 1FSKC 2PTTB 4Q8BA 4OIAA 4DZ8A 3T65A 5I66A 1EZLA 4OV6F 3SBWC 3ALXA 4I77L 4AIXA 2O5YH 2R56L 4S0TD 4PJXF 3HPLB 3EOBA 4PJCA 1ET8A 3EOAA 3BXNB 3IWVA 4MCNA 4XNBA 5KJRH 1ZPLA 2BM3A 4OGZA 3AWFA 4ZBJA 2HH0L 1AIZA 2WCGA 4YHPB 3EUUA 4AGQA 2AGJH 5I73B 3Q6FB 3DV4B 3OMIB 3B9AA 4LF3A 5T1KB 3IAQA 3BFWA 3DKHA 3K46A 1JV2B 1MEXL 2FWOA 4CC0A 1QFWM 1UTDA 4IGBB 1I3UA 3WMPA 1OQOA 3N9GH 3QEGH 2L0DA 4M5ZL 4IS6B 1Q1JL 4NWTL 1FHGA 4WSKA 1QSZA 1F45A 4ONHA 1ZLDA 1F90L 2EEFA 4PRID 5HDWA 1PEZA 3QW9A 3B3IB 3D6GA 4Q9BA 4LVNB 3RP1A 3HZKA 2J8UB 3NA4A 4YPGB 2OKMA 3OGCB 1TENA 2KZWA 5B21A 4A7VA 5LWYL 1V7MH 3ZGHA 3N42F 1LE5A 1F42A 3ETTA 1Q9LA 3OG6B 4TSCL 3U1SL 3US0A 1BCIA 1LYQA 3C60A 5I8EB 3BSZA 2YZ1A 1EUUA 4AW4A 4YHIA 3DDGA 1EZSA 4PRPD 2ATKA 4C55A 4C57C 2HKFL 3ARFD 1NPJA 2FGWL 4MB1A 1JWUB 3D52A 4MAYA 1UXWB 5A3ID 5KZCB 4NXSA 1RZJH 3SYCA 3WFDH 3GSNL 2BXYA 5ID0A 2AF2A 1DJIA 1F00I 5IW1B 4Z7NF 35C8L 1J10A 1MCBA 3IWUA 3GEFA 1EANA 5GRYA 1SJHB 4UWQB 3QIWD 3MRQA 2QKIA 1RSYA 2WXOA 3BCDA 3BHBA 4L9LC 5I71B 1XIWD 1A8ZA 1JGUL 2OLDA 4XT1C 1ES0A 5FM5O 4DQAA 4LKXA 3QR2A 4PG9B 5IF0B 4XZUB 3V0WH 4PP1C 4WGKA 1ND0B 4Z5RB 4FQXD 1KJ2A 4B95C 2BSRA 5TF1L 3SE4C 3QE5A 2XN0A 3WXVL 1DBJL 3WG7B 1ROCA 4LT7A 5F72S 2OYKA 4J12A 2BP0A 4R2GC 5GGTL 3VXMD 4QHUB 3OGOE 5FCSH 2WNWA 2AJYL 3HJ0A 2WAHA 5IMOB 1RUAL 2AAVA 2KZKA 4Z7UB 3ZUCA 2PR9A 5L2KA 3H4HA 1KYOK 4K3GA 2Z31B 3BGMA 2YAHA 1Y18B 5FM8A 1NCBL 2C3GA 4YEEA 4N3UA 5AVYB 2ATPB 5K93A 2JLLA 1A6AA 1QFWL 1G87A 4WAFA 4R0LA 2ICEC 3HAEG 1GC1L 1AQ8A 1HX0A 4OCSH 3HZVB 4IDJL 5SX5H 3REVB 4KQ4H 2B3RA 1REIA 4FZ8H 3S5ZA 1J8HA 3GLDA 3W5MA 2O26U 1DJWA 2HJLB 4XVUD 3CFDB 3D0LA 4JO4H 5AKRA 4ZT1A 3V2AR 2IPUK 4XP4L 1WTGT 5GGRB 3S8FB 1JD9A 4QTIL 4TSBH 2P28B 1DQVA 3DPBB 4PRHD 3SN6N 2K70A 3G5XB 4JFZL 5DJCA 2O5YL 2WBJC 2EDXA 5FB8B 3N55A 4DCQA 1A3QA 3FTGB 3DX9A 1BIIB 3QPKA 4QJ3B 5FO7A 4UT6L 3BRGC 4LCWA 1VFBB 4X6EB 5DWUH 1E42A 1O7DE 1N5YL 3GS4A 2IPKA 3KJ4C 5A1AA 2AGJL 2PCPB 2RR3A 1I8LC 1P0SE 3QCVH 2G60L 5A43C 4H1LB 4OLVH 5L2JB 2VO5A 1N26A 3GSNB 3QUXA 3N9GL 1XSIA 3BIAX 1KTJA 4LSUL 1AJ7H 1KJMA 5IIEB 1M7IB 4HJJH 5FYKE 4HSAC 1FYHB 3PGFH 4K9EC 3FBKA 3ZKQD 3E1F1 1A6VH 5F8RC 3S34H 4S0SD 4WKZB 5GIRA 3EH1A 1NIFA 5F7DA 4MJID 1FAKT 1V7ML 5ECJE 1AKPA 3KH3A 3O3BB 2LE9A 3G6JA 2Q9OA 3G6AA 5IGXL 1FLTX 3LOWA 4R2GB 1D6VL 1NCTA 2E7LA 5CWSA 5IMLB 3NVQA 3TJEH 3FQNB 4XN9A 3RIAF 4UT7H 1CE1H 4UTAA 1UATA 2I7SA 3FCGA 2GW5A 2GK2A 2GIMA 3L5XH 4PREB 5C9JB 1E2VA 5MERA 3ZGIA 4PJFF 3FU7A 2OJEB 3ARBA 3OL2A 3HOGA 4XZ4A 4MD4B 3NQIA 2ORBH 4YNYA 3QDJA 1RZJL 3WFDL 5IJKA 3S35H 4NGHL 2HT3D 3T4AC 1IAOB 4GLRH 1IKOP 4X6DA 2AQTA 3C5ZD 4ZODA 2UWEB 4KK9C 4BSWB 3V0HA 2P43B 1EFXB 1NBCA 3FUFA 3MPCA 1SBBA 5D7JD 4PLKD 1CICC 1G0YR 1GGCH 5HTSA 3VH8A 3LIZH 3FTZA 3A6BL 2BC4A 3KDMB 3ESOA 4TQIA 4X7FC 4G43A 1AGFA 1TVBA 3CFCH 5CILL 3UTOA 3V0WL 4YFLI 3QUKB 5DMIH 5L0QC 4IRSA 3ZQXA 5KJ4A 3E9TA 1J05A 2VISB 2UY6A 1EQWA 4NQCE 2WN2A 2NDGA 4A7SA 2IDUA 4DN3H 1TZ8A 3ZUNC 1M9WA 3BJ91 5D4HA 3DETC 3KNBA 3L4CA 4J3OH 3BPCB 1PZSA 4YE4H 3GBEA 4M29A 1CO1A 2WLLB 3H9SE 3QAQA 3N42B 4S1DC 1FCGA 3KYOB 4GB9A 4Q6IB 1HZLA 4TLKA 3HG1B 3D07A 3KJ4B 1MCQA 3HPLA 1OK0A 4DHLA 3CFTA 4IK7A 4U0RB 1P7KA 4H44C 4HJSA 1D9KD 3QDMD 1UOKA 2XXFA 4YHPA 4LPUA 5M7QA 1PSKH 4JY6A 3Q6FA 4NQEE 5T1KA 4QRTB 3OLEA 1JV2A 3KW8A 4RISL 1XSKA 4KQ4L 2BMKB 2NYYC 1O9WA 4Z7NB 1DVFC 3CUPA 5C2UB 4FZ8L 1CGTA 