1WEJL

Igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/electron transport)
molecule keywords E8 ANTIBODY
publication title Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution.
pubmed doi rcsb
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wejL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wejL01
5A2KH 3VDAA 4PV8A 1S7WB 1ONQA 3CFCL 4NZUH 4LBEB 4U1JB 4KJQC 2L4OA 1KYOJ 4JFFD 5I1HL 2Z8WC 3WFDL 1P84J 1CTNA 2PYEA 5HY9B 3G08B 3QCTH 1NFIB 4H20L 2FSEB 4RMQA 2CKBA 4C4KO 2A73A 5JXEC 1KCVL 2BY2A 3OB8A 2VLJE 4MZ2A 3S34L 1N0XL 1SEQL 2WINA 4WI4A 4X5XA 4IRJC 3MNWA 3SDDD 3EIFA 4G9DB 4QOKD 1RUMH 2W9LA 4XWOD 5GJSH 2P24B 4K8RL 3UBXB 1S7RB 1JBJA 3CFKA 4CNIB 1D7FA 4J4PA 1NCCH 3FFCB 5AUMA 1SY6A 2MOVA 4APQD 3EO0A 4JKMA 4F7TA 4H0IA 3MODL 43CAA 3DRQB 1YDPB 1MJUH 3LIZL 4OGZA 1WZ1H 4X9FA 5IB2A 1TJGL 2D03L 5H35A 1QO3A 3TH2T 5EZJA 5FYLD 4J12A 1RAMA 2P43B 4Y16A 1DJSA 3O3BA 1FV1A 3SJVA 2Y5TB 4PGBA 2FD6L 3K8LA 3L7EB 3D1MC 4NO2B 5KSUB 5MI0C 3CFEB 1X3DA 4JDZB 1CN4A 2Y25A 4F9PC 1OGTB 1QSEA 4TTGA 4YAQB 5IB3B 3HAEB 3TBTB 4CUCA 2F8XC 2JELL 4PRAB 5TE7H 2FIKB 3QEGL 3RZWA 4R4ND 2NXYC 5KSAB 4N90D 4RIRA 1CZ8L 1MY7A 4YHOL 3JUZA 3NGBC 2H8PB 3AC0A 3PDGA 1J0KA 1BVZA 3C87A 2PXYA 3ULUC 4ZOAA 3QIBD 4RGOL 3V4VH 4O2EA 5FUZL 5C1MB 4IIQB 1U0QA 4YXKH 2BXYA 4BZ2L 2GUOA 4M8VA 2MCG1 3RAJH 1KPVB 4G43A 4LLYB 2WWMD 5SWSA 5D6DA 3ZKNC 5HDLA 1HQ4B 1WFNA 1ES0B 3MRGA 4P2QD 3VH8A 3LKPB 3G9VA 1T2QL 3SDYL 2V2TB 3CUPB 2EDJA 4LRIA 5C0DA 2WUBH 4OZ4A 2EH7H 1MQ8A 3LN9A 1IAKA 2OL3B 32C2A 4MA7L 2AJ3A 1KPUA 4NFDA 4P5KA 2OR7A 5I75B 4QHKI 4UINH 5T1DH 1BOGB 1A8JH 2E27H 4FQJL 3T0DA 3ARBB 4I0PC 4P4KB 1JMZA 1EZVX 3V52L 4PJ5A 1K3IA 1KJMB 4U1LA 2Q7YB 1PKQE 1OF2B 4BQBA 1EPFA 5D5MF 2D7QA 2WAHA 3ULUH 4ZDHA 3C60C 5GHWL 2B7DT 5DD3H 4HUMB 4X0KB 4V1DA 3TZVA 3LEYH 1LO5B 2FHCA 2QJDA 5AZEL 2HH0L 1NGQH 3MMEA 2V9QA 4MAYB 2ITDA 4F2MA 1DBBH 1LO2H 3TBSA 4OD1L 5FUOH 1PDKA 1R3LA 1NBYB 4MNGE 2EECA 3KPOA 2FO1A 3HPJA 4P2RA 1G7HB 2DD8L 3DURA 4XNXL 3RA7L 2VXSL 3BIKA 1P7QA 3AS0A 1ZHNB 4XP1H 4Z7QF 4XC1L 2OK0L 3MUGA 4NPYB 4NJAH 4UT9L 3C6LC 1QBAA 4LLUA 4ONHB 5DJ2A 4S1SH 2YBRA 4JFFE 4X7SL 1RZKH 5D7SH 5EBLA 3FQNB 4FQHB 1FH5L 2Q87A 4TQEH 4RNRB 1P9MA 3QUMB 1F45A 2XTJC 2RAMA 3BKCL 3KLHD 2NNAB 1D5XA 1QEWB 2JB5H 3KYOA 4P4RA 2J4WL 1NCDL 4ALAH 1CBVH 4NRXA 4QTHA 4JZJB 4OKVA 3RZCA 5FEBA 1CD8A 1UJ3C 3D2UD 4CN1A 3WUWG 4EN3A 2YMXL 1A3RH 4X6CA 3S4SG 1WLHA 1EERB 4QOKE 3BPNB 4RGND 4HJ0D 1MUJA 2YD8A 4A6YB 5J6GA 1ZMYA 3LQZB 2R2BB 3VFOB 3KPMA 1NGWB 5ELIA 4C56A 5GSRA 3HI6H 2QEJA 2IADA 1I8MA 3VI4F 5AYUL 4XP5L 5KN5A 2R4SH 2VXQH 4JO1L 2A6JB 1BVKB 5C08D 1JNLH 4FNLH 4TUOB 5FGBC 4AEEA 3ILPA 2IPUK 2LFGA 2DBJA 2E5EA 3ISWA 3QRGH 4KMTL 2BOBB 5FYLE 3HNVH 2WBJC 1J05B 3SN6N 5L2KE 2AJUL 1KEGL 2XKUA 3O8XC 3OSKA 4Q2ZA 1EJOH 3EYSL 3KPSA 3P40A 1HKLH 5ESVB 5BRZA 3G6AA 2VO5A 2E7MA 1KIQA 3CLFH 4M7LT 3WFCL 2DLHA 3CVIH 5D7IE 3V0VA 4N8CL 4S1RH 4OZHE 1D3CA 5TFSH 3S7GA 4K3GA 3U9PL 3O11A 5FHAL 5HGBB 3TPKA 1J1XL 1K8IB 4R97C 2CXGA 3G5ZB 2VXVH 3DJ9A 1AGBB 4LSRL 1JTPA 2CO7B 4I48B 1BZ9A 1KB5L 4LSQH 5D7JD 4OZFG 4HZLA 1KCLA 1A1MA 3D5OF 5F7DA 3P4NB 4KKCC 4GFTB 5BZWA 1WVZA 3L3DB 3FB5B 5ANMA 4N90E 5I6XB 2BDNL 4EI5A 2NW3A 4PGDB 4OCMC 3U0PB 1I3GH 4KK5C 1ORQB 3PWLB 3KHOA 2J5LC 5L8LB 3BZFA 4GBXA 1JPTH 5IVZA 3L5IA 1BMGA 3BP7B 5F6HI 2B0SL 4KC3B 4MDJA 4P49A 1SM3H 4PJGF 4I77L 3U7WL 3FO9B 4AEHL 4FTVD 5CEZE 1MCCA 4R3SB 1SBBA 4HWZB 2AP2A 3DV4B 2DMBA 2WLZA 4WUKH 1C8PA 1E6JL 2FLBT 1KJ3H 4CW1B 3HFML 2QSTA 1MCWM 1VPOH 5C09A 1T5XB 4R8WL 2EDKA 1HE7A 1M7IA 3GSNA 1MEXL 5EO9A 3C5ZD 3EOAA 5IGXH 2KUTA 4FXKA 4JQVA 5EIIA 4JFPA 1T2JA 5I66B 2X70B 4KGLA 1YPZF 3T3PF 4E41B 5C0AD 4FMFA 3ZYOA 2I9LB 3O2DL 1LEGA 5KW9L 3HI5H 3ARGC 5I8EB 4FQ2L 4M4RA 4PRPD 5DF0A 3HC3H 1OT1A 3NABL 3IETB 1CLCA 1I9IL 1QKZH 2GKIA 4LSVL 5F7HA 4Z7UB 1Y6NR 3MYJB 2H1PL 1WFTA 2OX5A 4U6XA 3DUSA 4DQOH 1MCQA 1U58B 4HUXB 1QBLL 1FG2B 1TJIH 5HYSG 2IMMA 1RURL 3TYGH 3IGAB 4P23B 3B4NA 4QHMB 4N5UA 1DLHA 1W72A 3ET9F 4Z7WE 2WWKO 1IAIL 2X9YA 1QFWM 5JPNB 3VFPB 2XWJA 3CCHB 4MD0A 1IBGL 1JWUB 3QO0B 3OPZH 4Q0XH 4RQQA 3UTTA 3GEWB 4X7DC 4MJ4A 5FECB 3Q6FA 5C2BH 1UA6L 4WUUA 4I0KA 2CUIA 3OG6B 1JP5A 4PJAB 3AFLA 1JJUA 1NC2B 1YNLH 4IMKA 3SBWA 3CFBA 4LSTH 2LU4A 4H5SA 1FNGB 4JLRB 3F58L 2AJVH 4GW4B 5E1HB 3MTRA 4WI5A 2X89A 3MROB 4OLZL 3VE0B 2EE2A 5E24E 4H8WL 3HUJB 3C2AL 3LD8B 3RVXC 5FF6A 4JO3H 5EPMB 3VI3F 3QI9B 1AFVH 4JVWA 4BQ8A 2ED7A 2Z91A 5C08E 3RVWC 3WNMA 1JPFB 4EUPA 3AS3A 3LOWA 3C09B 3ZE2E 3LB6C 5IHUL 3THMH 1UH2A 3LKRB 1G84A 3VRJA 4PY7B 5SWSB 4G42B 4RX4D 1C16B 2VABB 4MJ6A 4NKDA 4N8VB 5JQHC 5T3XH 5GRVL 2EYRB 1KPRA 4U1KB 1YN6B 2BRRH 3FOLB 1G7LA 1R3JA 3HZMB 4JPWL 3CAFA 3GUTA 1X44A 5C0DB 1GH7A 1NUGA 3CDGA 3QH3A 3GRWH 5J57B 4Z76A 3CZFA 3U7AA 3TVMB 1MCKA 4OQTA 4NWTL 1BF8A 1XF4B 4C54A 2ZNWA 1A6VL 1TZHA 4PJEE 2ADIB 4L8BA 2CRZA 1EH9A 5E2UH 3AREC 3VXPA 3VXUD 3HMXA 2VE6A 4U1IA 1J7VR 2DTSA 3HR6A 2W0PA 3QEUA 3BYTA 4LVEA 5DMYA 1EGJL 1L7IL 3PGCB 1P4LB 4IRSC 3TLRA 2IH1A 2KPNA 1CT8A 1HHIB 4V1DB 1IC7L 3IRPX 4RFNC 3ARXA 2EDQA 1Q72L 3MRHB 1NMCB 