1WEJL

Igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E8 ANTIBODY
molecule tags Complex (antibody/electron transport)
publication title Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution.
pubmed doi rcsb
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wejL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wejL01
4WI8A 1PG7H 4CU8A 2KBGA 3FFCB 5D1ZD 3MLYL 3KPRB 1G0XA 3DIFA 4Y19B 4HUVA 5GGTL 4NQVA 1A9EA 4AH2B 1BZ9A 2W9EL 2WBJC 1KJ2B 5DI8A 1UWEL 5ILTH 4OFIA 5F72S 2BDNL 1MRDL 3B9KC 1PY9A 2QADD 1AGEB 1HKFA 5JORA 5K33A 2L0DA 3FHQA 1U3HC 1FVDB 3MBEA 3MRFA 3NFSH 4P46C 4NWTH 1U8MA 1Z3GL 3LQAC 2AK4B 2OZ4A 4PJHB 3G04B 3LMJH 3TFKD 4K3EH 4G6MH 1NUGA 3L3JB 4YR6B 5C08D 4OCSH 5DRWB 4JO1L 3HNSH 1JPTH 1WF5A 3MRRB 4LKXA 4ERSH 3HI6H 2ED7A 2H6PA 3AS3A 4GG8B 5DJAB 3TBSB 2X05A 1IGML 1CICD 1ZS8B 1UXWA 4JFFA 3VXRB 2X4NA 2MOVA 4HEPG 4Q6IC 4TOYL 2YKLH 2DQJH 1ORSA 4NKIL 1D5XB 1IEBA 5TQ2L 3UBXB 1MFAH 4XI5C 2NR6D 4HK3N 1FP5A 3I3BA 5EZOL 4LHUA 1U41A 3BQUA 4PJFE 1T80A 5E94A 5C0AE 1PKQE 1UM6H 2WSKA 1HHIA 1WIPA 4QWWC 5DZLA 4WEUD 4ZTPH 3QQ4A 4NIKB 5CZKA 5CEXA 2PW1B 1WCQA 5J57B 5F89A 2IAMA 3VD7A 1G9MH 1DANT 1NGZA 1BZQK 5CKGA 3MJ7B 3RGVD 3RNKA 4KI5C 4HBCH 4MB3A 4X8JA 5HDBF 5GS1A 1G1YA 3QQ4B 5T5FH 1G7PA 3SDDA 4MA7L 1AI1L 4ODTH 1WWCA 3LQZB 1RHHA 5IHUL 15C8L 2CIIA 2H1PH 3GKWL 3GIZH 3LOWA 4I77L 4ZFOA 1RFDL 4PJ8C 3DURA 4LNVA 4LHUB 4OZFB 1QSFE 4G8GE 5TJWK 1XF3B 4MSWB 4HQQL 2MHAA 1MRFH 3BQUB 1R24A 5A2IH 4OJFH 4V1DA 1MY5A 3D85D 4M1CC 2DQHH 3WNPA 1GGYA 1S9VB 1LP9E 3ALWA 5FHAH 1T7WA 1RZGA 1H15B 3UEZA 3WL9B 4WFGD 4JZJC 3RBGA 5H2BA 5DUMH 2IANE 1JNNH 3GK8H 1QFPA 3V4PL 1Q1JH 3E2HC 1T04A 4JFQA 1KJMA 4NHCL 1ADQA 3QEUA 3WFZA 3V6OE 1RUKL 3VG9C 3GMMA 3PUCA 4GRLA 4HWEL 2R0WL 2HT2D 1EAJA 2KDGA 4WV1A 2BVTA 5I1LB 4BSVB 4BKLB 3EDJA 1BBJB 5CLWA 1MCIA 3VI4E 1HEZA 1LK3H 2DQUH 4L8BB 5IMMB 1F4WL 1RZ7H 1I7RB 4QRSB 3X11B 3HNTL 2DI7A 3MA9L 1LO3H 2XKNB 5IVZB 3C6LD 3GSQA 1NCAH 4QOKA 2IF7A 2OZ4L 4HXBL 3C60B 5J89A 5IMMA 3VFWB 3PWVB 4AL8H 2VDPH 4K7FB 2IC2A 3SOBH 3ROOA 1AE6L 2A9NL 2AKRB 2GK0A 1BZ7A 4YXKH 2P4AB 3O9WC 2ADGA 3TIEA 5M95B 4GRLB 4ORGB 5D2LA 4NHUB 3MGOA 3A6OA 3UPCA 3ULUL 4J4PA 3U9UB 4TUOB 12E8H 3RVTD 5J9PB 5E8OA 4HDIA 3VD5A 2F53B 2XTJC 1SEBB 5J11C 2K3TA 4N0FA 3VRJB 2VDMH 5E4EB 1WFTA 5I0DA 1K4CB 3Q5TA 1MCWW 4S1DD 1FVEA 1LK3L 2NMSA 3NN8A 4PB0L 1FH5H 2YS4A 1BF2A 5FUZH 4UB0H 2P24B 1HIML 3P4NA 3RWCB 3VWJB 4RQQA 4X7FC 3ARED 5IV2A 1A6VL 4PR5B 5KS9F 3H8NA 2PYEA 3C08L 2F54D 4LSUH 2EIEA 1DQQB 1T0NB 4PYGA 6CGTA 1X3DA 1CN4A 1RHHB 2PTVA 3MV9D 2O5XH 4KROD 1HH6A 4KTEL 5CIPB 4Y5VA 2X09A 2Z8RA 1A5FH 3IGAA 3NOIA 4JRYA 4DK6A 1KIUA 3BPCB 3VG9B 4GG8A 1UKTA 4JPWH 4LSSL 4U0RB 5JHLL 4K9EL 3CVHA 3RDTD 3PL6A 5LWYL 3DLQR 1T7VA 2EIBA 3RVUC 3ULSB 2EDTA 2JK5A 4K8RL 1JZ5A 1RULH 2NY0D 1IL1A 3H0TB 5IBUG 1LEGB 5LQBL 1PQZB 3UTOA 4P99A 2CO6B 1XR9B 1NFDF 4PJXE 2MNUA 3U2SA 2HFGL 3MCLH 1YN6B 2F5AH 3OJVC 4KJQC 3KYKH 2AJXH 2WIIB 2XQYG 3GSXA 5E8PA 3CX2A 5CEZE 2I25N 2D7PA 3F7YB 4I0PD 3GGWA 3ARFB 5BV7H 1WGOA 5JPMA 4NRYB 5EZLB 2IQAB 5SX4H 1F90L 4U1LB 5C0NC 3U7YL 4FHBD 1S8DB 5EO1A 4WI5A 3PWLA 3VH8B 1QLEH 5L2JA 4U05A 1YYMH 4XBPA 3NPZB 3NPSB 5LAXB 4DTGL 3KLHC 2Z31B 1NC2B 1GGIH 1KG0A 3O4OC 3C60A 2FX7L 2E9BA 3GMRA 4JFEA 5AD0A 3QUXA 3SGJA 4WDIA 2NY1D 4R3SA 1NBVH 5T3ZH 3VFVB 3BYYA 2NX5B 1ZLVK 1CDUA 2ITDA 2EZ0C 2H2PC 1HYSD 5B8CC 1CFVH 2KZ1B 4C4KO 2Q87A 1RJYA 1GGBL 3T0EB 4BKLA 5DSCB 1CFTA 2VABB 5GIRB 2XA8H 5B22A 4Y19A 3KR3L 5F1OB 2ZOKB 4NPYA 4D8PB 2WINA 1NLDH 1SBSH 4XWGL 1MJ8L 2DLHA 2V5TA 2Y72A 3P40A 3WXVL 4DKEH 4MA1B 2MPAH 1IC4L 2QV2A 4JFQB 4B7IA 4FG6C 4N0YH 2JKXA 1GZQB 5I30H 1EHXA 3O3EB 4N0UE 4NNPH 4Y5XC 5D7LE 5C09B 5C0BA 3EYFA 3ZTNL 3MRBB 3TN0A 3I50H 3S5LB 4M6NL 4OZFH 2FGWL 5GSRA 4YEEA 4ZO6A 5IEKA 1NEZA 1NMAL 3AXLA 4U6XA 1KLUA 1NCUA 3DNKA 5CEYA 4MJ5A 4RRPA 1CU4L 2NPLX 2A9MH 3P77A 4KK9D 3MLRH 1AI1H 3LN5A 1ZHLA 4PJ9B 4HPOL 3CXHK 3MLVH 5D7IA 1XF5B 5HYQB 3B2VL 5GZND 4JKPL 2MMXA 5DK2B 4GH7B 2YXMA 2ZUQC 3VWKA 1KXTB 2HRPL 3ARDA 3QUYD 4RWHA 4MA7H 1J8HE 5T5NG 4L4JA 4LPWA 1WJ3A 4KV5F 5FA3B 3ZDZF 2X2YA 3FRUA 1SHMA 32C2A 4HJGA 4KC3B 2EIZA 2HJLB 3VE0A 3PWJB 2AJSH 4X6FB 1QQDB 3VCLA 4AJ0A 4ETQB 5AZEH 4ODXB 1CR9H 1HNGA 3TT3H 5ESVB 3ARGD 2XWJA 5CUSL 4YHZL 1H8OA 5F7KC 1T5XA 3HE7C 5FYKD 2C3GA 3M17A 4NZUL 2ZCLH 1WISA 1K9TA 1XF2B 4MWFB 3L5HA 2V5SA 3KLAB 3B8YA 2RJMA 4XP4L 3D9AL 1OGTB 3AB0B 2QR0B 2FEEL 4BA8A 4NNXA 5F1IA 5FUOL 5DHYA 4K71C 4DN3L 1HSAA 1WBXB 2AJVL 3T2NL 1CVSC 2W0LA 1QSFD 4G8GD 3BT2L 3B4NA 2OXGA 3MBXL 3MRLB 2UY7A 3FQXA 2C5DC 2R0KL 1EVTC 3QH3B 4HEME 4QY8A 3GSNH 2I60H 3JTSA 2FX9H 5AAWA 2EDYA 3FQRA 5DD6B 4OZ4B 4PS4L 4Y4KB 4CL7A 2A9ML 1GH7A 4RGNC 2P43B 3KPOA 4J3OC 1QACA 2H6PB 3MJ8B 4JRYE 2R4SL 1W72H 1CF8L 1WZ1L 4WTXA 3LDBB 5ITBH 3QJHA 3WFCH 4O4YH 4XTRC 3RDTA 1FL6A 5AWNH 3S34H 3MREB 1QKZH 1DQJB 2NY2C 5HYEA 3SE8H 3L3IA 3TEUA 3MNWB 1ZA3A 12E8L 2Z31A 4CNIA 1OGAE 4QRRE 5D7IE 4YHKL 3UAJD 3LQAH 1F5WA 1FFPA 1TETL 3RWIB 4OIAA 3QZWA 1RURH 4Z8FL 5FK9A 3BP6B 3RDTB 2AJ3A 1NKOA 3Q0HA 2FEDC 5EU7E 4X5WB 2LAAA 4JFEB 5GRJL 