3O6LH

Anti-tat hiv 11h6h1 fab' complexed with a 15-mer tat peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWFCQTPEKRLEWVASISSGGSYTYYPDSVKGRFTISRDNARNTLYLQMNSLRSEDTALYYCARDYDYGVDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 11H6H1 Fab' light chain
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lH01
4X5WB 4RMRA 4QRQA 1RUAL 3G6JF 5INCB 1F3JA 1JPSL 3X11B 2NXYC 1S9WA 4U1IA 4ELMA 2PTUA 4NC1C 1A0QH 2R56H 2FWOA 4NKIH 5FOBB 3LS5H 4YDJA 2C5DC 2ENYA 3U30C 2XZQH 4NKOB 1TZHB 2F5AL 4ZAKD 1NCCH 1MHHA 2GSGB 5C0CA 5IVXE 4OAWB 3MV9B 5D7IA 1KGCD 5FO9B 5H37H 4XMLH 1G7PB 1KPRB 5C0ND 3QCVL 1FAIH 1F6FB 5HPMB 1N0XL 4MLSA 1A9BB 3C8KA 4WVRA 2FL5A 2P49B 2EDJA 3OKMA 3LQZB 5FB8B 2VLKA 1U3HD 1I7RB 2OJEB 3VFMA 2DQDH 2ATPB 1PSKL 2DTML 1VSCA 1U91A 3HTLX 2EYSA 3RBGA 2BY2A 5GRJH 1OP5K 3MV01 1KIQB 3MPCA 4AQOA 2H32A 4JPIB 3BEWB 2ZPKH 5C6PB 1JV5A 4JDTH 4LLVB 3VFRA 4ONHB 3TVMB 4K8RC 1KLFA 2COQA 4HH9B 4XVSL 4ZD3H 4NP4H 4TSCH 1J1OH 3OX8B 4UIKL 4AL8L 1UQSA 4FZEH 4O4YH 3WIHL 4PJ8B 3LEXB 1DBBH 4I8DA 4WFGD 3SDXB 5ID1B 2EDBA 1MFNA 1REIA 2XWTB 2OJZH 1FVEA 3OKDA 3OQ3B 5IWLC 1P5UA 1QHOA 3EYOB 4E5XB 4JRWA 4HQQH 5DSCA 2VLRD 3NZHL 4Z76A 1X6NA 1FBIH 1OAUH 3WLBB 2NX5E 1R3LB 5I8KL 1NBYA 1A1OB 1J05A 4GG8B 3HLAA 3BP5B 3KXFA 3JWNC 3U48A 5IWLA 2WIIA 4GBXC 1LE9A 4XPTL 5CJQH 5E9DD 5BW7C 4F7CB 5F7DB 1JN6B 1ZVSB 2JJWA 2PETA 2BVYA 4K9EL 4X9BA 3IJSA 3GSRA 5FYKH 4FQXA 3QEUA 2FHCA 1QQDA 3PWJA 3ARTA 5C1MB 5HGDB 3G6DH 5DDHB 4JFQA 5C0FB 4WY7H 5DMKB 3LRSA 2J4WL 5KSAD 5B4MC 2RB8A 4NOBA 5IBUB 4K94L 1MCWW 1EJ6A 1QLFB 4NWUL 4L3EB 4BJLA 1RHHB 1JZ4A 3UTPE 1WWBX 2LTQB 3QXDA 5C09A 1KB5H 5HYSG 1QBLH 5FM4A 1QRKA 5FGBC 1PLGL 4MSWA 2OK0H 4WU5A 2IH1A 5HYIA 3CGTA 3FMGL 5E70A 1LP9A 2OZ4H 1G7QB 2GITA 2AABL 3QXAA 4Q97A 4RISL 1CICD 3HNTL 3RWDA 2W9DL 1CLYH 1IGFL 4QKXB 2NY6C 2Z92B 4OI9A 1A3RH 4WO4B 3PHQB 4MDJA 5CKAA 1G9NL 3GMRA 4JPIA 4XBEL 4U1HB 4NDMA 5F1SA 5TGBB 4PGCA 4ZUTB 1A6VL 5D7SL 3K3QA 2I5YL 1JNHA 4UILL 5LAXB 1W0YT 2F58L 5D2LA 3V5KB 4GRWF 3MNZB 5ID1A 2DICA 5E08L 1TZHA 3B6SB 3WN5B 2ZOLB 1ZT4B 2GT9B 5T1LB 3C2SA 3FL7A 1PBYA 1UM5H 4GAJL 1FSKC 1TZIA 5CGMA 1WF5A 4PTTA 3MV7A 1Q9LB 5I75C 3U0TA 3CVIH 4KJWD 1MUJA 1KCSH 5F3HB 2GJJA 3MRCB 4HWBH 5IGXL 5E2JA 1EUUA 3GSVB 4PRBB 2ARJQ 5FGSA 3T4YA 2HWZL 3BPLB 3O6MH 1TJGL 2VC2L 5CZVL 3NPSC 3RVWC 1MY5A 1TVBA 3OKNB 5MEOB 1D9KA 2ENSA 3VDBA 3HE7C 1C7TA 4HKJB 4JY4A 2NW2A 1T1XA 4L29A 4J3SA 4Y4HB 2D7NA 4XNMA 3B8SA 3HNSL 5TF0A 3CX5K 2ID5A 5LWYH 1PEWA 1KJVB 3EW3B 3RBSA 1A3LL 3CX5J 4TRPH 1D9KC 4WGWB 5KSBB 4IEFB 3VFUA 5ICYB 2ED8A 3RKDC 4NO5A 1G6VK 5F6HI 3RU8H 2I9TA 1LP9B 1VEMA 5KOMC 3D87B 3HRPA 4GAYA 3TPUA 5FHAH 1F3JB 5AEAA 2B1HL 4F3FA 1XGTA 3L9RB 4OGXL 2Z93B 3I9GH 3VXRB 3H9SD 1IAKB 3HPLA 2E7LA 4XMPL 2VR9A 4XPHL 2AEQL 3H42L 4YJZL 1BBDL 1MAMH 4G6FD 1JZ5A 4O5LL 5EFIA 3MFFA 1D5ZB 5IHBA 1AGDB 2P5WE 3H9YA 2BC4A 3DTXB 3VGBA 3SDYL 5DA0B 5HYJA 5TFSL 1R5IA 1RJYA 3BGMA 2VWEE 5BRZE 2I60L 5H37G 4E41B 1MRCL 2VH5L 4M62H 4N0UB 1G6RH 5GRXG 1RUPH 3MJ6A 5ALCL 3RY5A 1AGCB 5GS0L 4CU8A 2BVTA 3OKKA 3SDAD 4ODSL 4JFEE 2ZUVA 3RHWF 5J3HC 1A6PA 4I5BB 1F4YL 4Z7OF 2G9HB 4OD1L 5BOZG 3AM8A 3K1DA 2J8UA 3EOAA 3TC9A 5DZNA 3MNZA 