1WEJL

Igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E8 ANTIBODY
publication title Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution.
pubmed doi rcsb
molecule tags Complex (antibody/electron transport)
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wejL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wejL01
5C6TH 4EBQH 4XAWL 2KUTA 1D9KC 3MV8E 2GK0A 5D93C 2BNQA 2X4SB 4K3JH 4Y8AA 4YBLB 2XZAL 1BFOB 1D3CA 5EZJA 2I26N 5FGCE 3VXNA 3ZMRA 4H0GA 2FEEI 5HYJA 1HIMH 3EBAA 4GW1A 3WHE0 4OKVA 5IVXB 5IOPB 2YPLA 3DSFL 3V6FA 4D2NA 3DO7A 4MA7L 1H3XA 3O6MH 1YEFH 4JANA 5ENWA 4WW2F 3OBAA 4ZO7A 4JREC 2NX5E 1C16B 4DN3L 1N2RB 5D2LE 1L0YA 2Q3AA 3OKLB 3WS3A 2Q76A 5HHNB 4WJ5B 1G7MB 2BZDA 4XHQA 1CXLA 3QH3B 2YN5A 3I6KB 1T7VA 1Z9MA 3Q6GH 4YHKH 4G80B 4BQCA 1CDUA 4H5SB 2ZNWA 1QSEA 5F7NC 1TZGH 1NBQA 5GIRB 5ADPL 1QVOA 2YPKB 2MCPH 1OAZH 3LZFH 3UBXA 3TN0A 1JGVH 1WBZA 3J7HA 5J12C 5A2FA 1FYTE 2X7LA 5KZCB 3H42L 4PR5B 3CVIH 4KKAD 5ERWA 1VEMA 3DRQB 5IHLB 3FOMA 5LVEA 2J8OA 2IAND 4NYLA 3BRGC 3LKSB 3WFHA 4YZFF 2K1MA 1RFDH 1JWUA 4XI5C 3GZKA 3WSQL 1F4YH 4LNRB 4OQ1A 4OB5H 1CGUA 4ZUWA 3ZKXB 3AS3A 1XMWA 3H2WA 2I24N 1ZLVH 4K3DL 2X89D 4QXTA 5F1NA 1J05B 1N7MH 4TPRL 4PY7B 3L5WA 1D5BB 1KJ3L 2B0SL 2WIIA 2W9LA 4K9EH 3O9WB 5AG9A 1A6WH 1A6ZA 1F3JB 4TSAL 1FO0A 2N7AA 5I8OL 4Z7UB 5ILTH 3V52L 2NY0C 2ZG2A 1A1NA 5D96C 3SCMA 4HS3B 2DLFL 5I18L 4LLDB 3FRUB 5J11B 4I0KA 2I60L 4OT1H 4PJIA 5T3ZD 3EGSA 1QNZH 5C0GA 1Q0YH 3ELAT 1KJ2A 1HHIB 3C5ZA 4MZ3A 1BOGB 3RY4A 4QTIH 2R69L 4JFXB 3BQUA 2EZ0D 4P3DB 3LEYH 2X40A 3QDAA 1JV5A 3OKEB 1QHOA 5DHYA 3WKMH 1E4XH 1KPRA 3Q1SL 3EJJX 1J8HB 3OJVC 1KG0B 1WEJH 4OZHA 1X5FA 5CZXC 3QXDB 4EZMA 4L29B 3L3KA 1FO0L 1XZ0A 4OLYH 1U58B 3PP4L 4ZAKA 1ZVSA 1CGVA 2ZCKH 3GI9L 4KQ3H 4AMKH 3DETD 4TVPH 3BWUC 1W8OA 3ZTNL 1BIHA 4JRYA 2ZCHH 1AFVL 1KJ2L 2Y5TB 1MFAL 1S9XA 3DECA 1PX4A 3G6JE 3ARWA 3D9AL 1C5BH 4LBEB 5DJDA 4JFEE 5BZDB 3MC0A 1DEDA 3DXAB 3T3PE 1MRFL 3QDMA 1AP2A 1IGFH 4MCZA 1KELL 4KI5F 2MQ0A 3MR9B 4PJIF 2R1WB 5F7HA 2Z92A 3C60D 4LGPB 5HPMA 4IDJL 2W65B 3WNLA 2BY0A 3X3FL 2AAVA 3GK8H 3HC3H 15C8H 1MREH 1SBBA 5TDNB 4OFYD 2BERA 5DRNA 3HE6C 3OF6D 4J2XA 1G7LA 5DJAA 4WEUD 4UV4H 1A0QL 4JFDD 4OZHF 5IVOA 5T1KA 1S7XA 2CDGB 1TCRB 4U1GB 3ESVF 5EU6E 3ARGC 3C09C 3U9UA 4OCWL 5HVHC 4QXGL 1CDBA 1MFDH 3X12B 4D0DA 1VB9A 4F2MB 4U1JA 1S7TB 4C56B 3WO4B 3RX7A 5JHLH 1QKZL 5IFJB 4O9HH 2EYTB 1EXUA 4R2GC 3EIFA 3MJ9A 4U6HA 2ZOKB 3LMJL 1WIUA 3VFNA 2MMXA 4JVWA 1DEEA 4N1EA 3DURB 1F4AA 2R1XB 2CLVA 3JZ7A 3PQYD 4H0HB 5JW4R 3EYSL 4DAGL 3ARXA 3MLSL 3C2SA 3OB0H 2V2TA 5HI5C 5A3ID 3L3HB 4GG6E 2ZUQC 4KV5E 2YOCA 5BVJB 1BJ1H 4GRLA 3VXUA 3O4LE 4LSRH 5I1GL 1EFXA 2AI0L 2OL3B 4ODSL 1U92B 4BZ2H 1KJMA 4XCFL 1CT8A 4RGNE 2H6PB 3E3QE 4ZD3H 2N4IA 3QEUB 3S96A 2GSGB 4J1UB 4X99B 5ACZB 1AQDB 3MJ9L 4HUWB 5JQHC 1IGJA 3QEQA 4LASL 4F58H 3GMRB 3TVMA 1CXFA 4IRSB 2O93L 3QNXA 1WZMA 2ATKB 4BH8A 3BD5A 4N0UB 5GGVH 5C1MB 1LEIA 2AJVL 2XKUA 4JRXD 1JHTB 1FG2B 1PZ5A 1XCQB 1BD2D 4Y89A 3BKYH 5DK0A 4D0CA 3K1DA 5ITFB 5TDPB 1RZIA 4U6YB 5IBUG 2YK1L 2X1WL 3DX8B 5D7KE 2EDKA 1MY7A 3LN5B 1NANI 4Y5VA 1AXIB 5A40E 1MAMH 1LP9E 3KPRE 2F19L 3LS4H 1Q9OA 4HUXB 4N9OB 5FO8B 4OKDA 4TUOA 1ACZA 4AEFA 4PJXA 1CS6A 4M9OA 1U3HA 4RMTA 3BEWA 4UINH 4PB0H 3KPSE 3BD4A 1C12A 4ONOA 3O45B 2JB5L 1OTSD 4JFHD 4H1LB 4X4YA 5C0CD 4X8JB 2FJGB 3QBTB 1QLFB 3H9YA 3H3BC 2P7TA 4JHAH 3RL2A 5KVFH 1JYVA 2WK2A 3OAZK 1SYSA 2BSED 3WO3B 5JXAL 2AVGA 3H9SD 4OFPA 3V5DA 4BSWA 1JUFB 4DGYH 3TA3D 5D7JC 4JM2B 3VXSB 4JZNB 4HK0A 1HINL 4YWGL 2D9CA 3GJFH 2O61A 2Y07H 1U8OA 3D25A 4I3GA 4XNXL 3TO4D 4W4NA 1KBGL 4ONHB 1U36A 1CLZL 3ZO0A 3T0VA 3NCFB 4MXQC 2V2WB 1GL4B 2IG2L 3N85H 3FCTB 2NY7H 4PV9A 4PJ5E 2PR4L 4MX7A 4DVRL 4NRYA 5HVGB 3QQ9D 3QHTC 4HGWA 2ESVB 1NJ9A 4OLZL 2BC4A 1W72B 1CGWA 2F53D 3WL9A 3BGFB 1CVRA 4G9DB 5SWZD 1SVCP 1A47A 4OLWH 3WXWH 4ZSOA 4S1RH 5IGXH 2XWTA 3VDCA 3S37H 4OGZA 3O41A 1LHZA 3QFJE 5EPMA 4U6XA 4ZNCD 3O2VL 4ODBD 2XNAA 3LQZB 1QLRA 3ZL4L 3MFGB 2PYEA 2RFXA 3E1F1 4G3YH 2YA1A 2AEQH 3O81A 4N90D 3GBNL 1SM3L 1J0JA 3DTXA 1NC2A 2VLJA 4R90L 1QPXA 4XVTH 4OFIA 2C7UA 4EQ3A 2MOVA 2VNCA 3DLQR 4QRQA 1CXKA 2NY1B 2LTQC 4YHIA 4QRRA 4NCDA 1HE7A 4Q6IB 1H8NA 3RUGA 3OX8A 3ECBA 3IJHB 3L7EA 1M6OA 4G9FA 2XPGB 3TIEA 3VWKC 5D1ZC 4UV7H 3UAJD 4X5WB 4UZGA 4P5TC 2ATPB 5MERA 3L95B 1H3PH 3GRWA 1IRAY 3SDAC 4U0QB 5HGHA 4HBCL 3QDGA 4OCSH 5EA0L 3JV6B 1ZTXL 2VQUA 2IAMA 2YKLH 2IADB 3P11H 2I9LA 5B21A 2AXHA 2DQGH 4NP4L 3T0DA 3NOIA 1Q9WB 4MNGA 2M8XA 5CHNA 4ZS7H 5C0RL 5C0EB 4XMKH 1BVZA 3CXHK 3TCLA 2PN5A 3KPMA 4AIXA 3GMQA 2CR6A 2I07B 1UM5H 4EXPX 5HHQA 3ARDA 5MEQB 5C6WH 4IBLT 5I66A 4MD4A 3MREA 3QDHA 1MVUA 4XT1C 4IRZH 1UH4A 4X6EB 2OTWB 3RWCB 3RZCB 1T03L 3DMMC 5TDOB 3V6BR 3GRWL 1A7RL 4N0CC 1CD1A 1KOAA 1JMZA 4U7MA 4M1DH 3LRGA 4L8SC 5ETUB 5CUSL 2IBZY 5FGSA 3MRNA 3QNZB 1R0AH 3RUGF 4YXKH 3MRMB 4DCQA 1MLBA 4PJ9B 5IESL 3MCG1 3BEVB 3QFDB 3WMSA 1AR1C 5ESAA 1D9KD 5TPWH 5CCKH 1DDHA 2D7TH 4ZUTB 1CFVH 2VISB 4IHOA 3IU4H 5JOFB 1AO7E 5E5MA 4BUHA 1TVDA 3K80A 3FQXB 4NQEE 3D85D 3VW3H 4NNYA 4XPFH 1KACB 5E9DD 3FO0L 4FNLH 