4TSCH 5CKGA 5DJDA 2R0KH 2Q3AA 3NMEA 3U0TA 1NMBL 4FTVE 1T89A 4YDJB 4GAGL 2P47B 5IMKB 2XPGB 3RDTC 1BHGA 4X98A 1OSPH 5GGSB 5CJ8A 5GRYA 1T7ZA 4KPHL 4CVUA 4GW5A 4NN5B 4ZG1A 2CRYA 4KKNA 2O26U 5I30H 1EFXB 2H32A 4FZ8L 5CD3A 5AEAA 1CE1H 3IDMA 4DAGH 4R26L 5DJ2B 3HRZA 2G75A 1F8TL 3I85A 5EBLB 1XF1A 4JN2B 3CD4A 5FO7A 3ECBB 1KENL 1INEH 1MJJB 1XGTA 2B20A 1AI1L 1I8IA 3QPXL 3X12B 5ADPL 1ODAA 3C8KB 4XNUL 1B6DA 4PRPE 4ETQB 2XZAH 2YPLA 3WJLC 4EEEA 2VLKB 4O02H 4PRHD 4LASL 3QEQA 2DYPD 2P8PA 4Y89A 4DVRH 4QHKJ 2DQCL 4AM0B 4L8SB 1I8MB 3VXMD 4WTWA 1CQKA 4JB9H 1V3MA 1QPPA 3DWTA 3KXFD 4QT5B 4HUNB 2NY1B 2EIBA 2IGFL 2KH2B 3G6DH 4L4VD 3ZO0A 4X6EA 4XXDA 1FFOB 1MHCB 2RBLA 3KPSB 4PJIF 5I16B 2ZG1A 3QDAA 4P48A 5F7FA 2ICCA 1RJYB 2J8UF 1MELA 3B2VH 5DK0B 4P3WA 1X5HA 5DYOA 1CL7I 1N26A 5IT2L 3O11B 4I18A 4P2OD 1B90A 1L0XA 4PJ8C 2FJHB 4U1SA 4MMXC 2OYPA 5E6ZA 3T8XB 3U9UB 1NKOA 5DJZA 4C83A 3KYNA 3QCUL 1XIWA 4XPHH 3NCFB 3CVHB 3QUZC 3NFNA 3MRFA 1AJ7L 2JIXB 4M1CC 2NY4B 4YFDB 1AXSA 5B39B 4YBHA 1H8OA 1V7ML 4EI5B 4ZUTB 2Z35B 3NCEB 3O6FC 3QQNA 1KCKA 3I3DA 3EYOB 3U79A 2D9QB 1TVDA 1K3ZA 4PD4K 1WWCA 4YHYB 1NL0H 3HB3D 3HNTL 1D5BB 4PJCB 4UUJB 3PIQB 1ZA3B 3WIHH 5JORB 3L5JA 1WBZB 4H1LB 4NBYB 1GPOL 3PP4L 1JGLH 3CX5J 4P46D 1NBQA 3G6JA 5EOTB 3OAZK 5DFTA 1P4BL 3TWCL 3UTSA 1BREA 5D1XA 4ZXBA 1JNHB 4KUCF 4M8QB 2LTQC 1F58H 2AXHA 3VXUE 5A3IC 1QFWH 5SV4A 1MJ8L 1N7ML 3W39B 3LZFL 3SGKA 4U1MA 5CBEA 1NEUA 4KJYA 3MXVL 4Y19A 2R0ZH 1D6EB 4FFVD 4PRBA 1I7ZB 3O6KH 4JM2D 5BO1L 3L7FB 4UT7L 4J8RA 2A6IB 4ZUVA 5JZ7C 2AK1L 2JB6B 2F5BL 1P2CB 2CLZA 2Q1EA 1AQDB 2GJ6E 4PP1C 1QVOA 2XQYK 1ZLSL 4KVNH 3IS0X 2ZJSH 4FFYH 1F11A 4R2GC 3W9DB 3E1F1 4OV5A 3WEXB 4O2FA 5LBSL 5FM4A 1L9NA 3V4PH 5E70A 3TNNA 3P0GB 3I6KB 3TESA 1FGNL 2AGJH 1F2XK 4FA8A 5FK9B 4LSPH 3QWRA 5ITBL 4OGAD 3V8OA 1HK6A 1QLEL 4P5MB 4PJXA 2VERN 3LMJL 4Z0BH 3GKWH 5F6HJ 1U3JA 4OT1H 3BPLB 4HJGA 2HT4C 4WEBH 1UB5A 1DBKH 4GG8A 3SE3A 4AYFA 1IGJB 1XR9B 4MQ7B 1J8HB 3L3IB 1PJ9A 1VB9A 4PJFB 5DUBB 4MMZC 1AGCA 1ERNA 2A2QT 1FFNA 2EDYA 4OB5H 5F9JB 3O4LB 1MREH 2EDXA 3OXRA 5J11B 5HHMB 3PGDB 5DVNA 4XP4H 5TQ2L 3HR5A 1TIUA 3W0WD 4PRHE 2R39A 4L9DA 5C3LD 3EJYD 4LFHG 4IM8A 4XP6L 5HVHC 2NZ9D 4AG4H 4PPTA 3LKQB 5JW4M 4PRDA 3GI9L 3VXME 3ZHLA 5ICXA 4MSWA 5GGRB 3GO1L 4X6BB 1BFSA 2UZYB 3KXFE 2Z31C 5K9JL 3VXSA 4QYOB 4WWKD 1MFNA 5IHLB 2A1WL 3QO1A 3U30C 1B4JH 3NA9H 3H9YA 1S5HB 4OFVA 4QRPD 4YZFE 4NCC2 4L4VE 2BVTA 3O0RL 5FHBH 1JTTA 4F7CA 4CVZB 3M1BB 2I07B 3H3PH 4EBQL 1YMMD 3WXVH 2VSDA 3DUHA 1BAFL 1PYWB 3QUYC 1WIUA 3CXDH 1D9KC 5F9DC 1NEZG 5I8OL 1TZGL 3H9HB 4XMLL 3MOAL 1IEAA 1LD9A 1HHKB 4L3EA 4JFEB 1NQBA 4Z7VB 2OZ4A 1ZGLA 3T65B 1I85A 2AJYL 1PVHA 2NX5B 2VWEE 3GSRA 5I1JL 4OQ1A 1E4WL 5IFAL 1KTKE 1T22A 3CDYA 2DLFH 2X4SA 5ICZB 4U33A 5EZOH 3K8MA 4JFOA 1FL6B 5DEGA 1M6OA 2HT3D 4G7YH 2BCKB 3ZDYE 4KK9C 1CK0L 1KN4H 5D1ZD 4EIGB 4GMSH 2LV4A 3CSBA 3IDNB 2VDPL 1AY1H 4JJHA 2HFFB 1S9VA 4PR5B 3L3OA 2VC2H 5FCUH 4I5BB 4U6VH 3PWPA 4QNPF 2O93L 3VFVB 1FO0A 2ADFH 4YDVB 4MQTB 4YHNA 2HG5A 3TBVA 4NZTL 1AXTH 4JPIA 3QUKB 1G0DA 4KRLB 3DMMC 5J06A 3EKCA 1Z9SA 4RDQG 1S9YB 4MA8L 5BW7A 2R56H 4Y4HC 3AB0C 1QRNB 1HHJA 5E8NA 3HUJF 1FZMA 4S1QL 2P5EA 1FCCA 2B2XH 4ZUUA 5JOEA 4YJZL 2R8SH 5HGHB 2DWEB 2VH5H 1QFPA 4FABH 4KQ4H 4RGMB 5IMMA 4KKBD 3GSVA 1CDJA 3TPUB 4LEOA 5DXWA 4G6JL 2FX9H 5FB8A 4M6AA 1CFSB 5FGRA 5BV7L 1HNGA 4UDTB 5E2TL 2GSIB 3LV3A 3IYLW 4HS6A 5C0JB 1ETZB 4XNMB 1H8NA 1U8IA 2BVOB 4OLWL 1S7VA 12E8L 4CU6A 4OLYL 3TT3L 1T66D 1EK3A 3SKNA 5BZDB 1RK1B 2DI9A 3BSZH 5IG7B 5HYQB 5EU5B 1A64A 2AKRA 2Q6WB 4NHCH 3WN5B 1QA9B 2FATL 2G60L 1Z5LA 5FM8A 1CGSH 4P57B 1PZ5A 3QRFM 1BEYL 1AO7A 3BH8B 4TPRH 4S2SA 4BFGA 1FZKB 2E9BA 1WWWX 3KYKL 1UWEL 2ATKB 3NTCH 4NM8H 2DQFA 4D0BA 4XZUB 5HHQA 3A6BL 1MFAL 5CJQH 1I8LC 1Q9WA 1BBDH 4GLRI 1A6WL 4G5ZL 2J6EA 4JFDD 4U6HB 3IFLL 1DSFL 4NQEA 1NDGA 4BK5A 3QDJD 1F4XL 1SJXA 3PJSB 3J8F7 2VNCA 4M7ZB 1NBVL 3TT1L 3W0WE 3E8UH 3QUXA 3NFNB 4LGPB 3GHBL 3BP4A 1NAMA 1AXSB 4WY7H 3OBAA 3UCRA 3MBED 3BN9C 4DKEH 5KSAC 4NRZA 2XRAH 1FJ1B 3MLRH 4O9HL 3DIFA 4UV4L 5EC1B 3IKKA 4P59L 1L9MA 3ZE0E 5C6PB 5DJCA 4JFXA 3JWOL 3OKEB 4S10A 4N0RA 5CMAB 4IIQC 4JY5L 2F8OA 1U3HA 4LCCA 2XZCL 1XCTA 1BBJA 5IIEA 5IJVA 1LP9E 3LKSB 4UZGA 4K7FB 2W07A 1T4KA 3BEWB 3H7LA 1QRKA 3GMLA 4K71B 5TDNB 1YMME 4F7PA 1LEIA 3CPLB 1MCSA 3O3DB 1GZPA 4YR6B 4X6CF 5CKAA 1XGPA 1RZJC 2FH8A 1JYXA 1AR1D 1FVDB 1MHPH 2E3VA 5HHVH 3BZEA 4N1EA 3DO7B 1MCOL 1CI5A 4YHIB 2QKIA 5I75C 1A4KB 3HAEH 4UV7H 1Q94A 4QRQA 2A0LC 2GJZA 3ARBC 4P4KC 4F80A 3SKUD 4X80L 3SGDH 1MVUB 1OLZA 4GUPB 1XMWA 5GGVH 5L2KA 4QXGL 4EQ3A 1OM3H 1FORH 1JRHL 1CDHA 2PO6B 5JHLL 3QFJA 4IDJL 1EMTH 4UDUA 4NZUL 1JHTB 2HMIC 4OM1L 4N9GA 3QXUA 5D7LD 3BQUD 3CMGA 1W0YT 3OKMA 3QCTL 3WD5L 1CFQA 3NIDE 4MAYC 2A9MH 1OAXL 2D7MA 2NYYC 5EO0B 4MJ5A 2X1QA 2FEEI 3OGCB 4HUWB 2QQNH 4CN4A 4LIQE 4M5YH 4WNQA 2QADB 1RUML 3SY0B 3GB7A 4JRYA 1RZJH 1U2HA 2OL3H 1A2YA 3D18B 4V2BA 4C58B 1N59B 4XNYL 4HXAH 3ES6B 4GW1B 4H0HB 3RHWK 2P5WD 4HKJA 3MREB 5J9PA 5A2JH 5HJ3B 4XCNB 3ARDD 1UB6A 1N2RA 2C5DC 4WWID 1MJUL 3PWJA 4ZFOL 2IBGA 1U8LB 1Z3GH 