5D1ZA 2JKXA 4ZFFA 4NJAL 5CCKL 3PP4H 5BO1L 3NFPB 2EE2A 1UQSB 4D0DB 4L4VD 2DQFB 2EKSB 3A0OA 4XVJH 2CRZA 2P5EB 1EZVY 3SQBA 4LPWA 3W9DA 5E8EB 3U6RB 5CZXD 4F37F 4R97C 5F7UA 2IAND 1KENL 1S7UA 1T2JA 3SJVB 4XC1H 1XCTB 1QKZH 2W65B 3WHE0 1C5CH 2BK8A 2J8HA 5BXFB 3WNOA 4XB7A 4XPHH 1SY6A 1Y0LA 4K94C 4WTZA 3LZFL 1ZE3C 5IW6A 1QSZA 4XRCA 1JHTA 4LVNB 1MFCH 1T1XB 1URLA 2QQQA 3F5WB 4NCC2 2AJZB 4HS3A 4WI9A 1INQB 4UINL 4O9HL 5EOCJ 1T7WA 2ADIB 2Z31D 3QEHB 4L5FH 4YK4C 1MOEA 1I7TB 4P2QE 5GGVL 4ZS7L 2GJ6A 3STLB 1DLHB 4BFIB 3ARUA 4JO2H 1PJ9A 2IBZY 3GSWA 4HG4J 3OR6B 2BNQA 3MACL 1J10A 2R9HD 3B83A 2A0LC 5F1KC 4JY5H 2E5EA 3D2UA 2OM5A 4ZNEA 5KW9H 4Z7VB 5LGHL 1KLGB 4NQED 1MCKA 1NCAL 4I1NB 5IMLB 2PXYB 4K3EH 4OZHE 5KJRH 2ZSVB 5T1MA 2XV6B 4X5XA 4C56A 4I4WA 1U36A 1D6EB 4F7MA 3I6GA 4RMUA 2JF1A 3M17B 4R2GD 4HDIB 1YNTB 5JPMB 4JM2A 3U2SB 2EIZA 3QR2A 1T83C 3QBTB 5GISL 1QEWB 4JZJC 2BP3A 4ERSH 1PYWB 2X44D 3WUWA 1JNLH 2FJFA 3W0WB 2JCCB 4OV5B 2ZKHL 1NCWH 4PJ9A 1R3HA 3WDJA 4OUUB 2AJUL 4JCMA 2IBZX 4EN3C 5F70A 1GHFH 3VFSB 2H8PA 5J7CC 2NXZD 3LD8C 3G5VB 5GRZA 4F8TA 3BN9C 3P4OA 4HSQA 1H3PL 5T3ZE 3TNMB 3RJDA 2YPLA 3TP4A 1KG0B 3CZFA 3HI1B 4OLUH 5D2NA 1YEKL 1KIPA 3MLXH 2Z91A 3GIVA 2JLLA 4Y5YC 4PJIB 4P49A 5BXFA 1BGXL 3L95B 3D85A 1R0AL 5K9OB 5KZCB 1DN2A 1MCBA 1K4CB 1ZLWH 2QQKH 3UPAA 4LCWE 1I8IB 2DKUA 1XGPB 3ZDZE 3IDUA 1FYTE 4IIQA 4R0LB 2J88L 4L8SA 4PGBA 4P2QD 4MA8L 4YDKL 3GI8L 4HUUA 4I13B 3MCKA 4WTXA 1FVCB 2A2QT 2CO6B 3KPSE 3E6FA 1A7OH 2MPAH 1LVEA 4LEXH 5HPOA 3PJSB 3RTQB 2CPCA 3N1FC 4JZJA 4Y2DB 5H94B 3AREB 1YY9C 2GJZA 1GGTA 4MX7B 2HLAB 1I3GL 1J0IA 4PJEA 5GGTL 5CBEB 1KNOB 4JFOA 5L8LB 3BPLC 1HK6A 4LHUD 4AZ8A 4JRYE 4HKBA 1A22B 1XZ0A 3RWCB 3C09B 2AEPH 4OCRH 2Z9TA 3VD3A 2CQVA 3AC0A 5H8DA 1HDMB 3F58L 4XXCA 5MI0B 2DBLH 3B3IB 5IQ7H 1ZGLM 5E7BA 1KELL 3QI9B 5GS1B 3L7EB 1HHKA 3GGWB 3K74B 4IS6A 4PLOB 5C0EB 5EZJA 2YPKA 5GS0C 1IBGL 2VLKB 1BLNA 2AERT 1HXYA 3O9WB 2DTSA 5FA4A 5KVMC 4J6RH 4K9EH 1XH3B 3IDGA 1HIMH 3T0EB 1ORQB 4FS0A 4LCWB 4UZGA 4G5ZH 1HH9A 4LMQE 1W8NA 4XPGL 4X7SL 4HJ0C 1PGRB 1LO2L 1YQVH 1TTFA 4XCCL 3QZWG 1I9EA 5BVPH 5LG1A 1DLFH 3VH8A 4D8PA 1Z5LB 4K94H 4QOKE 1BPVA 2XTLA 2DYPB 2WBWB 1MHHB 2GSGA 3IDYC 1TCRB 5T3XE 4DN4H 2W0PA 3NN8B 4TYUA 1I1FB 1OAXL 5F7EH 4N0CC 3L5WA 2PYFA 5FCUH 3RNQA 3X11A 3NFNB 3OAZK 3QI9A 4M9OA 1IGFH 3VG9B 3QUXA 2DLIA 3UTOA 4JFEB 5T1KB 4LAQH 2X4RB 4P4KA 3ZDYF 1JK8B 1CN4A 5LBSH 4QO1A 5CILH 2BSSA 1B3JA 3VXTA 3V4UL 1C12B 2CKBL 1DBMH 2AEWA 5GS1C 2KDGA 5E6IA 3UJJH 5ITBH 3QI9D 1FDLH 1FL5B 1KLUA 3PWJB 2Q8AH 4JRXD 3AS0A 1DSFL 4WFGE 1CGVA 4GO6B 2KUTA 4CVWA 4CU6A 5DRNB 2PW2A 2A77L 3GMQB 4G7VL 1K4DB 3ZKMC 1BZQK 1E4XI 3CFBB 2NX5D 4X98A 2FO1A 5DHVH 4N1HB 3EO1A 4DOHB 4XCCH 3OKOA 5FO8B 1P4IH 4M7LL 5K9OA 5ICXB 2DYPD 2XG5A 5BV7C 5EUOE 2IH3A 3IDNB 4CRPA 4PJFA 4M1GL 4EDWL 4KZEL 1Q8MA 5F72S 1A02N 1U3HB 4XC3H 1V3JA 3CIQA 5EG6C 3WNLA 4NKDA 4NDMB 1FCCA 5EC1A 5IHLB 3BIAX 1EAPA 1K4CA 2X40A 3WXVL 4M7ZB 3K2UH 2AV1B 2BNRA 1N5AB 4F7PA 1FL3A 1YEEH 4WI8A 3G04A 1J8HA 2XQBL 1UACH 1T2QL 3PQYE 5JXEC 1DR9A 2PO6B 5K9QG 3PIQB 4G7YL 1DN0B 3RUGB 1QNZL 3WSQL 1AD0B 3VFOA 2ZUQC 1MF2L 5ETUA 1X5ZA 3MRFB 1ZLUK 2XY1A 1DVFA 1UXSA 3QUMA 4TVSa 