5KJRL 5D2NE 5E2TH 4KJYB 5F44A 3W0WD 2YHGA 1OP3K 3MNVA 3AUVA 5ISZE 2F74B 3R0NA 3L3GB 5BO1L 5A2KH 4R3SB 1G1CA 3VRLE 2EIBA 2HRPL 1OSZB 3ZYJA 1OAQL 4TNVF 5HDQH 4JRWA 1AXSA 4CAGA 4L4VE 2OJEB 2BSTB 5DUPH 4OSUH 2EEBA 2CKBH 3RI5F 3VGEA 1NDMB 2OJZL 4I5BA 5EFIA 3C08L 5CEZD 1HEZB 3O3BA 3VXRA 2VB5A 4PTUB 4B7IA 4QCIA 5MEPA 1XIWC 3BYTA 3DGCR 1IMHC 1JN6B 4PUBH 3JTTA 3U36A 1AE6L 3F5WA 4CU8A 1Q72L 2VH5H 3MRRA 4E0RA 1GHFL 3OZ9L 4S1QL 5GS3A 4FMKA 1KB5H 4WO4C 4PJAE 5EZLA 3FN9A 3S3SA 1T20A 2Z0BA 2QR0A 1UKSA 3MXVL 4ZMAT 2P24A 1C08A 1RZ8A 2HLFC 5KSAB 4HFUL 4IOIB 4JQVC 1FIGH 2R4RH 5A1AA 4M48L 2Q86B 3MBEB 4M5YH 4X4ZA 4YEEA 1FRGH 4LSVH 2QHRL 2VC2L 4Z18A 4I1NB 4W81A 1L4IA 1DL7L 2Y7QA 2YPVL 1G9MC 5TGBB 5SX5H 2HVKA 2B1AH 3R4DA 5L2KA 1NEZB 1EO8L 5E00A 1OSPH 3GSWB 1DBKL 2A74B 1BFSA 3CZJA 3I84A 3O9WD 4F9LA 4N8VG 1AIFA 1NGYB 2AJSH 5EBMA 2E7LA 3RA7H 4OZIB 2ITDB 4HH9B 5GS0H 4IMKC 4FFZL 1ONQB 2A6DB 2RBLA 4PS4L 1KIUA 1HH6A 1VKXB 4UILH 3GBML 4N9GB 5H35B 5TH2A 1IL1A 4H0IA 1UXWB 1AHWA 5IQ7L 2VXTH 4QRSB 1SY6H 2FBJH 1T3FB 1HHJA 3B9VA 1ZT4A 5ADOH 3QIWA 2AKRA 3DI2B 3WIFA 4YHLL 3VFRB 3PIQA 1R5IA 2DICA 3PDOA 5GQBA 1H5BA 3ARSA 5MEOB 4LNVA 5IQ9B 2VXUH 3O6FB 4YO0A 3HNSL 4HQQH 3JWOH 2ZSWA 5JR1L 2ZUTA 1J8HD 3NIFF 3IXAA 3NCEB 1NLDH 5IEHB 4PBXA 4ALAH 4WENB 2YBRB 2FHBA 2BFVH 3NIGE 4RMSA 4Q0XH 5IHZA 1DN0B 5C8JB 3E2HC 2IH3B 1BVLA 1F4XH 2B4CC 2NY2C 5ANME 2NMSA 1QRNA 4OZGB 1YZZA 2WWKO 3BDYL 3BMVA 3D3VB 3VXOA 5JXEC 3G6AB 4QRUB 1UA6H 2D31B 4GW4A 4HWZB 5FO9B 5INCB 2PO6B 3PWJB 4Q9RH 4XPGL 5EORL 4NKOB 4PY8J 5CZXD 1UB5B 4DTGL 1BQSA 4IRJC 3LEXA 3T09A 4M4PA 4WI6A 3QUZB 5EC2B 4Z0XA 4F7EA 1RHHA 2DMBA 1AJ7L 3VFOA 1AD9A 3C6SA 3ZE1F 4XAWH 4PJHB 2IJ0C 3MGTA 1JRHI 3PGCB 1OLZA 4LLWA 5F1IB 4GAGL 4YPJA 5DGQA 3MCKB 2XZAH 4HPYL 2F54B 1KNOB 1WGOA 2AJXL 1DQMH 3GMLA 1D6EB 2X2YA 1P7KA 2ZSVA 3DSFH 3T77B 4I48B 2Y6SC 3BKJL 3ULSA 1CK0L 1T2QL 2IANE 4MA7H 5J9PB 5F8QC 4XGZA 2R0LL 2D3VA 3O8XA 4JAMA 3U6RA 3ZT7A 3W9EA 3CFEA 4DN3H 4LL9A 1HHGA 3ROOB 4C57C 2F15A 2JCCB 2W59A 3B9DA 4FXGA 2XY2A 1QR1A 1KTKE 1BBJA 4TNVK 2VDPL 3CIQA 3BWAB 1CLYL 5DQ9A 3HE6D 3EKCA 1Q0XL 3S37X 2CIIA 4XZUB 1IGTA 5ADPH 3UTSD 3RPIA 3ZE2F 4IOSD 5D4QA 3V7AE 1ZS8A 2FEDD 2GJ6A 1WFTA 2ADJA 3PWNA 4L3AA 2OK0L 2JF1A 3S35X 4RFEA 3NCYS 2IALB 1J18A 1BWWA 3U4AA 1X5ZA 2ADGB 2IQAA 3H42H 2Z31B 2FJHB 3AB0C 4OUUB 2BXYA 4R2GD 2X4UB 1BJMA 4LSPL 5T3ZE 3RGVD 4I2XE 3K3QA 2DKUA 3FT3A 1DLHB 3RDTB 3WSQH 3V7AG 3H9HA 2ICWI 3A6CL 3FB7A 5HI5D 3G9AB 3U7AA 3IFOB 5DMJB 3C87A 4K3DH 2JK5B 3C8KB 4MNHB 4TPRH 3SGDI 3HRZB 3WN5A 3BO8B 1KJ3H 1LILA 1BFOA 1GC1L 2B0SH 3NFNA 2OI9C 2JELL 3HG1D 5I9QB 5DZLA 1UWEL 3BSZL 4HGMA 1RVFL 3KXFA 1J5OL 3EOBA 1FFQA 1KV3A 5AZ2L 4HZAA 2NNAA 5IMLA 3N1MC 5I8KL 4TSAH 5I8OH 3O4OB 5D2LA 1AGCB 3OL2A 1EAPB 1OAXL 2I9TA 3UJJL 2G60L 2DLFH 3CMOH 3FT4B 5I18H 5J1TC 2DKMA 5DJYB 2I60H 3D18B 1UB6B 3OAZH 5HHNA 2NY5C 4HWNA 3DO3A 1ZT7B 4KXZH 5ESVA 2GIYA 3VD7A 3F12A 2Q7NA 1JPFA 3QH3A 5AYQA 2R69H 3GMNB 4FQ2L 1OGTB 2APXA 3GSXA 3I6KA 4WCYL 2PTVA 4X7FC 5JQ6L 4R9HA 5M7QA 2PTTA 3SKMB 4Y7MA 1WCBA 5GIRA 3Q1SH 3U7YL 1CFBA 1QQDA 4GUPB 4J3XA 3OXSB 5KANG 1FYTA 3X3GL 3WFDL 1FO0H 3PP4H 4PJCE 3GI9H 4P4KB 4XWOC 3UZQA 1P2CA 4JFDE 3ZTNH 1MJJB 4JM2D 1G6RA 2VQ1A 4CN4A 1NFDE 4K3GA 1TCMA 4WI7A 1AFVH 1KJ2H 3H0TB 5T5FL 3V8OA 1MFAH 4QOKD 4CJ1A 4OIBA 4L4JA 4WFHD 4XRCB 4YHOL 3D9AH 2V7HB 1KIRA 1J11A 4KTYA 4LNRA 5C07B 1SQ2N 5D7JD 3SDXB 3V0VB 5LXGL 1MRFH 5E08L 1K9TA 1PX3A 1S5HB 4L4TD 4UDTB 4ZG1A 2LV4A 1BQHG 4JZJA 3LSOA 5D2LF 3U0WL 4M9PA 5CEZL 1J05A 5D1XB 3SE3A 5I16A 3PQYE 4PY7A 1KELH 3CH1B 1PFCA 5GGRA 1PW3A 5HGGS 4HIEB 1LDSA 2V17L 3EW3B 4QYOB 5ACMA 1QHPA 2ESVD 4FP8L 4NKDB 1A7OL 5DYOB 4IDJH 4F9PA 3MRQA 3N0PB 3BX7C 2KPNA 1RPQA 4TNWF 1WIOA 5HGBB 3Q5YA 3X3FH 4YDLC 1IM9D 1I8LC 2GCYA 1BZQK 4U1LA 1F3JA 4EN3C 3NFPB 3IAGC 4KGLA 2NYYC 2R56L 4HS3A 1A0QH 2Q6WB 4X4XA 5I73C 3WD5L 4PJ7E 4OCWH 3TZVB 4QXGH 5JMRA 5I15L 3N50A 1AKJD 4PJ8B 1TQCC 1QKZH 3QR2A 1AGFA 3QJFA 4TUKL 3VH8B 3LMJH 1OL0A 4HZLB 4JRXE 4G8EB 2H1PL 2NY1D 3HAEG 3D2UB 4APQB 1BD2E 3JV4A 5C08B 1G0YR 2MJWA 2YD9A 3EYSH 3WNOA 1JK8A 4DAGH 3MLSH 4D8PA 2AEPL 4MJ5B 3PHOA 4UAOC 4LLUA 5E70A 4LCUA 3VJ6A 1E4JA 5I1GH 2AI0H 2H3NA 4ODSH 3U1SL 4MB4A 3G6JA 4XCFH 2Y5TA 4JFEA 3ARQA 3D0VB 1BF8A 3O3DB 1AXTL 3CUPA 4NBYB 4JFHE 5IKCB 3MOAL 3VWKD 5D1ZD 3MJ9H 5C0CE 2EXYC 2HWZL 3VG9B 3DXAA 4EI6B 4LASH 3P0YL 5F7YC 4FXKA 4ELKA 1VDGA 3H9SE 3UYRL 2APFA 5E8OB 5JUEH 4K94C 4GS7B 4OCYL 1FG9C 2R1WA 3IKCB 4Y19A 3QXAB 2AJVH 2VXVL 4ZYKA 3SN6N 4U33A 1TQBB 4X6DB 2BMKA 5ECJE 3BZEB 1SJHA 2YK1H 3BN9D 1H8SA 4YAQB 2DI7A 5L6YL 2FX8L 5D70L 3IVKB 3W11C 3FRPA 4PREA 2F19H 1TCRA 4ZO8A 4DQOL 5F7LB 2KH2B 1OP3H 1ZHNB 3S6CA 3MTRA 3QIUA 1LD9B 1JGLL 5DEGB 5KSVA 1QPPA 4J4PD 4UT6L 1QFOA 2JB5H 1ETZA 4NN5C 1H3VA 4F2MA 1FNGB 1FJ1B 1KCSL 1A3RL 4LOUC 1P9MA 3G6JF 5DQJB 4OCXL 3V7MA 2F53E 1ZWIB 3PWPB 4OLEA 5EUKB 3B9KB 1I7TA 3DROB 1AR1D 3D39B 3CCHB 5JXAH 3KHOA 3QCVL 1EERB 3AAZB 5HDLA 5I75B 1S7UB 1R3JB 1HINH 4V1DD 4YWGH 3S5LG 2OL3A 4KROC 3OJDB 5CSBA 4XNXH 1KBGH 5MP6L 1I7UA 4N90E 3LKQB 1CLZH 3MA9L 2GSGA 