1NFDB 3BD5A 4B0MM 5DGQA 3TA3D 1QBBA 5KAQF 3A0OA 3D39B 4N1HB 2V7HA 1I1AA 1W2KT 2CDFA 3U7YH 2VDQH 4YQXH 4JZJC 3VH8G 4Y2OA 3LN5B 4HIJA 4R7NB 2Z0BA 5TE4H 3BPNC 2E7BA 5GS1B 4JFHD 1DEEB 1UJTA 4OFDA 5K93A 5EC2A 5T3XD 3UPRA 2DI7A 4LF3A 3MLVH 4NN7B 3MRMB 5AWNH 1W0WB 1XZ0B 5TE7L 3RNKA 1J1OL 5JW4Q 1C5CH 4LLVB 4GJTB 1MSPA 1MWAA 3DROA 4X6DE 3QHFH 1KTDA 1KJ2L 4GSDH 2VLJB 1FN4A 1PSKL 2QHRH 3HNSH 5HVFB 3Q3GB 2N1KA 5DURD 3MUJA 4WHDA 5TQ0H 2BERA 1SEBB 3QUMH 4PG2A 3LVEA 5HGAA 3RAJL 3F12B 3TNMB 1CG9A 4JFDE 3DI3B 4JO2L 4ZOEA 3WKNA 3MRRB 3T4YB 1FSKB 5GXBB 5T1MB 1BM3L 3QDJE 3TFKC 2EXWC 5M94B 1SBSH 1DBML 3JTSB 4H26A 4QTIH 1ZWIB 3DX8B 1R5IB 1ZEAH 4WDIB 3GSRB 2CDGA 2EH7L 4JRXE 3CSYB 1IQDB 2P49B 5DS8B 3RL1B 5I6XC 4D9RD 1HEZB 5KJRH 4PREA 3HG1A 4DN3H 1JGDA 5D6CB 5EN2A 5T1DL 5JOFB 5E1AB 5KVMC 1BPVA 2BY1A 1PW3A 4HKBA 1JZ2A 2MWCA 4PJFF 4P99A 5F8QC 3GBML 5DUPH 3QG6B 4Z5RB 3ARFA 3ULUL 3D85D 4UT6L 3SGJA 3QXDA 5DVKA 5DD3L 3GMNA 1U8OA 4ZOCA 3LEYL 1AKJB 1MCDA 4X5WB 1JI2A 1IFHH 3U6RA 5C9JB 3QNXB 2VL5A 1B0GB 1NGQL 5CGYD 1RK0B 2IH3A 1DBBL 5GZNC 1KXTB 4WHTA 3F8UB 3JV4A 5FUOL 5DMKB 3DX7B 1CICB 1KEMH 4DGVL 1H0DA 1JV5B 2AXFA 3GSVB 4H25A 3BZ4A 4LEOB 4YHZH 4ZUSA 4ZFFB 5HI4D 2MKLC 1N0LA 5ISZD 1EVUA 4Y8AA 3V5KA 5ACMA 2Z93A 4NNXB 1F13A 5D7LE 1MHHA 3VFNA 3B5GA 1ZSDA 1BZQK 3QA3A 4I2XB 1Q9KB 4DCQA 5F7UA 1S7VB 4IS6B 4K3HA 1NGZB 3JWDH 5KS9A 2GTWA 1J0HA 4OCYH 3FB6A 5JXAH 2JB5L 3V6OA 4ALAL 1BP3B 4PJEA 4TNVK 1X6LA 4X7CC 1DQQA 4HLZG 5F3HB 4M7LH 4P23C 3UDWA 1T20B 3VD4A 5E4IA 1A3RL 4OZGA 4X4YA 5DJXB 3FN9A 2OP4H 2CDEB 5FOJA 1PKQB 5C0RH 5CCKH 2MPAH 3HI6L 3VXRA 4PUBH 4Y16C 1G0XA 1S7XA 2P5WE 4G6MH 4JZNA 2CIKA 3QXAA 3VFWB 5FYJU 1HQRA 3E6HB 3QQ3A 4ELME 3EJJX 8CGTA 2IF7A 4LLWA 1XT5A 1JUFB 1AIFA 4YFLF 4YBLB 3QRGL 3OAYH 3HNVL 2X05A 4HUUA 5KAQG 4XB7A 3DNKA 5GRVK 4M61A 1HKLL 4MNGB 2D7PA 3BP5A 5EDXA 3EYQD 4LOUC 2AEIT 1N64H 5DJAA 3W81A 5EH1A 5TFSL 5FM5M 1KG0A 4JFHE 2N4IA 3WNKA 1W0VB 1YEEH 1T0NA 4R4BB 4PGZA 2E8YA 2LAAA 2XQBL 3LD8C 3O2WH 1FAIH 1UH4A 4JFFB 5CUSH 1BFOA 3BXNA 4RSVA 2FR4A 3PF2A 4RFEA 5CIPB 2G9HB 5EUOE 3IF1B 3C09C 4WTXA 5I1IL 4XMPL 4U3CA 5E6ID 1OW0C 3T2NH 4PJHA 4XGZA 4EVNA 1VKXB 4EJ1C 3WMSA 3NZ8A 4PRPA 4X8XA 4XHJD 4M6NH 5C0IA 2VUOA 4L9LA 3KLAB 1JPTL 3SDDB 2D0HA 2R9HD 5HI5D 4NOFA 5I1KL 4QOKB 2LU7A 1A6TA 4LPTA 1OD7A 4X99A 5E00A 1SM3L 3IJSB 4KKLC 3TVMC 5I8CB 1NUNB 3RKDD 5JQ6H 2NXZB 5DC4B 4APQB 1FYHB 1VDGA 3I6GA 3O9WB 4EDXB 3ZYZA 2A6DA 3R0MA 4AIOA 4LVHB 2H26B 3N0PB 3QXVA 4Z0XA 5CBAB 4JHBA 5FV2A 4OFYA 4ODUB 2OLDA 4D9RE 2EKJA 3S96A 3IDGB 1NCBL 3V5DA 1IL1B 3UAJD 3BDXA 2JK5A 5D7IB 3NCCB 1VFUA 1XH3A 1KJVB 4OZHB 5DD6A 1FFQA 3VXTB 1NMCC 1DN2A 2AJXH 3AU1B 1HI6A 3UTPE 4PBWD 4XPTL 3SDCD 1KT2B 1I1FA 2YZ1A 5EIVA 3RWCA 3HI5L 2XACC 2CR3A 3FN0H 1LWRA 4Y2DA 3IS1X 5IBLD 5JHDD 1CVRA 4HT1H 4K3JH 4TTDC 3T2PA 4NN5C 3CMOH 3UTZB 4UBDC 3MV7A 4P3DA 3N9GL 3EOTL 2GCYA 2V7NA 3QIBB 2HTKC 4HWNA 1S5IH 4GXUN 1SYVA 3PXJA 5FM5O 4EUPG 5I1LA 4LLDA 2YEZA 3RVVC 2AV1B 3QB7C 3HC0A 2GITB 1FNFA 1BFTA 5ISZE 3UC0H 1FDLL 4P2QB 3P11H 4JY6B 2FB4H 3LRHA 1ADQA 1KN2L 5CHNA 1DTUA 4Q0XL 4OD3H 3L6FA 1FPTL 1IM9A 4LQFH 3MO1B 2MKWA 2R1XB 3RU8L 2FEDC 1F3DJ 1YMHB 1RUAL 2D7TL 5C2BL 2FBJH 2Q3ZA 1T5WA 4PRNA 1FIGH 4PG9A 4L8SC 5EC2B 3MNZB 1YEDB 5DFVC 1XF2A 3SDAD 5DK2A 1HYRC 1QLRB 1YNLL 4JQXA 1DUZB 3OX8A 3L3KA 4OGXH 5T5FL 4XI5C 2NY1C 3VCLA 4CAGA 4KZDH 3BH9A 2AJVL 4BSVA 2BOCB 3DROB 3HS0A 3I2CH 3LS5L 3OXSB 3ULSA 1AP2A 4O2CB 3WFBH 1MHEA 4U2YA 4AEIH 3B6SA 3HC4H 2C3VA 2F54D 2AS5M 3TO2A 3PHOB 2GJ6A 5HGAB 1GSMA 4RAHA 2X5PA 1WBYB 1XGRA 4WW2B 3IKCB 1VGKA 2BRRL 4HAFA 3BGFB 1DBJH 5JO5B 1X5AA 3O3AA 2CDGB 1R3HA 5FKAA 4Z7WB 2NY4C 2VAAB 3REVA 5I15L 1YNKH 5M95B 4EI5C 3S36L 1EEZB 1EAPA 4PJXF 1FE8H 2YD4A 5BVJA 4XTRC 5E2UL 1SJEB 5T5NG 4UQ3B 1MRFL 1KV3A 4G3YH 3G5VB 5FDWB 1UWXH 4YHYC 3D3VA 1T21B 2PF6A 3ELAT 4AL8L 3NCYP 3VWKA 1EEYB 1Z6JT 3HI1B 2A38A 4E5XB 5TDPB 3MGTA 3D2UB 4XAKE 1TVBB 3O4OB 1WFOA 2ZSWB 1R3IL 1SMAA 4RGNB 1ZA6A 1K4CA 3FZUC 3V6ZA 3CC5B 2IAMD 4HFUL 3W11C 5MENB 1I8KA 3EYVA 1XGUB 4ZFGL 5A2IH 1J1PH 1CD1A 4N0UA 5C08B 1BLNB 4HLZH 2C1PA 3HMWH 2ZNXA 4HBQA 1OSPL 1F90H 3MJ7B 3MRDA 4JCMA 5DO2C 5GZOC 4NM4H 2VIRA 2WIIA 5I30L 4N0FA 3D0LB 4NO0D 1TTFA 4E42B 3DVGA 1CE1L 4NQSA 4DAGL 4G9FA 3V5KB 1FL5B 4OSUH 3JXAA 2BK8A 3WL9A 4NKMB 4F8TA 4HQQH 4F33B 3RNQB 4FQXA 3AM8C 3U1SH 3BPOB 4MCYB 3MRNA 3BKYH 4PJEB 3IVKB 1UXSB 3MR9A 3QQ9D 5JHDE 2XZAL 3KDMA 5D7JB 3R1GH 4XWGL 2ZCHH 3OKDB 1IC1A 3HPLB 5AAWA 4DVRL 4U1NB 1ZHBA 3EYUL 1YYLH 1EAJA 4PD4J 4LHUA 1NUFA 4YDLB 3GSNH 3WO3B 5D1QA 3RUGA 1X5FA 1G7PA 2XOTA 4DZBA 3BPLC 4XXCC 3RI5F 4PV9A 5GGVY 1DANT 3BIAX 3E6FA 4G80A 4Y1AA 1Q9OB 3VD3A 1A1OA 3G6DL 4FTVB 4LLQA 3P4OA 1LEKA 4X6FA 3CLEH 5E2VL 2FYYB 1BVLA 1HNFA 3PL6D 1R24B 1WC7B 3U46B 4B7LA 3HLAB 1QUNA 1U8JA 3ARSA 5J11C 2GSGA 4LKXA 4XH2A 5ADOL 4LKCA 4LSUH 4IMKC 3B2VL 5IOPA 4GRLD 5LGHL 5J1AA 3CIQA 1X7QB 1BD2D 3GJEA 1QSFA 2ZUXA 2AK4A 3KPPA 5EU3A 3C5ZB 1EXUA 4L3CB 3EFDH 3UJJH 5TF1H 5C0NC 2JCCE 5HYJD 5C0AB 4HIEA 1QR1A 4WV1A 4UIKH 1GOGA 2DQIL 3VU2A 1W72H 1WISA 1QQDA 5IM7B 4XGZB 3DSNA 