4YNYA 5DJAA 4U49A 1FAKT 2VDKL 4P46B 3WLWC 3KG5A 4I2XE 3VMOA 4HC1L 3ZKXB 4CVXB 1LO4L 5F9JB 4YXKH 2HTKC 5F88B 5IJVB 1OSZA 1O5DT 1K85A 4YPGB 3FB6A 4YXHH 3SGEI 4G8FA 1IAIL 3V8CA 1LD9B 4NWTH 2G60H 5TQ2L 3P4OB 4Y5YB 4K71B 4N0FA 4JY6B 2WUBH 5FF6B 1PKQB 4KMLB 4XBPB 4G3YL 2CK2A 1P4LA 2QV2A 3LPWA 4OB5L 3WFZA 4KZEH 2YD2A 1JYWA 5KSAB 2A73B 5E0QA 43C9A 2XA8L 1CG9A 3IDMB 2VLJA 3SGDH 1BQLH 1UWXH 2C1PA 4KTEL 1A6WL 2V7HA 5I8EB 4DK3A 3BKMH 4UV7H 1FYHB 3BFOA 3NOIA 4X7DC 1JBJA 3JVGA 3VFWB 4IJ3C 5F96H 4PRIB 2EH8H 3T3ME 2BX5A 3VXQB 3TFKD 3AU1A 5DEFA 1K8IB 3K46A 4XBGA 1MJJA 4N8CL 3FFDB 4PRHE 3W39A 3WFCH 1IGCH 5TDOA 1MRFL 3UZEA 1BMGA 1FNFA 3LD8B 1CR9H 1J8KA 1D5IH 1XGUB 3AREC 4X0KB 3VXSD 4M7ZC 3NIDE 43CAB 1BREA 3E2HB 1FIGH 4NKIL 4OT1L 2WWKT 4NFCA 4LEOB 3BGMB 5CWSA 3BPOC 4L1DA 2VXSH 3DRQA 2PW1A 2VAJA 2X9YA 2PKDA 3QYCA 4PJAF 1AY1H 1JPGA 1U93A 4NN6C 4OZHA 2DWEB 2O5ZL 3VFPB 2CLZB 1A3QA 1TJIH 4JO3L 1UB6B 4IRSA 4FQXC 3S7GA 1AH1A 2D3VA 4LL9A 5BW7A 3IKCB 4G9DB 3DRTA 3MREB 1YNLL 4I77H 4M3KB 5FGRA 3I2CL 4PJ7A 3RWGB 1JF1B 4GQ9L 4I48A 2WUCL 4RDQG 4XPFH 2YRPA 2NY7L 2DD8H 4ONFH 2EKSA 4R4FL 1FN4B 3WHXA 4M61A 1KJ2A 3Q5YA 5JHDA 1FLRL 3ES6A 4Y16B 3L3KB 4YIQA 2AXJA 4WNQA 2R0WL 1MJ8H 5E5UB 1K8DA 4H26A 4OZGF 1AR1D 3DYOA 3I84A 1E4WL 1I1AD 3T65B 3MZGB 2XKNB 3LPFA 1A1NB 1LO0H 2P47B 3KS0J 4S1SH 1N5YH 3HRZB 3NIFF 5DD1H 3CMGA 3RWJA 1AR1C 2JK5B 1F42A 2UUDK 2Y7QA 4ERSL 4R6UA 4GAGL 5IHZA 5JNYA 4J1UB 5B38B 4JFYA 3IU3A 1KJ3H 5DZOA 3VXMA 5B3JF 1MCEA 4DUWA 3MYJA 3OXRB 4N0UA 2ADJA 4QT5B 3Q1SL 3PWUA 1KT2B 3DX9B 3P30L 1B9ZA 2D03H 4WJ5A 4JZOB 2DJUA 4LLUA 2EDNA 5AYQA 3K8MA 3GMPA 3C2AH 2FX9L 4ZSOE 4GMTL 3O2VL 5T5FH 1ZLVH 2VLLB 4PPTA 6CGTA 5EOCL 5D5MF 2YPLE 4QF1A 3RU8L 2F15A 1LQSR 4K2UH 5I8OH 3MV8A 1ZHNB 5JW3H 3UPRA 4LSVL 2HKHL 5FAAA 4WHCA 1U2CA 4PJFF 1UJ3B 1DQDL 1U8IB 2VKWA 4RMVA 4ODSH 3V6ZB 2DAVA 4PLNC 5E8NB 5DHYA 1Z0NA 3FFCE 1BF8A 2VDNL 4HGWB 5D1XB 3RQ3A 3STBA 3QH3A 4F9PC 2VABA 3TO4C 4BK4A 2GJ6B 3BPCB 4N0CD 3WNKA 5KN5B 3QXDB 2ITCB 4MQTB 1U3ZA 3HS0A 2E9JA 1A2YA 1OAZL 2IMNA 4LIQE 1PX4A 2AJXL 1BVLA 1DDHA 1SY6L 4XAKD 2V5MA 4M6NH 5IEHA 3O2WL 4D0BA 5F3HA 2X05A 4GRWE 5F3BA 1JPST 3NIGE 3PQYB 4R26H 2EYTB 2H45A 3ARPA 1P69B 4JPWL 1LE9B 5E5RB 1RK1A 4N1CA 4MHHI 3O45A 4WO4C 4ENED 5DI8B 3D2UD 3BMWA 4DW2H 4MD0B 2Q6WA 3PGCA 5CLTA 2GYSA 4LPYA 4R97B 1WV7T 2BVUA 1J1PH 1RZ8A 4HK0A 1CQKA 3E8UH 4P2OA 4Z7UB 4Q6YA 2AJ3A 5I8OL 1IGJB 1UJ3C 1TNNA 3SE8H 2OP4H 4ZTOH 3HRZA 2O5YH 2K9UA 5ADPL 2IPUK 4ISVB 3D3VA 3LQAH 3WL9A 1O7SA 5IW1B 1YMMB 5E2WL 4X80H 4QTHB 5IG7A 1AXSB 1KC5H 3BP4B 4TRPL 2XQYK 3MRNB 3D48R 2WWKO 4ZPVB 5JW5A 1OAZH 5I2IA 4L29B 3FOMA 4QRSB 2DQIL 4OZGB 4NO3A 1MLBB 4ZOAA 3HZMA 5DD6B 1MCLA 3QCTH 4OV6F 2EXYC 1BZ7A 1XR8A 1MCPL 2C4XA 1OAKH 3B43A 3QWQB 3DI3B 4PRHA 3VWKC 3NIDF 4OFKA 2R69H 3TBYB 5IK3A 4CADA 1P7KA 1VADA 4JFYB 1NGQH 4M6OH 1CLZH 5FA3A 3E2HC 3BRDA 3QEQD 1T0NA 3KPRD 1YA5A 4L9LA 5GJTL 3SDAB 1S8DB 5C09E 1HHKB 4PBXA 1YJDH 3GSVA 1T0MA 4IDLA 4PRBA 3FONA 4AEHH 1ND0B 1NEZB 3GK8H 2DM7A 3ET9F 1M71B 4L8CA 3O6FD 4KVCH 4FFVD 4XPBL 4P2QB 4YHPB 2DI7A 2X70A 1H15A 4H8WH 3EYVA 4QHKJ 4OD2B 4E0RA 3GSQB 2FO4A 2LQRA 1VFBA 3BPNC 1B0GA 4D8PB 1C7SA 3VXUE 