3GMPB 3NP3A 1H8SA 4WEBH 32C2B 2ZKYA 4JO4L 1OAYH 1I85A 3MJ7B 2VW7A 4FEMA 4APQD 4X4ZA 2NSMA 4AYGA 3D2TA 3S4SB 3B3IA 2AJVH 1EDQA 1U95A 1RH8A 2NY1C 4YPGA 2GSIB 1ASOA 1QLRA 5GRVL 3Q8FA 5K59E 5EIIG 3U4EB 1G6RA 1AZUA 2PPEA 3MBWB 3DNKA 2A9BA 3CC5B 3H53A 5I8EA 3LQMA 3RI5F 3WD5H 3WLWC 5DWUL 5EZJB 3SJVB 1IGTB 1PW3A 2YHGA 3ESMA 1CTOA 1PD1A 3HEIB 4CU8A 1KV3A 5HYSB 1VZIA 2O93L 1JWUA 1UXWA 4C56E 1NCGA 2Y72A 4OZFH 4MJ6A 4DKEH 2FX7L 2X09A 1X9LA 3F04A 4HIPA 2Q3ZA 3DTXB 2EH7H 4TM9A 1FJ1B 4WI0A 4M6OH 3UZVB 5IW1A 1YEHL 25C8H 2VUYA 5DZOA 1CFSA 2M2DA 5JIMA 3A3YB 2F54B 3W9DB 1ZK5A 4PJHF 1SJHA 2BNQA 4XNAA 3VI3F 2AJUH 3BE1L 1INQB 1AHKA 4OH2A 1JFHA 3S34L 5IEHB 5I18H 5SWSD 1SOKA 2KH2B 3BCFA 3QQ9C 5AW0B 4X7CC 1I8MB 4PG9A 2EIZB 4TVPL 5IF0A 4XZUA 4QGTA 2DEYX 5JLZA 2VDLH 3FB8B 1ND0A 3LZLA 3O2WH 4Z5RA 1HZHH 1MIMH 4QRSA 4IIZA 1GGYA 3QRLA 5MEOA 3IS0X 2NR6C 3LAFA 1FNLA 2YC1B 2YAPA 1XF4A 5C97A 4UT7L 4AQ8A 5TFSH 3O0LA 3L5XL 3NFSH 1NGZA 3TT3L 4PJ7A 2CBMA 2KERA 2B15A 4FD0A 3NOIA 2YA2A 4GH7B 2ORBL 5ADPH 4HKZB 3JWOH 4JPQA 4NBYB 4Y4HC 4Z7UA 3H42H 1L9MA 3S35L 3KWTA 5B38A 3MV7A 1TJMA 3C12A 1OAKH 3QHFH 1MW3A 4EIBA 4QGYA 5E9DB 3KCPA 3D39A 4U49A 4HZLB 2PPDA 4N5EC 3LIZL 3MODH 1YEIH 3QO0B 4L4TB 4KJPC 3OAWA 2EEXA 4S1QL 3GSWA 1KCVH 3CFCL 5DJ6B 4XNXH 4FABH 3QIBC 5DMIL 2HJLA 5KANI 1YA5A 2CAKA 3PHAA 4GAJL 1YN7B 5GGRA 1TDQA 1WZ1H 4U1JA 2YAQA 3U0TA 2YRPA 3DPBA 3DJTA 3BPOB 3P73B 3ARRA 3G5XA 3BIKB 4ZMAT 4XXDB 4Q9CA 2XNAA 4B7LA 4NQDD 3FTGA 1BIIA 1QBAA 2XWCA 3WY3A 5FW6A 3ZMEA 3PQYD 1VFBA 4NNYB 1KB9K 1T2XA 5IFAH 3VD9A 1QR4A 2GJ6A 1ZSHA 4HX1A 1AGBB 3TA3B 3VGBA 2R29H 1PSKL 1KENL 4MBRA 4R8WL 1JN6B 5E8DH 4FFVC 4H1LA 5J13B 5L2JA 4HS6B 3Q2VA 5DJXA 5EULV 3BYYA 3INUL 4OM1H 4M6AA 4HUVB 4GQQA 2H0PA 4L8DB 3BT0A 4ADIA 3FT2A 5E03A 1Y1UA 3DV6A 4DQOH 1PZUB 3U0WH 1NWPA 4WKZA 3LZNA 1CL7I 5DWPA 3CV5A 5HHQB 6TAAA 4GG6F 5E00B 3WGUB 4N2OA 4CBZA 4QHKJ 3I85A 3ZZSA 4EN3B 3LN5B 4UTBL 5F7HA 3DTDA 3H7BB 5EF0A 3WD5L 4BZYA 2I7OA 2F2HA 3EJZD 3FQNA 1I53A 2I9LB 3LY6A 1IIKA 1KBGL 4OCYH 3MUUA 4Y4HB 1YEKL 5FF6B 4O02H 1GCFA 4G8AC 5GGTA 1A2YA 2OJEA 1Z9LA 3LNDA 4XO5A 3FQ1A 1HOCA 5DRNA 5DHEA 2IPUG 3TEXA 4DKEL 4Z7WF 4OLZH 2AFNA 4P23B 2IOMA 2EH7L 3O3EA 4M6OL 5BO1H 1A25A 5FGBA 4UQDA 2EVFA 1PZDA 4Y2NA 4CGUB 3G5VA 4MCZB 2AJUL 3ZDXF 2P5PA 2EVJA 3R19A 2JKXA 5I18L 3KDMA 5E5MA 3FUNA 2DWDB 4MTMA 3IPEA 4RCAA 4PRIE 1NSNH 3QUKA 2F1AA 5MEND 3O2WL 1YCSA 2A5UA 4I7ZC 2P1YA 1HZHL 1MIML 3KPSB 1EZVY 3NQKA 2WXIA 3O8XC 4JPWH 5GISL 5I23A 4JQIH 1KWKA 3W56A 4OD1L 1PZ2A 4FKHA 2I9TA 1F3RB 3BPCA 4G7YL 1IAIH 3QWNA 4LCVA 4RGMB 3P54A 3TTSA 2HFGH 5TFSL 1IBBA 3QDGA 3NFSL 3KYOA 4QY8B 4Q6IA 1OB1B 4A2EA 5ANMB 1TVDA 1OM3L 3A23A 2FATH 2ZWSA 1JERA 1GCYA 4KTGA 3ZO9A 4JMNA 3JWOL 4WEEA 4ZNCD 3H42L 4UT6A 3SGKC 4PRPE 1ZOXA 3F5WA 3VNZA 2XRAH 1OAKL 3QHFL 3VFTA 3T77B 5JPMB 1UZ8B 4G6FB 5B39A 3SDCA 1F5WA 1YEIL 1BZDA 5A7BA 1TQBB 1WBXB 3IJHA 5AW6B 1KCVL 3RAJH 4FABL 2XXCB 3GMPA 4AYFA 5J12C 2YJLA 4LHUA 4M8RA 2LTQB 4G11A 4C4KT 3MJ7A 3VI3B 3WN5C 1AD0B 4PJDB 3NP4A 3S4SA 4RRPG 4BRVA 3B6SA 1WZ1L 5IW6B 3B2UD 4JLRB 2QPSA 3HG3A 5JR1H 2J1YA 4KKLD 2HVKB 1W8NA 3U4EA 3L81A 1IAIM 1VEOA 2E8ZA 3MBWA 1BQUA 3GBML 2YD7A 4A63A 4YSQA 1TO4A 4OF5A 4RFOL 4N2HA 3VXME 5IFAL 3SJVA 1IGTA 2BVQB 4X5PA 5C09B 4GRWE 1AZZC 2R29L 1BOGA 3LKQA 2HLEB 7TAAA 5HYSA 2IVFC 2JTDA 2CIIB 4R9HA 4OZFB 3RWJB 1DLFH 1XO8A 4R7LA 1FJ1A 