1JZ8A 5IB4A 2ADGA 2GJJA 2F54E 3ROLA 3O45A 1P1ZA 4G8GD 1P6FA 3L5WB 1NL0L 3LKNB 2X4TA 3P9LA 5L8JB 2DKUA 4RMTA 1P4IH 2IQAB 3WLBA 2VXUL 4ACPA 3L3JB 4POZD 3UJTH 5M7QA 2ZUSA 4CN6A 5LQBL 1JGLL 1A6ZB 5C0FB 3WFZA 3WHE1 1M7DA 1QHOA 3NFSH 4GRWE 3U48A 3QCVH 3WSQH 1L4IA 5F9OH 1IGFL 4QGYA 1U8HB 4RZCA 1G7QB 5H2BB 1T6WA 3OR7B 4OCXH 3ROOA 3DV6B 2ENSA 4JG1H 2KDGA 4HK3J 1RQ5A 5CLWA 5F7LB 4L4TD 4H88H 1VFMA 4HKXA 4LFHD 2IFGA 4LCWA 5CEXA 1RZ8A 1E4KC 2E9IA 1IC5H 2ICEB 1ZLUK 1FNLA 4KK6D 2OQJB 2UY6A 1L0QA 2R0ZL 4MA3A 3RL2A 2HKHH 3O6KL 3NFPA 1ZLWK 2BMKA 5T1KD 3V95A 5DJ0A 4PBXA 3HE6D 5F1IA 5E9DA 3IXTB 3FONB 4QWWC 1YQVH 4HKZA 1NLBL 2O5ZH 4KVNL 1JYWA 1NCUA 1G6RB 1NCAH 3PHQA 3RWFB 2ATPA 3T4AB 1A7NH 6FABL 1AGFB 1AGEB 1NLDL 4MAUH 5C0GA 2EDEA 2AGJL 5EU7E 5J6HA 5A2LH 4RGMC 1JI1A 4YPGB 3O41A 4LSPL 3TN0A 1TQCB 2A9NH 5F89A 4TOYH 1LP9A 1IAII 3S8WA 2JJWA 4Z0BL 3GKWL 5EU6D 5SWZA 3LQAC 3U4BH 1YMMA 4WEBL 1DBKL 1H3TA 4GAYA 1CGXA 1I1YA 2BSSB 4YBQD 1ZT1A 1C08B 2OMBA 1C5DB 4XVJH 5KSBA 4Q74A 2V5SA 3X11B 2ERJB 4UU9A 5I8KH 1VA9A 2W9EL 4ESKA 1AQKH 3MLZH 3VXUB 2PW2B 5IMOB 2HN7B 3L3KB 2Q8AL 2X1OA 1A9BA 3WN5C 1HILA 1Q0XL 5I17B 1CD0A 1ZGLM 2V2XB 3OJMB 2H32H 2JLLA 4LCYB 4AG4L 1GGUA 4UMGA 4Q9RL 1YN7B 5ENWA 2CXKA 3GMRA 2IAND 4NN6B 5D7IF 5FFLA 5D70H 3IFNL 3OAUL 4OZHF 5FUCE 5HHNA 1IAOA 5FHBL 4WW1B 1D5ZA 3BT2H 2H2SD 1L7TL 2OR9L 3TYFA 5FYJD 4E0RB 1YUHA 3P77B 5KTEH 2C3XA 5C8JA 15C8H 3H3PL 1CFTA 5EZIL 4M7ZC 5E8EA 4MQSB 5AZ2H 3CXDL 5CSZA 3HZKA 1I7TA 2YPKA 3EAKA 1PG7L 3FL7A 2GFBA 4W81A 4JR9H 4OD2A 3RX8A 5IP4A 4JZOA 5HYJE 4KDTC 2DJ4A 3C6SA 3F5WA 3QT2A 1E0OB 4LLMB 4Z7OE 4TSAH 4EI6B 4Y4FD 2AABH 5F1NA 2I26N 3RPIA 4F7MB 5T3ZH 2A77L 3JV6A 5IBUB 4QHNA 4MYWB 1GZQA 4GKSA 4K23H 4JAMB 4XBGA 4K71C 3QPQC 4PRHB 4G7YL 5DHVA 4D94A 2DYPB 4AENA 1INQB 2XY2A 1KN4L 5JOPD 2F53A 1G7JA 4XP9H 1TPXB 1FZJA 1AY1L 2NY2D 1LVEA 3QIUD 1DDHB 2DJSA 3RVTD 2VC2L 3VXMB 5FCUL 3BKMH 4OF0A 3V6FB 3KXFB 4U6VL 2BVQB 4YXHL 5I1GH 5IW6B 5ALCH 1O7SA 3MRDB 3OF6D 1AXTL 3WIFB 5JLZA 3FB8A 4L4VB 1CWVA 5IB5A 4BH8B 5C7XL 4X6DA 2HJLB 2PO6C 4IMLB 4NFBA 1MFCH 5DJ6A 2R8SL 4L4TE 5DQJA 2VH5L 4YC2B 2QSCL 5F88B 4FABL 2Y6SC 4KAQH 4P2OB 1VFAA 4X8JA 5HHPB 5I74B 3WKMH 3IDJB 5SX4H 1HWHB 5GGUB 1K2DB 4QKXB 2EYSB 1MFBH 5EFIA 5BCAA 4XPGH 4HUVB 1IGCH 3QDJA 1I75A 3CH1A 5GIRA 4J1UB 3QULB 2D4FA 4IRZL 4WW2F 1UM5H 4HPOH 1UWGL 1G7MA 2PYED 4JRXA 2QADC 3MBEA 4Z7WF 5EOQL 4XCCH 2DF3A 1UZ6E 1KIRA 1P84K 1NJ9B 4UTAL 4S11A 4PJIE 4XC3H 4X83A 4JGMA 4WI9A 4TUJB 1T7WA 2J8UE 4FG6C 1FRGH 3IDXH 3RWDA 2FX7L 2XWBB 3DBXB 3W5MA 1A1NA 1CGSL 1GGTA 3NH7L 4NKQB 4J4PD 4P46B 4TPRL 1UM4H 4ZD3H 3L95A 1F5WA 2E7LA 3B2UC 3QAZB 3P0YL 5CJQL 3QDGE 4XNQB 5IESL 5GS1C 1WT5A 2CKNA 1JZ7A 2EO1A 4M6OH 1EA9C 1RZFH 5GGTH 4CVXB 4JPVH 1F4AA 4NN7C 3SJVD 3ZE2F 1JK8B 5INDA 2YOCA 5HD8D 4WO4D 1QTYT 1C1EL 2IALA 2Y7QB 4HK0A 1NDMB 2AEQL 4WY7L 4UTBL 2P46B 2YD2A 4DKAA 5I1CL 1ZVSB 3GMOA 4JM2B 1QSED 2RR3A 1NGXB 3EO9H 3EW3B 5D7LA 3BQUA 4JKLA 5CP3A 2IANE 2QR0B 3CNKA 1RIHH 3RWGA 1FLRH 3ILQD 5D2NE 4YWGL 4KTEH 2CO6B 2JKXA 5F72S 1CXLA 2BJMH 5FYJE 1KB5A 3ARWA 3EGSA 3FQTA 5GRUH 1FSKC 2CRIA 4PJEF 1FNEB 1WCBA 2PXYD 1RZIA 1KLFA 3QJFB 4JHWH 3S35H 1XGYH 3MV8D 3PWVB 1IT9L 1E4XH 2DM7A 3K3QA 3IU4L 1VFOA 1JNNL 3K2MC 1U93A 4PTTB 4U1GB 5GGSY 5HHVL 3GIZH 1SHMA 4Z78A 3IFOB 1LE5A 3KJ6L 1NCWH 4XVUD 3L9RB 4ZUWA 5B8CA 4LU5L 3W9EB 2UWEA 4PJ9A 3TA3A 1CXEA 3KWWB 5GGVL 2BRQA 2ZSVA 2ESVA 1FORL 1OM3L 3MJ8B 5IHBA 1P6AB 2NCMA 5KVFL 4OI9A 1YNTA 3QQ4B 4G6AC 3W0WB 2H2PD 2XWTA 4L8CA 2R1WB 5K9OA 4PJ5D 3I75B 2C7UA 5JOPE 1ZLVK 4QRRD 5BW7C 1K6QH 1OAYH 5E8OB 5HHOA 2W0FA 3VG0H 4HGWB 1F3JB 1PX3A 1T7YA 2DKSA 3C5JB 4U0RB 2ILLA 4JDTH 2OZ4H 5DJ8A 4WWKB 2FJGB 2HLFC 4JPKL 5IMLA 1CICC 2QQNL 4QRPB 3TZVD 4OCSH 4JFQA 1EHNA 1GIGH 2YRLA 1C12B 5ICYA 1RZJL 5I71B 2OL3L 2WBKA 4PGEA 4P9MH 4HXAL 4NZRH 4D0DA 1V3KA 1U95B 3JVGA 1XGQB 2EC9U 4MD4A 1ORSB 3O8XD 4NKIH 2ZCLH 1P7QD 2IQ9H 4NYLB 1RUPH 1Z3GL 3BESR 5A16B 4PGCB 2FJFB 4UU9B 1LO4H 3LHPH 3U7YL 2VDQL 4OTXL 1BIIA 4YQXL 4OUOA 5IFJA 1MRCH 3EOBA 5GS3A 2PYEE 5CSBA 1IM3B 5K9QI 4GRMA 2ZG3A 2BSRB 4HX1A 2IPTH 3B9KA 5J8OA 3QISA 1K8DB 4EZMA 2PW1B 3MRIA 4M3KB 3VD5A 4JY4A 3MLVL 1YYML 3DX9A 5L88H 4IHOB 5AWNL 3BEVA 3RZCD 1U8KA 5IJKA 5D1ZB 4EN3D 4ODHL 1ULVA 3GNMH 3DO3A 4NSKB 5IHZB 1IGIH 5DHYA 4YBLC 4ZQKA 5TE6H 4OM0H 4F3FB 5CP7A 3QHFL 4C56D 2F5AH 5C8JB 1ZVHA 1SJHA 3FT2B 2N56A 3FMGH 1MCEA 3MRPB 1CR9L 3RX5A 4YHPA 3KPRA 3S3JA 3WNPA 1AE6L 3QUML 2WP3O 3IB4A 1U91B 3ZHKA 3WV0A 2VXTL 3T0ED 3HTLX 2YRPA 1NFKA 4K07A 2G2RB 1GGBH 1SBSL 3SJVE 1YC7A 4PFEA 5DVLA 1CFBA 4QTIL 5F70A 4A6YL 1WIPA 4HIIB 2V17L 5KJRL 5MEQA 1UCBL 3OKOA 3Q6GL 1FVCA 1KACB 1TMCB 4GKSB 2CIIA 1QSEE 1NCNA 2BHZA 1ED3B 4YHKH 3DUUA 1BQHB 3SDDC 2OMNA 2HRPL 4O4YL 1P7HL 1H3UA 3V5HB 1F6AA 4XWOC 2JF1A 3IFPB 4I3RH 2Z9TA 5JNYA 2NXZC 4APQC 1MCNA 2NLJA 1EGJA 4LVHC 1VFBA 4GBXD 2IPKB 2OXGA 4KU1A 3MV8E 2FHBA 4BKLB 3NACH 4ZODA 5IB5B 1E27B 3VD7A 2AJZB 2X4OB 4PTUA 2QQQA 5GSVA 1JWSB 5DGRA 2J2ZA 2X4RB 3SPVA 4ISVA 1RJLB 4KQ3H 5CIPH 4OF5A 5DC0A 3BX7C 4LNRB 1JGUL 3BJ91 1AGDA 4HCRL 1YY8A 