5KN5A 4QHKI 4J1UA 5K9OA 4I0CC 2GFBB 3K4DA 2IG2H 2XTJC 2VLRA 4X0KA 1YA5A 1XH3B 4IRSA 5IR1A 3S3JA 2PR4H 2E8ZA 1D5ZA 4DVRH 4JKKA 2YRPA 4MB5A 1LNUA 1RZJC 2E9JA 3T2PA 3MBXL 4OLZH 2D9QB 3QWQB 2OL3L 3MBED 2VZTA 1FZOA 1I1AC 5ITFA 4LCWD 4WO4D 1J86A 4XXCA 1IAOB 3O2VH 1A9BB 3DX8A 3CPLB 4EXKA 3ZL4H 5LG1A 3RWIA 4RAUB 3LN5A 3IDYB 1ED3B 5FO8A 1MI5A 3TBYA 3GBNH 1SM3H 5HYIA 5LGKA 3U4BL 3O45A 4XCEB 4R90H 2DYPA 1A5FL 3HMXA 2A73A 1MJUL 1GGIL 1T0MB 1YYLL 4X8JA 1VGKB 5FKPA 2FJGA 4G5ZL 2NXZC 1YMHA 4WU7A 4RGMC 9CGTA 2P42B 1HHKB 5BZWA 4P2RD 4PJGB 1RZ7L 5IBLD 4BA8A 1CVSC 5C9JA 3ES6A 1NMAL 2ZOLB 2MHAB 5IVXE 3RIAF 8FABB 4EUPG 4HBCH 5J1AB 1H15B 4IJ3B 5EA0H 1IZKA 5JIIA 1ZTXH 2AABL 5H37G 3QDJB 1YQVL 1FLTX 4NP4H 1VFUA 4Z78B 4Z7VA 1EO5A 4AL8L 3HCVB 1R3KB 2X70A 3QIBA 4KRPB 4DUWA 2Q87A 5C0RH 3FCTA 3TM6A 5E9DE 2PO6D 1LK2A 3TF7C 3DUSB 3KHQA 1IAIM 2WV3A 4JJ5B 4LHQB 4X98A 3W0WE 2NY6C 2NY2D 4PLKC 2AV1B 2ZCLL 1F3DH 3QXWA 5C0FA 2O26U 3H7LA 4AEIL 4XAKD 3CSYB 1NC4A 2GHWB 1B88A 1W72A 2D0FA 3QNYB 1T03H 1X5IA 3GRWH 1KTLB 1A7RH 5TFSL 2E3VA 1AD0B 1YPZE 4OD1L 4I18B 3LVEA 5CEZE 3NAAL 1R6VA 5AUMB 4IRJD 4ZS6C 2O5XL 3WUZA 2VABB 2X10A 5CUSH 4JO3L 2F54D 3MLTB 2WUBL 3OSKA 1XR9B 4JFFB 3T2OA 4CVXB 5IESH 2V9QA 5HGDA 4WDIB 2NXYB 5C9KA 1U8IB 3I3DA 4NN6C 1WBXA 4D0BB 1W72L 3MUY1 5FF6A 1RIHL 5DMGD 1J0HA 1DQLL 3FO0H 3CC5A 1WZ1L 4Q6IA 5KJRH 1OPGL 2IGFL 4QWWD 1A6VL 3MROA 3IJHA 4B0MM 4Z7VF 4JKPL 1WWWX 2XPGA 4KDTC 5BO1H 4KK8C 2HRPH 1OAQH 5DURB 5IW6B 1FLRL 4LF3A 2QQKL 3O3AA 1IGIL 5E1HB 1A64A 2OJZH 1PQZB 4RBPK 3C08H 4MYWB 4CVZA 2V5YA 3JV6A 4XBPB 1DTUA 3WNNA 3OV6A 2PW2A 2EH8L 4JM4L 1HILB 1AE6H 2PNDA 1Q72H 4Y2DC 4AT6A 2EICA 1GHFH 3OZ9H 3IFPB 3Q5OA 4S1QH 1P4LA 3ULVL 5A43C 3JV0A 4JDTL 1I4FB 3UDWC 3IXTB 3RDTD 3SGKC 3MXVH 4BYHA 5KS9E 3IS1X 4HFUH 2E7HA 4M7KL 4RQQA 3PGDA 4QF1A 4M48H 2OTWA 1P1ZB 4X6EA 3RZCA 4LRIA 2QHRH 1U91B 2VC2H 2BNRB 4PP2A 5TDOA 3MQIA 1J8HE 25C8L 1K4DB 1V3LA 1DL7H 2YPVH 5TE6L 2E9WA 4CVUA 4WEBL 2DMKA 5IF0A 1EO8H 5IJVB 1DBKH 4LEOB 3JWDL 1UZ6E 2DJ4A 2NY4C 3ULVF 4FG6D 2DLTA 3MRMA 3CFDB 4DKEL 4PJ9A 4DFHA 4NQUA 5E8PB 3F6IA 4M1GL 1AO7A 1EUTA 4FFZH 4YHYC 3ET9F 2AXGB 4PS4H 1J0YA 1MCCA 3GBMH 2P5WB 3B5TA 1R5VB 5IQ7H 3ARBA 3IFLL 3JUZA 4P9HC 1FSKB 1IBGL 3G04A 4LLYB 1I7RB 3TNMB 1JYXA 1BIIB 4QHLB 4YHLH 1P7HL 4LHJB 2FHFA 1KPUA 4Y4FC 1PBYA 1ZXQA 2CLRA 3HNSH 5H94B 1OARL 2HFEA 3QI9B 5JR1H 2BY3A 2ZUYA 2BSTA 1DBBL 5F3HA 3PV7A 3ZHDA 3VRIA 3PNWA 3DUHA 5I8CA 2CMRL 1CIUA 3BDYH 2Y23A 3MMEB 4QO1A 4UMGA 5CSGA 4C83B 1JJUA 2XOTA 3WUWB 5E8NB 3EZJB 4XPGH 5EORH 4LPXA 4OM1L 1F3RB 4DTGH 1UT9A 1U3YA 2SEBA 1U8QA 2DJUA 4OZFB 1U41A 5KSAA 5I6XB 2I5YL 1AJ7H 4IOIA 4XWOD 2Q86A 2DBLL 3UTSE 5K59E 3MYZA 1X3DA 5GISL 1VERA 2VLKD 2B1HL 1GJIA 2LABA 2J88L 4GAGH 3VXTB 5EU7E 2EIZA 3WXVL 1NEZA 4HPYH 1XR8A 3GSWA 2AJXH 2C4FT 3OWEA 4Z95L 3SJVB 1BGXL 3EDKA 1NGYA 5FYLD 3MA7A 4OZIA 3BKJH 2XYCA 1CK0H 2ICWB 1T2QH 2W0PA 4PJBB 5B3NA 3DVGB 1NLBL 2R0LH 2A6DA 2ZUQB 3MRBB 2FJFB 3T1FA 1VKXA 5IB1B 2BP3A 1FORL 5IV2A 1T3FA 4NWUL 2E5EA 2R23B 2FX7L 3ZSSA 2VDPH 4HUNB 4EN3D 1CLYH 1U8KB 5FM8A 1S5IL 1VFAB 3N1GC 4OFVA 2EIEA 2NYYD 1Q0XH 2PYFB 3HG1E 4Y4HA 1Y18B 4P57A 3O6FA 5ID1B 3QQ4B 1J0KA 3DWTA 3FQRB 5EN2B 5ANMA 5IEHA 5JW4N 4APQD 1S78C 1YNTA 2OK0H 2YBRA 4TSBL 4X9HA 3O3UN 5C8JA 5C08D 5TE7L 2W92A 4M93B 2UYLB 4P2OB 2IH3A 3PL6C 1HKLL 2Z35A 3MLYL 5GJSL 3LHPL 5SWSB 5JPMB 4JFZL 1NGXA 2VL5B 1UENA 2D31A 4XH2B 2J8UE 4LSPH 5B3JF 3QQ3A 3DJ9A 1EEUA 3U9PH 1KN2L 1SJXA 3JSSA 3NVQA 5I76B 4LPYA 2BY2A 1DP0A 5CP7A 3TT1L 3HZYA 4HJGB 4JY4B 5EC2A 3QUZA 3A6CH 1TZIB 1JZ3A 4NZUL 5D71L 4RX4D 4OZIF 1T1YA 1V5JA 4MCYB 4BFGA 4KWUA 3L5XL 4YC2B 3OKOB 5DJ0A 5F9WB 3WHXA 3F62A 1QEWB 5DO2D 1JWSB 3PGCA 1HI6B 1GIGL 5F1IA 3I6GB 1GC1H 3SDDC 4EKXA 4Q7DA 2JELH 1KNOA 2X4TA 4KKNA 1UWEH 2FB4L 3BSZH 4S0SD 1RVFH 4W6WB 2IANA 4ZPVB 2H9GA 5DWUL 2EXYD 1J5OH 2DJSA 5AZ2H 3C9NB 3T77A 3TBSB 4I48A 4H1LG 3CDYA 3VFMB 4FQXB 4QOKE 5I8KH 2R2EB 4M7ZB 4WFHE 5MI0B 5ESQA 1FNEA 5D1QD 1OAXH 3PHQA 3UBXI 3UJJH 2G60H 1NCWL 5DS8B 4PRPA 4UUJA 3DOSA 3QA3A 3VFUB 4V2CB 2LU4A 5J1SC 4L4TE 1RZGA 4KMLB 3MRLB 1LO5B 4OZGF 2QQQA 2VZ3A 4FQ2H 3P4MA 1KIPB 5FM5M 4WCYH 3CFBB 4G7YL 1JIBA 3DRTB 2DQTL 5JQ6H 2W1NA 4XZUA 4OGYL 4ZTOL 2AJUL 3HNVL 3W11D 3NA4A 2ESVE 4NQXA 3U7YH 1OHQA 1I1FB 5E0QA 3X3GH 4NHUB 1S7RB 3WFDH 5K9QG 4KKCC 4GOSA 4KXZI 3UPAA 5F7MC 5JDSB 5DFVC 4OUUA 4I2XA 2Q1EA 1N6QL 1QBML 2X4UA 3TO2B 3HE7B 1HQ4A 5T5FH 1UACL 4Q9CA 4OF3A 2ADIA 5D72L 3D0LA 4YHOH 4HS6B 1DLHA 4AJ0A 4BH7B 5HYSA 2GJJA 4UDUA 5BV7L 2UZXB 5LXGH 5E08H 3ZYOA 1A8JH 3U0WH 4KROD 1PAMA 1T5WB 2MKWA 2CLZB 5CEZH 3BO8A 4GRMA 5GJTL 4F57L 3MX0A 1UEMA 3DYPA 2V17H 3KVQA 4YDVB 3O6KL 2YXFA 4FP8H 3KPNB 4PGBA 2AJ3B 4G8FA 1A7OH 4LVNC 4CNIA 1M4KA 2XTJD 3RVWD 2L7JA 2PXYC 5BJTB 1K8IA 1UJ3C 2Q7YB 5CEXA 3M17B 1Z9SA 1AGCA 1NDGB 2R56H 4PLOB 3JTSB 1ORSB 3ARFB 4L9LC 4XX1E 4LVOC 3CFJA 5DJYA 4YDJB 1UB6A 3MJ8A 3SDAB 2C3VB 3WD5H 3LDBB 3H7BA 1GGUA 1IE5A 2YA0A 1I1AD 5I15H 1KYOJ 4EI5B 1AI1L 1CICC 3BDBA 3JBG7 5GS2H 4TUKH 3X14B 5B38G 1P84K 3KG5A 1C1EH 4LMQI 4J3VA 2H1PH 4WV1C 4OFYA 1R3HB 