3SDCC 5HY9B 5GGVH 3D39B 1FGVH 1X9QA 3KGRA 1HINL 2VB5A 1JYWA 4O51B 4XVTL 1NUFA 4WFHE 3T4YA 3Q5OA 3EO1A 4M6NH 3MRDA 3QO0B 1YY8A 3G5VA 2CRZA 5GZOD 3DX6B 3QXTA 3C2AL 4NFDA 1AP2A 2APVA 4TULH 4ZPTA 3KXFE 4PJ5A 2FDBP 4JGUA 1IAIL 3MACL 3BHBB 1E28B 5DJ2B 5DMIH 1CLYL 2BVEA 3FMGH 1HN1A 3NGBC 1RZIB 2FWOB 4M1DL 4EI5C 5I9QC 5IHZB 2FATL 1DP0A 1N7ML 1OARL 4M8VA 1DBJL 3HPLB 4D9RD 1LO0L 4HHAA 1JWMA 5H37G 5CMAA 4CVXB 2GTZB 1J12A 4M1GH 1LHZA 2UWEB 1FZOA 4Q2ZB 3FN0L 1S7TB 4S1RH 3BPOC 4EDWH 1R3JA 2XWJB 4GMTL 4Y19D 4NN6C 5HI5D 4RX4A 3W2DH 3KPRD 5F88B 4ZOEA 1PG7X 3NABH 2X7LB 3RZWA 5ID0B 4PRHB 4UT6H 1H5BA 3VXUB 5C2UB 4LRIA 2AI0H 3LD8C 4L3ED 3EOTL 4XP6H 4O2CB 1T89C 3QIUC 1EJOL 2VSDA 5HGHB 5ANMA 4HKZA 2N56A 3DI2B 2CXKA 4JN2A 3EFDH 1T2QL 3CDGB 4PJ8D 1WAAE 3HLAB 4PJAE 1A7OL 2Y1VA 4FFVD 1AIFA 4IOFC 3QXWA 1L0YA 2RQ8A 4DZBA 4C56B 2X70A 3KPPB 4WFED 4HDIB 1MHEA 2DQCH 3BKCL 3VWJA 1F90H 1QNZH 1UJ3A 1WBYB 3DMMC 3Q2CA 4YDLC 5IQ9A 1M05A 1LMKA 4FQQB 4DK3A 2FBOJ 1ODAA 2XWTA 4OLVH 2WWKO 3GI9L 3MGTA 5CSGA 1XGUA 4P3CH 4H5SB 1BOGA 5JIIA 3O8XA 4K3DL 4PJEB 2D0GA 3OGCB 5DLMH 3STZA 2V5YA 1YQ2A 5F9AC 3NZHL 4K94H 4PJ7A 3WE6A 2ORBH 4KXZI 4X5LA 3RY6C 4PJIF 3V95A 2B1HH 3LS5H 3RNQA 3SCMC 1LVEA 1HXMA 1I3UA 5GRUH 1MPAH 1FC1A 3UC0H 3CXDL 4F9PA 2APBA 5F7UA 4ZDHB 1S9KC 1QR1A 1MREH 1WFOA 1FYTD 2VL5A 1JNLL 4HLZG 4P5KA 1F6LL 3L3HB 1AKJA 2XZAH 4WV1B 4XPAL 3QXDB 4OM1H 1OY3B 5HJ3A 1U8IB 2BMKA 3FQWA 1U8LA 2WV3A 1KG0B 3FT3B 3X11A 2NNAB 3S3SA 1KTLB 1QFUH 2EDHA 3MBED 4H0HB 4ZUSB 4YK4C 1RZ8A 4HFWA 4R4FH 3OGCA 4CN6A 3LEVL 5JW4N 3BEWB 1DN2A 1T1WB 4LFHD 4OKDA 1SYVA 4N8CH 1WWBX 3O6KH 4Y1AE 4BZ1H 1EZVY 4FQXB 1IKFH 2AJZA 3FQXB 4OZIB 1GPOH 1U8HA 3MLWL 1EFXA 4Z7VF 3GSVA 3TJEH 2EIDA 5JW4R 4AIZB 4Z7VB 3K0WA 4MQ7A 4D0DB 2QQNL 5FEBA 3JTTB 1G9NH 4JRXB 4YWGH 1W0VB 3FQTB 3QUXB 1N4XH 2NR6C 1NEUA 3QA3A 4JFOB 3VA2C 3D87B 2VDPL 1P9MA 3U4EB 4I9WD 2OTUB 4OLEA 1I7UA 5I1EL 4HF5H 3IJYA 1R24B 1NL0L 1DN0B 3U79A 1EMTL 2YA1A 1RUQH 4OUOA 4YGVB 4Z5RA 1LO2L 2APTA 4KI5F 3FB7B 2RAMA 1EGJH 1S5HA 3C6SA 4ZQKA 4HS3B 5KVFL 5DR5H 3CFEB 5EUKA 4XPTH 2B4CL 3TYFA 1OAYH 4MCZB 3GSXB 1NLBH 3VFSA 3VXTB 4GMSL 3C9NB 4LHUD 1MPAL 3VXQA 1JPGB 2BY2A 1RK1B 2YK1L 2R69L 1L7IL 4LVEA 1YEDB 4HC1H 4LGRB 3O4OB 3RGVA 1B0RB 1NFIB 3ARDB 3V4VL 1YPZB 2G5BA 1XR9A 4NN5B 4PRPD 4X83A 4UB0L 4IRSD 3BIKB 1NGYB 1KPUB 3FOMB 4G6AC 2X4UA 5L0QB 2ICCA 1LP9A 3HI1B 4NO3B 1A6WH 3TT1L 5INDB 5MEQA 4HZLB 2HFEB 3DJ9A 2IPUG 4EEEA 3LEVH 1MEXL 3D69B 3GSOA 4BZYA 1WICA 1VESA 3F65A 1BQUA 1LE5B 4HS3A 4GUPA 3QWOA 1T4KA 5D7JC 4LAJH 1UB6B 2NY5H 1JHKH 3X12A 2ATPA 2Z8WC 1IZJA 4JG1H 3V4UL 1B90A 2IFGA 1NAMB 2H32A 3O4LA 1PKQB 2OTWA 4XPGL 1JHLH 1PSKL 1N8ZB 3KXFB 4CVXA 4AMKH 3H3BC 3KS0H 3IJSA 1DE4B 1A02N 5DQ9B 1MFAL 1DDHA 1UJ3C 4HWBL 2MKWA 3RTQC 3DHJA 4L8CA 5FM8A 5DJXB 3VRIB 4UU9A 2OCFD 4U6VH 3MLUH 3JVGA 2X1QA 5DSCA 5KVEH 4QT5B 4J2XA 3UO1L 5JMRA 3CD4A 3PGFL 2XZQH 4UOW1 1ETZB 5KTEL 5E6YA 1FYHB 5FYLD 3QQ9C 3SEPA 4JFHD 4LIQL 1KIQA 2Z91A 5E2WH 1TENA 2BSSA 1SJEA 1TNMA 2DLFL 2ZOLA 5C9JA 2P8MB 3QJHB 3V6OC 1KCRH 3LIZL 4DKDC 4OGXH 5HGAB 4PRNB 4GKSA 4GLRH 1UG9A 3OXRA 4PYHA 2BSED 1KJ2A 3QPXL 4LAQH 4Y1AD 5DI8B 5KSVA 1J05A 1CT8B 3NIGF 4EN3C 3I6GA 4ODUA 3CFCH 3BFOA 1KXVC 4WUUD 2CKBB 1TJGL 4RX4D 3GKWH 5IT2L 5IK3A 5D2NB 3VFOB 5B39A 2X4PB 3OKEA 4L4VB 3IB4A 2BOBA 1NGQL 3KPMB 4NOBA 4WY7L 5TGBA 2H9GA 4HUNB 4LPYA 4Y16C 1GGCH 3FN0H 5C8JA 2QHRH 2FJFA 4OLXH 1Y6KR 1F4YL 4JDVB 2X44D 3X3GL 1P7QD 2YPLD 3HFMH 4APQB 4PJEE 4YPGA 5C0EB 1DJSA 4UT6L 3AREC 4RDQG 1JRHL 1OAQH 4MD5A 2YUWA 2IBBA 2OX5A 1AD0A 4HFUH 1J1XH 4P9HH 3NIGE 3QO1A 2E7MA 5DURB 3ZT7A 4MNQE 4OM0L 3TM6A 3WD5H 1KELH 3JWNC 2HT3D 2W1NA 4N9OB 4PRIA 1FIGH 1YDPA 3HN3A 3X3FH 4UNUA 4U1KA 3HAEH 2ZKHL 1XMWA 4WTWA 1R3JB 3FONB 5JZ7D 2R2CA 2VJXA 1IT9L 1ZXQA 1E0OB 5HDBE 3G5ZB 4U1GC 2JTDA 3MBEC 4WW2F 4XNQA 3HUJF 4LVHB 4N0UB 3H3PL 1SMOA 2IADA 2EH8L 1JPGA 3D18A 1CLZL 3GJEB 1MHCA 5K9QG 1T20B 3NN8B 3O9WD 2XG5A 4NKQB 1NEZB 3AXLB 3VDCA 4P2OA 2VZ3A 4HWZB 5DA0B 5C7XL 3F7QA 2X41A 1XCTB 3SJVB 3PG2A 5HVHC 2I24N 4LSRL 5DD5H 3IDJB 4YO0A 5J11B 4YUEL 4XCEB 3QDGE 4GG6B 3PXJA 5IIEA 3BN9C 3TA3D 5SWSE 1BD2D 4XVJL 2AJYL 1UYWL 4P3DB 5ESQA 1VDGA 2B0SL 4PJBB 4XNZB 4EQ3A 4LASH 1WAAF 3TIDB 3DBXA 3IFOB 4Y4FD 3DUUB 1N2RB 5GGRY 3UBXI 1S9YB 4OB5L 3VFWA 3EYUL 4U6XB 5LGHH 3TO4B 5EC1A 2NY1B 2WK2A 3LKQB 2YC1B 4Y16B 4DGIH 2VZUA 3U30B 2VAAA 4APQD 2FO1A 3FO2B 2H2PD 4PJFA 4DOHB 2EXWD 4X9FA 5E5RB 5DD0L 4HUKB 1AC0A 4W6XB 1F2XK 4RIRB 4L8BA 1IBGL 5C0GB 1MCWM 2ZCHL 1PJ9A 4YDJA 3H9YA 4W6WB 2FBJL 1XGYL 2AGJL 3PGCB 1GOHA 1K8DB 1CK0H 3BGFC 2W0FB 3FN9A 1ES0A 1XGUB 1FJ1B 5AZEL 4HKJB 1CFTB 5DGQA 3OKDB 4P5KB 3EYSL 1CICA 3W0WB 4ZSOE 5MP6H 1V3LA 4YZFF 1TCRA 4BH7A 4GKNB 2D7TH 4JFPB 1ZANL 1A6AB 2JELL 3ARGA 5GPRA 1UC6A 3K4ZA 3BD3A 3U7AA 3GSNL 1NCDL 5DJYB 2W92A 4Z7UE 1FFNA 2X4SA 3MRCA 1JV5A 3LQAL 4W4OA 4QTIL 2FB4H 2XN9A 5ETUA 3UTZA 1XT5A 3B3IA 5C0JB 2BRQA 4KJQD 1YA5A 3F7PC 5FUOH 3JTSB 5K9QI 1T0MA 1U9KA 4ZUTB 3M17B 4GW1B 4MX7B 5C86A 1XF3A 2UZIL 3WUZA 1I9EA 1CGXA 3S5LG 4NGHH 1FLRH 2Y23A 3BMWA 2E5EA 2GSGA 3MX0A 