3QZWA 5C09D 4JFDB 4PB0H 4YHZL 3Q0HA 2IG2H 1HIML 2Y1VA 3QDJB 4MJ2A 3OR6B 1MF2H 4GG6A 5DRXA 2CRMA 3P9MB 1G7IA 4PJ5E 4R4NC 1IKNA 2FWOA 4QRRE 3REWB 3MBEB 1IQWL 4TULH 1IGMH 1UC6A 3V4UL 1YQ2A 1HSAA 2A74A 4OCYL 3QYCA 1G9EA 4HULB 1YEJH 5JXAL 4OUUA 3KVQA 3QIBC 3WBDA 4JFZL 3Q5YA 4P5TA 1YJDC 1IC4H 4M7LL 2FGWH 3OJDA 1RV6X 1A1NB 3FQRB 5GGRY 2AXJA 2OP4L 2P8MA 3GSUA 5TGBB 4MX7A 2WWMC 5FYLH 2EH8H 5C0RL 3I3EA 5CCKL 4N68A 2MPAL 2C4XA 3L95B 2YA0A 5ID0B 1GJIA 4QRSA 2P1YA 3C9NB 4KUZL 5I2IB 3P73A 2DJUA 5JPMB 5IB1A 4GKZA 1OAKH 3JV5A 3ABZA 2YUVA 1RVFH 5IR1A 3FCTA 1OARH 4U3HA 5J13B 1CLZH 3BMVA 4HWEH 3PQYA 3WS3B 1CQYA 2ZUQB 3K2UH 4JG0H 1N64L 5C6TH 3UTTD 1AC6A 5DC9B 4YZFF 4HK0B 3BD4A 4WUUD 1YEEL 1E4JA 3UP1A 3O2WL 4NHUB 4ZTOL 3IDYB 1DVFA 1KLUA 4PLOB 3BVNA 3PWNB 3SCMA 2VISB 1TNMA 1W8OA 4YUEH 4NC0B 1YEFL 2X4NA 2Y07H 3AXLB 4Y4KA 4QHLB 2X89D 2D31B 4Y5VA 1WTLA 5CEZH 2NW2A 3EGSB 3T2NL 4C56E 1P53A 4WW2C 5DMIH 2GAZB 3P30H 4M6NL 1U92A 1TZIA 4JM4L 3ULVL 2F74B 3BGFC 2DQTL 3RGVA 4KTYA 4Z8FH 4YGVB 4HAGA 5JQ6L 5F71A 3T0EE 1DN0B 2P5WB 4BELD 5EZLB 5IEKA 4NO3B 3KS0J 4YIQA 1DE4A 4RMSA 3ARDB 5J4MA 5KZCD 3ZDYF 3STLA 3OTTA 4ELMB 5T1LA 3KLHC 1HHGB 4XPBH 3TA3B 3FRUA 2EDLA 1MWAH 3PDOA 1BF2A 1PY9A 4U49A 2YD3A 4LRNH 1OAUL 3VRIA 2XWTB 3PE9A 4HLJA 3O4OC 4Y5YA 4DVBB 3FOMB 3F7QA 2OTUA 2PKDA 4BFIA 3BI9X 4RGNC 4HJ0C 1BZ7B 2AJXL 3D25B 5ANME 4FN0A 3I50L 2KQMA 3FQWA 1KCSH 2EIEA 3CSPA 3C2SA 5D2LA 2W0KA 4U2ZA 3FN0L 5I18L 3MLXH 2BC4A 5EUOB 5C07A 4HT1L 4K3JL 1MOEA 1I7RB 3PDDA 2XI9A 3MLTB 3TV3L 3MLWH 3AAZB 4JM2F 5DURB 3S3PA 3SE9H 4DWHA 1F02I 5CEYA 3X3FL 1S5IL 2HJKA 4KI5D 1MPAH 2H3NB 5B38A 1TCRA 5C09E 3QHTC 2VZOA 4NO5B 5H94B 1IZJA 1ZS8A 3BPOC 1DQDL 2OSLB 1X5YA 1HSBA 2PCPB 2UYLB 3ARZA 4BZ1H 2W60A 3VJ6A 4AIZA 4P2YA 2IWGA 5DD5H 2FB4L 4MNQA 1TJHH 5AG8A 5D7JC 1YEGH 1KTLA 3RWEB 4NQVA 4OD3L 2WWKT 2X4PA 4JANA 4QY8B 2N7AA 3X14A 5FA3A 4LK4A 2FBJL 1I3UA 2AQ2A 1FIGL 4D0CA 5IBTH 1N3NB 4KY1L 3HCVB 1CDCA 2HVJB 4YDLC 4WJ5A 1JPGA 2YSSA 3TIEA 4NIKB 3WUWB 2YPLD 2XICA 3K74B 3S4SB 5DZNA 3MNVA 2MQCA 4DZ8A 3QEQD 3LS4H 4N0YH 4KZDL 4AH2B 1RIUH 2X7LA 1VADB 3I2CL 4WU7B 1RIVL 3VRLE 3GIVB 3D85B 3WFBL 4JCLA 4HHAA 4AEIL 3QDMA 5GS0H 1OAZL 2Y72A 2O5YH 3LQMA 3DVFA 4K2UH 5ESQB 1CDIA 4ZPVB 3MCG1 3U36A 3ZTNL 2LABA 5GGQL 4QCIB 2SEBB 3KNBA 2COQA 3KR3H 3C5ZC 7FABH 1VESA 1EHLH 2PETA 3ZE0F 4X9HA 3PABB 3UTTE 1J18A 9CGTA 2YUZA 4ORGB 5FA4B 2E7CA 5ISZB 1LP9F 3MRCB 3S5LA 4FQPA 2HFTA 1FE8L 5IW1A 3GMQB 3TBWA 3WIIL 3M17B 3DUUB 3GJFK 4NNYB 2VDRL 1VEPA 1XIWD 4DUWA 4OZFB 3VA2C 3GFUA 2Z8RA 4G3YL 3VGDA 3BO8B 5E99H 1AD9B 1BQLH 2VQUA 3BHBA 5KSBF 1FGVH 2YZ8A 4KK8D 2W9DL 4ZS7L 4WEUD 2CMRL 3VDCA 3EO1B 1UXWB 5TF0A 3QWOB 1JGVL 1T7VA 4BH7B 1H3PL 4K94H 4LHUG 3MLSL 4GLRH 1I7UB 2XQYG 3IU3A 3SPVB 4P0DA 3HMWL 4KXZH 4OIAA 4RWYL 1T0MB 2YC1B 3X13B 2DQJH 4PP2A 2LAGB 3CVHL 1AGDB 5C86A 4O5LH 3UTSD 4POYA 4KVCH 4NM4L 3LEXB 2HT4D 1GHFH 4HS3A 4QRTB 3DX6B 3PL6A 3NIDF 5D1XD 1HH9A 4ZXBD 5EWIL 5JW3L 4AT6A 4XPAL 3NN8B 1G7IB 5ESAB 4GT7A 4HQQL 4HXBH 5BMFH 3TJEL 1II4E 1HSAB 2VITB 1OD9A 1TQBB 4OCWH 4ODXA 4Y19D 3MRQB 1OP3K 3PG2A 1U8NA 1YECH 2FO4B 4NQDA 2F19L 3R1GL 3WUZA 5E6IB 4GMTH 3G5YB 1A0QH 4HS8H 2FH6A 2R69H 1TQCC 4F57H 5HYSB 4PLKD 2HVKA 4PB9H 2ITCB 3NPZB 4YX2H 1P7KA 2FECL 4CADB 3IDIA 2NY6D 4KI5E 5L0QC 3R06B 3DYMA 3P73B 3MLYL 1F3DH 2B39A 4JN1H 1MJ7H 4FXGB 3QWRD 1F6LL 1TVHA 2W65B 1QSZA 3CLEL 4O58H 3IJHA 4UOW0 4K3EH 4MNHB 2ERJC 5EUKB 1LQSR 2K1MA 1G9MH 4LSUL 4JQXC 3MRJA 3TCLB 3WJJC 4CMMA 4HFWA 1BQSA 1JWMA 5H8DA 1MCRA 1FL3B 3OL2A 4Q9BA 3BPCB 3S3SA 4X6DF 1W8NA 1S7QA 1V7NL 4IOIB 1Z2KA 1DQJA 3UJJL 1KLUB 5TF1L 3B9AA 1OAQL 3VWJA 1T2XA 2VQ1A 2YPLE 4LMQE 2X9XA 5MEOB 3GGWA 1R3KA 3QEQE 5HPMA 4UQ2A 3QJHA 4UIKL 3SDCB 1K5NB 3KPNA 5LJYH 4FQIH 4NP4H 1Y0LA 4ZAKA 1T1ZB 3QNZB 2VQTA 4TVSa 5KG9B 3CFIC 5JHDB 4OBSA 3L3HA 4FQQA 3VXSD 3BP6B 5MERB 1UGNA 3QWQB 3MCKA 5TDOA 4Y5XA 4PJ7A 4UNTA 4HGMA 5BOZG 1T83A 1A7PL 1P4IL 2BVEA 2GK0B 5CILH 4WIQA 3HZVB 3IRZA 2JJTC 1CYGA 1DANU 1UG9A 3PNWB 3IAGC 4MQXD 4Y4HD 1DL7H 5HDQH 3NFSL 5H37H 3QCVL 5EB9A 1NGYA 4YO0A 1PEZA 3OKKA 1IJ9A 3I84A 4PRIA 4L3ED 3U0WH 4L8DA 4TVPH 2AW2A 3IAPA 1Q1JL 1JYVA 4BSWA 4AQOA 4H88L 2OTUB 3K81A 1IZKA 2R29H 1A21A 3WHXB 4PYGA 1S3KH 3E2HB 1J0JA 3MJGX 5FGCE 3QDGA 3RHWF 5IEHB 1OQXA 1T03H 1M71B 4K55A 4F7EB 1TPXC 1IC5L 4V2CB 4ZPTA 5IWLC 2PTTA 2DWDA 3SDAB 2HKHL 2X4QA 4AIXA 3PHSA 2YD7A 2JCCB 3MRKB 1NKRA 4I4WA 5DWUH 35C8H 3S88L 4MCZB 4R4FH 3M8OH 1U6AH 4NUJB 3WE6A 3RWJA 5LXGL 3GSOB 1BJ8A 4ZYKB 1NCAL 2MHAB 3T1WA 1HXMB 4RBPK 3PWPD 2F54B 4QGTA 4ELKB 3G6JE 4MAUL 5DSCA 1XF5A 4YC2C 4ERSH 2X1PA 4AZ8A 2OJEA 1J9CT 1HZHH 1NC4A 4ODSL 4P2OC 5I74C 3UTSE 2OJZH 2A9NL 3GSWB 5DEFA 2J7LA 4KKAD 4TOYL 4D3CL 4LCUA 3QFDA 3U4BL 2I60H 3LSOA 2P5ED 2NTFB 1JTOA 4R7DA 2ADJB 3DVIA 4GRWB 4UIMA 1MFEH 3EJZD 3CH8A 2VZ1A 3RVUD 1KCUH 3OGOE 1WEJH 5FAAA 3HE7A 2JJSA 2VWEC 4PY8I 4L1DA 4OI7A 5E8DH 3B83A 3RBGA 3EYFB 4Y19E 3NCJH 3FB7B 5DTFA 3KPLA 4ZFOA 3RWIA 4M1GL 5I8KL 2UZIL 4CGTA 3PV6B 1QLFA 4NNPL 2DS4A 3HB3C 3C08L 1JF1A 2CLVB 4ELMF 3OAZH 1SMOA 2DQUH 2JE8A 4HH9B 1RZGB 