4XX1G 3OJMB 1WV7T 3MRDA 1N5YL 1H3TA 3GHBL 1B6UA 4D3CL 2FRGP 1KSRA 4JFDA 2CRYA 4WIQA 4LU5L 4Y4KA 2AEPH 4XTRC 5F89B 3TH3T 4LSTL 4BK4A 2V9TA 4Q58C 5IMMA 1MH5B 5I1LA 3U1SH 4F7PA 5EU5A 4LGRB 1DBJL 5DRXB 1KEGL 1F2XK 2NXZD 3U0TB 1KLUB 3CD4A 4Q2ZA 4XRCA 5AWNL 1AXTH 2V7HA 1IKNA 1NUDA 4BFEA 2DWEA 3MOAH 5C07A 1CG9B 3SDXA 2HWZH 4TTDC 3VGFA 4CADB 4KRPD 3T4AB 3GHEL 3P0YH 1S5HA 1H3GA 2R39A 2VXQL 4JJHA 4WU5A 5GS1C 2HH0L 3RTQA 1KTRL 5MEND 3C8DA 4OFKA 3UYRH 4OCYH 3T0XA 3NACL 1ZLUH 2EDLA 1ADQA 1NMCB 2VXVH 3HZKB 4TULL 4V1DE 4G6FD 5CJQL 1LO3L 4QKXB 3IETA 3U7WL 5JHDA 2NY6D 4X7DC 5L6YH 4OV5B 2FX8H 4PLKD 5D70H 2ADFL 3QUMA 2Q6WA 1UFUA 4DQOH 2VN7A 2DLHA 1IM3B 3FN0L 1TITA 3TZVA 1JGLH 3LD8B 4P99A 2NXYD 4UT6H 1OOAA 4I8DA 4ZS6D 2X42A 3GSNA 3RNKB 1KCSH 3VFWA 1A3RH 2PCPB 1BD2A 4OCXH 1J0ZA 4F8QA 4RBPH 3T0EB 5F9JA 3T4YB 1CFTB 3MLZL 5C0NC 1JPSL 4LCWE 1EHLL 3QCVH 3SDXF 5JIHA 1AY1L 4QRPA 4MJ5A 4OF0A 1QBLL 3BKCL 4U7SA 4QEGA 3WFBL 5BXFB 3A6OA 4HFWB 1ITBB 2R1YA 2O5ZL 4GMTL 1X5YA 4XP6L 5MP6H 2VAAB 4U1MA 5LAXA 4S1DC 4LLMA 4DGIL 1XF1A 1SEBB 5C0CA 3MA9H 3NPZB 5D6DC 1EEZB 1OW0A 4U3XA 1EGJL 5HTSA 4KK8D 1NAMA 4YIQB 1CDJA 4NO2B 5CJXC 1FGVL 4EI6A 3AFLA 3KGRA 4P2QB 1MJ7L 4DJMA 4G8GA 3WJLC 4PRNA 2JIXA 2UWEA 1M05B 4P2RE 4MQTB 4FZ8L 4P23C 4FTVB 4I77L 4YFLF 3ZT5A 4QRTB 3REWB 3ILPA 3MBXH 1FCCA 1MCFA 3TO4A 2OL3H 4N0RA 4PJDB 2Z9TA 4E5XB 1F5WA 2DS4A 3UTZB 5KSBB 4KJQC 4YAQA 4GBXC 2OQJB 4U1HB 3RIFF 3G08A 5DJCB 5CEYB 1ZHNA 4GSDH 1VFMA 2D0GA 1LD9A 2BVYA 1NGQL 4X9GA 3SO5A 2OR9L 4O5LL 3U4BH 4TVSa 2BNUB 2R2HA 5C3TA 1A5FH 3WFCL 1FJ1A 4HKJB 3MV7B 1MJUH 1GGIH 1YYLH 2P5WD 3B5HA 4XAKE 5D5MB 5DQJA 4RIRA 2H32B 4PRDB 1A14L 3PJSB 3PWPA 3B9KA 5CGYC 2ORBL 3SDCB 4TTGA 3D39A 3HNTL 1ES0B 1RZ7H 2M26A 1FFOB 1JPGA 2E7BA 2F54E 1I7ZA 1MFBL 2AK4D 3DX7B 4HHAB 1PEZA 5CJ8A 4ZNEA 2XY1A 2GTWB 2UWEF 1NMAH 3CFKB 5EIQA 4MXVE 5I17A 1U93A 2HAZA 2AABH 1ZKAA 1YQVH 2ZJSL 4H1LH 5GSVA 4LDEB 1RJZB 4AL8H 1Z5LB 3HTLX 4ELME 4QXUL 4Y4FD 4MAYC 2JCCE 3LN4B 3MZGB 4U1NB 1RJLA 3SHSA 1D7FA 2PKDA 5EOTB 1YECL 2BCKA 1L6XA 5FO7B 4X6BB 2BVTA 1N59B 3DNKA 5IG7B 4XMPL 2ZCLH 1X5GA 4AEIH 2EO9A 4DN4L 2KQMA 4MNQD 1F02I 5TFSH 1O7SA 1PKQB 2FO4A 3T1WA 5C0DB 4OD1H 3NAAH 3AM8C 1A9EA 2O5XH 3KS0H 2X1XR 2P43B 4JO3H 5GZND 5ACLA 4X5XA 3GKZA 2WUBH 3VWJC 3FTGB 5F71A 1OWRM 4MMZC 4YK4B 5ID0B 2K3TA 4LIQE 4M6ML 1KPVA 5FIEA 1Z9OA 2CKBB 3VD3A 3EJYC 3NMEA 3T2QA 4L3EB 5BS0D 4JGMA 1JYNA 1HXYB 3MGAA 5C0AB 3L5JA 2HTKC 1K2DA 3VI3F 4LVEA 1W72H 2DB8A 1RIHH 1F4WL 1DQLH 5FGBA 1WZ1H 1FVDB 1OPGH 5FYKU 2IGFH 2IMNA 1A6VH 1HHKA 4MDIA 4PJGA 1BMGA 2W07A 4Z7WB 4JKPH 1YMMB 4RFNC 4U0RB 1QA9B 2P1YA 4WI9A 3P0VL 1FLRH 1D9KA 1BAFL 1T1XA 2QQKH 1IGIH 3ULUL 3S4SB 1RJYA 1S8DA 1ZA6B 4ZO6A 1HSAB 8FABA 5HHOD 5BVPL 2J3SA 5J1AA 2EC8A 3D85A 4P2OD 3WCYA 5GS0C 1B4JL 1U8NA 1S3KL 1WUNT 3ILQC 3QDJA 2EH8H 4Z78A 5E9DA 4JM4H 1EZVX 2RQ8A 4DEPC 3NCCB 1R3KA 2ICCA 4DZ8B 1JGEA 2MQCA 2GUOA 3ULVH 1C7SA 4JDTH 4JJ5A 1EVUA 5C09B 3PWLB 1B2WL 3DX6B 2HT2C 2QQLL 1JF1A 4M7KH 3ULUF 1YPZA 1HSBB 3CSPA 1B0RB 4G8IB 4X7CC 3HRPA 5DRZA 25C8H 4FQIL 3JWOC 4RGNC 5TE6H 3FFDA 1N8ZA 4QGTA 2VZSA 5AYUL 4WEBH 3BW9B 2VABA 5E7FA 3ZTJH 5LGJB 1JHKL 2B5IB 3JWDH 4OLXL 1DE4A 4IMLB 4AM0B 4W4OC 1KB9K 4JFFA 3AXLA 1W2KT 1CGYA 4DKEH 4PJGF 5E2VL 2XV6B 4M1GH 3CXDL 4L8DA 4WDIA 1XCTA 2GITB 4K7PX 4ODTL 1X5AA 3RVTC 1WC7A 3EYUL 1U8IA 3BT2L 4KJPC 4Z7NE 3SDDD 1UM6L 1LDPL 4CW1B 1G7JA 4WW2C 4NQTA 2YUVA 3IFLH 4R4FL 1IBGH 1XGTB 3CX5J 2VLKE 4I9WD 43C9B 5FDWA 5F7DB 4MVBC 3D1MC 3B9AA 1WFUA 5IW6A 2HLAB 7FABL 4HC1A 1TPXC 4NT6B 4GRWB 1DBBH 5FYLE 4DK3A 4LAQL 3GM0A 4JN2B 1PQZA 3OR6A 1RURL 3CDGB 4HIJA 2E6QA 5KTEL 1RZKL 1UYWL 1A1MB 3MCLL 2CMRH 1YPZF 4NQDA 3TJEL 3NH7L 3CVHB 2J8HA 5JW5B 3L3IB 1O7VA 2G75A 2XN9B 4Y16B 2P8PB 2EDDA 2CJUL 1RJCA 2YRZA 3IFPA 5DJ8B 1VEPA 5KS9A 4OM1H 3UMTA 3LKPA 3GSUB 1F45A 1BPVA 1JPTL 1I4FA 4LHUA 3BISA 1BZ7A 4JR9L 4KKCD 4OZ4A 2P5EB 5CWSA 4CBPA 4Y1AB 5F6IC 3IFNL 5FUZL 1MJ8H 3BPOB 2I5YH 3MPCA 4JDZB 4JZOA 4KVCL 1H3UA 5DFVD 5F6HJ 5GISH 5IMKB 4Y5XC 2B1HH 3BMWA 1Q1JL 1K4DA 2DAVA 4YH6A 1II4E 2J88H 3W5MA 2GK0B 2XT1B 3ZKNC 5C08E 3WXVH 4MZ2A 4GKNB 1K6QL 1VFBA 4JLRA 5EZJB 2YWZA 3VXNB 4Z95H 4KK5C 4GQPH 1BGXH 4AH2B 4AQ1B 1XF2B 3CFDA 3O6LL 1VHPA 3P73A 4NC2B 4OKVB 5L0QB 3FAWA 2YPLB 4GT7A 3V6FB 3OJ2C 1NLBH 3FKUS 1X6LA 1INEL 1KGCD 4GXUM 3VH8G 3HHRB 3DO7B 1UCBL 2AXGA 1F4HA 4R4BB 5LKNA 1RZFL 2E6JA 5BOZG 3ARFD 2CK0L 3HLAA 1HNGA 1FORH 3DYOA 3CLFL 4NWUH 5IIEA 2FX7H 4LLYA 4E9LA 3QPQC 1BIIA 3TN0C 1IQWL 5T5NF 1YEHL 1S5IH 4EI5D 3DARA 5IB4B 3KYAA 5KS9F 3G5YB 5EO9B 2WP3T 3S3PA 1QVOB 2DIAA 4WWKC 2DM7A 3UBXB 4TSBH 5TE7H 5E4IA 1HKLH 3MLYH 3VFPA 5GJSH 3LHPH 3KJ4B 3DI3B 1CICD 3BKML 4JFZH 4LSSL 4C83A 2X7LB 2A77L 5ERWB 3MJ7B 1F13A 3EYQC 1OCWL 1KN2H 3FOMB 4HG4K 3HE6A 3K8KA 4Z7OF 4NYLB 5F72S 3WFHB 3TT1H 3K4ZA 1JWUB 3SKNA 3NZHL 3GGWA 5CP3H 3IJYB 3UTSA 4F15C 4NZUH 4OZFA 4PJEE 1X4YA 4XTRD 5D71H 2EDXA 1PY4A 3ARGA 3L5XH 1E4KC 2R0KL 3DYMA 3V2AR 4YHPA 5D7LD 3SOBL 1GIGH 1IARB 5CZKA 4AEEA 1WTLA 3L5WB 2FB4H 2WBJC 2AS5M 3L3DA 3VD4A 3MRGB 3SJVA 5DWUH 3BDXA 3ORJA 