4K3JL 3PHQA 1WBXA 3MOQA 3QWQB 4JANA 3P30L 4P23C 4KKCD 5I71C 4JRYB 4NQSA 3IU4L 1U95A 5MEPB 4JY6A 1HHJB 5D5ME 3OQ3B 2W0PA 9CGTA 4EJ1C 1OT2A 1CDCA 4MXWL 3SCMB 2DYPB 3V0VA 1S78D 4O2FB 4S11A 3WEXA 4DQOH 1MWAB 3H9SA 4LBEB 1E27A 2YN5A 4X6DE 3MV01 5FM5O 4HH9A 4LFHG 5TQ0H 3VFTA 4I1NB 4PG9A 1IARB 5DQJB 3VXQB 3GBML 4ETQA 4BQ6A 4WWKB 3BGMA 1LO4H 3O8XC 5IGXL 1BFOB 1CFVL 1VGEL 3SY0A 5AZ2L 2HVJA 3SKNA 3ULUF 4HPYH 4U3CA 1A1OB 1R3LA 1BIIA 1G7JA 4O02H 5HGGS 1AP2B 4Y5XB 5HDQH 4YDVA 3KJ4C 4DUVA 5E8OB 1UVQB 1QO3B 2N7BA 4RWYL 1HHHA 3V5KB 4YFLI 3KHOA 2DQCL 1DN0A 4IMLB 4UOJA 4OI7A 3VA6A 3D85A 4FQIH 4OD3H 3VXMB 2J6EH 3QG6B 4F9PC 2C3VB 4U6YB 4HHAB 2OJEB 4MA3B 2JJTA 4M3JA 4JREB 5DEGB 4EBQH 5DRWA 3GMPB 1AKJD 3OKLB 2VDKH 5BRZB 1TNNA 2ZUUA 4OD1H 5F3HA 3GK8L 3OXSB 1VSCA 1A47A 3MOBH 4FFWD 4Q9QH 3TGXA 4PJ5B 3K8KA 3S5LA 3SE9L 1SEBA 1DBKL 2ZUQB 5D96C 4XCCH 4PJ9C 5CSZA 1BVLA 5HYSA 4X7TA 2P8LB 3S9DB 3VU2A 4MMZC 1FL5B 4PREA 3VXUE 5LJYH 3CDCA 3OKDA 1MLBA 4ZXBB 4I3SH 1YQVH 4HW6A 1R5WA 1H0DB 2BSTA 1EZVX 2ADGB 4H26A 1P7QA 2YPLA 4U1MA 3SDCD 4X7SL 1FHGA 1HDMA 1R5IB 4L5FH 4QRUA 4RIRA 3MRLA 1PG7W 2F53D 5D1ZA 4F3FB 1HSBA 1LNUB 4J3VA 1P4IH 3T1WA 1MFEL 1MFDL 5CBEB 3EFDL 3HRZA 4PS4H 2XKNA 4Q58C 5IVZA 4P3DA 2HFFA 3VFGL 1IAOA 2DLGA 3BQUC 5I15L 5DZNA 4HF5L 3BKMH 3KYMA 5JO5A 3MUJA 2P8PB 4A2MA 4V2CB 5I6XC 4QF1B 4G9FA 5KSAB 4EI5D 3FZUD 1AO7D 1CICC 4U1LA 3MV8B 5IESL 1YN7A 1A3LH 4KJWD 4P2OB 3S35X 1AXSB 4M7JL 4RZCA 4XMKH 4O2EA 3P73A 5BO1H 4XVSH 3AREA 4Y5YB 2JCCF 4X8JB 2D7OA 5GS1B 3F62A 1QSVA 2YPLE 1IGMH 3BX7C 1IGTA 4LDOB 1OD9A 3JV5A 3HI6L 1MI5D 4WENB 3GSWA 2WAHA 5AWNL 2H3NB 5IVXA 1D9KB 1BGXL 3DRTB 4H1LA 2AJXL 2DWEB 4QXTA 1C5CL 4BFBD 3ULSA 1YZZA 4IBLT 4MSWA 1RK0B 4XNXL 5BVPL 3OF6A 4QCIB 5B4MC 4DW2H 1LGVA 1FFQA 3OHXB 1D5BB 4G9DB 1H5BB 2B0SH 1ONQA 3PWJA 1REIA 3IFLH 5I1KH 3C8KA 4K8RC 2P7TA 4I18B 4C56D 1QA9A 4JZJA 5D7LD 4DGVH 1JN6B 5D96B 3WNLA 4EDXB 5DTFB 1F8TH 4WGWB 4DGYL 5DF0A 1YNLL 3EYFB 4X6CB 5DJ8A 3GBNL 4MD5B 2F53A 4KH2A 2DQGH 3RDTC 1TTFA 1CDBA 1BQSA 2FRGP 4OLWH 1RUPH 3HC3L 4ELKA 3H3PH 3I02B 3WFEL 5C0FB 5F89B 3RZCC 4NSKB 3P73B 2JCCE 1CQYA 5E00A 3P9WB 3DYMA 1J1PH 1INDH 5C70A 4AEIL 2HG5B 4ODHL 3T0EE 2Y36L 4NPYB 4D8PA 1U8OB 1K2DB 4AT6A 3ARVA 2BY1A 3QCUL 4NRZB 1RIHL 2DM4A 4XGZB 3HCVB 4PRHD 3S37H 2QQLL 1KPVB 4HIJA 4NHCH 2DS4A 3DGGA 2DIAA 3MJ6A 4CDHA 4U0QB 2VLRB 1N4XL 1FLTX 1JZ4A 5GSRB 4TSCH 1FVCA 4J12A 2OR9L 4ODBD 1Q9WA 1AE6H 5AG8A 5F93C 5IVXE 1OTSC 4OF0A 3LV3B 3PDGA 4D9RE 3GSUA 1N64L 2YD4A 4JREC 3BZFA 2FH6A 2Z93B 2BNRD 1TJIL 4NZDA 5HY9A 5D1ZB 1LD9B 1IGIH 4YFDB 1W8OA 1H3WM 2VDLH 4E5XA 4P9ML 5I73B 2X5PA 2LABA 5JXEC 1ETZA 3QI9D 2DQHL 3UXFA 4D0BA 2ZG1A 4PREB 2A6DB 2P8LA 1H0DA 4Y5YC 1S7WB 3LD8B 2Y6SD 3KJ6H 2W65B 2OTPA 4LHQB 3HC0B 3ZE2F 5IW6B 3V8OA 1WLHA 2PXYA 2ZCLL 1IM9B 5K9KA 3LB6D 3DMMB 4JM2A 2R39A 1R3IL 2HTKD 1INQA 3CZJA 3FB5B 3V6ZB 4FMFA 3HZYA 3CLFH 4HXBH 2I9TA 2J88L 3WN5A 4OUUA 3KYOA 3OMZA 3R4DA 2ICWJ 1KCRL 3LIZH 1PYWB 3LPFA 4X4ZA 5C07B 1GVIA 2CMRH 4QHLA 2FGWH 1DDHB 1BFSA 2XACC 5L8JB 2COQA 4Y2DC 5CEZL 3OAUH 1A1NA 5KSBE 1JK8B 3QUMA 4UDTA 4WI9A 1DSFL 2WP3T 3PGFH 5ACZB 4BQ9A 3S8WA 3OX8A 3T8XB 4IMLA 2G5RA 2O5ZL 2QR0A 4RGND 3QG6A 1KBGL 1FRGH 5DXWA 4RMTA 2BY3A 3UTTD 5BS0E 3MRPA 1YYLL 1LDSA 3QWOB 1ZV5A 3CCHA 4CMMB 4AEEA 5KG9A 1EHAA 3ARXA 4ONHB 5CZXC 5DO2D 4R4BA 3WDHA 1ZHKB 4GG6F 4QCIA 3O2VH 3ARRA 5TQ0L 1KJ3L 4WV1C 2W60A 4P2OC 4X9IA 5F7DA 5I76B 3WHXB 5KVEL 5FYKU 3G08B 1YMMB 3PL6B 3ZYIA 3PXHA 5B8CB 1MAML 5H94B 3TYFB 4MMXC 4HK0B 32C2B 5JHLH 1MF2H 2VLJD 3WNNA 1YEDA 4X6BA 2IALA 4L9LB 3SCMA 1QZ1A 2YEZB 5EBWA 4TUOA 2A38A 3LZFH 1I8KA 2NXZD 1D5MA 2C1OB 4JRXD 5L88H 3ARZA 2OMBA 1JGEA 2EEBA 3QDMB 1K5NB 3D39A 5E2TH 4OCLC 4R96B 3EAKA 4PG2A 1YEJH 5IB5B 1M1SA 4Z7WB 4NCC1 1JYNA 4TVSa 5JOPD 2HTLD 2IAMD 2QQQA 4ZO9A 4KZEL 3ARBD 3LRGA 5I74C 3FAXA 1IM9D 5ELIA 4JPWL 3SHSA 3QFDB 5C0AA 5GXBB 3GM0A 3MV8E 5GHWH 3VXRA 4J1UB 5JORB 5C0ND 1FDLL 1CGUA 2VE6B 2QKIB 1AHWC 1ZGLM 3GJFK 3NIDF 2DM3A 3B9AA 1NL0H 2DJSA 2F8XC 1A0QH 3W5MA 1OPGL 4LK4A 1IC5L 4NKOB 3R8BB 1INEL 4ZTOL 5DJCB 3NFPB 3TWCL 1Q72H 1SYVB 4Z7OE 2P46B 2I9LA 1B2WL 2JCCA 2VITA 1I8MA 1MFDH 2XYCA 1RV6X 3K8MA 1II4E 3QCTL 3QEUB 5BS0D 2YD5A 1J8HB 4NKOA 3MRIA 1FN4B 1JGUH 3BD5A 4Y5VC 3NTCL 4JM2D 3O6LH 3LY6A 2LV4A 5T1LA 2J5LC 4G6AD 4FFVC 3P4MA 1F3JA 2J8UB 2VR5A 4NZTL 2GITB 1MVUB 5GS0L 1A7QL 3U1SH 2ATPB 3AB0C 2BCKB 3O8XB 3MCKB 4RFNC 1T5XB 4WHYG 3Q3GB 3SKOA 4DN4L 5FO9A 3V7AG 5J1AA 3WJLC 3QNXB 1KPVA 4HIJB 3CX5J 2BVPB 1H3TA 3RI5K 3WE6B 1L9NA 1IILE 5A40E 5ESQB 4R90H 1YEJL 1CTNA 4PRIE 3AU1B 3OKNA 3ARWA 3TBVA 3T0VA 3L3OA 3UPAA 5E00B 3WO3B 5D7LA 2OR8A 4PJBE 4ZS7H 2DQDH 5ICXA 4M6AA 3EOTH 1BWWA 3IDJA 1QSED 1SMAA 2XTJE 3QEHB 3ARYA 1KNOB 1TQBB 4L3EA 5IMLA 3BP5B 3H3KA 5GHWL 3REWB 4M7JH 5FOBB 4R9HA 1I8IA 3A0OA 5IM7B 3U4BL 2EDKA 1YEIH 4BJLA 3C8KB 2NY2B 3IJHA 1VFMA 2H8PA 1T1YA 4HIIA 2FR4A 4QHKJ 5DD1L 4O02L 5L8LB 3FCTB 3P77B 1NAKL 1X4YA 3A67L 4ONHA 2NY3C 3EFFB 3ES6A 3FO1B 5EN2A 2VDQL 3DXAD 2DKSA 2WQ8A 2AK1L 5CS7A 3FONA 4RFOL 4WW1A 3ZE0E 2OJZH 2Y06H 2PTUA 2VWEE 5I66B 