3IVKB 4HWZB 4N1HB 3H4FA 2X4TA 3W9DA 2GC4C 4MAYD 1E5YA 5F7YC 4ZNEA 4AXWA 2WN3A 3U0WL 4YK4B 2UYLB 4KZEH 3KGUA 3QZPA 2IWKA 5FFGA 1I8MA 1FVCA 2EIZA 8FABB 3FB8A 1YMMB 5E2TH 1OHQA 3NJNA 4X9IA 4RFEA 4PRHE 1SHWA 5D72H 5ESVB 3TBVB 1I8IB 1V55B 1NKOA 4ZD3L 2R0ZH 3QZBA 4W6WB 5AKTA 2HTKD 5E5LA 5BVJB 2BWDA 4HEPA 4XNUL 2NTFB 3FSZA 3RA7H 1RMFH 2EDMA 4PI2A 3UMTA 3KCWA 3L7EA 1QBMH 2E9JA 1ET5A 4KFMA 1CD1A 4F7MB 3CSGA 3DROB 1YUHB 5D93B 1ILSA 3WHE0 5TDNB 3CHRA 3SDAA 1W0YT 3OKOA 4OF7A 4OLZL 1NIDA 1Z3RA 2ZX5A 5I19H 3QQ4B 4PJAE 3HAEH 4LL9A 2YUZA 5IQOA 3C8HA 5J12B 3SY0B 4XP6H 1INEH 4HZLA 3KPPA 3RTQD 5L2KD 5IB4A 5H4YA 5F7FA 1L9RA 5FO9B 1DTUA 5CUSH 5DJ6A 5HHPB 1IT9H 3ZBMA 3H9ZA 2CO1A 2XBDA 1JZ3A 5LB1A 3JZYA 4L8BB 4HOZA 4ZMPA 5JORB 1KC5L 1C7SA 4JPWL 2VIRB 1U8OB 2BIPA 4MJIE 4QRFA 3TH4T 1YN7A 1AY1L 2VLKE 4DP6X 2BZCA 2JKSA 3N5AA 4MQ7B 3O4LE 3P73A 5EORL 1WFNA 1KIPB 3I3EA 4OT1L 3BIKA 2O5NA 5CJOH 3EDDA 4Y1AA 4NQTA 1BVLB 2Q8AL 2ARJQ 2CRMA 1EIBA 1XB3A 2BFGA 4AZUA 1IBGH 4HCFA 4JFUA 1FZKB 1Y6KR 1IGMH 2EDFA 4AGOA 4BGDA 1V3MA 4ZDHB 4CSTA 1XGZA 1AGBA 1HL9A 1Q9WA 2NNAA 4N2NA 2ZNXA 5EOCJ 3VXRD 4E41B 2VMCA 2VXVH 1SPDA 3X3GH 5J56B 1PAZA 1D5BB 1BJ1H 4LCWD 3WY2A 5L8LB 4M3JA 5HHNB 5GZOC 4IBSA 5E23A 3TPUB 3ZDWA 4PV1C 1I8KB 1FH2A 1K4CA 4U33A 4N8UA 5AQ0A 4HWNA 2R2EB 3L3JA 3O3DA 5E1AB 3U36A 3ROLB 3AGWA 1YQVH 1IAMA 2QZ5A 4EKJA 3VYNA 4KK5C 5JR1L 5HHQA 1WAEA 3CVDA 4KROC 3O11B 5T1DL 1TQSA 2H9GB 2X2IA 2JJVA 4OZ4B 3KPLA 4U3HA 4JRYA 4M9OA 3WKPA 1TZHB 4OKDA 5D96B 5KS9F 4BZ2H 2WLNA 1XF2B 3H7BA 1L7TL 2BIOA 5FF6A 1FHNA 4G8IA 1B0WA 3WFCL 4ABQA 4O02B 5E9NA 5DYOA 3WMSA 4JG0H 4LARH 1ZJAA 4MMZC 2HFFB 3OQRA 4ZXBD 1SF3A 2D3JA 3QDME 4Z0BL 3ZPDA 5GS0H 3KBEA 3GZOA 4XWGL 3ZKMD 1RUQL 4K7FA 3ZKSD 3LKSB 1AYRA 1QPXA 2IBGA 3ARDA 3BO8A 4XNQA 1G7JB 5KBDA 2DQCH 4KITB 5ACLA 1YEDB 1ET7A 3ARBD 5D7KD 4MCZA 1H9DA 2E27H 4GO6B 4D0DB 1H3VA 3O2DH 1OAQH 3AVEA 4LCCB 4PVMA 4KZEL 3UERA 3TN0C 4K7PH 5DD0H 5ANHA 2A73B 4L3EB 2C3XA 3DIDA 1IB5A 5D7IE 3RHWK 3EJCA 3QG6B 3VNYA 5FS5A 4MWFB 5E2TL 4HFUL 2ZF9A 3IKCA 2IH1B 3N43F 5D72L 1NFDB 1XEDA 3UBGA 2BW4A 2R0ZL 4ODXB 4OJFH 4TL5A 1PX4A 2QPEB 4YS4A 4XBEL 2BRRH 1G9HA 3BKMH 3ZTNL 4JREC 1QBML 1SXCA 2XG4B 4MQSB 5EA0L 3SQOH 1OB1A 2EIDA 4FKEA 3MUZ1 1AS8A 4XCEB 1Q0YH 3UZEC 1C5CH 2NY0D 3OR7B 4P2OB 1YNTF 1UACH 4YWGH 1AGEA 1M1XB 3CFIC 4YPJA 5I19L 2GCYB 2Q5BA 2VLJA 1XZ0B 3F64A 4L37B 4OVUA 3T77A 5JPMA 1S5IL 1UZ8A 1OF2B 4XP6L 2M83A 1TF4A 3NSCA 1T0MB 5DHDA 4R5VA 3E2HB 1ONQA 1MJ8H 1UCBH 5DEGA 3MV9B 3U7YH 3ZXAC 1BEXA 4UAOC 1WBXA 1AQKH 1W80A 3VFNB 3NEXA 1FIGH 1IT9L 4DOHB 3D2UD 3EKCA 1JZDC 1A3ZA 4HIIB 4JUSA 4G1MA 5SWSE 3PDOB 2DBJA 2B5IB 2OSWA 3AXHA 4HLEA 3DK2A 2CLVA 3RJOA 5KSAA 1GYAA 4N20A 3MV8D 3KYAA 3A47A 4FYSA 3SEPA 1UM5L 5CLTA 3IJSB 3D87B 4NN6C 3K0YA 1JJUA 5CJOL 2NY3B 5JHAA 1U3JA 5DZAA 4EDXA 2WXHA 3VWJC 4D7PA 4MMZB 4N2MA 2Q3XA 4N8VG 1IBGL 3QZMA 1JPSH 4HS8H 3FUKA 3PHQB 4UTBA 4RAHA 2HN7B 5E8NB 2BVQA 1G1YA 2DV6A 3DYPA 3G08B 5C09A 1N9PA 3ARGD 5LCVL 5EBWB 4GP4B 5B7FA 2F7PA 2H2PD 5DDHB 2VXVL 3QQ3A 3G7TA 3X3GL 4POZD 4X5WB 2WYZA 3VFUB 2LU3A 4NT6B 4V1DA 1B88A 1T5WB 2XPZA 4DEPC 4WGVB 1UH2A 5LDUA 5CFHA 4MVBC 3B4NA 4UM8B 3IVKA 2ZUXA 3D4GA 3HB3D 4HWZA 3QVAA 4QRPD 4Z7QE 1G5GA 4CADA 1ZV2A 3GS0A 1YQVL 2RFXB 2ZAIA 2WOBA 4FQ1H 1GL4B 4Q9QH 2ERJC 3SDDC 4HPOH 4NO3A 2GYSA 2WB7A 4ZFOA 1THAA 2BNQD 4JO1H 1TQCB 1BBDH 3TXAA 5JW4Q 