4OLUL 1BF2A 5A1AA 5J6GA 2JE8A 3T3PF 5HD8C 1WCQA 1CTOA 2IFFL 3VRLF 4Z0XA 2BXYA 1UM4H 1CGTA 4P46C 2VXQH 4TUOB 2P24B 1MCIA 3V0WL 1P7QD 1MIMH 1AFVH 4PJGF 3ZTJH 4DVRH 4L4JA 2HKFL 3MUJA 3C08L 4N68A 3BZ4B 1BEYL 2HLAA 4O2FA 4PS4H 3FOMB 4BSVA 4JDZB 1S7QA 5KVFL 4JPVH 3VWJC 4K07A 3VXOB 3CPLA 4IRJC 1KB9K 2VLKD 2JELL 1XZ0B 1AIFB 4P5TC 3KHOA 3T0ED 1KV3A 1DVFC 2ESVA 1CLOH 4O2CA 4EZMA 2C3VA 2UUDH 4Z7WA 1MFEL 5MENE 1P7KB 1VADB 4MA1B 1KJMA 3H0TA 5GRJL 2DBLL 1AQDB 4FZ8L 5EU6A 4ELKB 1BHGA 1MJ7H 5DJCA 4FFWC 4PB9H 1BWMA 1N64L 4YUEH 1VERA 1RMFH 2EH8L 5DURD 4XXDA 5DJZA 3QJFA 1IC7H 1NGXA 1E4JA 4O4YL 4KKNA 4FABL 4LKCA 3O6KL 1V7NH 1JCKA 5TH2B 4MNQE 2AK1H 3BRGC 1CR9L 5DMGC 4TPRL 4Q2ZA 1AXSA 5HHNA 1AKJA 5B39A 3AB0B 4X99B 1FVDA 1VPOH 1A9EB 1EHAA 3CXDL 4HIJA 4B50A 3NIGF 1AXTH 2BXZA 1S5IH 5I30L 3AUVA 2BNRB 4PJXE 2RJMA 4G9FE 1G7MA 2JB6B 5I1KL 2EDLA 5GJSH 3ARDD 2P43B 4HPYH 1C5BH 4GRLD 3SO3B 4MWFB 1KXQE 1OF2A 3Q0HA 4OKVB 2O61B 2XNAB 4PJ5B 3HUJA 3MX0A 1U8JB 1XR9A 5JR1L 1X5FA 2NCMA 1WT5C 5I1LB 5JLZA 4NQSA 3ZDYE 1ZT1B 3MBEB 4HWEH 4N5ED 4BZ2H 4UTAL 2J4WH 4U2YA 2D4DA 4PRIE 5EU6E 3VRJA 3ARDA 5EBWB 3OB8A 2VLKE 1RSFA 3G5YB 3QZWA 5TPWL 1I3VA 1NGWA 3VWJB 3C60B 1DBBL 1M6OB 3UBXB 1S9YB 4HJJL 1IAOA 2Y25A 1S7SB 4M7LH 2UZXB 3B4NA 1EHLH 1HQ4A 4U1LA 4KTDL 1AHWA 5I73C 1ADQA 5HHVH 2OZ4L 1OGAA 5A16A 1MQKL 5D7IE 1L0QA 3AU1B 4ORGB 2YHGA 1BVZA 2A1WL 2W0LA 1I3GH 2WIMA 3IFLH 1MQ8A 4P48A 1YC7A 2OR9L 1NC2D 1D6EA 3K2UL 4ZDHA 4XNZB 5I1DA 3UTTE 4DZ8B 3H8NA 5C6TL 3FO0H 5AUMB 3PL6D 4HLZG 4F57L 3L5JA 4J23A 4OF8A 4NQCB 3BEVB 5ACZB 4DTGL 4LLVA 1UCTA 4BQCA 4GG6A 5IMKA 3RDTB 2CRMA 4ZAKA 3NAAL 3WHE1 1NGZB 5FGCB 2EIDA 1BZ9B 2JJTA 4GRLB 2Y07L 3QZWB 1SM3H 4Z7QF 4LPCA 2HFTA 1D5BB 4LCWD 1A14H 1AQDA 3R1GH 1KB5A 5EU6B 4ELKA 5ILTL 3MBED 2Q3ZA 3L1OH 4S11A 3L7FB 1I8MA 3S5LB 3QWRD 3FB7A 5GS3A 5D6DC 2DLFH 3MJ9H 1T2QH 2BCKB 1YQVL 3A6OA 4K8RD 4IM8A 4JQXC 4RISH 5C9JB 1YNKH 3WKMH 1EO5A 1SQ2N 2QTEA 3GZKA 1BAFH 3V7AG 3CH1B 1FGNH 2FEDD 5C0CE 1C8PA 4FQ2L 4NN7C 5GGQH 1TJGH 2VC2H 5E4EC 2QADD 4RAVA 3LKPA 4E41E 4YGVB 5I0DA 3OJVC 3SDXE 4X99A 1ULVA 3U1SL 3G6AA 4HUMB 4ELME 1BVKA 4Q9BA 1LDPL 4HS6B 4QY8B 4PJBB 2X70B 1DEDA 1FL6B 3WDIA 1GGIL 3ZDXF 4ZD3L 3TBSB 2OYPA 5JPNB 4MD4B 3KWWA 4PJBE 5J4MA 1IKNC 3IFOB 2GAZB 2IJ0C 4MJIE 1DL7L 3RVVC 4APQB 3DRQB 4HWUA 5D1QB 1N6UA 5I1EH 1A7BA 4ZS7H 2HJLB 4PY7A 3WHXB 2ICCA 1G7IA 4D0CA 4IRSD 1JHLL 3FO1B 3KPSD 1PSKH 4WUUE 2OL3B 5FO8A 4OIBA 2EH7H 4PFEA 3KXFD 1SVCP 1L7TH 4MAYD 5D2NC 1JTOA 2CJUH 2MWCA 5TH2A 2X4SA 4HQQL 3WNNA 4DCQB 5C0JA 4IS6B 1FORH 5EPMA 3TLRA 1HNFA 4TUJA 2FEEL 2XY2A 1S3KH 5IFJB 5DD5L 4PJ7B 3RWGA 3JWOL 3KYMB 5TFSH 1H0DB 4ZNEE 3BH9B 4ZXBA 3CPLB 2AGJH 3CVHA 3OGCB 1FN4A 5MP6H 3I3BA 5JHDB 3SCMB 2NY3B 3EBAA 1J1PL 3T8XB 2OJZL 4RX4D 3A6BH 3LSOB 3T3MF 3DGGA 1T83A 1KJVA 1KB5B 5IBTL 4Y5XA 1UA6L 4WFEE 3F12A 3WFDL 5C71A 4R0LC 3BD3A 1JNHB 5IVZB 3PABB 3G08B 1OOAA 1J86A 3HG1A 3WXVH 3MUGB 3B5TA 1CL7L 4FFZH 3D39D 4LASL 4M1DL 4Y16D 2IAMC 1MPAH 2WBJD 3NFNA 3CLEL 4V1DB 5KBNC 4JLRB 1ZHKA 3GI8H 4TULH 4ZSOA 1MI5E 1G9ML 2XICA 3TO2A 3R0MA 3RGVB 1QO3A 3FQTB 3SKNB 3P73A 3MUZ1 4OLVL 4Z7WE 3IU4L 5IFHL 1LEIB 2VAAB 5LXGH 1N8ZA 5T3ZL 1MRCH 