2J8HA 4YDVB 4LLMB 3HS0B 3OSKA 1WZKA 3ABZA 5F9OH 4B53A 1DQQA 1T0NA 1PAMA 5HPOA 1ZTXH 4F33A 3CMGA 3HUJE 1KTDB 2GIYA 4B0MM 1A64A 4C57C 5DK0A 4NO2B 1PYWA 4W81A 5IHZA 5T3XH 3T3MF 1T0MB 2EEAA 5D6DC 1NUDA 3UTTA 1DZBA 4TOYH 1R6VA 4XAWL 4PJ7F 2O93L 5MERA 4XPBL 5I75C 1G9NL 2WBJB 2E6QA 3PP4L 3F5WA 2D0FA 4LQFL 3THMH 3MUGB 1NFKA 3RVTC 1SJHA 2X10A 5MENA 2VQTA 3ARGB 4UQ3A 2DLIA 3SDXE 4HBQA 5K93A 1EJ6A 2DIBA 3GNML 3O6KL 5HYSB 1NSNL 4XHJC 1Z9MA 1XZ0B 1GHFL 1OTUD 4OZGA 3GMQA 4MD0A 1J1OL 4APQC 2CRYA 5CZVL 2VQUA 3U0TB 4GRLD 4JAMB 3RIAF 1EIBA 3I6LD 1CXEA 1CXIA 4YR6A 3VGEA 1DQML 3HNSL 1NANH 4UNTA 5EIIA 2C26A 1CFSB 3O3BB 3VWKC 1F3JB 3C09C 1D5ZB 3SDDC 2IG2L 2Z4QA 3F6LA 2PN5A 4FN0A 3T3PE 1P4LB 1QUNA 1YEKH 1T1ZA 4LGPB 5JA8B 4NKIH 3RU8L 5E8DL 1YNKH 5DA4A 1A14H 1RZJL 4XGZA 4FABH 2VLRA 1LO4L 1U92B 3ARTA 5LBSH 5FO8A 3I2CH 3G9VA 5C3TA 1T7ZA 1U8OA 4ERSL 4U3XA 5HVHB 4Z18A 4HAGA 4HIHA 1FFOA 2V5RA 3HR6A 4GW5B 3OG4B 3WXWH 5LGHL 4X4XB 4UU9B 5B3JF 5DEGA 2V2WB 1FGNH 2DQDL 4JQVA 4KDWA 4LF3A 3BXNB 3BIBX 5TDNA 5KS9E 1CL7I 2NY7H 1Z5LA 1JF1B 5E8NA 5HPMA 1RU9H 4X7DC 1HHHB 3V5KA 1G7HA 3UP1A 3WJJC 3LEXB 3CIQA 5EU6A 3QIBB 4MXVE 4XCNB 2DWDA 1UB6A 3T3PF 3VGFA 4KRPB 4PJ8B 3HZMB 4K3HA 5IBTL 2W9DL 3HC4L 1DLHA 3MMEB 3WS3A 5ESVA 3OHXA 3LKRB 3DURB 4H8WC 2X4OB 5C7XH 4XAKD 2XPGB 1MJJB 5IOPB 1HXYB 4POZC 4NO3A 1ROWA 5FOBA 2R2BA 2ILLA 5HHOD 3BP5A 1GRWA 3B2VH 3ESVF 2NY1C 4U1KB 2YXFA 1C5BH 4MVBD 4GRWE 3V0VB 4G8FA 2CGRL 3HE6C 1JWMB 1MIEH 1ZOXA 3ZKSD 1QRNB 2LE9A 3EYVB 5CGYC 3RGVB 3W2DL 1U8NB 4JY5L 4ONGH 3ZE1E 2CXGA 4U1NB 4PJXF 4WTZA 3KPQA 3GHBL 1A6ZA 3UZEA 2UUDK 2CRMA 4UUJB 5FM5M 2QLVB 3CFKB 4DFHA 3K7UA 1XIWB 1VGKA 4HAFA 2DN7A 5GISL 4YPGB 3DWTA 5C0EA 4CVZA 2BFVH 4JDVA 3CCHB 4CMMA 1NC4D 1ND0A 3MZTA 1U3YA 2GY5A 1JFQH 3UBXA 4Y1AB 4LNRA 2J8UE 4HK3J 2ITCA 1QSZA 2R9HD 3FT4B 4NM8L 1MVUA 1A3RL 3QIWA 4AQ1B 5HHVL 4U1HB 2X4OA 4OZHE 2VTFA 3EDKA 5FCUL 3MOAH 1IAOB 1CK0L 3SGKC 1WVZA 5IK3B 1PG7L 1TVDA 1VPOL 2RCSL 4TTDC 2OL3A 1Q0YH 1RUMH 4EI5A 1CR9L 3MNVB 5CJQH 5INCB 5JLZB 1XGPA 3FL7A 4AEHL 3T2NH 3NBNA 4FNLH 4HV8A 3HUJA 3U83A 4HKJA 1I7ZA 2AK4A 1P7KB 2EDBA 4K3DH 1KTLA 5JW3H 4Z7NE 5HYJB 1UB5A 1BVLB 1U91B 2PXYB 3HFML 5GS0H 1P4BL 2L4OA 4WI2A 3SBWA 4P9MH 1HQ4B 1MI5A 2ZCKL 2BNQE 5I8CA 5C0DA 2ICWI 1B0GA 4MLSA 4NO0D 3SJVA 5I18H 4OZHB 1F6AA 3QIUA 3R8QA 2NXYC 2I5YH 4PJGB 3FFCA 5K9OA 2RIKA 4JFDB 5EU4A 2BERA 1WT5C 1ZKAA 5FXCH 4FZ8H 4KY1H 3QAZC 3QXVA 2HLFC 4NO0B 1Q9OA 5FDYA 1NMBH 1JRHH 1OAQL 4U6YA 3AVEA 3KXFA 4RWYH 3FB8B 2FGZA 1RVFH 3CFDA 2E8YA 5ABDE 4LVOB 4QGYA 4PD4J 3CXHJ 1K6QH 1YYLH 3MRHB 5J7CC 5E1HB 5L2JB 5F7NC 1AO7A 2LU7A 4GXVH 1IKNA 3N9GH 5KSAD 3CH8A 3T2PA 4U49A 1CIUA 2QL1A 5HI3C 2BRRH 4JZOA 4B7LA 3IDYC 2H2SC 3GMQB 4MD0B 3QFJA 2BNQB 5KOMC 4NWUH 5IB3A 1A7PL 1JWUB 2XN9E 3I9GH 3IDXL 2WLYA 2HG5A 4KRPD 4X6FA 1TJHH 4ONOA 2G60H 3ULVE 3NZ8A 1KBGH 2VDOL 3BDYL 3IJSB 4IJ3B 3PP3H 1KN4H 3RWHB 4G8FB 3QG7L 3CDGA 3FHAA 4OV5A 4MAYC 2DQIH 3H7BA 5FV1L 5J06A 2X9WA 4DUWA 4XZUB 3S96A 2GYSA 3HPJB 4G43B 1HHJA 4CMHC 4YBQD 3CVHB 1QPXA 3ZL4L 1RFDH 2DI8A 2OQJB 1TFHA 5MEND 1EX0A 5FGRA 5FO7B 4DAGL 1AFVL 1ZVYA 2WZPD 1H3VA 3RPKA 4XAKE 3E8UL 3Q1SH 3U48A 2JIXB 5A43C 4KKNA 5BV7L 2A74A 4N0RA 1MCBA 1EAPA 5DJDB 4FQLH 1JZ6A 2Q76A 5E2VL 1MFCH 1TIUA 1UENA 3G6JE 1E4WH 1JF1A 3KPTA 3HZVA 5HSFA 4XCFL 2YWZA 2XN9B 4WW1B 1AGFA 3MNZA 3BQUD 3NABL 3VRJA 4HCRH 2VLJE 4NQEB 4U4BA 2N4IA 5ACZA 3PDOB 2ADJA 1WAAA 2G75B 4N0CC 5K9KB 3C5JA 2JIXD 1LWRA 2NY6B 4NHUA 1DTUA 4NQED 1KB9J 3I6LE 3IYLW 4YLQT 2BSSB 5DHVH 3M8OL 3I84A 4S1QH 1F00I 1VEOA 2GI7A 2X4PA 4L4VA 5IMKB 1JPFB 1OTSD 3CSBA 1YY9D 3ARBB 4LSTL 4OAWA 5BZDA 4XPFL 3U9UA 1JTTA 2DF3A 2EYRA 1T22B 3PHOA 4XWGH 1PZ5B 3FB6B 2HJFA 1I75A 4LCIH 4NC2B 3EO1B 3G6JB 3QNYB 4ZFFB 5JXED 4PGBB 2XFXB 4QGTA 5HBBA 4PGCB 4Q6YA 1FV1B 2YZ1A 5E2JA 3D3VA 4JKKA 2QQKL 4NO0A 4MNQD 1VFOA 2AW2A 5JNYB 1Z3GH 3I75A 5DD0H 5LKNA 5EU4B 4X6EA 4H88L 4MYWB 1IGJB 2NX5D 1CD9B 1X7QA 4I18C 5I1LA 3LKOA 1T7XA 3V6BR 5JTWA 1F11A 4PGZA 4GRMA 3U82B 1P7QB 2YPLB 3HMXH 2JJSC 1S7QB 4K8RD 2ATKA 1HYRC 3NIFE 4ZNEA 3G5XA 3AMKA 4M61B 2PR4H 4Q0XH 5GJSL 1HKLL 5F96L 1MHPL 1MSPA 2GJ6D 5DYOB 2KPNA 1RU9L 3SBWC 4XMPL 1FZJB 4LNRB 3QCVH 4ODSH 1I4FA 4S1QL 3FQRB 4C4KT 4C59B 4YXLL 2GQHA 5A16B 3ARFD 3DGGB 1YMHA 3AMLA 4WWID 1M7DA 1RIVL 4OZ4A 4Y4KA 1BWMA 4XNXH 2Y5TA 3CFKA 4P2QA 4G3YH 1QVOA 4NZJA 5DHYB 3VXMD 4R2GC 5JDJA 4HUWA 3MO1A 1KCSL 5JPNB 1K4DB 2EYSB 4F7TB 1NBZA 5D2LF 4OFKA 3QIWB 4ESKA 2GT9B 1XGTA 1IKNC 5EBLA 5L2KE 5F21B 2DL2A 3CAFA 1QA9B 4JZJB 4ISVB 3RNKB 1KJVB 3D9AH 3FFCD 2VLMD 4DAGH 4AQOA 5SWQA 4WFHD 4Q74A 4TUJB 1J8KA 2GJ6E 4HFUL 3CPLA 3MLWH 3QDGA 5DWUH 1KF9B 2DYPD 4J6RH 1WBYA 2D7QA 1N5YH 2IH3A 3UTQA 1CBVL 1AD0B 4NQXA 1YEEL 5CP7B 5I17A 3B8SA 4IIQB 2EO1A 4PP1D 1E6OH 4QRPA 2EE2A 2Q8BH 1JCKA 3O6LL 4P0DA 1TZIA 1OAZH 4Y4FB 3P9LA 5F9WC 3CSPA 1T21B 4JEGB 4ONFH 5C6TL 2Q7YB 1OAUH 1U8JA 3D39D 3B9KA 2FWOA 3EHBC 4KRMB 4NUJA 4RZCB 3B43A 2VZSA 4I0PA 4WVRA 5E2UL 1DBKH 1B4JH 1IT9H 3LKRA 3PIQB 1DQLH 3UJJL 5C08B 3SGDI 4D94A 4ENED 3BKYL 3VXNB 5BJTA 1MCEA 4GRWF 4F3FA 2DAVA 