5EBMB 5BZDA 3AB0B 2ZJSH 3IE9A 3L5IA 4ODSH 4BFRA 4P5KA 3TBVA 1I8IA 3UPAA 3SIKA 5BVJA 2TAAA 1IQDB 1KJVB 1BZ8A 2NTFA 2A6JB 1WEJH 2OCCB 2ZOWA 5DS1A 4Z7OE 4NQDE 3ZMRA 2YOCA 3DJRA 1ORQB 3DROA 3NIFF 4JG0L 4LARL 4N24A 1YUHA 4Y0GA 3WY1A 1UZGA 4BZ1H 3HI6H 1LMIA 4M6NH 1ZVSB 4AQEA 5GS0L 4HIJA 3SY6A 1S7SA 1M7DA 1ZVHA 3GSVA 2IC2A 3UO1L 2EC8A 1AYOA 3ILDA 3QQ4A 4YXKH 3HAEB 2JCWA 2VC2L 4OGXL 2N1TE 4IJ3B 3JSSA 12E8H 4FI8A 4AV4A 2EXWC 3U2SB 3OHXC 1IEBB 1OAQL 2OCFD 3MSPA 1I1YB 5KOMC 5CAYB 4NC1E 2Q0ZX 4W4NA 5FO9A 3R0MA 4AL8C 4CVXA 3LKPB 1RZPA 3L4UA 1GS8A 3KPRB 3LSOB 1BMWA 1QUPA 4P99A 3VRIB 1JYWA 3S5LA 1JRHH 2PWHA 4L8BA 5JORA 1OKEA 2KI6A 5CJ5A 2B59B 2VIRA 4KH2A 4W6XB 1OAJA 3BVNB 1YEWA 4HMDA 1TJGH 4UM9D 1KGYE 4OJFL 3VWJB 2DDQL 1DZ0A 1S7TB 2BRRL 4DPAX 3BKML 3CVCA 1PCXA 1KIPA 3TO4C 3W39B 4ZX4A 3NH7H 4JKLA 4IMLB 2I26N 5I6NA 4NO5B 1FZKA 1P1VA 1UACL 4YWGL 5I0XA 1O0VA 1NIAA 1AACA 4HUCA 3TV3H 4DEPB 2I25N 1KCRH 1MQ8A 4ZDHA 2R27A 4G7VL 2ZT9C 2DL9A 1RJYA 4UANA 2R29A 1NC4D 3JT0A 2XHNA 4AMKL 3U6RB 5IBLD 1D5BA 4JCLA 1QTSA 1MJ8L 2CRYA 1UCBL 1XL6A 3KXFA 1CIUA 2A4CA 3U7YL 1AQKL 3V8OA 1M57B 4M3KB 3WKYA 4NLHA 4KXBA 2ERJB 5EBLA 1T2JA 4TQHA 1FDLL 1Z3GL 5D5MF 3S35X 4PUBL 3FRPG 3AQXA 2HZHA 2D8KA 5GSVB 4P2RB 4TVSa 4B9FA 5AD0B 1BGXL 2R2EA 3PL6D 2BO0A 3ROLA 3M7OA 4ZX3A 5EV7A 4BYHA 1UM6L 5DJ0B 3M1BB 4RGNB 5C6PB 3O11A 2H9GA 4AITA 4PMFA 4X83A 1PS3A 2EEBA 4JRFA 2A9ML 4TQEL 5ICXB 5I15H 5E9AA 1ZT1B 3N43B 4XX5A 1TZHA 1VAHA 2D3LA 4OM0H 4ZTOH 3VX0A 4BSVA 4HS8L 1JPSL 1OE2A 1J9CT 4N9GB 3ZYJA 4AK1A 3IK2A 4Y4FA 2DN7A 1HZKA 1E3ZA 2WCSA 5DMYA 3QZWG 3QSKB 2RH0A 2H47C 2HFFA 4U1NA 5D2LE 2BOLA 3ISYA 4U6XA 1YNTB 3KWVA 3OHXB 5IEKB 4Z0XA 4PJGA 1FVEB 2YN5A 2X0VA 3W0WB 2D7OA 4DGWC 3EHBB 2VC2B 4RMRA 4OU3A 1YEDA 3NZUA 3ZDZB 1T1WB 2DH3A 4CVUA 5C0EB 2AXGA 4PS7A 4D0DA 2Y7SA 2YQGA 2OPCA 4MBOA 3FQTB 4UDUA 1IFRA 1BPVA 4Q9QL 3KBFA 4HAFA 4HPOL 3Q01A 4GI6A 3H2PA 1CF8H 3QG6A 4HOXA 3H0TA 4JO1L 3FQRB 4HLZG 4MWFA 1BBDL 2ZJSL 2IH1A 4ODSL 4AE0A 1DSWA 3IXTA 3LPWA 1FZOB 1WZMA 2WYIA 1FG2B 2IFFL 2QQKL 3C6LC 1RKRA 5ISZA 2XG4A 2X3BA 1IL1A 1CG9B 4JFXB 4Y5VA 2OULB 3PXHA 4KTYA 4M6ML 4BCZA 5E0QA 3HI6L 5F7MC 4XCEA 1GIGH 4R4BB 1KBPA 3OR7A 4P2OA 2X4QB 2ED8A 2YPVH 3US1A 1M1XA 4PWJA 4LZKA 1WITA 4JHUA 3QDGD 4JFFB 2CUAA 4ZUVB 2NY2C 4GSDL 2F0CA 1RZFL 2L7JA 4L37A 4R5TA 1OF2A 2ED6A 3H3PH 3NACL 1MCCA 1F18A 3IDGB 3TYGH 1OGAB 4KXZI 4RA0C 2BXZA 3MV9A 3O6FC 4N68A 2B20A 3T3MF 1FZMB 2NQCA 5D1XB 2PXYB 5IB3B 1U8MB 4HIIA 5DC4B 3RX8A 4FJYA 5AAPA 2VLMD 3PDOA 3VGEA 4NQVA 3SDCD 4PYGA 5EIIB 4Y2OA 4ZK8A 3MRJB 1G9ML 3DBXB 3VO0A 4KHXL 1IM9B 4LHUD 4I48B 3IJSA 2D4FA 4NCC1 3NH7L 1W91A 3WTTA 3P40A 4YLCA 5EFIB 2ZCKH 3PHQA 5KYYA 4NZTH 3LS4L 3NFPB 3NJKA 1ITCA 3LMJH 3FTUA 1ACCA 2HN7A 5D1ZD 5E8NA 4NFDA 1L6XA 1KTDB 3G08A 1QKZL 3BMVA 4YL9A 3FCUB 1MN4A 3NIFB 5FM4A 2PW2B 3S3CB 3T3PE 2F7OA 1RURL 2UY7B 3ZHKA 1ZXQA 5DDHA 2X70B 4X5WA 3CGTA 3VFUA 3CVHH 1JGIA 1T5WA 3K5SA 1AO7B 1SHSA 3K5RA 3RUGB 4UM8A 1G1CA 3U25A 3GDBA 4WW2F 2BERA 1BLIA 2KUTA 5C6TH 3QNZB 3WLBB 4YBLC 1MWAA 2RFXA 3ARXA 3FYEB 5EU7C 1SJXA 2JLPA 3B8YA 4J1UB 4JBSA 3DVNB 3P11L 1KN2L 1UZ6E 3HR6A 1M71A 2OJZL 3C6LB 1BFSA 4KO6A 5KVGL 4D2NA 4ZTOL 3EYFA 2LGNA 4H8WH 4MA1C 1I7UA 3BI9X 4JN2B 3U0PB 4KUCD 2FNBA 3HNVL 4N0UE 1IQDA 1OK8A 2ZE0A 3P77A 2A6JA 3BLPX 1PNDA 1X5JA 2IV8A 1ORQA 5HD8D 2BHFA 1DVTA 1ZVSA 3QH3B 4OCNC 3MN8A 2NXYC 