4P46C 1N8ZA 2R23A 4XNZB 3P4LA 2XNAB 1QYGH 2Q76A 4NCC1 5JXEA 3MRBA 5D70L 3QAZC 2EO9A 3QIWB 5E94A 3OMZA 2IAMB 4QF1B 2F58H 4PJXE 1AO7D 5KTEL 4MHHI 3QEHA 4J3VA 3LQAL 15C8L 3GMPA 4LAQL 3LH2L 4AMKH 2EDRA 4ODVL 5EUOF 1KJ2A 5HDOA 3VG9B 1LK2B 5AZ2L 1FIEA 1A7QH 3GMMB 4LLAA 4NO0B 2RFXB 3PWUB 2N7BA 4BYHA 3SE8H 4JM2C 4NQED 2XXMB 4AEFA 4JR9L 2ED9A 5KANI 4GKNA 4Q6IB 1G9NH 3QUXD 5ALBL 2GY5A 4HIHA 3VFUB 2HMID 5EO1B 1PQZA 4NQXA 2BSTB 5T3ZL 2HFGH 1FZOB 4X7TA 3FQUA 1FBIH 4K23L 2EKSB 2OI9B 2P48B 1LNUA 3BE1L 1Y6KR 4OAWA 3VXSE 5EBGA 4F9PA 3E3QE 3FT3A 2DB8A 3W82A 4XP9L 5E5MA 4OGAC 1U3HD 2Y06H 1I4FA 4U1GC 2LVCA 4WRLA 2B1AH 2BNUB 3BWAB 5F3BA 2B8OT 4TNVF 3FO2B 1AD0A 2ZOLA 4MXQD 5IKCA 4R0LB 1CE6A 2EDBA 3GDBA 3PL6B 5L2JA 1MNUL 1EBAA 2L7JA 4L3EE 3UZVB 4QRUA 2XZQH 2CK0H 4KHTH 1CF8H 4GRLB 4J7RA 4MD5A 1CXHA 3EJYC 4NKOB 1N4XL 4KAQL 1BD2B 3TBYB 3U82B 25C8L 1BOYA 2NZ9C 1GGCH 4NFCA 5IF0A 1HDMB 1M05A 5L2KD 1MFBL 5C0CA 4JKPH 4NRYB 4XPGL 4U0RC 1IGCL 3QFJD 4NT6A 1UM5L 4HPOL 4LL9A 2YD5A 4WWKC 3TIDB 5HYJB 1CVSC 4JGUA 3WS6C 4WO4A 3RTQD 3VFTA 4I0PA 3IJYA 1SYSA 5I71C 1JMXA 5D72H 5DRWA 3PWPE 3KPQA 4F15B 1X5KA 4G8GB 4QXTB 1T1YA 5ITFB 3C60A 3ZKMC 3L3GA 2EYTA 4JRYD 3B9EA 1PLGH 1NSNH 2CLRA 3RWHA 1ZHKB 5E5UB 1JN6B 2P5EE 4Z7NE 3O3EB 3MV8A 3D6GA 4F58L 2ZOKB 1VEOA 3CFCH 3FO1B 1ZANH 3N1PC 4X9GA 5MEPB 5I1HH 2F8VA 1D5IL 5HYEA 1YEIH 4O51B 4X5LA 1RU9H 1OP9A 5CEZD 1UQSA 2AXGB 2KQNA 5IK3A 5GGTL 3CFDA 1KFAL 1I1AD 1Y18A 4L4TB 5EBMB 1IGTA 4NCDA 1OGAA 3C6LA 2AV7A 4HW6A 5D1ZC 3MRLB 2BNQA 3S34H 4WHYH 1Y0LB 2C4FU 2FZ3B 3H7BA 2G5RA 4F9LC 2G5BA 3ZTJG 3P0VL 2H9GA 4HDIA 3MOBL 4YLQT 5K33A 2RIKA 5T1KB 4NC1E 4BA8A 1AHWB 5DVOA 1RZKC 2YD6A 8FABA 4GG6F 3HE6B 5DRZB 1MLBA 1ND0B 3ZT6A 1RIHL 4QRRA 1FLRL 5C0EB 4KTEL 4NDMA 1S7SA 1RMFH 5DDHA 2XG5A 2XTLA 2BJML 3R8QA 5ERWA 4PJIB 4JFYB 3C8DA 4RA0C 3BDBA 1AO7E 3LIZH 1FFPB 5GRUL 4J3OC 2J8UB 3RQ3A 2D03H 3JTTA 2C26A 1DFBL 3F7YA 3T1FA 1S9WB 4POUB 3QDHA 4JHWL 5CJXC 4URTB 1A9EA 4KKBC 1LE9B 1E4XL 3OHXA 1TCMA 3ALWA 3EZJB 1NEZB 3G9AB 1SQ2N 1U8MB 5FGBA 2FD6H 5EU6B 2QHLA 2HT2D 5HBBA 2BVPA 4W6WB 4NQEE 3P9WB 4E41D 4M9PA 4XVSL 1XF3A 1S7UB 4CDGC 2H6PB 2VAJA 2WBJA 43C9B 3O8XA 2O61B 3BD3A 2ICWB 3B3IA 3N85L 1NCWL 2XIDA 2JELH 5E2JA 3I6LD 1T66C 4LMQI 1DCLA 3HG1D 4D8PA 3D0VB 1KNOB 1CZ8H 4FZEL 3ZDZE 3DRTB 3VFRA 3MFFB 4QLRA 4LIQH 1FYTA 2YS4A 3AROA 2AEPL 4RGOH 1VGEH 5FO8A 5FUZH 3VFSB 5HHXH 5HDBE 3ZT5A 1IAIM 1NBZB 1X5JA 2YWYA 5FCSH 4JDTL 3ARFD 2FL5A 4G8IB 3IXAA 2IANB 1MI5A 3MLPA 3MA9H 2WMPA 5D2NB 3R8BB 3RGHA 5HYFA 3RJDA 1T2QH 3SDYH 2EZ0D 3ULVD 5DHXB 4NGHL 5IVXA 1N5AA 1UKTA 2XXCB 4L29B 3FTGB 5DD1H 4MA7H 1E28B 3BW9A 4XRCB 4NKIL 5FYKD 2P8LB 1EO8H 4RAUB 2ZCLL 2IQ9L 3MBEC 4XCEA 5I76A 2CK2A 2A83A 1XR8B 3V52H 1RUPL 3GI8L 3T0EA 1GYAA 1MIML 3QFJE 4HWUA 1FVEA 2AQ3A 1LO4L 3LHPL 1PY4A 5GS0D 3G5XB 3O6ML 1H5BB 3VXNB 1VACB 5GISH 3AGVA 4Y4FB 2HWZL 4MS8D 5C71A 3QI9D 5DQ9A 3VXOA 5ID1B 4U6YB 2IPTL 5LWYL 3BGMB 2WQRA 1FC2D 2HH0H 5TH2B 4L5FH 3BKJH 3ARGA 3MACH 2WM0A 2DQEH 1I9RL 4Y88A 3VW3H 2NY2B 3NAAH 4LEXH 4TUKH 4JRYE 3P4MA 3QIUB 1AR1C 1BX2B 1HH6B 2DD8H 2VLLB 3RA7H 4UILL 2VXSH 4OM0L 4R96B 1MLCA 2F5AL 3VXRD 3T2QA 2W91A 5J13C 2OK0H 3ARPA 2HKFL 4UT9H 2JCCF 3FFDA 5CWSB 2ZUQC 4JQIL 3RKPA 2IBZX 2HFEA 1RHHA 1FH5H 4FP8H 1H3VA 1S9XA 1X6NA 1QG3A 3BKCH 3IDYC 3DGGA 4HBCH 4ODWB 4Z95H 1HOCB 1GGBL 3BQUC 1JGEA 4KRMB 1HXYB 2VYRE 4Y0GA 2NY5L 4YHML 1FHGA 5DRNB 3H9ZA 3QZWG 3N1FC 3ZT7A 2YMXH 4PV8B 3GRWA 1ONQB 3LPGA 5E03A 1MY5A 5D9SA 4EDWH 4PY8J 3U2SA 5BVPH 1UYWH 5C0BA 4YHKL 2DICA 4GRWF 2LE9A 2XFXA 2PYEB 2YXFA 1CLOH 4JO1H 2B1HH 2YK1L 1A6AA 1RULL 1HYSD 2CKBB 1T1XA 2A73B 1J86A 3F7PC 1B2WL 3QNYA 4MWFA 2D3VA 3WCYA 4NBXB 2AJSH 4J3SA 2WINB 4X5XB 4UBDD 3MNWB 2VZ3A 3RIAK 3ARDC 5KVDL 4UB0H 3NACL 3EYSH 4JHZA 2ZOLB 3AS1A 1A4JA 3CFKB 3VXQA 5A1AA 5ETUA 4K3DL 3TA3C 3WFCH 5AUMB 4ZO8A 3EO0B 4F7TB 4E41E 3U9PH 5KVEL 3A6CL 2XT1B 43CAB 4ENED 5EORH 4KQ3L 2VDML 2CUHA 5IB2B 4ZOBA 4DGYH 5H35B 4OFYD 1QO3B 5EZJB 4PB0L 2VSCA 3I6LE 1M05B 1J0YA 2IG2L 3HG1E 4Y16B 4M1DH 4NT6B 3O3BB 1FV1B 1YZZA 1MF2L 3SJVB 2J88H 3MV9A 1RZ7L 4PGBB 2IFFL 2HJFA 2R1YA 4WO4B 3LRGA 1R5VA 1ZOXA 5DUML 1IGML 5IROC 4DUVA 1HINL 1OB1A 2B0SH 1QSEB 4X4XA 1YEJL 4OGYL 5MHSD 1MAKA 1KUMA 4I77H 4G8FA 4Y2DD 4OKDA 3VA6A 4AEHH 1K4DA 2CPCA 5HGDA 1U41A 3I9GH 4IRSA 2FGWL 5FKPA 2JTDA 3T77A 4JVUA 4RIRB 5FYLL 5JDSA 3RWHB 3ULVE 1UACH 3TP4A 3MV7D 3VGBA 2PXYB 5JA9A 3T0VA 3K1KC 3HZYA 4KI1A 4O2EB 3U4EA 3MV8B 2P7TA 1MEXH 4LP5A 5FYKE 2GUOB 4PJAE 3W5NA 5I9QB 3RDTA 2IEPA 4G43B 3EOYG 1NMAL 3FO0H 3MA7A 3V2AR 1EBPA 3O2DH 3MRGB 5DJYA 4QXWA 2EDOA 3VH8B 1CLZL 1KCRL 1IGYA 5I1AA 1GVIA 1JYNA 2B4CC 4JG0L 3RY6C 4OZ4B 4OCRH 4W6XB 1U8QA 1IAKB 4FRWA 5ACZA 1IM9D 1KSRA 32C2B 3NABH 1I9IH 2AJ3B 1KPUB 4P5KB 3UBXI 5KS9E 4LSVH 5F21B 3V6OE 1K9TA 1IEBA 4M48L 1QBLH 1YJDL 4YUEL 5I19L 3KYMA 4FQCH 4PJ5B 4J2XA 4KHXH 2GTZA 4U1LB 4OZGE 4YNYA 1CFVL 4X7EC 4R90L 5F96H 2E6PA 3WJLA 5JR1L 4QHUA 3TCXA 3T2OA 1JPST 2GT9A 1INDH 2AI0H 3VXRE 4ZDHB 4TVPD 3OJ2C 5DMIL 4UOJA 1KIPA 5LCVL 1RFDL 2O5XH 4IJ3B 3TZVB 3BOVA 1IAIH 1EO5A 4Z7OF 