3L3HA 5E6IC 2FO4A 3W9DB 4X9BA 3DETC 5JO5B 4ZDHA 2N1KA 4JHWL 2GITA 3PWPB 4JDZA 4MDJA 2NY4B 1FG9C 1HCFX 4MJIA 1W0WB 1OTUC 1BQLL 3MRBA 1M71B 3SGKA 1J8HD 3FT2A 3DVFA 4TYUA 2XRAH 1IAKB 4TSAH 5GRZA 2JJVA 3Q5YA 1MVFA 3O2WL 3RU8H 2A1WH 2VNCA 1RUML 4GBXB 4HD9A 2LTQC 4JKMA 3PDDA 5CZVH 1EERB 3VXME 4C56E 4AY0A 2OS7A 3PHOB 1I1AC 1BQHA 5DEZA 4PJEA 3VWKD 2X4QB 4Q7DA 1MFEH 3B2UC 4OAWB 5TFSL 3GMLA 1I3GH 2RGSA 1CXHA 2DBLH 4I77H 3FO9B 1IMHC 2B1AL 1YEFH 4WGVB 4FQXD 3ZKMC 1I9JL 5B3NA 4MD4B 2R2EB 4FQQA 4ZOCA 4AK1A 3QEQE 4UT9L 5CJXA 4UTBH 2PO6B 4PJ5E 1A6PA 1FV1A 3P0VL 2WQRA 4HG4J 1J1OH 5BMFL 1N0LA 2QSVA 4S10A 4XPBH 3I50L 4RMRA 3KJ4B 3D0LB 1JHTA 2R0ZH 3ULVF 4FMKA 4JG0H 3EO0A 3GO1H 3HB3D 4NFCA 1N3NB 4XRCB 4FOMA 4RSVA 3BD4A 3RA7H 5E9DB 5EO1B 2WMPA 4FZ8L 3U46B 3B5GA 2BY0A 3T0AA 3DSFH 5HYSG 2HAZA 4CAGA 2CK0H 5GSVA 2HFEA 2CLZA 3IFPB 1LE5A 2HVKB 4XP9H 5JOFB 5KVDH 4DGVL 1IC1A 2FHFA 3JV4B 2XWBB 3D85B 5SWZD 2NLJB 3VFUB 4EI6A 5IW1A 2VLJB 4LMQI 4OLZH 4M1GL 1TDQA 3HNVH 3HAEG 4M4RA 3H42H 5DVLA 1QYGH 2BDNH 4MJID 1ND0B 1FORL 4FRWA 4NJAH 4KK5D 1MWAA 3H9SB 1LEKA 3UDWA 3GSRB 4OCXL 2DMKA 4JY5H 4R7NA 3MLXH 4FFYH 3ULUD 4PGDA 5EDXA 3WUWA 4PJAF 3U0WH 2D7TL 4MXQC 1C7SA 1JHLL 4NNYB 5CP7A 3U1SL 4Q9RL 3GRWL 3BPCA 4OIIL 1A6ZB 4IDJL 2VLLB 1E4WL 1DLHB 4JM2F 3REWA 5GRYA 1CE6B 2BFVL 1S3KH 5I2IB 3QIWC 1KC5L 5DVKA 5HHMB 4G6KH 1X5ZA 4JM2C 1QRKA 1G7MA 4Z7VE 5E7FA 5CILL 2IANA 3DX8A 3M45A 4QXGL 4U1IB 5DUPH 3OAYH 4JFFB 3QDJA 3AY4C 1F02I 4JZNA 5D71L 5IFJB 4OCRL 2CDEB 1J0ZA 4V1DE 5KSUB 1A7QH 4CADA 1AQDA 1DFBH 3QI9B 3UCRA 4RMVA 3HG1D 3TNMB 5CINL 2NW2B 1KYOJ 1VERA 1OB1A 4MA1C 4KVCL 2EDFA 1AR2A 3RJDA 3R0MA 4K94L 1BQHB 5JDSA 3MROB 4PJ7E 5CP3A 2W07A 4PLNC 2YZ8A 3O4LE 5DEFB 4LLYB 4JFZH 3BVNA 1G0DA 2ZSWA 3SKJH 4JO3H 3MRIB 6FABL 4PY8I 5HJ3B 4ZUSA 3IDYB 1RUAH 3UPRA 3GEWB 2F8OA 3WNMA 1W0WA 1JGLL 4M7KH 3O3DA 3L6FB 1UACH 3PWPA 1JF6A 2R2EA 1SVZA 1Q38A 1UYWH 2VDRH 1KT2B 5INCA 5TE7H 5K9OB 4FQ2H 4K7PL 1TQBC 1JNJA 5EC1B 5C0CD 1XF4A 4QO1A 4A6YH 1QFWM 3QDJE 25C8L 4WFEE 4B5EA 5KSBF 3P9MA 4KUCD 4Q9RH 4MAYB 1AXTL 1BD2A 4FXKB 5JZ7C 1CD0A 4M6MH 4QRSA 1A4KA 3RNQB 2UWEE 2NXYD 2GJ6B 1TZHA 1SJXA 3LKQA 5D70L 1FN4A 4H1LH 4W68A 4LLYA 3MRGA 1NSNH 2UZXB 1MCFA 2OBGA 3BZEB 4P2CG 1KUMA 1DCLA 3QUZB 3LB6C 3L5XL 4XNZC 1MCKA 3MV7D 1GZPB 3LH2H 3AAZA 3HE7B 1IEAA 4Z95L 1B9ZA 4HWEH 3VI4F 3JWDH 1MHEB 3PP4H 4Y19E 1UM5L 3CC5A 4G7VL 4Y4HA 3FZUC 5AUMA 1U8NA 1DQMH 5L2KD 2RHEA 4C83B 5DK3A 3S4SB 5FA3A 5GGQL 1LO0H 5L7XL 4NRXA 5HHMD 1MI5E 4PGJA 1L0QA 1P69B 4L1DA 1XCTA 3E2HB 4JKWA 1X5YA 4XNQB 3ZKQD 1OWRM 3QHZL 5L9DH 2CRIA 2NX5E 3D18B 3PF2A 1K4DA 2OXHA 1QFWI 4P5TA 3MMEA 4L9DA 2YSSA 5ESAA 2VSCA 4CU6A 1ZHLB 1FE8L 4PJ9A 5DO2C 3SDDB 3V4VH 3CU7A 1CLCA 5DMKB 1QLRB 4U6VL 5I16B 5DRZA 1LP9B 3HI1A 1YN6A 1H8SA 1VADB 3FN3A 3MRPB 1QR4A 4HJ0C 4N68A 4U6HB 4CN1A 5GGUA 4LCCC 4XZUA 2R2HA 5CEXB 5C0BB 4GKZA 4Q2ZA 4ONFL 1AXTH 5SV4A 2IAMB 2E9IA 3C09B 3VXSD 1ZLWK 1MUJA 3A6CL 4NZTH 4NKMB 4ZAKC 4RA3A 3O2DL 1EGJA 1MJUL 2B5IB 5ACMA 5L7XH 3S35L 4LRNL 1YEHH 4MQXD 1IQWL 1MCQA 3SDCB 2HJKB 1A6VH 3QIBD 4MNQB 4Y2DB 4MJIE 1JVKA 5C09E 1IM9A 3JWOH 1L7TH 2NYYC 1I9JH 3MUY1 5JIPA 5L0QC 2BXYA 3DVNA 1YUHB 1IAIM 4GAGH 4GXUM 2YUXA 2YKLL 4NUGH 1FZJA 3AS1A 1MQKH 4X4XA 1KFAH 5FK9B 1KYOK 3RX7A 3ULVL 4ODHH 3P4OA 4JJ5A 2QEJA 2O61B 5J13B 2CKBA 2WNGA 5FFLA 4X9HA 5MENE 4BSWA 2WUCL 1AC6A 5D7JB 1JPTL 4PB0H 5MI0B 1XFPA 3C6LC 3MV8D 1RUPL 5JPMB 3T0WA 4R0LA 5EU3B 5ENWA 4PLJC 4OM1L 3GMNA 5FYJH 1DUZA 2JLLA 5D2LB 2YPVL 3WO4B 5HYJA 1EUTA 5SWSB 1SJVA 4L9LC 3D0VA 3OB0K 4HUVB 3M1BB 3UC0L 5JW5A 5C07D 1BAFH 3RKPA 4L3CA 1XIWC 4YHNB 2ZG3A 5ALBL 2I9LB 3UTTB 3RVXD 4JDZB 1F4XH 1T6WA 1E4KA 1N6QH 5CGTA 5FB8A 3MLXL 4YDJB 4N8VG 5IWLA 5EIQA 1UEYA 4K55A 1JGVH 4Q97A 1M71A 4OZGF 1OGTA 2EYTA 4S2SA 1WEJL 1V7ML 4XPFH 2C1OA 1A6UL 1RUQL 4MDIA 4JVPA 4V1DB 1HH9A 4P5MA 1R3KA 5CWSB 2YC1A 1UVQA 4IRJC 4BUHA 4Y4FA 2FZ3A 1BEYH 4YIQA 1OAKL 1S7RA 2AAVA 3ZKNC 4LP5A 1H3PH 1ZLWH 1JL8A 2ERJC 4F15B 2ESVB 3ALXA 5H94A 1CL7L 4F9LA 3OTTA 1JGDB 4J3TA 5BS0A 1Y6MR 2EC9U 4L3AA 5FHBH 2DOCA 3WLWD 4OLZL 2G2RA 1BECA 2FH8A 2R2HB 3MV9A 4WI6A 1U93B 2F19H 3VFGH 5K9JH 4Z77B 3VGHA 3KPSA 4UBDC 4DKEL 4LLVB 3TT1H 4O9HL 1EV2E 4HWZA 3AREB 1VB9A 2NXYB 5JXEA 4L5FL 1OSPL 1U3HD 2EE3A 3VRLE 5I6XB 4OZFA 1MRFL 4DVBA 4JFHE 3HG1E 4UZGA 5EC2A 1ZHBA 2VXTL 4PJAA 2BVQB 5C0CE 1RIVH 2FR4B 4P46B 4PV9B 1MRCL 1UH3A 4QRPE 1DVFC 2CUMA 4E9LA 4MX7A 1IEBB 3D25A 5KOVC 1BJ1H 3GNMH 4LVOC 4MJ6A 5MEOA 1H3UA 3JWOL 1EO8H 5F6IC 1HI6A 2GJJA 3C5ZA 2AABL 1HZHL 2GTZA 1P6AB 5CLTA 2I07B 4F80A 2VZTA 1OL0A 1UH2A 4M7LL 5CJ5A 4OJFL 4I2XE 5FGCE 1L0XA 4U33A 1HHKA 2DJ4A 3TO2B 4NNPL 4NBXB 5ACLA 3T0DA 4PTUB 3N9GL 3BGFB 5CJ8A 3QUKB 2R0LH 5J1AB 4N5UA 4U1MB 3MV8A 2ESVD 3T0BA 5F7EL 1G0YR 4OTXH 4P49A 2XIDA 4XTRD 4LLUA 1DL7H 4HMCA 4XNMB 1M7IB 4X80L 4PJXA 3KNBA 1IRAY 4PTTB 5GRXG 1IFHH 3TO4D 1BVKB 3REVA 3KPMA 5C0AB 5J0BA 2A0LC 1U91A 3RAJL 1UACL 3QHFL 3NAAH 4JE4B 5ADPH 4OT1L 5TF0A 3U36B 4BZ2L 3MYJA 4M48H 4JO4L 2WWKT 3EJJX 4ZPVA 3VXOA 2LFGA 1BBDH 4Z7WA 1XGQB 2M26A 3QHZH 3BESR 4BQBA 1LD9A 2ZJSL 