2DJSA 3HMXH 4HPOH 2CDGB 4NPYB 4EUPB 1OARL 3KYOB 3QNYA 1KBGL 3MV9D 3BKJH 3SE4C 3F58H 5HGAB 1GCFA 5EO1B 4PP1C 5FECA 3RUGA 4IHOA 5MEND 2XIDA 1T0PB 2OQJB 3LKPB 2HMID 2B39A 1ES0B 3Q1SH 1Q0XL 1M7DA 3K1KC 3DVGA 1BZ9A 1ETZA 4JHAL 5FYKU 5SWZA 4U1KA 2GCYB 5IEHB 4LSSL 4F9LC 3T3PE 1KFAH 3D9AH 4JR9H 4DFIA 5TDOB 3HG1E 1YY8B 1DFBH 2Y5EA 4P2CG 2MNUA 4LCCA 1NLDL 1OY3B 4KI1A 4LNRA 5C08B 2QSCL 2R1XA 4MNGB 5IB5B 4CL7A 1Q72H 3WIIH 4BK5A 1FNSL 4FFWD 4K3DL 4KK5D 5SWSD 4YEEA 4V1DD 3LKQA 5JW3L 3SKMA 3RIAF 4C55A 1GGYA 4PJIE 1MAJA 3GMOA 4DN3L 5DR5L 1RUMH 1S7UB 4B5EA 2A6IB 4JVPA 4FMKA 3RGVD 1UJTA 2DQGL 3NZ8B 4HUWB 4HEPG 4ONHA 1D5IL 3NCBB 8FABB 1I9RH 3GSRB 9CGTA 5DEZA 1JNLL 5H35A 2D7TL 1CDBA 1ZLWK 2J2ZA 5I16A 1PZUB 4WENB 3R8BB 2VLME 1A6TB 2AJXH 1CYGA 2HKHH 3QUZD 4JKMA 4YBQC 4YQXH 4MAUH 1SJEB 4NSKA 3V8OA 3PG2A 3L3DB 5F71A 2I27N 2E6JA 3RWIB 3HNVH 1U8HB 3V6OE 5F7WC 2ZSWB 3ES6B 2ICWJ 4OZFA 3VFRB 1TJIL 3HG1B 4HBQA 4RBPK 3MLUL 1NBYB 2AJVH 3UYRH 4O5LH 1PD6A 1ORSB 5J9PB 1H3XA 4RFOH 2XN9A 4G8GE 1X4ZA 3WS6A 3DYMA 3ULUE 3N9GL 4P2OC 3MV7E 2P5WA 1UH4A 1UB6A 1UCBH 1FZKA 1A9BA 4FNLH 4AEEA 5DSCB 5DJ0B 4RIRA 2KKQA 2BMKA 1B90A 3KDMA 2HJFB 4NBYB 2YD8A 1RZIA 4AQ1B 3GJFK 2YKLH 2LU3A 5D6CA 1CGSH 1MLCB 1I9IH 4LPUA 5IVNA 1MFBH 1C16A 2YZ1A 3KPLA 2NZ9C 3O4OB 2VDOH 5TE7H 3VFGH 3MFGB 3Q6GH 1ZVYA 1S7QB 3ZE0E 3TO4D 1EVTC 1U2HA 3E8UL 2P5ED 4PRAB 2EDQA 3DO7A 3QUZB 5D7JB 3C6LB 4PTTB 3SKOA 3RFZC 3HUJE 4U6YA 2FATL 2A9MH 4NRYB 3O6LH 4K3GA 4XP6H 2DWDA 1H8NA 4S1DD 5C3LD 4P9HC 3BUYB 3CAFA 3TO4A 3IAPA 2PW1B 1ONQA 4I9WD 4POZC 5GS2D 1L6ZA 2UWEB 4WW2B 4YXLL 3MRHB 3HE6C 4EI5C 2WAHA 3V6ZA 1M71A 1FNGA 1IGIH 5CWSB 5SV3A 5BO1H 3QHZL 5SX5H 5C07A 4OTXL 1JHKL 1RULH 3EYVB 5EBLB 3GSOA 1WBZA 5DO2D 3MV11 3KPLB 5DS8B 3WSQH 5E94B 5ISZA 2MSPA 1BBJB 2XI9A 3IFPB 3KLAB 3F12B 1B6DA 3MA9L 5IHZB 1EGJA 4PJFE 4YK4B 2AJYH 4KDTC 1LO4H 4JZJB 3KNBA 5H94A 5JW4Q 1BQUA 4JY5L 1F6AB 4NQEB 2WW8A 2XKSA 1IMHC 1EK3A 4J4PC 4KFZC 1T7YA 5E08H 5CD3A 1KT2A 3DX9A 4NRZA 3ECBA 8CGTA 1A21A 5IFAL 4OBRA 4RIRB 1EEZA 4JFDA 5GGVH 2NMSA 5ANMB 5MEQB 3WKNA 4HUUB 2A74B 2O5XH 5L6YH 5JW4R 3T0EA 1HYRC 3FTGB 3NAAH 1UADC 2V2XB 3I9GL 4E0RB 2K3TA 4LCYA 2EE6A 4HHAB 1SM3L 1QSFD 2IPKA 1LP9E 1P5VA 5EBWA 2LAAA 3EYUL 3IDJA 5INDA 3NMEA 4PP2A 1YNTA 3R1GL 2NXZB 5GPRA 3GMNA 3SDYH 3PJSA 4AG4L 3RDTC 3U9PH 5DJ0A 4NO0D 4X6BA 5J8OA 1S9XA 4ONGL 2DQTL 4HUXB 4MQ7A 5DK3A 4EOWL 1P2CB 5CUSH 4AENA 1DP0A 3SJVE 3GNMH 4GLRI 1BAFL 5FYKL 2P8MA 3QQNA 1MVFA 2QQNH 5KTEH 4C59B 1S9KC 3NA4A 2IWGA 4OD3L 3RL2B 1OAUL 1KCVH 4U3XA 3RI5K 5CJBA 1N7ML 1XIWD 3CSYB 1AGEB 4AYFA 5ESAA 4Y16C 1RZGA 1H5BA 3TM6A 4LLMB 3SGKA 2W91A 1F4XL 3A67L 4WI6A 3VXSE 4BH8A 3QDJA 4X6EB 1FLRH 4Y4KB 5DXWA 3OGOE 1JGDA 2I9LA 4OCYL 1XGPA 1XGQA 5L0QC 3CK0H 2AABH 4Y5VA 3DSFH 2YPVH 4XRCB 2AKRB 1RK1B 2BOCA 1IM9B 1BQHG 1AO7B 2JB5H 2GK2A 4G7VH 3FOLA 3N1QC 1QBAA 4NNXB 4NYLA 5E6IB 4FA8A 1G9NH 5HGHB 1DDHB 1V7NL 3O6KH 3LEYH 2F53D 5D1XA 4KK5C 1KYOK 4I3RL 1JFQL 4QTIH 3WCYA 5F9OH 4JKKA 2ITCA 4OUOA 3TCXA 3EYFA 2VL5B 3CSBA 3CD4A 3U46A 5ISZB 2EC8A 1HOCA 4OCXH 1ZLUH 4PRPA 3IDYB 3C60A 3QRGH 4NO0B 2KBGA 5T1LA 1VCAA 1B6UA 2R0ZL 1A7QL 2FR4A 4OFYA 4Z7VA 1UEMA 1FRGH 1WC7A 3ARFA 