2GJ6D 1IBGH 3CXHK 5IFHH 3MMEB 1F2QA 5CJOH 2ITDB 5HI4C 1KLGA 3H9SA 4F2MB 3TBSB 2MJWA 5AD0A 1XF3B 1NUDA 1R3LB 3O81A 1S78D 2XKNA 3KPOB 1S7TA 2B4CH 3HPJB 4P2RB 5CZVL 3DURB 3E0GA 3BIKB 1P7QB 4M93B 5B38G 2C1OA 2FGZA 4XPBL 3MUGB 4HIXL 3SKOA 1PG7W 4LLUB 3F58H 4PJ8A 5K9KA 2YBRB 5LGKA 4XMKL 4LRNL 2BNRA 3M07A 2LQRA 3C2AH 3CU7A 3VFMA 3SKMA 5TPWH 2CUMA 3GJFA 5KSVA 3D3VD 5GRWA 3CGTA 1S8DA 1JCKA 3QUZA 4M7JL 1D5XB 3VWKD 3KYOB 4PJHE 4P4RB 4NRXB 3F62A 4QTHB 3WNOA 2DLTA 3MLXL 5JIPA 4OKVB 2KBGA 4DKDC 3RZCB 5BS0D 5CD5D 4EN3B 1UVQA 2VLRA 3O6FA 4X6CB 4ZSOA 3NIGE 1MUJB 5J6GB 3RJQB 1ACYH 4CDHA 4Q97A 2HTLD 2OXHA 3KPMB 4JPWH 4C56B 5GSRB 1MH5A 2IADB 2ICES 4LPYA 3MLWL 5K9QG 5KN5B 4NWTH 3SE9L 1KXQE 1UKQA 3EYQC 1A6UH 4OZFH 1MPAL 1A6VH 3ILPB 3KHQA 4U1HA 3F7VA 4Q9CA 3KJ4B 3NCMA 1UZ6F 3T0EB 4Q2ZB 5FO9A 3V7AG 1FVEB 1TQBC 3S37H 4G9FD 4BZ1L 1DP0A 3SGEI 5BRZB 3G6AB 1URLA 1L7IH 5J89A 2R2HA 1KIQB 3BUYA 3V0VB 1TJHL 2NY0D 3B8SA 4WVRA 5E6IC 2H45A 4FQXD 5JW5A 5LAXA 3CK0H 1E6OH 4NQCA 5MHSE 4XHJC 3S5LG 5HVWA 1CDGA 3UMTA 1BZ9B 2R9HC 5HI5C 4HZLB 5BZWB 1A1MB 5F7DB 1QNZL 3WO4B 3LS4L 5ANMB 4N0YL 2ICWI 3RKDC 4XCFH 3KPTA 5E08H 4KPHH 2NW3B 3MQIA 5DR5L 4M9OA 3MV7E 2EIZA 3NCYS 4LHUD 3T0BA 3DVNA 5C92A 3BZFB 4GBXB 3NVQA 5D1QD 4RISL 5IVZB 5IQ7H 5CZXD 1J11A 5I1DA 4R26H 4MDJB 4RWHA 4OZIA 4Y1AD 4HV8A 3S97C 2I9TA 3JV0A 5FOBA 1A22B 3GSXA 1KENH 7FABL 3KR3L 5EU4A 2IJ0C 1AI1H 5ADPH 3QPXH 4GO6B 5IVOA 3D48R 5C09B 2DI8A 4RDQF 5DFWH 3SDCC 1YEHL 3Q48A 3K0WA 1QSFD 2AK4D 4LASH 1UEYA 1M7IB 3GSNB 5EO9B 3EOAB 4OFIA 4PJGA 4FXKB 3U2SB 5IBLC 5EIIB 4JFPB 3LRSA 1RD6A 5IQ9A 1I3RA 2FRGP 3FT4A 5BXFA 1NANH 2HLAA 1LEGB 2QSQA 3DTXA 4ZFZA 1OSZA 1H15A 4JDVA 3KGRA 4GXUM 2EE9A 2IGFH 4TVPE 1JZ3A 4U7KA 1U8PA 2Z31A 4U6XB 4HWBL 3F6IA 3DUSB 2R2CA 5IT2H 1D5MA 2ARJA 4XBPA 3X3GH 4S1DD 2DQJL 1DLHB 1MCJA 4YE4L 2E9WA 5DI8A 1W72B 4CRPA 3E2HC 4YHLH 2FCBA 4G8EA 1OTSD 5JMOC 1GHFL 2PTUA 1I9JH 1AJ7H 3H0TA 3AMKA 4WU5A 2F9BT 2PR4L 1D9KA 2XWJB 4MD0B 3SDAC 1V7MH 3VGAB 1FQ9C 2V2WA 2HJFB 4RQQB 3UTQA 3UTTB 1R5VB 2R2EA 1RPQA 4J3TA 4Z77A 4HXBL 3D3VE 1ZHLA 1R0AH 3Q6FB 2PYFA 5BMFL 4OCNC 4LCWD 3AVEA 4WUUB 1J12A 1YEKL 4YDIL 4RAVA 5LGJA 4LPCA 1T04A 3SHSA 1WGOA 1CFNA 3HNTH 5L8KB 1IVLA 5INCA 5HPOA 5BS0E 5FGSA 3CFBB 4H5SB 5E9DD 4HS8L 3DSFH 2R69L 2WIMA 4MJIA 4F57L 5FF6B 3M45A 1P4BH 1JHLH 4PB9L 3TWCH 1CGYA 2Z91B 3BN3B 4N0UE 3MCLL 4WCYH 4MXWL 4EUPB 3MSPA 5IW3A 4OLXH 1LILA 1MJ7L 1I1CA 3VRJB 3TN0D 1RJZA 1F6FB 4TRPH 4GQ9H 1EFQA 4O58L 4MJ6B 2FIRT 1MIEH 3BDYH 4NKDB 4OFKA 3DMMA 1KOAA 4G9FE 4K3EL 3D69A 1KPRB 3LZFH 5SWZD 4K8RD 4Y4HA 5B22A 1G7LB 1R3JB 5KZCB 3GUTB 3CDGB 3MXVH 3QH3B 1OWRM 4Z76B 3CZFB 1S7WA 2MNUA 4LBEA 4U1JA 2DDQH 5BO1H 2EEDA 4UT7H 1WSST 3KAAA 1G6RL 2F5BH 5HY9A 1TZHB 3G08A 3SE4C 3ARQA 4L8BB 1NFIA 4XNZC 3VXPB 2FSEA 2VE6B 4U1IB 5LBSH 3T04D 2FX8H 1CDUA 3QEUB 1A5FH 4DTGH 2V5TA 1B0RA 3F6LA 3QIWC 4FQIL 1KC5H 3AY4C 2IAMC 1FGNH 1OTTD 2IH1B 2V5MA 4G9DA 1CT8B 3H6JA 4QXUH 3RUGE 2P24A 2D7NA 1S7RA 3UBXA 3MBXL 4CNIA 1HKFA 5HYIA 1QLEH 4FOMA 4GRWH 4GAJL 4EOWH 3FFCA 5DJDB 5EU7C 3VG9C 5A40E 3RIFK 3U0TB 4Y1AE 2MQ0A 4OLVH 4Z7VE 2X6MA 4LSDA 1BQUA 3ARRA 3DRQA 2DIBA 2VDKL 2CQVA 3SO5A 4B5EA 1YDPA 3MUZ1 1EO7A 4X98B 5HDQL 4GW5B 4Q6IC 4X4ZA 3MLUH 5DD0H 4OLUH 1GC1C 2H32B 1QSFE 2AK4E 5CD3B 2Y5TA 3IDMB 3WXWL 3L7EA 2DL2A 1I8LA 3HRZB 4NO2A 4JREB 2G75B 2QL1A 5KSUA 1A7RL 3U0WL 3CFEA 2OI9C 4JDZA 1UM6H 5FO7B 1OGTA 4KMQA 4YAQA 5IB3A 3HAEA 3TBTA 1T03L 1GGIH 1WZLA 1XGTB 1I8IB 2FIKA 1A3LH 2ZPKL 3ZSSA 5KSAA 4TNWK 1ZGLP 1ZT4A 2YPLB 4NOBA 5HSFA 2APWA 5DWUL 3QEQB 3QSKB 4EXPX 2VJXA 2H8PA 2KZWA 2P8PB 1A7BA 5FUCC 3RY4A 1CLYH 5E7BA 2F53D 3M8OL 1U6AL 1BAFH 1MH5B 4R0LC 3PL6C 4IIQA 2ZUYA 4M43L 1KPVA 5I8OH 1TZGH 4LLYA 3MOAH 4GRLC 1Q9LA 4KJWD 4ERSL 4F37K 1WJ3A 1HQ4A 4ONFH 4X6EB 1ES0A 4XXDB 1GC1H 2OJZL 2QQKL 3LKPA 2V2TA 3CUPA 1PZUB 5I1JH 1E4WH 4PLNC 3L5HA 5IFAH 2OL3A 1FC1A 4HMEA 3UO1H 4I9WD 2BHUA 5DYOB 3S35X 5SX5K 3RY5A 4I18B 4LDOB 3J7HA 5CGMA 2VDOL 1BOGA 4LCWE 4U1SB 5B4MD 3ZE1E 2DTML 3ARBA 1RUKL 5E8DL 4P4KA 4NUGL 4PJBE 4BFBD 5DJZB 3CFJA 3NZHH 4C83B 1BJMA 1KJMA 3KYNB 3H8NA 2Q7YA 1Q8MA 1XIWB 2BP3A 1KBGH 3EDDA 4KDVA 4F15C 1OF2A 3MRFB 5FGCB 5E9DE 4WI8A 4JRXD 4X0KA 2DQUL 4ZS6D 2QQLL 4NZTH 1KF9B 4POZC 1LO5A 2HP4A 5KOMC 2DQDH 4MAYA 4KWUA 4S1QH 4JO4L 4HV8B 4HC1L 1NBYA 1G7HA 5SWZE 3SOBL 3G6JB 1ZLUH 3ZKQD 2EXYD 1ZHNA 3DHMA 4G6JH 4AMKL 1ITCA 4NPYA 2PNDA 3UTSB 3L5XH 5E2TH 1B3JA 4ONHA 2L0DA 2C3GA 5ACLA 3Q5TA 4J3WA 2EC9T 5D1XB 4ZXBB 3FQNA 4N5ED 4KK6C 3GBNH 4WGVB 4FQHA 5KSBE 3K4AA 4RNRA 3QUMA 4OLWH 12E8H 1AHWC 4OLYH 2NNAA 3ALPA 3TT3H 3HE6C 4WFFD 1QEWA 2VZSA 2YR3A 4JZJA 4U1MB 5CBEB 2KKQA 4KJYB 2FATH 2LVEA 4Y19B 2HFGL 4PRBB 4A6YA 1QFUH 1FBIL 3LQZA 4J8RB 2R2BA 2GW5A 4ZUVB 3VFOA 1NGWA 1T80A 3RTQA 3B43A 2X40A 2CLZB 3LPFA 3L1OH 2YHGA 1QVOB 3KYKH 2VRAA 2A6JA 1BVKA 4TUOA 1VEMA 1F11B 4OV5B 1OHQA 3A6BH 4O2FB 1ITBB 1A6WH 4G5ZH 2NY6B 3WLWD 2BOBA 2EEBA 3TNNB 4FFWD 1J05A 4LQ1A 1DSFH 4KFZC 4YBQC 5GJSL 5ESVA 1NBVH 2WZPD 5LVEA 2DMKA 4PJXB 4RFOH 3GHBH 1NCCL 1U3YA 2XZQL 4HJGB 1CF8L 1UB5B 3T09A 5HGBA 