3MGTB 5HD8C 3VDBA 1MOEA 3HB3C 3MRQA 3O9WA 3KHQA 3JBG7 5DEFA 2PCPB 5HGAA 4XH2B 3SQBA 1T1XB 4WW2A 5JDSB 4EBQL 1A0QL 1CGWA 1NGWB 4HWBA 4LARL 3T65B 4Y8AA 4C56A 4NQVB 2C1PB 2MJWA 4J4PC 2ORBL 4MB5A 3BI9X 3O0RH 1RQ5A 1CGSH 3VW3H 3N85H 5B8CA 2XA3A 3HC3H 1FYTE 5HGHA 2CDEA 1DVFB 3V7AE 2NQCA 1KIPB 2FJGB 5KVGL 5F71A 1H9VA 4LLQB 4KGJA 1LO5B 4XPHL 5A3IC 5GGUB 5F6IB 3KPSD 3LDBC 4M6OH 1J10A 3EYVA 4YDIH 1RIHH 3NVQA 4CKVX 5IFAL 4GOSA 4N8VA 3WKMH 2XQBL 2VXTH 3K2UH 4OIIH 5J6HB 1A6WL 5KZCB 4ODVH 5EOCJ 3QUYB 3V52L 3HE7D 1SY6H 4RCAA 1G7IB 4DEPC 2PO6D 4F8TA 4FXGB 2CGRH 3INUL 2IPTL 5C6WH 3MV7E 4YHML 1R3HA 4H1LG 3C87A 3RWJA 3VRLF 4XNUH 3ULVH 4OZIE 1OM3H 2X1PA 4LBEA 4RAUB 3H2WA 1I9RH 1HINH 5ETUB 3UTZB 3K4AA 1FVEB 1VPOH 2K7PA 3CZFA 2YD6A 5E4EC 1T66C 5D71H 5E8NB 1D7FA 3DECA 2XWBA 2R8SL 2EE6A 4Y5YA 4FQ1H 3AU1A 4LCYB 3HRZB 1UWGH 1LO5A 4IRZL 2MCPL 3U7WL 1CD1B 3CVHL 4FS0A 4BUGA 5HYQA 1BPVA 2YSSB 2MCG1 3HAEB 2YN3A 4I3SL 4TUKL 5IP4A 3ZTNH 2WWMD 3ZT5A 2EDQA 2H2SD 4G6KL 2GJZA 3DROB 2V7NA 4KK9C 4ZUWA 5I19H 5EIIB 4GAYB 2OMNA 3NIFF 3ET9F 2WLZA 5C07A 3SQOH 1KLUB 1C08B 4HG4K 1P5UA 4KRPC 1U8PA 3QYCA 3BEVB 2QADB 4H26B 1I3RB 4PRHE 3HMWH 4ZXBA 4HS6A 4OF3A 4TULL 3MNWA 5F1NA 5C0DB 3EDDA 4U7SA 4E41D 2XKUA 3FRPA 1I85A 3M1BA 3BWUC 1MAKA 1D6VH 2A6KB 4XPHH 2ZCHH 1A6AA 3RWEA 2DMBA 3MUHL 3QJFA 2EDOA 1OT1A 3DO7A 1YEGH 3GRWH 3O3DB 4YX2H 2DKUA 4D9QE 1CZ8H 2CJUH 2B4CH 2JCCB 2VITB 1LK2A 1I8MB 4QHKI 4RAHA 2K7QA 1JNNL 5IB1B 5GS2D 4V1DD 1R5WB 2BSTB 5FYKH 3NCCB 3VXRD 2F5BL 4PP2B 5FHAL 1HNFA 3F12A 1JWSB 1MFCL 2WW8A 3EIFA 3PIQA 1WFUA 1N8ZA 3U9PL 2BMKB 3FQWB 43C9A 1IC7H 3X3GH 4LLMA 4RMWA 4P59L 3D2UA 3OR7A 2D7NA 4BFGA 2FO4B 2MPAL 2G60L 4WO4A 1WV7T 3QEGH 4Y5XA 4I5BA 5BQ7A 2YUVA 3RWGB 1YC8A 1C5DA 2P42B 3TPUA 1E4JA 2Z31C 4NKMA 1QRND 4P2RA 5I1AA 3UZVB 4NKDA 1RZJH 4FABL 4LSTH 4HGMA 1YJDH 1UZ6F 3QUML 5H37H 2B8OT 1H8NA 2I07A 5K9JL 5E6IB 2IGFH 3K1DA 4Y89A 2EXWC 3FRUB 5EBWB 2C3HA 5J4MA 2IMNA 5HVFB 3GUTB 4KPHH 3QEQB 3OG6B 3B5HA 3DTXA 5DJ8B 5FUCC 1RSFA 5CHNA 2X4RB 4R7DB 5DTFA 3OKNB 5ERWA 3TBVB 2P7TB 4I18A 3OKMA 1A7NH 5E6IA 4G6ML 4NNYA 1UA6H 4JO2H 1JGDA 4KTEH 3G6DL 4N9GB 3PWPE 1MREL 1P6FA 4PGDB 1A7RH 1OGAA 4QRRA 1A22B 2XZQL 3KPNA 2NTFB 1WCBA 5SX5H 3MOAL 4PJ8A 5J6HA 2UWEF 4GQ9L 4X5XB 5C1MB 3V7MA 1G9MC 5CEYB 5DD1H 3B3IB 4KKBD 2DTMH 2Y5TB 3LAFA 3GIVB 4MCYA 1HZHH 3BZ4B 1RMFH 1M7DB 3VWJD 5FA4B 5TDNB 3BAEH 5B38B 4RISL 4ZYKA 2IPKA 4NZRH 4D3CH 5DFWH 3IKKA 2OJZL 1CE1H 2Y06L 4Y4HB 2KQMA 3NCJL 1UXSB 1ZK9A 5ICYA 2FIKB 3UYOD 1MCCA 3QUMH 4CN4A 4DVRL 4Q9QL 4M03A 8FABA 4GAFB 1PKOA 3GHBH 2V17H 3L3JA 4WO4D 1GOFA 3IDNA 2XZCL 1H5BC 2RCSH 3G04A 3TN0B 3X17A 4G42B 3QXUA 1OAYL 2X4TB 5I8KL 4N0FB 3H9ZA 5IEHB 1MHPH 1T89A 1CT8A 3VGGA 1WBZA 1BBDL 2I5YL 2AXGB 2VOTA 4XAWH 4KTDL 4QXUL 4DN4H 2A6IB 3RFZC 5ISZD 1DEEB 3W11C 4KFZC 1IGCL 3QXDA 3RAJH 4GRMB 2E7LA 2IGFL 4PGEB 2XN9D 3L9RB 4EOWH 5H8DA 3VFPA 5F7FA 3ZSSA 1CF8H 1HKLH 3A67H 1A4JA 5HHVH 2YPKA 3MRJB 4HLZH 4MJ4A 4IDLA 1FJ1A 2CK0L 4HWNA 2F5AL 3P4LA 1ITBB 2EYRB 1KCSH 4TVPH 3ZDYE 4Y88A 4R96A 4M5ZL 1GGBH 3MRDB 3QO0A 5EUOE 4IRJA 3THML 4AIXA 5L2KB 4U7KA 3GGWB 1TETH 2C7UA 2E9JA 2VLKD 2BK8A 5HHPA 4PRNA 2FCBA 2QSCL 2AXJA 1I9IL 1NAMA 2H32B 3STZB 4F7CA 3MV7B 4NC1C 1WQVT 3NIDE 3BVNB 3I3DA 4QRTB 1A1MA 1KPRB 5BJTB 4XMPH 4OLYH 2ZUWA 1RUAL 4UI2A 3QFDA 1ZVSA 2YA2A 2Z92B 5IBUB 3VXSE 4R8WL 4WEMB 3OXSA 4PJHF 5IQ9B 3PQYD 3RL2B 1V3KA 4K7PY 3DETD 3DHMA 5ICZB 1J18A 4JY4B 4GMTH 2M8XA 2VLME 3RBSA 4Z0XA 1I1YB 5T3XE 2NTSP 3Q6FA 1MY7A 3DXAB 3TV3L 3MPCA 5BW7A 4LLAA 3HS0A 4MNQA 3BKJL 4GAJH 4YQXH 4CW1B 1WUNT 4KHXH 4RGNB 1KIRB 3INUH 1RK1A 2EKSA 3PP3K 5TPWH 4L8SB 1SY6L 1KTDA 3F58L 5ECJE 4YFEA 2DQFB 4YHPB 3CX5K 2F58L 3IDMA 1C12A 2BNRA 2AEQH 1TVHA 3SE3A 5C6PB 3PABA 4HZLA 4XVSL 5K59E 3K2MC 4N90E 4KHTH 4ZOBA 3RUGE 5J6GA 4HUUA 5EORH 1ZGLB 5GGTA 4MAUH 3UYPA 5F7DB 2DQTL 1S7TA 3IU3B 3WV0A 1IGYA 2APFA 1QNZL 2FECL 3RVWD 1XF2A 1D9KA 4RISH 5FKPA 3VDAA 4F57L 5L88L 3RVUD 3PNWA 2Z35A 1E6OL 1J9CT 1RPQA 4PRPE 2AEWA 4HCRL 4UILH 1OW0A 5HYJD 3P4NB 3CXDH 2EE9A 3C08H 3BSZL 1G84A 3JV4A 1W0YT 1NCWH 1PY4A 4JZOB 4GQPH 3EHBD 4GS7B 3MYJB 2UUDH 2PNDA 2FZ3B 1NC4B 3TZVD 3TJEL 3VXOB 1JJUA 2AKRA 3H6JA 3QBTB 4ZOAA 1YY8B 5DYOA 1J87A 5C0JA 2HKFH 3MGOB 5C0IA 3DV4A 4OIBA 4U1JA 3UDWC 3A6BH 2FEEI 4OBSA 1S7XB 1X6NA 1BD2B 4FXKA 5KAQF 3S36L 5FGSA 5DJAA 3REVB 1FG2A 2R0LL 4OKVB 5SWSD 1F11B 3R1GL 4Z9KB 3GZKA 2I26N 1VA9A 2PKDA 4OD1L 3VFRB 2W65A 4HZAA 4XCYA 3TT3L 1AY1L 4EVNB 3QIUB 4BH7B 4MXQD 1KLGB 3T09A 1UWXH 3O2DH 1QSEB 1XGRB 2P1YA 2V9QA 5T1LB 2XY2A 1ZMYA 1QSFB 4G8GB 1QBML 3STLA 1SEQL 4LCCB 4L4TB 3RGHA 4RRPG 1QPPA 1DEEA 1JBJA 4U1GB 3OAYK 1UB5B 2HYMA 4HIEA 4XNYL 4RBPH 1F58L 5HDQL 1UEMA 4GG6A 5C0FA 3LV3A 4ZAKB 2CK2A 3EYOA 5DC0A 4MNGE 5CJQL 1YJDL 1BOGB 4F58H 2VC2L 5MEOB 4X98B 5DUBB 4G42A 4X80H 2D31A 4RGOL 4OKVA 3AS0A 4Z7QF 3S3JA 4HBCL 2AERT 2MHAB 3TIDA 1ZHBB 4OQ1A 4PJAB 4H88H 5HHQB 1DLFL 3BRFA 4Y0GA 2NY3B 3OR6B 4QHNB 4J3XA 1IC7L 1X5KA 2KKQA 2W91A 4XC3L 1AGFB 4P59H 4QXTB 2YA0A 3ME0A 5T3XL 1AY1H 1YECH 2BXZA 3S34L 4MCYB 8CGTA 5CCKL 2FATH 1N5YL 