2DQTH 2EDEA 1LO0L 2E7HA 1FZOA 3RVUC 4U0RB 3CSGA 4J6RL 3SY0B 5DUML 3HUJF 1WZ1H 4H1LA 1YMME 5D7SH 2CD0A 2AW2A 3G5ZB 3RNKA 2EDXA 3LKNA 4ZFGH 3W9EB 5IQ9B 1AI1H 3ZYZA 2C9AA 4OKVA 2O61A 1YN6B 1XIWB 1JK8A 2ATKB 3TJEL 1B0RA 5KSBE 4HS3B 4LCWA 1CLCA 3MA7B 2HWZH 1I1CA 3BZDA 1DBJH 1MCNA 4UOW1 4POZD 2XQYG 4YHZL 4QHNA 5F89B 4G8GA 2FX7L 3TNNB 4I5BA 4C83B 4HIIA 1OT1A 2WV3A 4X7SH 5E8PA 1VB9A 5E6ID 4BZ2L 4L8DA 4WUKH 2CGRL 1A2YB 4JFDB 2BVQB 3C6LC 1KTKE 3MGOB 3BT2H 3NCJH 1KPRA 1MIML 3FQRA 1RY7B 3UO1H 4UINH 1F4WL 5CD3B 5GZOD 1IM3A 3IRZA 3C6LA 3SKOB 3HE6B 3C08H 4B0MM 3S37H 5JXEA 1T1WA 3B9DA 3MCG1 1TVDA 5HGGS 1KJMB 3H0TB 5CGYD 4Z8FL 3RL2A 2GW5A 3U7WH 5GZOC 1OW0A 4W70A 5E9DA 1SJHA 2AJSH 4WFHD 1YEKH 3ILQC 3RAJH 3HFML 1IFHH 5CEYA 4OM1H 5DHVA 3T04D 1OD7A 3G08A 1ZWIB 4GG6E 1ROWA 3WFHB 1T22A 3KPPB 2R1WA 1YEFL 1P2CA 4LVEA 4MXVE 3GIZH 4GBXB 2CKNA 2CKBH 3FB5A 5C2BL 4PJ5E 1SY6H 5L9DH 1G7JB 1FL6A 4KHXH 3MRDB 4EIZC 3ILPA 2N4IA 5AZ2L 2V2TB 4XWGH 5I1CL 1X7QA 3NGBC 2Z31A 3S9DB 3GIVB 1I1AA 5A2JH 3E1F1 3N50A 3MUY1 4HFWA 4Z18A 5CD5D 4APQA 4N90E 2VSCA 2DQJH 5BS0A 3ARGB 2BDNH 5FDWB 4R4BA 1CTNA 1NJ9A 2CR3A 4FMFA 3OHXB 3QIBC 4JFDE 2M8XA 1TVHB 3HI6L 3DETD 3PP3K 4KXZH 5FUOL 2HVKB 3SN6N 3VXRE 3EZJB 5EZLA 2VQ1A 1J0YA 1IGMH 4YBHA 4MGXA 1FZJB 5T3XH 5IEKB 1NEUA 2PO6D 4GXUM 5CEYB 3WXWH 4M5YL 4PJAB 4OZGA 1VA9A 4MX7A 3D85B 3SY0A 4IRSB 5FGBA 3NCYS 4XCNB 3NABL 3I3EA 4BQ6A 4LDOB 3QIUB 3I6LD 2C1PB 4FQCH 3QUYA 4MJIB 4MJ5B 5E2WH 5KS9F 1EVUA 4HV8A 1FQ9C 4LCCC 5BV7L 2J88H 3TYGL 2Q76B 3ME0A 5F7MC 4MB4A 2YXMA 5DD3H 5CBAA 1QYGL 4PG9B 5GRVL 3UYRL 4L4TD 1YEFH 2Y9RT 1I1RA 2Z31C 3FT3B 3ZT5A 2LU4A 2VUOA 3SKMB 1EMTL 4PREB 3RWEA 5DRZA 1U92A 3S3SA 3QPQD 5I74B 1TIUA 2IF7A 4IHOB 1KG0A 1QG3A 5MERB 2R56L 5C0BE 5GGSY 3T09A 5ACZA 4N5UA 4O58H 2YWYA 3V6FB 2F8XC 3MACH 5AG9A 4HWZB 2F54E 3DLQR 5IQ7L 3O41A 3ZL4L 1I9IL 1LK2A 1RZGB 1CFNB 4ZUVA 3RVUD 1M6OA 1J18A 3M45A 1MCDA 4FG6D 4TTDD 3UBXA 3PHQA 4QHLA 2X4TA 5C0EA 1UWEH 3PNWA 4FFZL 4O02L 5D5ME 2H1PL 4UQ2B 3OV6A 1RHHA 1ZLSL 1IGML 2YC1A 2WIIB 4P57B 3CX2A 4KQ4H 3M17A 1AKJB 3DURB 3O4LB 2H9GA 4G42B 2IAMA 1JF5A 4RGNC 3O2WH 1IL1B 1QQDB 2W38A 3UYOD 5IF0B 4DZ8A 3G5YA 1LEKB 3EGSB 3B6SA 3WN5A 1Q1JH 4FQCL 5E8DH 4MDJB 3IF1B 1CGXA 1ZEAH 2HFGH 5JOPE 4DN4L 4M1DH 2IQAB 4NP4L 4QOKD 1LMKA 1T1YA 2UZYB 1T4KB 4HBCL 4FXKB 1X5AA 4ZXBC 5DGQA 2B4CL 4P2RB 4Q9QH 4JDVA 4QNPF 1VFAB 1S7WA 1MJUL 2QADB 4Y4FC 1CDCA 3CUPA 1I8IA 1NGYA 1KCUL 1L4IA 1X5JA 3BOVA 5ID0B 1FLTX 2BY1A 3EO1B 2OR8A 4LU5L 1IAII 1RZJH 1Z9MA 1N4XL 2EC9T 2XTJB 3HE7D 4EQ3A 5EDXA 5IB1B 4U7MA 1D3CA 4QXUL 3H7LA 3MQIA 1R3KB 1X5XA 3MLXL 3FRUA 5D1QD 3QP3A 5IB3B 5DRNA 3MV9E 5HHXH 4DWHA 2A6JA 5DQ9B 2PR4L 1ZAGA 5J13B 3HKFA 4XBEH 1WLHA 3MUHL 1TZGH 3CFKB 4HK3J 4NHCH 5HHOB 1T04B 4NQDD 4ODXB 3MRQB 1FORL 1M05B 1MCOH 5L7XH 5GS0H 2VSDA 1CU4L 1RIUH 1XEDA 1ONQB 1FYTD 2X7LA 2H2PC 2DM4A 4NBZB 1I3RB 1HE7A 1VGKA 1W72L 3CMOL 3GSNH 4JCLA 1E4WH 2NY3D 3KLAA 2JIXD 1IGYB 5MEOA 5MP6L 5I9QB 5F7LB 2EDTA 4HS6A 1DBAH 5KVEL 3C2AL 2W9EL 3A6BL 1OB1A 3IF1A 4ZUUA 1RK0B 1S7XB 5DS8A 4PJ8A 5EIVA 1NL0H 2MOVA 2V2WA 3EUUA 2XA8H 3CXDH 3IFPA 1CS6A 4BZ1L 4PJCA 2HMIC 5EFIB 1I1YB 4YO0B 4PRID 4Q6IB 4O00A 