3QUYC 2CIKB 2J6EA 3CDFA 2IFFL 3C5ZC 1DVFC 3GIZL 3B83A 4K8RD 2FJFA 1QG3A 1NCWH 1A1NB 4KH2A 1CGXA 4TSCL 3SCMB 4LLAA 4RWYL 2VUOA 2W38A 2ZUVA 4PJIB 4O00A 4P9ML 1FVEB 5C0GB 3RU8L 5FB8A 1YEJL 1I9JL 4G7YH 4ZAKC 1XGRA 3BQUB 2DQTH 2PYFA 2DLIA 1Y18A 5ID1A 4OGYH 4ZTOH 1CTNA 2AJUH 3HNVH 3P4LA 2XTJE 5EN2A 3U2SB 2M1KA 2R2CA 4OZHB 5GRYA 4O02L 1T80A 1CD0A 3MLVL 3QQNA 2J8UA 2JJWA 4PG9A 4S10A 5SWSA 1ZVSB 1ZK9A 4NQCD 1A4JA 2XWBB 1N6QH 4AIZB 4XH2A 1QBMH 3TCXA 5DUML 2WM0A 5DMIL 5JIPA 4JRYB 1NGZA 1UACH 1Z0NA 5D2NC 3NPSB 5C0ND 1S9XB 1YEDB 1UXSA 1E4WL 4JY4A 2LAAA 2J5LB 5BV7H 2CPCA 4WHYH 2OZ4A 3ROLA 5IEKA 3ZYIA 4PJBF 4AEHL 2BOBB 3MXWL 3QDMB 3BGMA 1JWSA 4MCZB 4M3KB 3I6GA 4S1DD 2V9RA 4YNYA 5GJTH 1BHGA 4HLJA 4F57H 1V3MA 5IB3B 1ZSDA 3ISWA 4FTVD 1MHHA 1BECA 2X5PA 3O6KH 5CKGA 2YRLA 1IC5L 3S36X 2Z92B 3L3JA 3ABZA 4MS8D 3C9NA 1Z0MA 4KHXL 3VFMA 1CXIA 1A6WL 2R2EA 2MSPA 4ERSL 4HIHA 1HYSC 5D7JA 5DRNB 2OZ4L 1G7LB 5DJAB 4N0FB 3VFUA 5T1KB 1S7XB 5EH1A 3MRLA 1LO5A 1KLFA 2ICEB 3FN3A 3ZDYF 4KK6D 3U9UB 5MENE 1KIPA 1AI1H 4D0DB 2HFFA 3IRPX 1HQRB 1T66D 2VXSL 3MV7D 4U1JB 2A6JB 3QCUL 1IZJA 4X7EC 3K46A 1IM9A 4GRLC 1EXUB 4U6HB 4NHUA 3WYRA 1DEEB 1S7RA 1N5YH 3GHBH 4D3CH 1HCVA 2CLVB 1GOFA 4LU5H 3ZKSD 4LSTH 5CGMA 1RUAL 4KFZC 2V2TB 1X5KA 5I74C 2FLBT 5JDSA 5E03A 4UI2A 1EK3A 3VD5A 2XKNA 1DBJH 1KEGH 1EFXB 2X4QA 1AKJA 5T1DL 1KJMB 2ZCHL 5HD8D 1CT8B 1SMOA 1RUML 5AWNH 2DM4A 4Z0BL 4BH7A 2X4PB 4NC0B 4OF5A 3S96B 4OAWA 1NPUA 2GSIA 1P6FA 5HY9A 3GHEH 4JQXC 1IGJB 2D7MA 3QEQB 2J2ZA 2VXQH 3DGGB 4RWHA 4ZFZA 3ZE0E 5C86A 2HH0H 1MCHA 1X5LA 3TVMB 1U8JB 3FONA 3QNXB 2B8OT 4BH8B 3NACH 3JUYA 1K5NA 3KPNA 4TULH 5CJQH 2AJ3A 4MAYD 3T2NL 1DQJA 1LO3H 1LEIB 3V5HA 3AC0A 1MCNA 1WAAF 5BJTA 3UX9B 5DK0B 4D0CB 2Q7YA 3U7WH 1RZIB 5EUOE 3BPNC 3HC0A 4P46C 3JTSA 4P5TA 5HYEA 1ORSA 1ORQB 4BQBA 5B39B 2ZWLT 2ADFH 4YDJA 3MLWL 1BWMA 4Y5VB 3F7VA 3SDAA 3FN0H 4MJ6A 1Q9OB 2R29L 4TUOB 3FAXA 3BIBX 4PJXB 4YGVA 1U3HB 4JKLA 4OQTA 5ALBL 1DANT 3AREC 1KT2B 5DSCA 5HSFA 1C12B 5C0AD 4HEPG 5E6IB 3UTTA 5B8CC 1MIEL 4KU1A 4X4YB 3HZVA 3VWJD 3BP7B 1G9EA 5JNYA 3MLZH 3B43A 1JGUL 3RL2B 1NCCL 1JPSH 1EHLH 1P69B 1SYSB 3K8MA 4CMHC 5J6HA 4GJTB 1AY1H 1LVEA 5DC0A 1QBLH 3BKCH 5F89A 5F9DC 3WFBH 3V5DB 2CXGA 4OCRL 3DMMA 2HTKD 3P4OA 4IIQC 4K07A 4G42A 2O5ZH 4HK0B 4XP6H 1UADC 4WVRA 1IGYB 2YEZA 2PETA 3MUHL 1KLUA 5IB5A 2O61B 1U8OB 3D25B 4L8SA 2F5BL 4OCMC 4BM7A 4DGIH 4OQTL 3LQMA 1MWAA 4H8WL 1RAMA 2FATL 1EGJH 1KLGA 3L3OA 4GQ9L 1FGVH 2P5WE 1MJ7H 2H26B 3VFTB 1N6UA 4QNPF 4BJLA 1ZHKB 2UV3A 2EEAA 4PV9B 4QT5A 1X9QA 2OBGA 4FZ8H 5GS0D 4V1DA 4I77H 3ILQD 2AK4E 3HZKA 3U82B 4HGWB 1NJ9B 2BC4B 2XWTB 5SWQA 3O41B 2R4SL 5EO0A 2EZ0C 5EPMB 4U6XB 4HXBL 3S97C 1L6ZA 4OV5A 3AS1A 2XNAB 3UROR 2W60A 1QLRB 4TUJB 2APBA 4L8BB 1IM3A 2DKSA 2RFXB 1NGQH 4L8CA 2OR9H 4O5LH 4WY7L 43CAA 5KOVC 1XIWA 4MJIB 3DTXB 3WFCH 1NC2B 4NQVA 3F6LA 3BUYA 2VLJB 4UTBL 4O4YL 3OKMA 1B3JA 2C7UB 4QLRA 3MGOB 1A14H 4WO4A 4MNQE 4QRQB 3T4YA 4I13B 1CFTA 2ORBH 4YHIB 4J6RL 5KVFL 1MQ8A 5IMOB 3HNTH 3RUGB 3WUWG 3OX8B 3ECBB 4PLJD 2J7LA 4K8RL 4AIOA 3L7EB 1CLOL 2X1OA 2WLZA 2EDBA 2IAMC 3NZ8A 4G9FB 4KJPD 1MFBH 4M43L 4HMEA 2EDNA 3AROA 4RMRA 5MERB 2Y9RT 4R0LC 4YPGA 1SEBA 5HGHB 5BS0E 3QDGB 4JFOA 2ZJSH 4MVBD 5DHXB 2I9LB 4X7TB 4NCC1 4PJFB 2XN9D 4QXUH 3FMGL 3VXMA 3KPTA 4P2RA 4P2QA 1GOGA 4IMKA 4MNGB 1QFPA 1WWCA 1YECH 1JI2A 1MUJA 1N64L 4ZXBD 5CFHA 1M05A 1X44A 2F8XC 1XF3B 3QSKB 5HHQB 3ARDB 4XMPH 3O2DA 4NBXB 4LARL 4DN4H 1MVUB 1G9ML 5LBSL 4PJDA 4NQSA 4B5EA 5HHOE 4OLWL 3C6LC 5F21B 3UTZA 5KSBA 1CD1B 4MA1C 5I1CL 2BNQD 4U1HA 4NPYA 1FC2D 3HC4L 1CGSL 1T0PB 5HYJD 5TQ2L 5CEYA 3S35L 1HNFA 5KBNC 4M6MH 4DCQB 1MLBB 1KENL 3PL6B 4LQ1A 4OGXL 2YPLD 4O51A 1A6AA 3HPJA 5JXEA 2RGSA 4MSWA 5A3IC 3Q3GA 3F65A 3FL7A 5E5MB 4EDXB 3FQTA 1F4WH 4KK5D 2H32A 4PRDA 4NNYB 5DFTA 3LQAL 4IRJA 2FZ3A 1GZQA 5JOPD 3VGHA 4PBWD 4KRLB 5EU4B 1FFOA 3DV6A 2EE3A 3R06A 5CBAA 5GRJL 3P0VH 5DHVA 3TBWB 4Z77A 1BAFH 2GTWA 3ULUH 3CFKA 3EAKA 3QISA 1QSED 3T3MF 1AXSB 1A2YA 5BVPH 2IF7A 3QPQD 4I5BB 3TN0D 3BH8A 5GPRA 3IAQA 4ELMA 1B4JH 1S3KH 3O3BB 3VXRB 1BX2A 3IDJB 4PJDF 3PABB 5MEPB 2EKJA 1CE1L 2R9HD 5KAQF 3JTTB 3IDMA 3U36B 4PD4J 3OKDB 5J0BA 3F5WB 3LN4A 5KSBF 3DUUB 5FYKL 5HDOA 1ZV5A 7CGTA 4E0RB 2DI9A 4I9WE 4GH7B 4WWKD 4X6BA 1B2WH 2OTPA 5EZLB 1TTGA 5IG7A 1JYWA 2QQLH 5D7IA 3VD9A 3VG0L 1S7WA 4JDVA 2P24B 1C08B 2BVQA 4C55A 5JW3H 1W8NA 4DKFH 2AV7A 1PKQA 4FQIH 1M7IA 4F7MB 3OKNB 3BYYA 1UH3A 5AYUH 1FYHB 1G7IB 5I71B 2Y7QB 1I1RA 2HVKB 4PGCA 1JHKH 5E00B 4OLXH 1T22A 3A67L 1O5DT 3NCBB 1EZVY 3FTGA 5GGRY 4E41A 1UQSA 3DBXB 4ETYA 5E2VH 3CXDH 1AIFB 1FPTL 1HK6A 2VIRA 4WTZG 3EO0A 1NSNL 4MXVF 5J6GA 4ODTH 1JZ4A 3T65A 1HXYA 3EYUH 3BT2H 1UM6H 1LDPH 4IS6A 3TA3C 2WBJD 4HWEL 1HH6B 1PG7L 4NO5A 3SCMD 5TH2B 1J0IA 1CXEA 1IL1B 4R4FH 4JQIL 4F8TA 1AHWB 1FVDA 1ZT4B 4UOJA 3QIWB 3C5ZD 4A6YA 3WIFB 2HT3C 3SBWC 5IFHL 1BJ1J 4Z9KB 1BFVL 1QTYT 3PDOB 1H5BB 7FABH 4X7SL 2CO7B 3P9LA 1KULA 1A3LL 1EJ6A 5E5RB 4LAQH 5C92A 1HSAA 2ZSWB 4CUCA 1MFEL 2YA2A 1RURH 3IXAB 4D94A 5KTEH 5D7IF 5E1AB 1RZKH 1UYWH 4DWHA 1KGCE 3MCLH 3SO3C 5IHZB 3GMOB 3QYCA 