3QCVL 3K74B 2ZCKH 2AJYH 2SEBA 4IM8A 3TNNA 2PR4L 1IFHL 5IB5A 1HCVA 2HJKA 2FSEB 6FABH 4U3HA 3QQ3A 4O00A 3NH7H 4XWOC 4OFDA 4JCMA 3O2VL 4U1NA 2J4WH 4HGWB 3TYGH 2CIIB 1IAMA 4JHAL 4UBDD 1D5MB 3MJGX 1MHCB 4W6YB 5F70A 4FXGA 4N1HB 5J1SC 1F4HA 5KJRL 3GSNA 5C07E 5GGRB 1LEKB 2PW2A 2X4UB 1Q0YL 5D7KE 1AIFB 1FAIL 4OZHF 4YGVA 3WNKA 1PQZA 1NCDH 1ZHNA 1MH5B 2PW1A 4M1DH 3D39E 2KQNA 3ARGC 3LS4H 1FNSL 2FJFB 3BZDA 4U2YA 3G08A 2Q1EA 4LF3B 5CILH 4P2RB 3PABB 1G9NC 1GGTA 2P5WA 3TBYB 1GIGL 2V2WA 1C5DB 2EYTB 3C6LA 4YDIL 4JQIH 5DJ0B 1GL4B 3OPZL 1DBJH 2B7DT 2GSGB 1CXKA 5E0QA 4UT7L 3C2SA 4HKBB 1J0IA 3VD4A 2E8ZA 1OVZA 4YNYB 5CBAA 1NCBL 2AJSL 4HGKC 3NACH 4CW1A 1Z2KA 5L8KB 1KLFA 4TSCL 2CO7B 4XMKL 1JYVA 3QZWG 2M1KA 4JRWA 5FUCE 2R23A 1U8MB 3F7RA 4IRJD 2HRPH 3MFFB 4KQ3L 3CVIL 4PV8A 4CMHB 1VFAA 1NC2D 1CDYA 4FP8L 1NFDA 3ZKND 4F7MB 4L4TA 3DXAE 1RZIA 2CLZB 3IFPA 5E8DH 1TJHL 3GSVB 4K9EH 3WFBL 4FQLL 2Z92A 4FQHB 4YZFE 3T0EA 2V7HA 3SGEI 1PD6A 5LGKA 4HC1A 4KZDL 4TVPL 2W0FA 1NDGA 1UCBL 3CVHH 1YPZF 3PGCA 4MAYD 4HULB 5J56B 4R8WH 1JHTB 3ZL4H 1S7WA 1FG2B 4HXAL 5T1LD 4KROC 2HLAA 5D1XA 2ZKHH 4YBQC 3GHEL 4PGCA 1FO0A 5SX5K 3M8OH 1A9EB 4I48A 4NN5C 4X0KB 1VEMA 3BDYH 2K9UA 2WUBH 1WIOA 2P8MA 1ZT1A 3QZWB 4IRZH 3JV6A 1KIQB 2Z91B 5FM4A 4QHUB 2KUTA 3B9DA 4NP4H 2WBJA 1MIMH 1KTKE 1FH5L 4M5ZH 1QBAA 1W2KT 4GLRI 4IHOA 4UIMB 4KJPD 1NJ9A 1A2YA 3GI8L 4X6CE 3FO0H 1CD1A 3ARBC 1J0YA 3QXAA 1UJ3B 1X5GA 3TO2A 1FVCB 2CDFA 1DQDH 1F8TL 3KPPA 4Z7QE 5GS0C 4S1SH 3U2SB 4JFYA 1T3FB 4X6DB 4EZMA 4F33B 4I4WB 3SO3C 3VG0H 1LEGA 1WTLA 3HE6B 3ARPA 2IEPA 1YNTB 4E41E 3VGAC 4ODTL 4ZNEE 4LSPH 2OSLA 2NW2A 1DANU 4BFEA 3C9NA 1YYML 1S7UA 1VADA 3SDYH 4MCZA 3SDAD 5JHDB 5IVOA 5F7WC 1YY9C 5I74B 2Q76B 2NZ9C 2OYPA 4A2LA 1AGCB 2O5ZH 2JIXA 3IGAB 5ALCL 4RFOH 1MFBL 3HKFA 4MAUL 3QQ3B 2FECI 1T2JA 3WDJA 1L6XA 2VUOA 3MLZL 1U42A 4N0YL 3L5WB 1G6RL 3CNKA 5DGRA 5IB2B 3QEHA 3GSWB 4CVZB 1IAIH 5DMGC 3NA4A 4NZRL 3JSSA 4PRBB 1XIWA 2XA8L 2AV1A 4OCXH 2Q8AL 3TVMD 4Y2OA 5GGRA 3IJHB 3S88H 3MRNB 5HHQA 3RWHA 1E4KC 1OLZA 3JTTA 1I8IB 1WT5A 5E6ZA 3R06B 4BZ2H 3CC5B 4KQ4H 3VE0B 3VWJC 5F8RC 1AXSA 1MF2L 2BVPA 3LSOB 2C4FU 3C5SB 3PV6A 3QFJB 1J11A 2H26B 1T1WA 4JRXE 3G5VB 2R29L 1NMAH 4YC2B 3A6BL 3ZE0F 3BP4B 2RB8A 4F2MA 1C8PA 5FF6A 1A9BB 2FLRT 3IXTB 5E9DD 5HGDA 3TIEB 2D3VA 2KZWA 2E7HA 1AJ7L 5JW4Q 1FFNB 1AD9B 3KPSE 1N59B 4UOW0 2NYYD 3OKEB 4J6RL 4HC1L 3L3DA 4P4RA 1RUKH 4G6JH 1FCCA 4UAOB 3T08A 4ZPTB 3V0WH 1ZA3B 4PJGA 3G6AB 1VACA 4OGZA 4RGOH 3LKNA 2OI9B 5D1XD 25C8H 2VC2H 1BM3H 5E1AA 3QUYC 1K3ZA 1OTTC 4M7ZB 4YDKL 3EOBB 1JHKL 5C0RL 4RFEA 1OP3H 1EO7A 4DKFL 4MXWH 2QKIA 3MRRA 4PLJD 3CFJA 5CSZB 1HOCA 5IB4A 4FTVB 4YAQB 2VAAB 1AKJB 2D0HA 5C3LD 4UNVA 3HZKB 1QSEA 3ZZ1A 4I0CC 3WHE0 3LRSB 2P44B 2DKMA 1PEZA 2E7BA 2HWZL 3C5JB 3OKKB 4BM7A 3PWPD 4X99B 2ITDB 4UIKL 1UXSA 4JCLA 3RL1A 1S9XB 1D5ZA 1MFNA 1I9RL 3EJZD 1IM3B 2CQVA 3WUWG 1NCAL 1DQLL 3DV4B 3UJJH 3HI5L 1JPST 3LEYH 2B1HL 3QPQD 2C3WA 4K3JH 1OF2B 1CD8A 1J1PL 3ZDXE 2R8SH 4XP1H 4GBXC 4M6ML 5FUZL 3F58H 2N7AA 3OJ2C 3TH2T 1V5JA 5AYUH 3V5DB 3EO9H 1ZEAH 4KMQA 3U30C 3IDMB 3BJ91 4TRPH 3RPIA 1FNGA 1C7TA 4ETYA 2XZAL 1HSAB 4WI7A 4PRHA 5D4QA 1BLNA 4QYOB 5IBLC 3HTLX 4MS8D 2VXUH 2DBJA 1F97A 4PRAB 3OPZH 2DQJL 4G8EA 1MJUH 3GFUA 4EXPX 3V79C 1NGYA 2QADC 3HLAA 2HP4A 1BJ8A 1NBQA 1UWEH 4PJ5D 5FKPB 4L29B 5HDLA 3LPWA 3HRPA 2XOTA 2P5EB 4WWKA 2H41A 4PBXA 3VH8G 3BP7A 2Z9TA 2LVEA 3LCYA 4PRAA 1HHIB 4YHLH 5I1IH 3RHWF 1NEZG 2W60B 5E08L 1OCWL 3HZMA 5J3HD 3L7FB 3TZVA 5DJ2A 3WFHB 1WZLA 4FQXC 4HIXL 3OB8A 4KK6D 4POUB 3ZKMD 1G7IA 3ILQC 2DYPA 3VXUA 2OQJA 1ZVSB 5DMJB 5HD8D 1RZFL 2BVYA 2WIMA 2HH0H 4MGXA 1J5OH 2F15A 2E3VA 2EECA 2H32H 3HPJA 4G43A 1JNHB 1BJ1J 1ZE3C 2Y9RT 3MSPA 5HPMB 2RFXB 4X4YA 4WI3A 4Z7NF 2B1AH 4H0IA 5CJXC 3RIAK 3PHQB 3ZYZA 5HYIA 1J1XL 4P9HL 3C60C 1OP3K 3W0WE 4J4PD 3TCLB 4JO4H 2ZPKL 1QOKA 4ODSL 5TGBB 4Z0BL 3WFBH 2P5EE 3KYOB 4JFPA 5DUBA 4L8DA 5FYLL 4NBZB 4PUBL 5CEZH 2D31B 5DJ6B 1HE7A 3DRQB 4P9HC 5I8CB 4QWWD 4JR9H 4EKXA 1DQJA 1H3GA 1KPRA 4QRQA 5D7LB 1MJ8H 1T1ZB 5ID1B 5A3ID 2MQCA 5C09A 4FTVA 3CUPB 1JMZA 3IXAB 4KPHL 2C3XA 4NQCD 1J05B 4NQUA 3JWOC 3LRSA 1S78C 4HIEB 4G9FE 2CD0A 3G5XB 4O51A 5EOTB 4D0BB 3PGDB 3ULUC 3HZKA 4P5TC 5FO9B 5C71A 3HG1A 1MQKL 1UT9A 3DIFB 4OGAC 3H9HB 2BSRB 3KPLB 3G6AA 5A2JH 3MODL 1XR8A 4P4KB 3O8XD 4OV6F 3BZFB 3MLRL 5D7IF 3G6DH 3WXVH 4CNIB 3QIWD 1ZVHA 35C8H 4IMKC 4YE4H 3HCVA 2YUZA 4I0KA 4PJBA 4K7PH 1K2DA 4AT6B 5FKAA 3RVXC 2EDNA 1IJ9A 3V8CA 1S9VA 1YEEH 1D9KD 5ALCH 4PJIE 3BP4A 2DDQH 5I30L 2CPCA 2R15A 1Q94A 4QRPB 3L3DB 4NJ9H 5F7HA 3QRGL 4WEBH 1UKQA 4EUPB 1EEQA 1YMME 5J1TC 2VQ1B 1A7NL 3JUYA 5IMKA 3UROR 1KOAA 3MJ9L 1P1ZB 2J4WL 3QWRA 3C5SA 3KR3H 2AV7A 4Z76B 3CFBA 5E56A 1CU4H 1BHGA 5KSUA 4XPGH 5DJ0A 2ZZUT 1B0WA 1CIDA 5DQDH 3CK0H 3LHPL 2Z0BA 4YHYC 3NCMA 3H9SD 3QDGB 4GG6E 3IKCA 3UTSB 3E6FA 5FYLH 1WEJH 1AHWB 4HUXA 4LLDB 3TN0C 1P2CA 3QDMD 5D72L 3EZ8A 4I9WE 4LDEB 4ZS6C 1OQXA 2IANB 2IPTH 3HR5A 4H8WL 5H35B 4F37K 4P23D 3NTCH 5LG1A 1F3DJ 2E6JA 5IJVA 2XNAA 2VYRE 4QEGA 4YHLL 5I1IL 4A6YB 1NBZB 1DLFH 4KU1A 2NY3D 5IBTH 1A5FL 2EYSA 5EC2B 