1KXHA 5G4MA 1R75A 4BGLA 1I9IL 1ZT7B 2GKIA 5LG1A 3VXRE 2VERA 3HAEA 3BJLA 3PUUA 4LCWE 1MFDH 1YLBB 2DPKA 5PAZA 4HQQL 1DLHB 4KZDH 2NXZB 3MVSA 3SDAD 3U2SA 3VA6A 3VQ1C 2IQAA 4ZQKB 1IEBA 4EJ1C 4TTDC 2WIMA 3HFFA 1I1YA 4TUJB 1J9TA 5CHNB 1QNIA 2F7IA 2FL5B 3MR9B 1K5NA 5F8QC 3VRIA 2LABA 4CDHA 1NJ9A 5JW4N 1ZEAL 4HISA 2J2ZA 3BVNA 5D1QD 2NNRA 3GMQB 2FO8A 2ENYA 2ZUTA 1S7TA 3KLDA 4MYWB 1T7WA 2E59A 1DJHA 4GSRA 3GLZA 1D5RA 1P7QB 4QTHB 1KXTB 3W39A 3WUZA 3K6SB 4NO5A 2P5EB 4N0FB 1GIGL 4P4KD 2FLBT 3LZFL 1D5MB 1Z9MA 3ULAB 4FNLH 4PLNC 2FT6A 4N0CC 2YARA 4OFYA 3PV6A 1BQHG 1HQ4A 3LJ3A 1KLUA 3X12B 5LCVA 4Y1AD 1BXUA 3GI9H 3HLAB 2Z34A 5E2VH 1QR1B 2WLIB 3U6RA 3TYGL 1IZJA 1RZKL 4GSQA 4V2CB 2YBRA 4HGWA 3UL4A 2PWGA 4H88L 3TX4A 3BAJA 4N6RB 5D7KE 1MHEA 1AGCB 2DWSA 2YIHA 5JA8B 1M6UA 4MD5B 5DD5L 3L3KB 4MA3A 2CKBA 4R7XA 3Q8CA 5GSVA 4NNPH 1WHPA 2OL3L 2AQPA 3CD4A 3OAUL 5EO9B 4BFIB 4H0IA 1B4JH 4WK4B 4FJZA 5DJ0A 4YSUA 4QDGA 1ZLWK 5IHLB 2XKUA 1T7XA 4WW2C 5DHYB 3SBRA 2D7MA 3HG0A 1V5JA 5ALBH 3TJPA 1KG0B 4HPYH 1R5VB 1ID2A 2ZCKL 3U79A 4N9GA 3HG5A 2Q7AA 1GOHA 4GFXA 2NXYB 3FHQA 5FYLL 1D7BA 4NBXB 5B4MD 2Z7ZA 2HRPH 4FFWC 1AR1C 1TOXA 4HIHA 1F3DJ 3L4WA 1OD9A 1TMCB 1GTNA 4S10A 3RGVC 5EN2B 4FFYH 5EWIH 5H2BB 2YXFA 3HZ3A 5IEKA 4OKVA 1MJUH 1FVEA 3F58H 4S2SA 3W0WA 4FXKC 3TZVD 3U46A 5C0AB 1GMEA 3UBFA 1T1WA 1L0QA 4ELDA 5C0EA 2AK4B 1QFWI 1XR8A 4PJ5D 4ZO6A 3NGBB 5IVZB 5C6TL 1NDGB 2Y06H 3TEWA 3JV0A 4NKMB 1RERA 3MNDA 2E74C 4KI1A 4PVLA 1NPUA 1C7TA 2XWBB 1U33A 4FXLA 4J3UA 4J3VA 1MFCL 2VZUA 3CZGA 3MV8E 3WEXB 3PP4H 4LL4A 1UOVA 4H8WL 3FB6B 4QRBA 1FZOA 3QULB 1FG2A 3OPZH 4FZEH 4NM8H 4M93C 1K5WA 3LHPH 4M5SA 2E6QA 1U30A 4F80A 8PAZA 4JFXA 1J1PH 4LU5L 1HH6B 4R4BA 2E7DA 4ZOBA 4BK4A 2MEJB 4YGAB 1M2OA 1DBMH 4W9JC 1C8PA 2DF3A 4Z7IA 3CXHJ 2OZNA 2ZCHH 5DUBA 4Z1PA 2WUCH 5FOBB 4JFFA 1QACA 4HS3B 4GW4B 4ZUVA 2IAND 5KVFH 2CLZB 1MFDL 5F0PB 1SY6A 5KVDH 4UT9L 4KZDL 2DYPB 3TTYA 2X88A 1OGAA 4UDTA 4YH6A 5J9PB 5JHLA 4QRPE 3SGDH 1FZMA 2VLJD 1QPKA 2DKUA 3L3DA 5D1XA 2OYLA 1TEFA 2PXYA 4AKOA 1U8MA 1WD9A 1H8NA 4XGZA 1OTTC 1HHJB 2CHXA 4AW7A 5JQ6L 4ZZKA 5E1IA 1CYXA 1GS6X 2OL3B 3VWKB 3VB8A 2NX5D 4IU3A 4JO8A 2BNQE 4B9PA 1A6UH 3QR0A 4JM2A 2NQ3A 2F5AH 4I48A 3B5TA 3ELAT 4HBCH 1KXQE 5AKVA 3FCSB 3K4DA 3VM7A 3S8GB 1U8QB 1EAPB 1QSVA 5KSAD 2W65A 4PLJD 1E4JA 5EFIA 2DLTA 1Y07A 3NFPA 2V2XA 4IDLA 1N19A 4ONGL 4L18A 2AI0H 1KTDA 2VN6A 4HCRA 4J3WA 3ZE0F 5B8CA 2E7CA 3MRMB 3PAYA 3FQXB 4LNRB 1S7XA 4Q4EA 3FZUD 3REWB 5E2VL 2X70A 3RVUC 4F57L 4KJWC 4YR6B 2PR4H 2VXQH 4FHBD 1XAUA 4Q6YA 4PFEA 3CVHB 2WSDA 2YBGA 4PJ7E 4IRJC 3RUGA 4XPTH 2NW3B 1YYLL 5K9QI 5HHOB 5TGBB 4BFBD 2D7TH 3CZFB 1GH7A 1EVUA 2A6DB 4V1DD 3L1OH 3WLBA 4I9WE 4KH9A 4B3EA 2EICA 1B4JL 3G6DH 1AHWB 1H5BB 1NGWA 2VXTH 5GGSY 3JXAA 4J1UA 3WIHH 1GY2A 5BXFA 3DVNA 4XO4A 3PHSA 4PWFA 5E7BA 2WTRA 4I3RL 3WGVB 2YA0A 4OZIA 2KS0A 4G6AC 1CDBA 2D7NA 1XQ4A 5LQBH 3FN0H 4QXUH 3S37H 4OJDH 2ZX8A 2VDKL 4RWYH 1R3KA 4QNPF 5DURB 4AVIA 1Q0XH 1G4MA 2DQIH 1A6PA 3ARUA 4M7KL 5TE7H 1EEUA 5HYIA 5IHBA 4DT2A 3DLQR 3OJ2C 3QS3A 1I1AB 3RVVC 3T0EC 5IT2H 3X11B 3EJYD 3DOSB 3QH3A 2NZ9C 1MCOH 2TRHA 2FWSA 3KHQA 4FFYL 1NICA 1TPXC 3J2PA 1EXHA 1MJUL 3F58L 2QTVA 3KYMA 5JW4R 1XH0A 3MLWH 1CXIA 1NFIB 2A3TA 4YJZL 3M1CA 4MS8C 3IFOA 2YD8A 3AMKA 4JY5H 1DLHA 4EOWH 3FU8A 2FWUA 5E4EB 3K71A 3BDYH 2C7UB 4TUJA 1CB4A 3AU0A 2FL5A 3MR9A 3MJ6A 4P2QA 3CQPA 2MJWA 3P9WB 