4UV7L 3QUKA 4NJ9H 3X12B 3BZEA 3LHPH 2IANE 3VXNB 2P7TB 2HT3D 4KTDH 4IRJD 4XC1L 5C07B 1YEHL 3LKRB 2HT4C 3JZ7A 2ATPA 4GAJH 4DCQA 1TCMA 4JGMA 1XR8B 5D5MA 3B9KA 1WIOA 1WUNT 1NBZA 5L88L 2BY3A 2FIRT 3R06A 4HS8H 2R29L 3P11L 3VFTA 3CDCA 1JYNA 4S2SA 1ZHKB 1H3UA 2YA2A 4BSWB 3LS4L 5ITFA 5F9OL 2RFXB 2W60A 4ETQB 1AE6L 3VI4E 2AXFB 2BOBA 4LVHC 2HP4A 1AHWC 4PRHB 5SWZE 3VXRD 5DJXB 3OAUL 3MYZA 2RIKA 4YBQD 3QNZA 2R0ZH 4U0RC 1HH6A 4MSWB 2A1WH 1IEBA 3VFWA 3PXHA 2G9HA 3PDOA 4NQXB 4PTUB 4JE4B 4L3ED 4H88H 4CVXA 4E41D 5ICZB 4HXAH 4FZEL 4HLJA 1NAKL 4G6KL 2C26A 2J6EA 2IGFL 4TUKH 5I1AA 5TGBA 5IK3B 3I3DA 3O81A 4R4ND 2QR0B 3S4SG 4LSUL 5C0RH 2R0LH 5DI8A 4AT6B 2A0LD 2A9ML 1GC1L 2Y1VA 2XWBB 5E95B 4LOUC 4H8WC 5D70L 5CSZA 4HGMA 1X6LA 4J3WA 4P0DA 4RQQB 4J3TA 1U3HC 4HDIA 3EJYD 4HGKC 5ISZE 1I3RA 2IC2A 5BVJA 3O3BB 3TBSA 2HLFC 3VFVB 3WEXA 2W0FA 3NCJL 3JTTB 3GMOB 3CFIC 3MMEA 4EBQH 1EBPA 4HUNB 3H3PL 4OUUA 2QSQA 4LCUB 4OSUL 1CLOL 4FXGA 5LGJA 5DTFA 2HVJB 2O5XL 3MA9H 3SKJL 4OD1H 1T7XA 3T1WA 3MRJB 3N85H 3QQ4B 1OTSC 5ALBH 2CH8A 1SBSH 1SYVA 3DARA 5FO7A 3ZKNC 4OF7A 1F2QA 2V17L 4EJ1C 3FMGH 4UTAH 1T03H 4N90D 1INQA 1QLRA 4P5TA 2NQCA 2G60L 4LFHD 4KI5D 5GSRB 5TQ2H 3TCLB 3IXTA 4M5ZL 3STLA 3MXWH 4HWBA 3NCFB 4X6CA 3ZT6A 2OQJA 2IGFH 3WJLC 4JDZA 1FCGA 1U58B 5T33H 5AD0B 5GRVK 1IEAB 4Y4HD 2ORBH 2B8OT 2VDKH 5EUKB 4JG0H 3QWOA 3VG9C 1WFNA 3C6SB 1OGTA 4OFIA 4KU1A 4AY0A 6FABH 2PXYA 3FQXA 2ADIA 4XX1G 5I8CB 1IAIH 5C08A 4PJDB 4GSDH 1NBVL 2AEIT 3ZYIA 1U8QB 1HEZB 4UIKH 5FHBL 4LBEA 2PCPA 3GMMA 3OAYK 2IFGA 3S88H 1CFTB 4M00A 5B39B 2CR6A 4E42B 1T3FA 4PJHA 1IM9D 3P73B 1U8JA 4LRNH 3ZHLA 3V7AE 1TDQA 2WBJC 4POUB 1KCVL 3QDJE 2D9QB 4G6FB 32C2A 4JFFB 4KH2A 3VXPB 5BVJB 4G8EA 4WI5A 1UWGH 1RPQA 4HIXL 1J1OL 3VJ6B 3IU3B 1NUNB 2V17H 3PWVA 2ZCKH 4GRMB 1CICA 4PJHE 3IS1X 3LDBC 2BVOB 4IDJH 5I15L 5JZ7D 1SEBA 4Q6IC 4AIZB 3ABZA 5J1AB 2DYPA 2UV3A 3IFLL 2YK1H 4GXUN 4WWKA 4H5SB 2V2TA 3MO1A 3VWKA 2DQEH 2MKLC 4L8BB 1PX3A 2GTZB 3WMSA 3L3JA 1ODAA 5HI4C 4JO4H 2AJUH 2ZUTA 4WI3A 3U1SH 3EYOA 4UMGA 3QDGB 2AJYL 4HKBB 4U7SA 1NAMA 1U8MB 4IOFD 3H7BA 4FQQA 1EO8L 1TITA 3UTSA 35C8H 4HIJB 1ZS8A 4HMDA 1PLGH 1VACA 4GOSA 1RZFH 2IPKB 4IMLA 2C3HA 1J8HE 4GBXA 4YEFA 1FO0A 1RMFL 2Y06L 3BP5A 2DRUA 3GGWA 4KUZH 4M6MH 5J1SC 4HFUL 4XB8A 1QSFE 3TA3C 4G9FD 5DUMH 2ZG2A 2L7JA 5SWQA 1LNUB 4X6BB 4LHJB 3W81A 4PG2A 2VLRA 1D5MA 2X4UA 4H1LG 2OXHA 4HC1A 4PLJC 3UTZB 1NLDH 1CFVH 4P3CH 4RAUB 4XXDB 4JFFD 1QSED 5CKGA 2BCKA 1KGCE 1MJ7L 1K2DB 2D0HA 3WIIL 1AO7E 3PV6B 1OHQA 5GSVB 4EI6B 1O7VA 2EEBA 5BZWB 1OP3H 1TTUA 1IC5L 3WD5H 1GSMA 1FZJA 1G7JA 2FD6L 5DJXA 2WLYA 3QEQB 2DLGA 1T1ZA 4WHYG 5EBMB 2Z93A 4RDQF 1CF8L 5EO9A 4GKNA 2AK1L 1N6VA 2HH0H 3LV3A 3RNQB 3ARWA 4N8PA 1E0OB 4X7CC 1YJDL 4Y5XC 4X9HA 3OJDB 1G0YR 3U4EB 1X44A 5E99L 1UH2A 1BQHA 5IROA 1D5BA 1RUKH 3VWJD 3QDGD 3C5ZC 5I1DB 1ZSDA 1NLBH 2VLJD 4JGJA 1U8KA 5EUKA 2A74A 1NMBL 4U1JB 3O4LE 5INCA 1T21B 3QCTL 4XH2B 1Q9WB 1GOFA 2F74A 3EOTL 4YR6A 4UIMA 3LEVH 1JGLL 3MLWL 5E1AB 3BZFB 3ARGD 4AMKL 1UZ8A 4HKZB 1UXWA 2VO5A 4YHYB 4UDTA 5JOFB 3TBVB 3HR6A 4NKOA 1LEGA 1HOCB 2R69L 2R0KL 3ELAT 2NY2D 1YEDB 2IADA 5FA3B 3PWLB 3UC0H 2R4SH 1QSEB 1NCWL 2AGJL 5MENA 2FJGB 1I8MB 