4K7PY 3TJEH 3V6OE 3NH7H 1BVLB 4ZAKD 3RWGB 1HN1A 2QLVB 5L8KB 3VXOB 3GBLA 3JVGC 2CJUH 1JNJA 5E24E 2A38A 4JRYD 1Y6KR 4XC1L 1JPTH 4JO2L 5C09A 1UH2A 1Z2KA 4N8PA 4JR9H 3UO1L 3VI4F 2QADC 1WWBX 2X4OA 3IFNH 1HCFX 1FQ9C 5FUZH 4Z0XB 2B20A 2HJLB 4XNZB 1BQLL 4F7EB 1RHHB 4KVCH 4G8IA 2VDLL 3C2AL 1Q1JH 1REIA 1AD9B 3HA0A 3QDMD 3RWHB 3MGTB 4LLWB 3BW9A 1K6QH 2BX5A 4HWBA 3RKDC 3BH9B 2D4FA 3GMLB 3O6LH 5FYJU 5CJOL 4MDJA 2YMXL 3ULSB 1INEH 4MQ7B 1UCBH 4XGZB 1NH6A 1WT5C 1RZFH 2XWJB 3O8XB 4JAMB 3U6RB 2GJZA 4CW1A 2CK0H 3B8YA 3UJIL 3W9EB 3CFEB 3UAJC 1HHGB 4QHKJ 5E56A 3CLFH 3UZEA 4BZ1L 1PLGL 4TYUA 3UYPA 1U95A 5D7LE 5HYQB 4FXGB 1MCWM 4HULB 1IQWH 1V8HA 5GGTA 3SKUD 5I1EL 1YEHH 1BBJB 1QSFB 1HYSD 3ZDXE 4LK4A 1GC1C 3BZ4A 5DQ9B 2IPUK 4OIIL 2HLAA 4FMFA 1XGQB 5FA3A 4BSVA 2EDFA 3GSQA 4MD5B 1QACA 3R0MA 3KDMA 3RPIB 3EHBD 4JN2A 1V7NH 1ZS8B 3N1FC 1CD9B 3OXRA 2GJ6B 3RRQA 3UP1A 1A1MA 2BVEA 4RFEB 3ZLQC 2CUHA 1ZA3A 3BKMH 4LSSH 1RK1A 5L8JB 4Y16A 2A77H 4A2MA 4K7FA 1UA6L 2W0LA 4GRLD 3VXUD 2AERT 1OCWH 1NEUA 1MF2L 1OP5H 3FT3B 3NZHH 1MCLA 1P53A 4HPOL 4Y1AA 1I1YA 4YBLC 4F37F 1SJEA 3H9HB 3IGAA 5C0IA 2V5SA 3HI6L 3MV8B 2R0KH 1PVHA 4R96B 1PD6A 3SOBH 3QEQD 4MD0A 5HI4C 2VJXA 5FGCB 3WN5B 4GKNA 3CVHL 3S8WA 5KVMC 3KPPB 3NFNB 5DDHA 4F80A 4NQCE 4AH2A 1DQML 1XF2A 3KXFB 2QSVA 5IK3B 3EOBB 1YDPA 2RCSL 2IFFH 2NNAB 5IMLB 2NX5B 2AJYL 3GIZH 3WBDA 4R4BA 4OZFH 5D2LB 2HG5A 4GRWF 4TSCH 2ZP0T 2I9TB 5DMKA 4RWYH 3I9GL 4NSKA 4MAUL 1WFNA 1JFQL 3BIKB 3L7FB 4P9MH 1VADA 1DFBL 4OD2A 5ESVB 3RU8H 1YEJH 3F12B 1JPFB 1I9JH 2HJFB 3GSXB 2DMCA 4I0PB 5IB4A 4P46D 4P5KA 4FTVE 4N68A 3MRJA 2EKSA 3G5YA 2PTTB 5EO9A 1KN4L 5IW3A 1WCBB 2IQ9L 1U42A 1QQDB 4O02H 3S9DB 4GO6B 1FYTB 3X13A 4YDIL 5F3BA 1W0VA 3MLVH 4KRMB 5FCUL 3EDJA 5JORA 4FQPA 3ARED 3R8BB 5FDYA 1P2CB 3SGDH 4PY8I 2P44B 3ZKXC 4WNQB 4U7KA 5DMIH 5DUMH 1G6RB 1ROWA 2IPUG 2VQ1B 3MJ7A 1INQA 4GBXB 3LKRA 3MLRL 3K81A 1E4WH 4XP1L 2QL1A 4YDKL 3FHAA 1GOHA 3IJYA 4M6NL 1KIRB 3MV7E 2X1QA 5D5ME 4HCRA 4NHCL 3O9WC 4AEHH 1NGWA 3MXWH 1IC4L 2WNGA 4JZJB 3LSOB 2NZ9D 5AZEL 4X80L 1PZUB 1NFIA 5I16B 3KNBB 4M02A 5GGRB 4XPTL 1IC5H 1RK0B 3MRGA 4XP9L 5D6CA 3HZMA 1NQBA 3EFDL 5GGUA 5J11C 3VGAB 3O2WL 1WWAX 4JY6B 2EC9U 1OB1A 3MRQB 2CIKA 3FO1A 4KHXH 4XWGL 2W9DL 3OGCB 3TIDA 2VO5A 4ERSH 2FR4A 4U05A 2GCYB 4U1LB 2OZ4H 3FFCA 1UZ8A 5SX5K 5F7UA 3CMOL 4HCRL 3SGEH 1WITA 1T4KA 4X4XB 4P59L 1DJSA 4W6YB 2PYED 1FVEA 2BSRA 4PYHA 1FNFA 1TJIL 3Q5TA 3NCYP 4BFIB 4KGJA 5I1DA 2VXSH 4HDIA 4U3HA 1GGCL 2LQRA 3QCUH 1AGFB 3QJFB 2FL5A 3TC9A 4XXDA 3U2SA 1G7HA 4QRRD 2EDRA 3JV4B 4PTTB 2CH8A 3LB6C 3PUCA 1JZ2A 3GNML 3FT2B 1JK8B 1RUAH 3NIDF 3SPVA 4D8PB 4G9FD 4JFQA 4B53A 1QBBA 2VSDA 3PHOB 2XWBA 4LLUB 4LCUB 3VJ6B 4AIZA 4HUMB 4RRPA 2H3NB 3RX5A 1ZVHA 4KKLD 4AYFA 3G6JB 5T1DH 3TEUA 5GSRA 4JFEB 1C5DA 4PV8A 1RUMH 1AH1A 5EBWA 4Z0BH 1YEDA 3G5VA 1N26A 4UB0L 3QDGD 1FBIL 3CUPB 5C0AE 2IAMD 1T7XA 5L9DL 1IT9L 4YR6A 3U30B 4HIIA 3ZT6A 3C5JB 1N5AA 2BOBA 5DVNA 4AQOA 1FL6A 5HHPA 3TYFA 3ARTA 4FXKB 5A2IH 4ELKB 1RZJL 4Z7WE 1X5JA 4CVWA 5IB3A 3ARDD 5CLTA 4KHTL 2NR6C 1SYVB 4Y19B 3T2NH 4U1GC 4ZYKB 4LQFL 4J3OC 2BMKB 4YBHA 3GM8A 1HXMB 2VERN 1SJHB 2AQ1A 4N0FA 3MLWH 4UT9L 3PDDA 1UG9A 2WBKA 4R8WL 4PREB 2FEDC 2R29H 1EH9A 2ICEA 3QIUB 1UKQA 4XVSL 3C6LD 5EU7C 4KRNA 5ALBH 5KSVB 1NCBL 4IOFC 3S4SG 1ETZB 1HQRA 3HUJA 1MCSA 2A6JA 1MIEH 2IWGA 5I1JL 3QB7C 4NN7B 1JGUH 1NCCH 2D03L 4MHHI 3RGVC 1IEAB 3QUXB 1I7TB 5IROC 5JO5B 4Z6AT 4GG6B 1N6VA 1KFAL 1KIQB 3O4LB 4OCRH 4DZBB 3QEHA 1JNNL 1CDIA 5EOCL 3HFML 4RGNB 2BXZA 3I75A 4NUGL 2MFNA 4R7DA 4ESKA 2F5BH 4IRSC 4OQTH 4HS8L 4H8WH 1I7UB 4K23L 5HDBF 5I0DA 1Y6MR 2X4PA 2FATH 2WMPA 1ODAA 3VXRD 4IDLA 3KR3L 2J4WL 5KN5B 4GQ9H 5IBUB 4DKDC 5K9OB 2WWKT 2ZUUA 2Z91A 1ZVYA 2X4RA 5ALCL 2VLRB 3DGGA 4GMSL 4X0KB 2YS4A 4YFLI 1U8JA 5IR1B 3INUL 1QYGL 5BRZD 5I30L 1D5ZB 5JUEL 2DDQL 5IWLC 4NZTL 4NO0B 1CWVA 1LNUB 4LVHB 4D9RD 2JJTC 1CZ8L 2H8PA 1FZOB 4KDTA 2CRMA 4FQLL 3HUJF 3OR7A 3OQ3B 2R4SH 5AD0A 1EEYB 4GFTB 4HXBH 4FA8A 5L2KD 1ORQA 1ZAGA 5B39A 2XN9E 3RWIB 5FYJD 4JE4B 1MCKA 2KQNA 3KWWB 3KPSB 1MI5B 4WY7H 1DN2A 3TBYB 1KT2A 1FZMA 4Y2DA 5E6IA 2DYPB 4UTBH 4O4YH 2A73B 4XMLL 1KCVL 1YEEL 4JM2C 3BP7A 2XZQL 1EVTC 1L0QA 5FKPB 3UDWA 1U8LB 4J6RH 1FNHA 1YMHB 4WU7B 1AC0A 3Q2CA 1RUKL 5B22A 1EEQA 4LCCC 1U8PA 4K8RH 5BZWB 3QIWD 1QZ1A 1CLOH 2BNQE 4ZUVA 2NY3B 4KUZL 1UWGL 2OM5A 4NO3A 4RNRA 5C9JB 1MNUL 4Y5XB 1YQ2A 4M43H 1FDLL 5HYJE 2VDNL 4K71B 3HPLA 3ES6B 3CFIC 1IGYA 3QPXL 2YPLE 5FKAB 4KPHL 4FZEL 3LEVL 3PF2A 2FCBA 3KPQB 2HT3D 4QY8A 2AP2A 1QRND 4NFDA 4YHZL 3FMGH 4Z7VB 2H26A 3VFTA 2X70B 1M7DA 3QIBB 3BGFC 1ZHKA 1BLNA 1N64H 5JOPE 1LK2B 3LKNA 4X98B 5GZOC 1R5WA 4HF5L 3GFUA 4LARH 2C5DC 3UEZA 3KYKL 5C0FB 1FV1A 4HUVA 4NNPL 1NC4B 1G9MH 4PJXF 5LBSH 3RNQB 3IF1A 3ZDZF 1QSEE 5HPOA 1DBAL 3QFJB 1HH9B 3P4NA 4XNYL 1ACYL 5I1CH 1XT5A 4Y4FA 2QADD 3THML 3HC4H 1CGSH 2DTML 2WAHA 5TQ2H 4TUJA 4L8BA 1LK3L 2MNUA 3S35H 2NY1C 1KENH 2DWDA 4OGXH 2DRUA 5HGDB 2GQHA 1DQQB 3BP5A 4MJIA 3O8XD 4MNQA 4LLVA 4JY5L 4P9HL 3RKDD 3UBXG 1WBXB 2VR4A 2ENYA 4OM0L 2J12B 3MGOA 2BRQA 4HJJL 1X4XA 5FF6B 4NJAL 3LQAH 1BJ8A 