4OF5A 4F7TA 5D7SH 2GT9A 2IADB 3DGCR 1FO0L 1U58A 2BP3A 4WU5A 4HUWB 2XQBH 4R0LC 3B9VA 3KPQB 1BEYL 1MFBH 1JGEB 5EZJB 2CSPA 4YHPA 3NCBB 2IFFH 2VERN 3DRTA 2NXZC 5DRXB 4IOIB 5I9QB 4OZIA 1URLA 5IEKB 4WNQB 2AV7B 4QNPF 2BNUB 1Z9OA 3L5WA 4ZSOB 2QHRL 5T3ZD 2J1KA 1MRDH 5D9SA 4F7EB 2EDLA 2W9EH 3OX8B 5C0CA 1DVFD 3MGAA 3IRPX 3QEQD 2IMMA 4HK0A 2HTKC 2YWYA 4Z0XB 4M00A 1A1NB 3G5YB 2J2ZA 2WM0A 2VLJA 5F44A 5DT1H 2NNAA 4KHXL 4PJCA 2YMXL 1YNLH 4PR5A 4F7PA 3P2TA 3TZVC 4LDLB 2HFFB 3AUVA 2AXHA 1LDPL 2VAJA 2GKIA 2YRLA 2ESVE 1QFHA 4AIZA 4LGSB 4ELMB 4MZ2A 5D2NA 4LVNB 2PETA 4BH8A 1AGBB 1FL3A 5D6CA 1LE9B 4IIQC 5TDOA 3I75B 4NQDA 1P4LA 1A3RH 1IGJA 3VFVA 2R56L 4Y4FC 1X5HA 3V6FB 4P2YA 3T8XA 5CP3H 2D7MA 3KWWB 4UT7H 3ROLA 1NBYB 5L2KA 3ARUA 3BGAA 3WNOA 5HHME 1YEHL 2VLRD 2PO6A 4KKLD 2P47B 3SDAB 4XBPB 5IR1A 1U8LB 4YDLB 4TQEH 3X13A 1U8PB 4U1SA 1C08A 1TLKA 1F6AB 4QRQB 1T22A 35C8L 3WJJA 3ZHLA 1S9WB 4OSUH 4U7MA 3BWAA 4UTBL 3GSUB 1JTOA 4CJ0A 3RWFA 4NM4H 4P2QE 3RZCB 1EEYB 3CLFL 3GSQB 5BW7C 4GRWB 3RVWC 2E7CA 2FX8H 1GJIA 1AGEA 4E42B 1RZGB 1LDPH 4NQEA 4NQDB 2EDDA 5F9JA 4GMSH 1DFBL 1AGBA 4NUGL 3RZCD 3KPOB 2LTQB 4U1JB 1CCZA 4UV7L 1OB1B 5SX4I 1I1AB 15C8H 4P2QD 5LCVH 1RJLA 5DUML 3SE3C 5F1SA 5C2BH 1ZTXL 3GMMB 4JPIB 4WRLA 5IR1B 5E70A 2V6HA 1T4KB 4IMKA 5IMOA 5J13C 3T2QA 2HN7A 1ZT4B 4LSRH 3VXSA 2KL6A 2GCYB 3OKYA 3FFCE 4OT1H 3KPRE 2QJDA 4YXHL 5MI0C 2J8UF 5I1GL 2RFXA 1KN4L 4IRSB 4Y2DA 1QYGL 4LCYA 1JNHA 1LEIA 3ARDC 4G5ZH 3IDIB 5DC4B 2ADFH 4YK4B 5EOQL 3MJ7A 1P9MC 4X4MA 4O2FA 3NCJH 3SE4C 3PWNA 1I1YA 3O4LD 2NY6C 1TTGA 1DBAH 3CLEH 5EU6E 3TZVB 3BKCH 3WFHA 5ANMB 3UYRL 2PYEB 3KG5A 2VXSH 1KEML 5EA0L 4WU7B 1J5OL 2R0WH 4BK4A 5IB3B 4O5LH 4NDMA 4XXDB 3L95B 4LVNC 1MNUL 5DMGD 5IJVB 4R7NB 1QBLL 3G5YA 1IVLA 2BHUA 5D70H 4L4VE 1H3XA 1GOGA 2P48B 5D93B 4G8EB 4X6CA 4LEOB 2Q3AA 3QEQA 1ZHKA 3P30H 2IPUK 3LKPA 3O11A 2XZZA 1CL7H 4IRSA 1C16A 4XT1C 3WKML 1S7VA 1F4WH 4Y7MA 3LH2L 2W59A 3RY6A 1AQKH 2HVKA 4KKBC 4E41B 2HMIC 3OR6A 4QHNA 3QNZB 2WBKA 4Z78B 3FQUA 3GM8A 3V2AR 4EIGB 4G6JL 3QPXH 4LAQL 2HH0L 1D3CA 2NXZB 2P24A 2Q3ZA 5D1QD 5DRNB 1EHNA 1OP9A 2P8PA 2AEPH 4H1LB 2X1OA 4YBLC 3X3FL 2I9TB 1NLDL 1SBSL 2BVUA 2YD9A 5MHSE 4P57B 4P23B 2MFNA 3DX7A 1OSPH 4JM2B 4M02A 3RWDB 4AMKL 4EUPH 3E6FB 4PJIB 2R1XB 4QRTA 1BVKA 4OCMC 5EB9A 2DL9A 3QDGD 5FGBA 4R97B 4C83A 1G6RH 3GMNB 4O2EB 4WCYH 2A83B 5AZ2H 1SVCP 3V9FA 2IBZX 1FYTB 3CFCL 4KUCF 4PJ9D 2ATKB 43CAB 1UADC 4P2OD 5GRUL 5IEHA 1ES0B 3MRGB 1F4YH 3LKOB 3EYOB 3IDXH 3ROOB 4EI5B 4HV8B 2LQRA 1RZKL 1HIMH 4P48A 1U3ZA 3VFPB 2R1YA 4OLYL 1GC1L 2DQTH 5F8QC 2GUOB 4V2BA 4G8GA 1QSFA 4UV7H 3MLYH 3STLB 3IDGB 2Q86A 1QBLH 2VMFA 4ZXBD 1FZMA 4O58H 3ZO0A 5TF1L 4GW4B 1FNHA 4Y1AA 4MAYA 4HSQA 2BVOB 3FT4A 5F3HB 5IGXH 4QRUB 5EPMB 5SWZE 2X1WL 2BZDA 5IW3A 4UV4H 3VH8A 3DBXB 3IFOA 4OZIF 4LOUD 1HXMB 3KDMA 4YH6A 5GS0D 4LSVH 4UIKH 2X4TA 7FABH 1BOYA 1W72L 1IQDB 1K85A 4U2ZA 3N1FC 4NRYA 5EZLA 1NGPH 5DMIL 5JHDD 4F2MB 1MCPH 3CH1B 1RULL 5C0IB 4G80A 1UZ8A 4NSKA 3IXAA 5F6HI 5LWYH 3PDOA 3GMOA 1VFUA 2X4RA 3CUPA 4R7DA 4LRNH 3WIFB 4PJCF 2VUYA 1KCUH 2Z31D 4RBPK 5EZIH 5IKCA 2FBJH 2R2BB 2LU3A 4EN3B 1CTOA 1P4BH 4J3SA 1KEMH 4IDJH 4DOHE 1IGFH 4KQ3H 3PL6D 4NDMB 5DMKA 4L3EE 5BRZA 1FCGA 1GPOL 1XF5A 3GMPA 1YMMA 1NPUA 4JLRB 4DGIL 1R3HB 1HWHB 3CPLB 3TH3T 3TCLA 4XBGB 4E0RA 3IVKA 4K2UL 1D5BA 3BISA 3T77A 4TNVK 4JZNB 5IFJA 2J5LB 1KSRA 5GJTH 3ZTJH 3EOAA 3U6RA 1C1EH 2F58H 1ZLUK 1C16B 1V3JA 5IF0A 2AK4D 3SDDD 2EKSB 1U3HB 4KMTL 4LPCA 1ZEAL 2H1PL 2IALB 4L9LA 2FD6H 3QRFM 4OGYL 4NQCE 4HXAH 2HA1A 4PRIB 2AXFA 5T33L 2BC4A 2R56H 2DQFA 2GCYA 3T0EC 3ZKXC 4HIIB 3WUWB 1X5LA 1RZJC 4MNHB 1Q9KB 4NN7B 2R1WB 2OSLB 4HH9B 3VFTB 1P1ZA 1MWAL 4OCWH 1P5VA 1U8QA 3BYTA 1IGCH 4K23H 1BREA 3IFNL 3VJ6B 2P5ED 4OZFG 4R4BB 2C9AA 3MRCB 1FGVL 2PCPA 1H3PL 4G8IA 4D0CA 2GSIA 3MXVH 1CGSL 4F7CB 2OR7A 3VXPA 3WO4C 3OKKA 2Y4SA 5B38G 2BOBB 1ORQB 2GW5A 3AM8A 3IF1B 5FECA 3QT2A 4WW2C 3ARSA 5ADOH 5HI5C 1VKXB 3OJDA 4GXVL 4TQEL 1S9WA 5TFSH 4PLKC 4MA8H 2CUIA 1VFBB 2BHYA 3EGSB 4LKCB 3VMOA 3W39A 1JPSL 4HT1H 3T2OA 2DQEL 4I3GA 1RZ7L 1CE1L 5IB1A 4HPOH 1Z0NA 2B4CC 3I6GB 4ODUB 2VABA 5C9KA 1HDMB 1R5IA 2V7NB 3QUXC 4ZUWB 3RHWK 4OCNC 3SGJC 1E4XH 3WCYA 3OV6A 1FSKC 1ULVA 4OD2A 3P3YA 5I1JL 1YNKL 5I8OL 1TVBB 3QDHA 3L3KB 4JFXB 5I8KH 2ZSWB 4Y16A 2DDQL 3TO4A 4GKNA 4IOFD 4X7TB 2V17L 2GTWA 4XNMA 5HGBA 4NCDA 4KTDH 4R0LB 2Y36H 5LGJB 5KAQG 5MP6L 4BQCA 1AD9A 3S88L 2CLRB 5IB4B 1MCOH 1JI1A 4WY7H 3NA9H 3MXVL 4L8CB 2ZUSA 2E9WA 2WANA 8FABB 1CZ8L 2DLEA 3CJJA 4M4PA 4NC0B 1QSEE 2XTJD 1A14L 1MCRA 3ROLB 3TESA 2VLKB 3TBWB 2P5WB 3TBYA 1FNAA 3QRGH 5FYJE 5I1DA 1YJDC 2FB4L 4FQPA 3BH8B 4K23L 1VGEH 4MJ6B 1BX2A 3WIIL 4R2GD 3NCEB 4K71B 1V3MA 4ZFGH 4W4OC 3TA3B 1T83A 4TSAL 4HMEA 5GRVK 4YQXL 2G5BB 4LU5L 4K3EL 4NN7C 3FQUB 1WWAX 4FQIL 4OD3L 4ZS6D 2F54A 2NTFA 4PUBH 4YHOH 4PJGE 2ZUVA 1UCTA 4PG9B 3EDFA 4PRBA 2V2XB 3KS0J 1WZMA 3P9LB 4U6TA 1T5WA 1KPUA 5IIEB 5D2NE 2Q7YA 3TJHC 3FFDA 4LCUB 2AXFB 3B9KD 3EYQC 1DUYB 3FB7A 4ZNCD 5J3HC 3VWKB 2G2RB 1EA9C 4KK6C 3U0WL 1T1XA 4WW2B 3T1FA 4XXDA 3CU1A 3MRQB 3O9WB 3SN6N 3HE7A 2CIKB 4S0SD