4F58H 5CLWA 4JB9H 4LLYB 2XIDA 4YO0B 3RDTA 2FWLB 1FL3B 2W0KA 2GI0A 1W0VA 3AG1B 2WXJA 5H37G 4B5EA 4F7CB 3GMQA 3EG9A 3W11D 3OPZL 4PSPA 2J8HA 4FZEL 3V0IA 1N3NB 2VMFA 4QTHA 1KXTA 4OZHF 2UV3A 4FTVD 3K6SA 3BPLB 3CZLA 2P5EA 4N0FA 3N1MC 1UYWH 5A16B 4KV5F 3TBYB 1A3LH 1DBML 3H6JA 1OCWH 2ZCHL 4N1CA 4F37K 2WUCL 1QQDA 1XTLA 3NCWA 3PE9A 4ZAKA 3X12A 2E47A 2XVBA 5KVFL 1TNMA 3FO1B 2FGZA 2WZ5A 3HLAA 5KVDL 3DX4A 4PD4J 3EAKA 4LLVB 4E0RA 1JZEA 5MEPB 4L8SC 3MHZA 5T33H 5HVGB 1P2CB 4DPRA 4XHJD 1HL5A 4N6RA 5E1QA 1HIMH 1XGYH 2CM6A 4PGBB 3QI9A 4MD5A 3L3KA 5AZEH 4X8GA 1LGVA 1F1DA 2Y7LA 3MO1A 1AS7A 1WZKA 2X4SB 4ZMZA 4GAYB 1S6NA 3BW9A 3KXFD 1YEGH 3NIGE 1FG9C 3T0AA 3PJNA 4BFIA 5F7EL 4E42B 5AVZB 3J27A 4WV1B 5IV2B 1A7RL 1LK3H 2XN9B 2F5AL 3DMMD 5DHYA 3CFQA 3V10A 3ZL4H 4AM0B 5DC9B 3HR5B 2HKAA 1KG0A 4H5SB 3T0EB 4XCNB 2KZBA 1HOEA 3QHTC 4ZSOE 1J1OL 4XNMB 3QG7H 3NCEB 3LPFA 2AI0L 5DVPA 3FH8A 4MXWH 4M4RB 4KHTL 4CAGA 5J1TC 1OL0A 3EJSA 2BSSB 1CVSC 1V7NH 5GZNA 3ATAA 4KKZA 2PR4L 5EN2A 3QDGE 3FTWA 3Q1SL 2EECA 5H2BA 3D34A 3QC5X 1HXKA 4Y4FD 5CEXB 1A02N 4NZDA 1D5XB 4GLRI 4JX0A 4JE0A 1NC2B 3UGUA 4U6VH 5C0AA 5BRZB 5DK2A 4HETA 3FW6A 4Y4KC 4B97A 1RSFA 2BWIA 2FYYB 3DRTB 3IDNB 2XTJB 4G8FB 4HLZH 2W94A 1NGPH 4NKMA 4NUGH 2VLME 2YFNA 4PG2C 2FD6H 3IT8D 1YY9D 2JE8A 3TCLA 3GXUB 4PHZA 1RJLB 3QEUA 3RIFK 2D4DA 3P69A 7CGTA 3WEXA 1IFHH 3K2UH 4A04A 1F4XL 5LQBL 3FN0L 3S37L 3GC3A 4P49A 4GY4A 4ANXA 3FB6A 4WWKC 2ICWB 4OLXL 5J3HC 3OAZK 4L0PB 1Q0XL 1HEJC 3BN9D 2DQIL 1Z5YD 3QJQB 5TE7L 4LIQH 1TEGA 2XYBA 1W6WA 1HH6A 3V95A 1MCOL 4AMWA 3KPMA 1QP1A 1W9XA 3KLSA 1XR9B 2WC7A 4OV5A 4HIEA 3IYLW 5GJSH 4XVJH 5FOBA 3NMEA 3UJTH 1E4HA 1HCVA 3MLWL 3QJHB 1PJ9A 2DICA 4HS3A 4OF6A 4ELME 2IAMC 2CLZA 2P5WD 5EUOE 2H45A 4EI5D 5IROC 3SDXF 4EOWL 2DYPA 1MLCB 3GK8H 3VUAA 3NJGA 4XNUH 5J9PA 3BDYL 3EOTH 1LP9A 4I2XB 5T3XH 3O4OC 2HVJB 3IDYB 2X6BA 5LBGA 5AOKA 4F58L 4RRPA 1NLBH 4I0PD 2G9HB 5I16B 3OAYK 4G7RB 3MQIA 1EO5A 1HHJA 4CJ1A 2Z64C 2OL3A 3MRGB 3OJDA 3VWKA 5HYJA 3KMDA 4DO6A 3HMXL 3MCKA 3GHPA 4EMZA 2ZXEB 2DMHA 5LXGH 2RHEA 2EABA 5HPMA 2JCCF 3FCSA 5CM1A 2W88A 1U8QA 2X4OB 15C8L 1UYWL 1XGRA 4UNVA 3VDBA 3B9VA 1U92B 3V0EA 1OCWL 5KOVC 2EDYA 1OXYA 3SQRA 2BSDA 4HWBH 3FQXA 5D4IA 1IC7H 1UM4H 2CJTA 5JHDA 4YXLH 1USZA 2R2HB 3T71A 5DD3H 4IOSA 4YR6A 5T33L 1S7WB 2Y22A 3MUGB 3KPOB 3LKOB 4MRBA 2NW3A 1XGYL 4J4PD 1MF2H 3AREC 4NLAA 5HHOA 2R15A 5TGBA 5AZEL 3U7WL 1KFGA 4LCUB 4HH9B 4HXBH 2DQMA 5KSVA 2GSGB 4HV8B 1S2EA 5T5FL 1OIOA 3I2CL 4XN1A 4K3DH 2WVVB 1N8ZB 3MRPB 4UILL 4XMTA 2P4AB 2DYSB 5D1QE 5J0BA 2IGTA 1ZVNA 4I3SL 2P42B 5HGGS 3T6QC 4XMXA 1TR7A 5T3ZH 5AAWA 1U93B 3QG7L 3L8QA 1WS7A 4FQJH 2R83A 3GLEA 3V9CA 1KCKA 4B0MB 4BKLB 2B4CC 4MXWL 3HUJB 2FJGB 3STLB 4F7EB 5KYXB 2R1XA 1I1AA 4JVPA 1V7NL 3IKKA 2IAMB 3B9KC 4M1DH 3X11A 1LQSR 4QAMB 1KT2B 2NY5H 4IQHA 3N0PB 1CXFA 2VTFA 2FVNA 1CC3A 3CDZB 1CDHA 2YFOA 4NZUH 1NFIA 1YNLH 2ODIA 1I7RB 3UMNA 3Q1EA 2H1LM 4KNSA 4AK2A 1MI5B 2VDMH 1VPOL 1MDTA 3AG4B 3QEQA 4I1NB 4UT9A 2DZEA 1DO5A 1SQ2N 4FQIH 4K8RD 4Y5XB 5GJTL 2D9CA 2L4OA 1VJSA 4KPHH 4R83A 1NGPL 2O6CA 4FLHA 3DIVA 4NUGL 4M8VA 4EI6B 4CMHC 2FD6L 1E4WH 5J11B 4YO0A 1XGPB 4LLYA 1FL3A 1KNOA 1IFHL 3EXLA 3K2UL 3AS0A 5SWZB 4P9HH 2XV6B 3WS3B 4F7CA 4HVBA 1MFNA 3NIDF 3UC0L 1SJVA 3D08A 1LM8V 5FGCB 1N3NA 3PRZA 1GYVA 4FYTA 2BH0A 4YGVA 3PABB 2W9EH 3WNIA 3WTWA 1SGKA 4W81A 5GS2H 3TBYA 3BAEH 3QFDB 4PR5B 2MHAB 