2ZUWA 1CF8L 3CC5B 4ODUA 1KXTB 5IMOA 2VWEE 4HKXA 3QWRD 3MROB 1L9MA 1U2HA 5D8JL 5GRJH 3RVXC 3MV9A 1WBYA 3LAFA 3JWDC 2OX5A 1EHAA 4LF3B 1A4KA 5BS0A 3O3AB 1P4IL 4MQSB 2GJ6D 5CILL 2C1PA 1G7QA 1RUQL 1TIUA 4CVZB 2YD5A 1T1WA 3W2DL 4X7TA 2PW2B 3QUYB 4PJFA 1CE1H 2H32H 2K7PA 5FYKH 2OYPA 4LRIC 4AT6B 4PJIE 1UJTA 1P7QB 1P4LB 1V3JA 1XF3A 4HMDA 1NBYB 3BN9C 3VG0H 3V79C 5T1MA 1OQXA 4RQQB 3PGDB 1RY7B 4QF1B 1PJ9A 5IVNA 1CGTA 3RWDB 3CH8A 4PJ9C 4PP2B 4RMUA 5L7XL 4OZHE 1OTTC 4J4PC 3RGHA 1OGAA 3QUKB 4JEGB 4KTDL 5IF0B 3WJJC 1I8MA 4AG4H 1Z9LA 3A67H 1V7ML 4PFEA 5TE4L 3KXFD 1FPTH 4GKOA 2A9ML 4JRYE 3PL6A 1NSNH 1AO7B 3FQWA 5HI4D 2C4FU 3W82A 3P77A 5GHWL 3FQNB 4HWEH 1PG7H 4EDXA 1H0DA 4WUUA 4UQ2A 2MTPA 4JQIH 5J06A 4DOHE 3ARBB 3P9MB 1J1OL 1OD9A 4FHBD 2ED8A 3G04B 4RAHA 5EU4A 4PJFF 3CXHJ 5IFHH 1BFVH 5CSZA 1AQKL 4L4VB 5E7BA 4OV6F 4X7SH 3TBWA 1KPUB 1QO3A 2CLRB 4KTEL 1A3LH 2HFEB 3GB7A 1MFEH 1Y6NR 2DQDL 5F3HB 1WISA 3VRIB 3PNWB 4DUVA 5C0BA 3VFSB 3IDJA 5I8CB 1F2QA 4O2EA 5L88L 3PABA 3TBVA 3VMOA 5KSAC 5KZCD 1GZPA 3OKDA 3MBEC 3DUUA 2JTDA 1NUFA 4ORGA 4XC1H 4JO2H 3UO1H 3HI1B 1R24A 2SEBB 5DVKA 4GAFB 1U8QB 1BQLH 4H25B 4HKBB 4LDOB 5KG9B 4M7JL 2VDLH 1ND0B 3C2AH 4F7MA 1A6TA 2PUQT 3OKNA 1G7IA 4PRIE 1XF5A 2ZNXA 2EIZB 2QSTA 1XR8B 5F96H 2C9AA 3NCJL 3DBXA 4DGVL 4JHWL 1GXEA 5CJOH 3VXUE 5GS2D 5EU3A 2BY1A 3MA7B 2GAZA 2YMXH 1J12A 3EOYG 5IBLC 5C0JB 1DUZB 1KCKA 4XB8A 3RHWF 2VZVA 1IEHA 4HLZH 4CU7A 3QHZL 3T1FB 3UJIH 1XGYL 1LE9B 3O6FC 4NZDA 2IPTL 4BZ1H 4WTXA 1PLGH 4NUJB 5IV2B 3V0AC 3QEQE 5GGSA 1Q9LB 2RJMA 1NUNB 4ETQA 5I1EH 2GEEA 3BJ91 4OIIH 2WQ8A 4X6CE 4Y4HB 5FYJL 4P57B 3G9VA 4P2YA 1I8IA 1OAUL 2Z93B 2PO6C 5ANMB 3EOTL 5E1AA 1YNTB 1SEQL 1WFOA 3LH2L 3GMOA 4W70A 4HWUA 5CD3B 2Z35B 3RWGA 3EZ8A 3MV01 2AJZB 1NGXB 2PXYA 4XNMA 5JPNB 2HVJA 1MF2H 1TLKA 3QQ3B 3NGBB 1LO4L 1PYWA 3BPNB 2XQYK 4MA8L 2DM2A 4HPOH 3LB6D 5CP7B 3HZYB 5DD0L 2HJLA 3IDIB 2JJSC 2YZ8A 1WF5A 3HI6H 4GRWH 1T1YB 3DV4B 3DXAD 5DJ0B 5DI8B 3WHXB 1PGRB 3RWHA 1CICA 1YEIL 3VFGL 5BW7C 3CVHH 4XC3L 1MOEA 4NIKB 3BH9A 4YQXL 2X4TB 4WV1A 2MWCA 3MACL 4X5LA 3VXQA 4Y19D 5DMGC 2IANB 5FHBL 2H9GB 3P0GB 2DQEL 4LPCA 4RAVB 2RCSH 3QZWA 4PRHA 4QWWC 4MQ7A 2AJYH 2DIBA 2XA8L 3FB5A 4JKMA 1Y0LA 2XWJA 5ESQB 1FNEB 5HVWA 3PHQB 1Q38A 3I9GH 4PRPB 2Q20A 4UUJB 1JMXA 4MAUH 2NR6D 3GIVA 3K0WA 3QA3B 1CD8A 1JFQH 3UJTL 4HKZA 1DFBH 5HYQA 1F11A 1RZGB 5LQBL 3B4NA 5I8EA 5K33A 1QSFA 5HVFB 3P4MB 1B9ZA 2GK2A 4OLUL 3RI5K 5BV7B 4C56D 2Z31C 1XGQA 2DQIL 1KN4H 5GS1A 3AMKA 1XGUA 4NQXB 1YEGL 4MD5A 2IQ9H 4ZOEA 4RGOL 3F8UB 4YDIH 1E6OL 4ZSOE 4XBGB 5FCUH 3RDTC 3V5KA 2BSSA 4RDQF 4IOFD 4NFCA 5DVLA 1QFWI 5D9SB 4ODWA 2YWYA 4TQEL 4I2XB 3FO2A 2PYEE 1HQ4B 3MLRH 5F7WC 3U9PL 2ADIB 3OMZA 3D0LB 4XP1H 2LU7A 4YDKH 1YN6A 4M6NH 5HYSB 4UDUB 5I9QC 3QO1A 2HFTA 3MV8A 4NHCH 4FG6C 3V8CA 3QHFL 4R96A 1IC4H 4U31A 2VLRD 4KVNL 4QRRE 5AZEH 4X80H 5TF1L 4IRSD 4NQCA 1GGTA 1ZLWK 3O4OC 1HOCA 3Q48A 4XCCL 4GRMB 4BKLB 3KPPA 4FS0A 4XPTH 4G9FE 3SY0B 4EQ2A 4XPHL 4XP9H 3VFVB 3EFDH 2Z8RA 1UVQB 4PGBB 3O2WH 1YJDC 4G8FB 4CNIB 4QTHA 4XWGH 5IK3A 2W9DH 3S98A 1K8IB 2NX5A 2VRAA 2ED7A 5CEXB 2ZUXA 4KZEL 3QDGE 3TV3L 3I3BA 2DD8L 4PRBA 3WHE1 3CFJB 4HCRH 2YUZA 3MFFA 4R0LB 3MJ8B 5EULV 3BIKA 3F58L 4P59H 3IDUA 4MNGE 3L7FA 5F7FA 4KUCF 5D6DA 3TPUB 1MI5D 3H7BB 1TJIH 2QTEA 2GW5A 4OTXL 2HJFA 5CJXA 4I0PA 1GGCH 4P4KC 3C60B 2DYPD 1MAJA 2Y06L 3WJLA 5GRUL 2FLRT 1IC7L 3S7GA 1FE8L 4PD4K 4P23A 4PJCB 3MRDB 1GAFL 3GNMH 4PG2C 3QG7L 3SGEI 1MFCL 4JFDB 4Y4KB 3STZA 4HIXL 4JPKL 1OWWA 4UIMA 4WNQA 5IMMB 2ITCA 5I1LB 3VXSD 3IT8D 1PG7X 5EU5B 4F7PB 4WHTA 2IBGA 4GBXA 2ARJA 1G0DA 5D1XC 4Q2ZB 4P4RA 4UB0H 1FBIH 4AENA 2Y36L 3MRIB 4HXAL 3BN3B 2DWEB 2FWOA 4FQQB 5L9DH 1IT9H 4HT1L 1G84A 3QIBD 3MUGA 2HA1A 5MHSD 4WU5B 1RZJH 3RTQB 1S7VB 2C26A 1DZBA 3KNBA 2DQUL 3TT3L 3NCMA 4KY1L 3TNNA 4KMTL 5T33L 3O11A 1RK0A 4KHTH 1G6RL 4JY6A 4LQFH 3MNWA 3OGCA 4UQ3A 3TZVC 3HAEB 4LEXL 3IETB 1KCUL 2E27L 5GZOD 5JHDB 2X09A 3VXRE 4PJ8C 4S2SA 3SE4C 4UT9H 1T6WA 32C2A 4JFYA 2FGZA 4R8WH 5INDA 3E6HA 3QUMB 4LKCA 2OTUA 4APQC 4B50A 4JPVL 1P4BL 4XVSH 2QQNL 4BFIA 4RISL 3GSRA 1NCBH 5BRZE 2EO1A 4G6ML 4MAYA 5J13B 4M1CC 3GSNB 5LCVL 3VFWB 4JRXB 1HWGB 1BD2B 6CGTA 5I1JH 1SMAA 1SBSL 3U46A 4D9RE 1J1XL 2C1OA 1PEWA 5DVOA 1C1EL 3EDFA 3QXUA 2D03H 2GI7A 5F9JB 4HUUA 1T7ZA 4YHNA 5IVZA 4PTTA 3ULVD 3N1QC 4R6UA 1WICA 1KFAH 3FT2A 1G9NL 2AXJA 4NKMA 4QRPB 2R2BB 5L2KE 2LU3A 1JNNH 5B4MD 5EOCH 3HFMH 3VG9C 3A6BL 3DX9B 4WFGD 5FYJE 3SDYL 1AGEA 4NUGH 4NZRL 5HJ3A 2R1YB 3AM8A 3IS0X 3QG6A 5DO2C 4U1MB 4HS8H 5LAXB 4K23H 3MSPA 1F6FB 1LWRA 3FOLB 5KVEL 4LLMB 3VWJA 3EO1A 5C0CB 3ZE1E 2G9HA 4QHUB 3KR3H 3AS0A 2J4WH 3RVXD 1A1OA 4HD9A 1NAMB 1B0GA 1D5XA 4JO4L 1H9VA 3C5JA 5ALCH 2CUMA 4GMSH 4K7PL 1GYAA 1TQBC 2AK1L 4G8GB 3H9SB 5J3HD 3OKKB 4PRNB 2JIXB 2UWEB 3G5ZA 3RWJA 1J88A 3INUH 1QYGH 3TA3B 2EC9T 5D1QC 4K55A 5I30H 5EZIL 2DDQH 5DT1L 4H20L 4NZTH 3H6JA 1SYVA 3ILPB 3AY4C 3TO4B 3K1KC 1CZ8H 4OF7A 3RZCD 4FQLH 2HRLA 1HXMA 2HJKA 4LLQA 5EDXA 4R97C 1JL8A 1S7SB 2DL9A 3ZHKA 1TTUA 1QRNE 3MRCA 5EU6A 2V5MA 3G08B 2EDYA 3MRHB 4NOBA 1N0LA 5DLML 4NJ9L 5JZ7D 4PJ9D 