2VUYA 4GG8B 3INUH 1T1WA 1K8IA 4DN4H 1WWAX 1PKOA 3G5ZA 4O9HH 4UV4H 1WZ1L 1AGCB 4P59H 1AGBA 1MAMH 2VN7A 1FFNB 4ZNEE 3EHBD 4PJ9D 4I48A 3OXRB 4HCRA 4JKPL 2ESVD 3P4NA 3L3DA 3FB5A 2XZCH 3HR5B 3MJ9H 2UV3A 4PGDA 5D2NC 3U0PA 1ORQA 3EFFA 3PWLA 2F53E 1PX4A 2X42A 2OTPA 2H2SC 3SQOH 5HHOD 2UUDK 4PRDB 3TH3T 3BP7A 4MSWB 5ICXB 5DK3A 5L7XH 3VXSB 2FECI 3FO9A 4N0CD 1NFDE 3QO1B 1MCOH 4R3SA 4KROD 3QR2A 4HWZA 4OFPA 4F7CB 3DV4A 1NSNL 4CW1A 2ID5A 3O2VH 1IMHC 1T5XA 3V4VL 4QXGH 4I9WE 1JRHH 1H5BC 5JHLH 4IDJH 4FMKA 4YXKL 4Y4FC 1ZANL 4OM1H 5I66A 1I9EA 2X70A 1IEAB 1LD9B 1YEIL 2CJUH 1RU9L 4L3EB 2VB5A 5DMGD 3QG7H 3VRLF 4E41A 1ZGLB 3WD5H 2I9LA 2ZUWA 3EZ8A 4IOFC 1OAXH 2WUBL 5I8EA 1T22B 1B0RB 2NY2C 2X4SB 3IETA 5F1SA 3QIUC 5FYJH 3RVTC 2A6KA 2JJUA 3B9KD 4JFOB 3HN3A 4Z7UA 4EIZC 3MYJA 5DEGB 1M6OB 2J3SA 4UINL 2E27L 2APFA 4XNYH 4PJDE 1U58A 2NXZD 4HUXA 1FG2A 3O9WD 2YKLH 1PFCA 3UTPD 3WNLA 1RMFL 1S9VB 1RJCA 3L3OB 3IGAA 4P23A 3JWDC 4QHMA 3V8CA 3PWPB 1QBMH 2ED8A 1FO0B 3TBVB 4YHNB 2HG5B 4JPIB 5CGTA 2DQGH 2D9CA 1OOAA 5JPNA 3KPRD 3VFPA 3CCHA 1JWUA 1HHJB 5E8NB 3QO0A 1FZMB 4KJPD 1LO2L 2P5EB 4ZUUB 2K9UA 5FECA 1V3LA 3UTOA 4WFFE 5IMMB 3ARVA 4Z6AT 1OCWH 4PLJD 4PJAA 3EDKA 4XP1L 1NC2A 5FB8B 1J1OH 4NJAL 1FP5A 3LV3B 1FNGA 1MRDH 4JLRA 1ZT4B 2XY1A 4GW4A 4WFHD 4HS6B 2C9AA 4S1SL 3MROA 1RZKL 5D7SL 3MV11 5TJWK 5FIEA 3VE0A 3HUJA 5DT1H 4LIQL 1KJ2H 4TQEL 1PSKH 5EPMA 3V6BR 3QI9A 1U8IB 1VGEL 3A6OA 1JPFA 5HHXL 1BWWA 4J4PC 3SKNB 3IDUA 1CBVL 1OW0A 3LKRA 2AKRB 3OV6A 2PN5A 4PY7A 3OB0K 4JO2H 1Q9LB 3GK8H 2W38A 3MA9L 4G42A 1C16A 2VABA 1BM3H 4N8VA 5GJTH 1Z5LB 2EYRA 3OZ9H 4U1KA 1YN6A 3V7MA 1DBMH 3LAFA 1PZ5B 3FOLA 3HZMA 1AO7B 4S2SB 3TVMA 2R4SL 2VXQL 4I2XE 1XF4A 5DD1L 1JNLL 4FNLL 1U36A 4XCYA 2DQFB 4D0BB 4AK1A 5HD8C 5HHQB 5C9KA 5I0ZA 4WO4C 1Q9WB 1UCTA 1EO8L 2ADIA 4YFLI 1ZK9A 2UWEE 5J1TC 2CKBH 3CFJB 4NQEB 4M5ZH 1NDGB 2ESVE 4DJMA 1EJOL 3QUXB 4KI5F 3CLFL 3PGCA 1P4LA 3CVIL 3BP4B 4MB5A 3GBMH 3ILQC 2V6HA 4MHHG 5GISL 4S1RL 1NAMB 4UT6H 1HHIA 3ARYA 2ZKHH 4NRZB 5GPRA 5HHOE 3MRHA 1SY6H 1VENA 2VXVL 3DIFB 2PXYC 5DJCB 4JFXB 5T5NF 4L5FL 2ZCKH 4P5TD 4YDJA 4LSQL 3BKJL 4LDEB 3MACL 2DQEL 3VW3L 1U3HB 5IMKA 3NAAL 4LEXL 4OLEA 4LCCB 2XPGA 4TUKL 5KANG 3WFHA 1XCTB 3MC0A 1A14H 5GGSA 5I9QC 1BBJB 3DETD 5IIEB 5IJVB 5D6DC 4DGVH 1T4KB 1I3GL 3GMLB 4F7PB 4I3SH 1LEIB 3ZKSD 4XAKD 1EFXA 4HEPG 1GZPB 1QR4A 4LRIC 4XVUC 2OR8A 5T33H 1XGPB 2NZIA 4CKVX 4FP8L 3BZEB 2ORBH 4JN2A 1H9VA 4JHAH 1ZLVH 3ECBA 2QKIB 1Q94B 4HMCA 1MJJA 4HBCL 4QRQB 2GJZB 4Z95L 3PQYD 2H2PC 2WP3T 4WUKL 4HG4J 3X12A 1KJ3L 2GI7A 3C8KA 1VPOL 4ETQA 3SEPA 3TC9A 5L2KB 2VLKA 2J8HA 3QFJB 4UDUB 4WI7A 5IGXL 1DVFD 4N9GB 4EDWL 5BVPL 1UYWL 4AM0A 3SCMD 1VCAA 4IJ3C 3TZVC 3RTQB 4L8SA 3OKMB 4AQ1B 3DARA 1CLOL 5MEND 2M8XA 1TETH 4Y4KD 2B1HL 1CFQB 4QT5A 4U0QB 4LPWA 1EX0A 2NR6D 4KTDH 4MJ5B 2AJSL 1FFOA 3HC3L 1WF5A 1MHCA 4WNQB 1QKZL 4UB0L 3RGVD 1P69B 5I16A 4KDWA 3KPRE 4M93C 3GB7B 4JRYB 1A2YB 1RJYA 1FNAA 5DK0A 4DQOL 5EULV 2YRZA 5E0QA 1TJIL 1X4YA 3UPAA 3PP3K 4WFGD 4HKJB 1WWBX 1DLFH 1OWWA 2FJHA 3TYGL 5J9PB 1T1WB 2FNBA 3T8XA 2XQBH 4LVNB 5EORL 1UB6B 3U9UA 1N2RB 1P9MC 4OZIF 1ZTXH 3PWJB 5T1LD 4DGYL 5SX4I 4MVBD 3SDXE 5KBNC 3CVHA 3V0WH 5I1IH 3A67H 4XMPH 2JIXA 2V7HB 1I1AB 4M1DL 2CDFB 4WFHE 5B39A 3LN4A 4X7FC 3G6JF 2J88L 4HIJB 3RZCC 4ZUTA 3OPZL 2Z35A 4EN3C 3EFFB 3K4ZA 1LHZA 3EYOA 3QXTA 3HRPA 5I1KH 3UPRB 1D5BA 4LF3B 4MGXA 4PJCA 4UUJA 2OTWA 3PIQA 1ZA3A 3RNKB 5JORA 5C07D 1WBZA 3I9GL 4H1LA 4LSTL 4P2QE 5F7EH 1N6QH 5EOTA 3KJ4C 1MWAB 1Z0NA 2BY3A 1KTDB 3ESVF 1UACL 3T0EC 4JO3L 1FN4B 5J3HD 1AFVL 3MYZA 5HVGB 3CXHJ 1NCBH 1IRAY 1Y6MR 4IEFB 3THML 1JNHA 3LDBB 1O0VA 4M8QA 1CG9B 5GRZA 4M03A 3FO0L 1JPSH 5T3XL 3W39A 4XPTH 4GG6E 4H26B 4MNQD 4OCRL 3GRWL 1D6EA 5F7NC 3WO4C 1I7ZA 3L7FA 4K9EC 4PREB 1MCFA 2A6IA 2A6KB 3HG1B 5HGGS 2JB6A 4ZO7A 1JGDB 3AM8A 1P2CA 5EN2B 1AQDA 3D9AH 3GM0A 4GBXC 3N9GH 3EOTH 2CGRH 4FQCL 3W9DA 4HKBB 3WEXA 4KHXL 2YA2A 5F96L 4LARH 2ZWLT 3I6KA 4YK4B 3VGHA 3BGAA 1INDL 2AI0L 5FK9A 3ARFB 5JUEH 1C5BH 3QXDB 5BS0A 3GMNB 3QDMD 1U8OB 5AAMA 2O5XL 4WI6A 3NIFE 2VR4A 3RPKA 3S98A 4P5MA 1FDLH 4WI3A 3U6RB 4TSCL 2R0KL 1E4XI 2VL5B 4XXCA 5DVMA 5IFHL 1KN2H 5CJOL 1TFHA 5EOCJ 1IGJA 1XR9A 2IH3B 2UZXB 5K59E 4MQ7A 1J8HA 3L3IA 1FPTH 4PJFA 4WHTB 2VDLH 5DUBA 3JV4B 3RU8H 1T7XA 1RUAH 2D7TH 4JQVC 3PQYE 1MAJA 2B4CL 5F9JA 3O4LA 3TEUA 1H0DB 4L1HA 5F9WB 3TJHD 2AXFB 4H25B 3BZ4B 3PGDA 1N6VA 3MUHL 4K9EH 4ZUSB 5C70A 2X44D 5T5FH 4RGNE 2Z93B 3DXAD 3FRPA 1I3VA 3LS5H 1MHHB 3VFNB 3LKQA 1ZSDB 1LDSA 3QA3B 5TPWL 5GGRA 5MENE 4X6BA 4M7KH 4DCQB 1INEL 4U7MA 5KS9B 2GTWB 1JFQH 4QYOA 3FB6B 3CDFA 4GS7B 3TO4D 1S5HA 3B5TA 1DQQB 2DM4A 2XV6B 4HK3N 2QV2A 4O02L 4CVZA 4YH6A 4OZGB 4X4YB 2ZZUT 3M1BA 4YEEA 2I07A 1ACYL 1C7TA 5B3JE 2ENYA 1PYWA 3MFGB 3VXRB 1S7XB 4JZNB 4JB9L 2FBOJ 4WFGE 4DK3A 2CIKB 3QXAB 4YXLH 1F4WH 5I15H 4XCYB 3VGAC 3S36H 3H9HA 4UAOB 5DA0B 1A6UL 1HHKA 1HQRB 3B5HA 2MSPA 3QQ3B 2GEEA 4JFEA 4LLWB 4Z7VA 1AIFB 2VZVA 1J5OH 1MRFH 4HUUB 3T65A 3PUCA 2NX5A 4M61B 3S37L 1YY9D 3BP5B 4MXVE 4AL8H 5ICZA 5DJAB 3SBWC 1FL6A 3CDCA 1KG0B 1WTGT 2BCKA 1T0NB 1R3IH 5D2LE