3O9WB 4ODBD 2ESVA 4XVJL 1EPFA 2EP6A 3UJTL 1T22B 2IEPA 3BAIA 1J88A 4XI5D 3FO1A 2YEZA 2NDFA 2YO3A 1F4HA 5T1JA 3AREB 3GK8L 2F08A 5MEPA 4OLUH 3L45A 4KRPB 1NUFA 3EOTL 4M43L 4WUUB 5K9KA 1P2CA 2EDBA 2YK1H 4PJ5E 1UUSA 2CO6B 4JZNA 2YGVA 4WLCA 5C0BB 1NLBL 4YVUA 1MHCB 4MNQD 3TL5A 3CN0A 2X4SA 5B1JC 3UAAA 5DA0B 3A67H 4E42A 5IV2A 3BH9B 3CFMA 4L9DA 4WV1A 5C07B 5LXGL 1AAJA 3RWHB 3ULVH 1HJCA 4JG9A 4G5ZH 1Z5LA 5JMRA 5CGYC 4LASH 1QRNB 1NMAH 1Y6NR 3HR5A 4H5SA 2BY2A 3QZWB 4N2GA 1QSEA 2G75B 3B9KB 4XNMA 1SUHA 1HESA 1I8LA 4PJIB 3EGSB 2ZWLT 5BS0D 2CSPA 2WKOF 3SKMA 4G9FD 1KEML 1H3GA 1XD0A 3K91A 3R1GH 2IH3B 2HRGA 3RIKA 4UCFA 4DVBB 2BSSA 4WQOA 3LX9A 1UH3A 5DD3L 5JIPA 1J5OL 3QQNA 1LJMA 2BVOB 1BDYA 1B2YA 2LFEA 4J3XA 4JHWH 2IANE 2WJ5A 3RWCB 5I1LA 1IKNC 2V9RA 1N68A 3FQUB 2OTUB 4JS7A 1UXLA 4UBDC 5D71H 1MF2L 4CMHB 3V79C 3SDXB 1OP5K 3IDNA 2FYYA 1MVFA 3VRJA 2ZKHH 3WXWH 2VLJE 4J2QA 4XBGB 1UG9A 1FGNH 4KFZC 4YHKH 3ARWA 3BWAB 4F20A 1K85A 5C3LD 2HRHA 1U8KB 2FEJA 3IBEA 4K3DL 1Y7VA 3SBPA 2IXQB 3CHXA 3RY5A 3ULVF 3LH2H 4YDKL 4PRDB 1COBA 3DOHA 2XZZA 2NX5E 2FO1A 3HHMA 1PQZB 4XB3A 1EAQA 2KDYA 2W95A 2ICWA 4QJ5B 1MHHA 1P6AB 5DS8A 4FQJL 4PWEA 1KPUA 3UEZA 3MA9H 1MCJA 2JCCB 2BPBA 4WEMB 3OB0K 5EEXA 2A9NH 4M1DL 4QRUB 3A21A 5LG6A 2NY5L 1TLKA 3GM8A 3L1EA 2C3HA 7FABL 3QUZC 1IGYB 1QEWB 4A7QA 5BCAA 5CCKL 3M7FB 1UD4A 3TH2T 3UOAB 1MLCA 4FQIL 4KAQH 1CD0A 5HI3D 5ILTH 3OC5A 3QPQC 2CNYA 1UOWA 4U6HB 4PMEA 4KPHL 3HA0A 1P5VB 5SV4A 4DIXA 2VR5A 2VGLM 5IQ9A 2HVJA 2I5YH 1D5ZB 5TK2A 4ODVH 1MCLA 1E4WL 5TE4H 5DVNA 2ENSA 6PAZA 4F27A 1F2QA 1SMDA 2G9HA 2V4LA 1DSYA 3BD4A 1FQ9C 1LL1A 1TU2B 4P9HL 4PGDB 5KSBF 2UUDK 2V0AA 1F1AA 2K3TA 1MRDH 3JVGC 4CN1A 1AQMA 1QSFA 1XWVA 2Y6SC 4XOBA 1XSJA 4YDZA 4WHTA 2O30A 3MXWL 3U9WA 4AT6A 2X4OA 1A5FL 1G9NL 4GUCA 4RIRB 3QNYB 4JM2D 2ATAA 1AS6A 4FERA 4MCYB 3I6KB 1EAOA 4L1BA 3QR1A 4J7RA 1BF2A 4Y8AA 4AY0A 5JXEC 5DVKA 1FO0H 2A6KB 2V7NB 5JHLL 5DFVD 4ZX5A 3GKWH 2FIRT 4NJAL 3WTXA 2ADIB 2HG0A 1DVFA 9PCYA 1MVUB 3CN1A 2X42A 4OLUL 4UI2A 4W9HC 1S7WA 2Z91A 2RIKA 3MUGA 3KPOA 1LMKA 2PCFB 3LKOA 3PWUB 4NKQB 5D7SH 3VCLB 2YK1L 1TTRA 1S7VA 3OF6A 2OX5B 1JD7A 4KJQC 4H25A 3DWTA 5E1HB 2XKSA 4HH9A 5D2NC 1JGEA 3V4VH 1O6VA 5CN1A 1E6OH 3TVMC 4LFHG 5FA3B 4DUWA 3ULUH 1MFAH 2GSGA 1L9SA 3LYRA 2XQ0A 4IOFD 4NO0D 4KBPA 4HGMA 3ZR6A 3MRPA 1IQWH 2BVPB 1ZLSL 1EHKB 3GTVA 4LASL 3D0AA 3T2NH 3DGGB 4XN2A 1OAZL 3UAJC 2FBJH 1JYNA 1U93A 3ULVC 3NIDB 1S5HB 4FTVE 4LEBA 4A6YH 1WG3A 4BKLA 3JT2A 1YVLA 5DFWH 4RMBA 2BP8B 1ETB1 3PAZA 4ZS6D 3R1GL 3NZHL 3N6YA 4FI7A 4PVBA 3GWJA 4K5OA 3TEZA 3JWDH 3Q8EA 4Q0XH 5C7XH 1RJZB 2NRDA 2Y5QA 1OGTB 1UWGH 1KT2A 3ZKXC 5ALCH 2XQYG 4JHWL 5CN2A 5EOTB 4XPGH 1DQDH 4J39A 3CDZA 4ODWB 4Y2DB 3Q05A 1RZIB 3QIUC 4CMMB 2HFEB 5JUEH 4ZW6A 2VDMB 3STZA 2ZKHL 3WXWL 4Y5XA 3UPRB 2C9SA 4LVHB 3K1DA 1E2WA 4GW5B 3ULUF 3PNWB 2P8MB 5H37H 4EI6A 3KGRA 2DIAA 3BVXA 1WT5C 3LH2L 2LR4A 3VFVA 1H15A 3EH2A 1E90A 2E9WA 4OQ1A 2YMOA 3QWRA 2EVHA 1F3JB 2WINB 3DC0A 5EDSA 2EIBA 2VZTA 3WS3A 4YZFE 2JMRA 3MAWA 1LO5B 3HMXA 4P2QD 1K72A 4YQXH 3GBDA 2PCXA 3MA9L 4KRNA 2NCEA 1SDYA 3IDIB 5E6IB 4GUPB 1P6WA 3P4MB 3Q3GB 5FYKL 1ZK9A 3S6CA 1BQHB 2DJSA 3PABA 4X6FB 2ZUYA 1RLBA 5ITFB 3NRPA 5CCGE 1G0XA 4WO4C 3C8KB 2DYRB 3QFDA 1YG9A 2MHAA 3O9WA 1D7DA 1DVZA 1CLOH 4YXHH 1T22A 4ZTPH 4AJWA 1KXVC 4ANWA 4KDVA 5AW5B 2C1OA 1XB8A 3RWDB 1XCQB 4KAQL 1QATA 3ZLQC 1QTYT 3NESA 2KQMA 