1CFNA 3B9KC 4PP1D 5CS7A 3D69B 3WKNA 2NLJA 1OTTD 3ZE2E 5ICYB 2R2HB 1RU9L 4C4KO 1BFTA 2F53B 4XMLH 5F7EL 4AZ8A 1KCVH 4EOWL 1YEEH 5I75C 3I02A 2A0LD 2XZQH 4RIRB 1RUPL 2P8LA 3ARBD 4XB7A 5SWZE 2YD6A 1OT2A 1RUKH 1IEAA 3QUXA 2MQ3A 3T3PF 5JO5A 4PGJA 4GG6A 2HTLC 1ZLSL 1A6UL 2GT9A 5FK9A 1JPGB 1KIQA 3GSOA 4I3SL 2NW2B 4KUZH 1UWGH 3O4LA 5DEZA 2B2XL 5DUBA 1MNUH 4GG8A 1BZ9B 1FDLH 4DZBA 1F6AA 1I7ZB 2VDNH 2WANA 2ZZUT 1T5XA 3X11B 5I17B 3QPXH 1U93B 4KPHH 4FZEH 3FO9A 3LEVH 4W4OA 4F7TA 3QRGL 4M03A 5IJKC 3TLRA 3ZSTA 4YHZH 5GSVB 2NZIA 2WBWB 3RL1A 3P40A 1P5UA 3KYNA 3RVWC 3TJHD 1RJLB 3GDBA 3RY5A 1FFNA 1C7TA 2BCKB 1A3QA 5CGTA 4HF5H 3ALPA 4WI4A 3KYKH 4NO0A 4TNWK 1UM4L 4NZJA 5KSAD 4NNPH 3WEXA 3IDYC 1NL0L 1DBAH 1I85C 4LSQL 4F7CB 3ULUC 2JLLA 2FO4B 5FCSH 1WVZA 2GJ6E 4XNYH 1ACYH 2VKXA 1EEYA 1A9EB 1U3ZA 3TH4T 3THMH 1FFPA 1GGBL 4CJ0A 1LP9A 3KPRA 4X5XB 2DTMH 2DLEA 2KL6A 1LK3H 4ENED 1J87A 4GG6F 3KWWA 3BAEL 3KPSA 4KV5F 4GSDL 2IBBA 1R3IL 1KPVB 4GW5A 2CDEB 1S9YA 2YC1A 4JY5H 4P9HH 4R4ND 1T89A 2EDWA 4P3WA 4OM0H 1K2DB 4HJJH 5ICXA 4NJAH 4PYGA 1FHGA 1CF8H 2AEIT 1U8LA 2YN3A 2DM3A 1I3UA 5DA4A 4MDIB 3LCYA 2VITA 1E28A 3ESUF 4IJ3C 3V4PL 5D8JH 3WIHA 1ZGLA 5CD5C 4Y5XA 2V7NB 4BELD 4Y4HD 3O6FD 4KRPC 1BM3L 1D9KB 1T1XB 4F33A 2F5AL 3KXFE 3I50L 1FNLA 1P4IH 5D93B 1RJYB 1S8DB 2JB6B 35C8L 5FKAA 5CILH 1RUQH 3KPQA 3D85B 1CDYA 1LEGB 4JCLA 1U8NB 3W2DH 2EDHA 3HMXL 4Z8FL 3NN8A 4N5EC 3D3VD 5E9DB 4U1IB 1QLEL 1DUYA 2XG5A 1MIML 3W0WB 4PJ5A 1JGEB 1RMFL 5EC1A 2GUOB 1INDL 3R1GL 3E8UL 4I18C 1LP9F 4JREB 4ODHL 4MLIA 5E5UB 4NKIL 3WIHL 3QUZD 4HAFA 2HN7A 1JF1B 2UUDK 4HK3J 1T7YA 1YPZB 3RNQA 1YEKL 4XHJD 3QFJA 5DRZB 4PLNC 1NKOA 5A2LH 5L7XH 1HH9A 1Q94A 3FFDB 1JF5A 2NXYC 4GXUN 3MLPA 1N8ZB 1RZKC 4KTDH 3EFFA 5T1LA 3GUTB 3VA2C 3WV0A 3K2MC 1RIUL 1V7MH 1L7IL 1MY5A 1DE4B 1TZHA 4WWKA 2B7DT 3AXLB 5TE4H 1TXKA 1ZLUK 2A9MH 2WINA 3P2TA 4L8DB 5J12B 1DQQA 5E95B 1XCTB 1PDKA 4PRAB 3DVIA 4ZPTB 3W81A 5GHWH 1WC7B 3BP4A 3BZDA 3RP1A 3Q6FA 1LO2L 1OT1A 4PRPD 1G7JB 3T8XB 1J1OH 3EJZC 2ERJC 2VDKL 1CFSA 5C7XL 4RCAA 3STLB 5FDWB 1AQKH 2BJML 1E4KA 4U1KB 3H9ZA 4KTEH 3FB6A 4WHDA 5A16B 1H8OA 1T2JA 2DQDH 4JGUA 3OR6B 2WBJA 4HIJB 4L3CA 2PW1A 3I6LD 4Y5YC 1T7WA 1NCAL 3S36L 2A83A 4Z7UE 4NQDB 5L88H 1CFQA 3HR5A 1G6VK 2FBOJ 3QUYA 2ED9A 4UU9B 2Z31D 2G75B 3I3EA 2D2OA 5E8EA 1DVFA 1FGNL 1P7QA 1ZLWH 1U8HA 5EO1B 5KS9B 3LKPB 3VA6A 1NBYA 2NY0B 3BZFB 5D96B 1CQKA 4LHUB 3PDGA 1BZ7B 4OZ4B 5CWSB 5EG6C 4M7JH 4JZOB 1T0NB 3RWDA 4OD3L 2VLLB 3H3PL 5FOJA 2VE6A 2VOTA 3G6DL 3QUKA 4O2CB 1J9CT 1LQSR 2IMMA 4WWID 1IVLA 3CZFA 4GAYB 1VFBB 2A6KB 4JLRB 3NCJH 2EYRA 3ETBF 4JG1L 4JHWH 4DGVH 4XPBL 1FSKC 3U79A 4EDWL 4PGDA 3P73B 4ZOCA 5ABDE 3G5XA 4MLSA 2DL2A 4JFPA 3C5SA 4D9LL 3N06B 3LPWA 4BUGA 4NQEA 1X7QB 3FQNA 3QHZH 1XGYH 1K8DA 3KLAA 1V3KA 3V6ZA 3IDGA 2IPTH 5D2NA 3HLAB 3QI9C 3P9MA 3DXAE 5ISZA 5IIEB 1RD6A 4M6OL 3I85A 3IJSB 2H45A 3RIAK 4L4VA 3LIZL 4XCNA 3EYFA 5FYJH 5BMFL 1WZKA 4Y19E 4FQJL 1OAUH 1W0WB 3EOTH 4M3JA 1SEQH 5C6PB 5HXMA 3LH2H 5EBLA 3VFSA 3QULA 3VFPB 4Y4KD 3WNMA 4P4KD 5I6XC 4ODXA 2CD0A 2DQFA 4G7VL 4PJAA 4HGKC 1LO4H 3BESR 1FFRA 3LRHA 4N8VA 1MLCA 4MA8H 5DC4B 3HE6B 1MHPL 4H26A 3HI1A 1DBML 3MRFB 5DD0H 2D7NA 3SKNB 3GGWB 3AU1A 5GZNC 4H25A 3UTSB 4HKBA 4C56E 1MJ8L 5KG9A 5C07D 4C58B 3DVFA 1ND0A 3ARGB 4PRIA 3C09B 2BK8A 5HVHB 3KYMA 4YHPB 1YEIH 2UVEA 3E0GA 5JLZA 5D1XD 3VFGH 1MCJA 3RTQD 3FRPG 4XVJL 4XC3H 1FL3B 5F93C 4YQXH 4R2GB 1OQOA 3MACH 3MRKA 5DJ2A 5DJZB 5DR5L 3L3DB 3RGVB 1OP9A 5FHBH 2XQBL 3F7YA 3VRLF 2DF3A 2DQEH 1JNLL 2QEJA 1DUZA 1HZHL 5C0JA 2XA8H 1JGDA 3IU3A 3GI8L 4WFFD 5JHDD 3REVA 3WIIL 3UC0L 1LE9A 3VDAA 4J3TA 4NUJA 3UJTH 2R8SL 1EIBA 2VLRE 5LQBH 1Q9LA 3TZVD 3KPLB 4KDWA 3HG1B 1MAKA 4X6CA 4F3FB 4M93C 5FB8B 4P2OC 1FN4A 4D9QD 1XGRB 3DPBA 4OLUH 4PJAF 4JQXA 4ONGL 4PJ8D 4HV8A 4CMMA 2DQIH 4N0UE 1CR9L 1YEGH 2Z93A 3RVUC 4K9EC 4RGOH 4JGJA 2E9IA 3D2UD 4WGVB 1E6OH 3VXPA 5CD3A 2J8UB 4PG9B 4QRPD 4LPUA 4M1CD 2AJZA 4TQEH 3ZZ1A 3QWOA 1A4JB 2COQA 4YC2C 4M61B 4DUXA 5JPNA 1FC1A 1CE6A 5F9WC 5FOBB 1NGZB 1B4RA 4P46A 1IAKA 1MI5E 3AS2A 1EBAA 2PF6A 5F6HI 1NAKL 1X4ZA 1UXSB 4AK1A 5J56B 2AW2A 3IDIA 5IB2B 3ROLB 2WWMC 3LV3A 3BHBA 5IEKB 3DV4A 1JTOA 3QHFH 2Y4SA 1NCNA 4KVNH 5DI8A 4G8GD 3KS0J 3AREA 3BGMB 4FQXC 2JIXD 4WW1A 5TF1H 4M7ZC 4BQ9A 5B8CA 4RA0C 4XCCH 3HB3D 4YNYB 4NDMB 5MI0C 5M94B 1ZSDB 4XPHH 1MHHB 3WS6C 1CLCA 4PBVC 3L3JB 4QOKB 1FVCB 4LCCB 3VXSE 4X6CF 4RAVA 1J1PL 2NPLX 3LKOB 3CLEL 4KZEH 3TV3H 3VE0B 2P8MA 4HIHB 4IIQA 1G0XA 2YXMA 5D7JB 4ZUSA 4EIGB 1OTUD 2DD8H 5FA4A 5J57B 3NIGF 2X89A 4L4TB 5KSUA 4Z7VE 1QFWM 3F58H 3EUUA 5DK2B 3QJHB 1XGPB 5MHSE 4MGXA 4OTXH 1EUUA 1N3NA 1BOYA 1K85A 2HFFB 2Y06H 5BOPA 2WW8A 1XF4A 5GRUH 2HMIC 3ZKQD 2WZPD 1IM9B 1IC7H 2OCFD 3ARYA 2W0FB 2CDFA 1HDMB 1LO0L 4P3CL 1EPFA 3HE7C 1FE8H 1EO7A 4M8QA 3PWPD 1DANU 3B9KD 2MPAL 1GAFH 2OS7A 4XBGA 3D39D 3QG7H 1MFCH 4XPAL 2OP4L 4UOW1 4OLVL 4HIXH 4JPKH 1IAII 5D9SA 5F8RC 3SE8L 1MCQA 2XKNB 5H2BA 4W6XB 2X4QB 5TQ0L 1AKJB 3DHMA 1I3GL 3TYGL 2HTLD 2Y36H 3CFCL 3KPOA 4HXAH 1FL5A 1VA9A 4LP5A 3PWUB 5K9KA 4HT1H 4G43A 4OAWB 2P47B 3SE9L 2GSIB 5C2BL