4X7DC 4ABWA 3GUTA 4WUUA 4NN5B 1EZVX 1FNGA 4KTDH 3P4LA 4ALAH 3L2LA 5GGVY 2WQRA 2I5YL 4ZAKD 3LEVL 3WFHA 3IDXH 1N70A 3TNNB 2NW2B 4M62L 4D9LH 3HMWL 2K9FB 3QCUH 4GAGH 4LQFH 3CFEB 1ZANH 2VXSH 5B1CA 5EF2A 4OZGE 2IDCA 2QADD 2PP8A 3VI4F 4MAUL 1VEPA 5C0CD 5T5FA 5C07A 1A6TB 3R8QA 1MRDL 3BSGA 3QI9D 2DQEL 4CN4A 4PEEA 3UG3A 2EDLA 1H3TA 3L3OC 5E7FA 2H3XC 2VAJA 2Z8VC 3QZWA 4Z95H 3RL1B 2HX7A 2VXUL 4PJIA 5J57B 2E9IA 4ETYA 5G5DB 4QUOA 1FO0L 1FZJB 1P9MA 3TWCH 2HLAB 2IH3A 1PLBA 3GKWL 4EF3A 2XCMC 3X14A 3TBCA 3IU4L 2BVOA 2IGLA 5KTEH 4R3SB 1KMGA 1IARB 2P5WE 1FNSH 3FQUA 3IF1A 2OTUA 4JFSA 5D7SL 4MDRA 1IAKB 4X50A 4JPIA 3MJWA 5JW5B 2YXVA 1U58B 3GSOB 1N2RB 4X4KA 4YSPA 2OMNA 5DRWB 5IQMA 4XC3H 2MOVA 3V4VL 1E6OL 2N7SA 5LGJB 4OTXH 1U8KA 2IXQA 5IVXF 5E70A 1HQRB 2R9HD 3SKUD 3BT2H 3EYUL 3T2NL 3ULUC 4QR7A 1Q8MA 2OMYA 2FBJL 2CLRB 3NDZE 4Y16B 3RURA 2CK0H 4BCYA 3ASOB 4J8RA 4A6YL 1L7IH 3GO1H 3D4CA 4YSCA 4YHZH 1EBAA 4GEJA 5CN3A 3PYCA 2LAGB 3VGDA 2XIBA 1ZAGA 4KKAC 3RWIA 3T6ZA 4F7TB 4HDIA 4QRUA 4Q0XL 3BUYB 1TUPA 5IMKA 1E65A 4ZW3A 1H3WM 3CK0L 1JNLL 1DQDL 3QUMA 4GT7A 4XPGL 4OGQC 3DHUA 3ILEA 1QEWA 5B1BB 5DFTA 2AJSH 5EC2A 3JWDC 4LOUC 4AEIL 2H8PA 5E5RB 3KLHC 4JQXA 4U6HA 2Y1ZA 4JNXA 4UQBA 3ZL2A 1D5ZA 3QQXA 1I7TB 5I6LA 1IU1A 1JF6A 2ZKXA 4EZKA 3NDYE 1QFHA 1ETA1 1TU2A 4GRLD 1NCDL 5FUOH 3SSGA 3II1A 4PGDA 4G82A 4JRXD 5KBKA 1J12A 2F53D 3O3AA 3OG4B 1S7UB 5CFAA 1F6AB 4HD5A 3HRPA 3BGFC 3VMPA 2CK2A 1LD9B 4X6CF 5I0DA 3VFOB 2FZ3A 3VAEA 1DFBH 4ESKA 5HYJD 2Y1AA 4TNWK 4PBVC 4AKQA 1EH9A 1VRSA 2X9YA 3QJUB 2BOCB 4RIRA 3Q5YA 1XH3A 2X0UA 4MCYA 4YXHL 1CLOL 3B37A 3I6KA 1XT5A 4L1SA 3S37X 4YDMA 1E3FA 1GZQA 1PKQB 2A6KA 1TVHB 1FO0B 4JQVA 1M42A 1NBYA 1EHLL 3LRKA 3UAEA 1B0IA 5J7CC 1PU0A 2ADIA 1JZ7A 1SXSA 4PGCB 3T0WA 5IP4A 3PXLA 4XAWH 1FH5H 4YZWA 3VFWB 5FCUH 4U1MA 3DBSA 2B39A 4M1GH 4MAZA 4YFLF 1PLGH 3NABH 4Z76A 3MYZA 3H9SB 1EMTL 3MFGB 4PBDA 4OUUB 2NSQA 3U30C 3W2DH 5AL0A 3WNLA 4D9LL 3VYPA 4GAGL 4TULL 2J5LC 2PPAA 3D0VB 1ZANL 2VXSL 4IOSD 4JO5A 3DGCR 4ALAC 4DH2A 4Y2LA 3V4VB 3L3GB 2N0KA 3D50A 4WSGA 2EIMB 4HHWA 2HJFB 2VERN 2N7AA 4OIBA 2CO3A 4GG6A 4MD0B 2BVPA 2ZUSA 1LEGB 4NQEB 1YEJH 1HH9A 4HK0B 3DGGA 1WAAE 5DT1H 1U8JA 4UAHA 1QZ1A 3P3RA 1GTFA 4A6YB 1I9JL 1IGIL 1CDCA 2BP8A 2VLLA 3TWCL 1U8HA 4CC1A 4NPKA 4HUXB 1CDGA 4CU6A 5HDRA 5BOZG 3WAJA 1OGTA 3QUYC 3HC4H 5KTEL 4PJ8C 2PO6B 4ODWA 3MLSL 1RZIA 5JPNB 3S36H 3PF2A 1SVCP 3E9UA 3U2JA 1OCCB 3GLAA 3EDEA 1CLCA 2X1WL 2YRZA 3CX2A 4XC3L 3UPRA 4GW5A 1E5AA 3SCMA 1HSBA 1T83A 4K5LA 2WIIB 1TITA 2P8MA 3RJDA 2P52A 4MHHI 4MNQE 2LLGA 1A14H 2ITDA 2I32A 4Y19E 4FMKA 1VKXB 3T1FA 4C56B 4BM7A 4PP1D 3VI4B 2V5SA 2CK0L 3PXJA 5K1NA 4LSTH 4AH2B 1L7IL 3GO1L 2RBLA 2P80D 1P7BA 3IDIA 3LXCA 5E6IA 4GUPA 3DIFA 4BFKA 4FG4A 4PV9B 1AQHA 2C4FU 1BQHA 4J8QA 4XXWC 5ITFA 1IEHA 1DANU 4FG6C 3TH3T 3MLYH 5BS0E 4R2GD 1KYDA 3C8KA 2DM3A 2W80C 5IJVA 3FNKA 4A38A 4G9FE 2NQDA 4MKTA 5I1EL 1S7RA 3BP4A 1HU8A 2V5TA 1SOSA 4PGJA 3GNML 2H6UA 1A7BA 1JMZA 2AJSL 2LLLA 3AC0A 3TIEA 4BK5C 2ISDA 3QO1B 1BFOB 3RWDA 1SYSB 1XCQA 2H3KA 3ECBB 2AXFB 1DJGA 1JCKA 3S0PA 2ESVD 5TE6H 2C1PB 1X5MA 2NW2A 3TFKC 1SEBB 4C4UA 3CFEA 4JFDD 4JJHA 1EFXD 1DVSA 3V8CA 3VXNB 4R84A 2K4AA 4LLWA 2O6DA 1NGXA 3GMLB 4PJ9C 5IVXB 1O7SA 4LHJB 1RK0A 4XMPL 1N64H 3GF8A 2KT6A 2YRBA 3IGFA 1F56A 3LRSB 5E4AA 1CPUA 1Q94A 1NL0H 1MAJA 1E4KC 2WBJD 2QSTA 3RL1A 4X5RA 4DEWA 2JV6A 2NMSA 2Y7QB