4YHNA 5GJTH 5HSFA 3HC3L 5HDOA 1S78C 1BEYH 3N0PB 3TV3L 1EEYB 4NCDA 1S9VA 4JO2L 4NRYA 1KEMH 1IC5H 3EIFA 1NEZA 3WD5L 1FG2A 3DPBA 2FATH 2JJSC 4IOIB 1NEZG 2AEQH 3O8XD 4LARL 1QVOA 1E6JL 5EUOB 2FZ3A 2V7HB 4HEME 4LLMA 4Z7NE 4LSSH 3MTRA 4QHMA 1FFNA 2DL2A 2GJZB 2H6PB 4Z7QE 5KVEH 4UNTA 4PJFB 1Y6MR 4MXQC 3G5XA 4Z0BH 5J3HD 3BWAA 3HPJA 5C0IA 4Y88A 1HXMB 4AH2A 3RPIB 2BNUA 3DUUB 3FRUB 4GAFB 1CDHA 4PJDF 1S7VA 1H8OA 3MR9A 2VZSA 5DA4A 4K8RH 3K8KA 4NQVB 1G9NC 4PJCE 1Z9OA 3UTQA 3TFKC 4JKWA 2HKFH 1OWWA 1WFOA 4HWNA 5DWUH 5KANG 3BKJL 3OKLB 4BFGA 1HINL 5AG8A 5DD3L 4X8XA 4M62L 3ALPA 2MJWA 2B0SH 5B39G 1ZMYA 3WKML 5J89A 1MCRA 4D9RE 1D5XA 4O02H 2VDLH 3CVHH 1ZGLP 1GZQB 3JWDL 3U36B 1AXIB 3O4LD 4F15B 1R0AH 4KQ4L 4DUXA 4HCRL 1UG9A 2UWEF 3FQNB 4MXVF 3O9WD 4WW2F 3ULSB 3ULUC 4M8QA 4PJ5D 1KTLA 4DOHE 3GRWH 1DQLL 4PJAE 2NXYD 3NCCB 3DWTA 4LARH 4NQCE 4MNGA 5IB5A 2FECI 2FL5B 2M26A 4GKZB 2R8SH 4XPAH 1UZ8B 3ZTNL 4K2UL 2OJEA 1CZ8H 4LKCB 2D0FA 3O3AB 4PJHF 1JWSA 2VISB 5I1HL 4U6HB 1K9TA 3TIEA 5E2UH 1XFPA 4F7CA 1QVOB 1F02I 3O0RH 1JGUL 4GW4B 5FYJE 2J8OA 2OTUA 4Q6IA 5LVEA 2VDQH 4LEOA 3ARSA 4P2RE 4UU9B 4C58B 1ZKAA 4YDLB 4KTEH 1AXTL 3JXAA 3OKMB 1NC2B 2HN7B 3MNVB 1H15B 4ZUUB 4MA7H 4Q74A 1BFSA 3QNYB 4HBCH 1L0XA 1YYML 4ESKA 4PJ8D 1RUQL 4FQHA 4LCIH 5T3XL 1JHTB 4KK9D 5A3IC 2CMRH 3CU7A 12E8L 3D85D 4NC2B 1YEJL 2PTVA 3OG6B 3QUKB 5JOEA 4Z0XB 1HH6B 2Y36H 3HAEB 4PRIA 3L6FB 3JWOC 3FT3A 1IZKA 3P0YH 4W6WB 1Z5LA 5T5NF 1BQSA 2Q7YB 1EEYA 2WP3O 4IBLT 4ZTPL 3H9ZA 4UT6L 5M94B 1CFSA 1KBGH 1N4XH 4AEFA 3L3KA 1MPAL 1N59A 3QIBB 4JFFE 5MENB 5C92A 5E5MB 3DYPA 4N8CH 3G6JB 2Q3AA 1JPTL 4XX1E 4YDVA 1MCSA 2XKUA 5L2JA 1IQDA 3MNWA 4B7IA 2BMKB 5B8CB 1AC0A 3EO0A 1KCKA 3MRQA 3VH8G 1B2WH 5DVOA 3V7MA 3RGVC 5LXGL 3WBDA 4LHUG 4PGDB 2PYEE 3DX6B 4LLYB 2NZIA 4N9GA 4AJ0A 5I8KH 4JPKH 2DWEA 3VFPA 1DFBL 1AI1L 4HUKB 1WGOA 1U8KB 4R7DA 1UXSB 2VXSL 4DAGH 5C0AB 4U6TA 5IJKC 1GGIH 5HHQB 3UTTB 4WO4A 2Y07H 2Q7YA 2O5ZH 4CJ1A 4JFZH 4OGZA 4Z7VF 1I1AB 2DKSA 5EZLB 1EERB 1BFOB 2QEJA 4KGJA 5CHNA 4W6XB 1ZHBA 1N3NA 3LRGA 4OZFH 4KJQC 5JQ6L 1CXLA 3KXFE 1RIHL 4HIEB 5LAXA 4DGVL 3KPQB 1N5YL 5FGCE 1NJ9B 4GUPA 4KPHL 4EUPH 1BJMA 5C0NC 2EH7L 4X9GA 1TJHH 3CDFA 1XGTB 3L9RA 4I3GA 4U6YB 1CVRA 4MD0A 4OCSL 1A6UH 4WEBH 2J1KA 1CL7I 5HVWA 5D1QC 3P77B 4M7JH 2R2EB 1QFWM 3OB0K 5IVXA 1U3HA 4N9OB 4PRHD 4FP8H 1LGVA 5GGQL 2AS5M 4AK1A 3ZKXC 2FIKB 1EFQA 3WIFB 1QSEE 2YA0A 4KDWA 3I75B 3UPCA 1EBAA 4OZIE 5FXCH 2J6EL 1JTTA 4ISVA 2FX7H 3EOBB 1QRND 3MV7B 2VZVA 4N5EC 2YZ8A 4P4KD 5CJ5A 3BE1H 5F9WC 1J1XH 2FZ3B 4WV1C 3AS2A 1IGJA 1IFHL 4A6YH 5I8CA 4A6YA 4H20H 2I5YH 3FT4A 3S97C 5BVPL 4PD4K 2Y6SD 2Z8RA 3HS0B 4JO4L 1ED3B 3D39B 4KHXL 2DLTA 2ZG3A 5IG7B 2V5YA 5CMAA 3VCLB 5JDSA 2AP2A 4QRSA 3V4VL 3AB0C 5EC2B 3O6ML 5IHUL 3HZKB 1ORSA 1QBBA 1OPGL 2DM2A 2NPLX 3CUPB 3EGSA 4YHML 4P5TD 3TA3B 2NXZC 5D1XD 1CXIA 3EYUH 4JREC 3T1FA 4OI8A 1CFSB 1TQCB 1HHGA 1A3LH 5EOCH 4ONOA 4BH7A 1SHMA 3W9DB 5DJDA 2OR9H 3PGCB 1M7DB 3QCVH 3QFJA 3QWOB 2FLRT 4NQDB 1NFDE 4D0BB 4EI5D 1IGTA 3CSPA 4BQ9A 3DXAD 5HJ3B 4OGAC 1BWWA 1I7TA 4HK0B 3PQYD 2Q86B 2Q8AL 5F97E 4NC0B 5D70H 3VFVA 3QIWB 1EEUA 5JHLH 4WV1B 1EHXA 1T3FB 3REVB 4JZNA 5DVNA 3D2UB 2A6DA 3ARQA 3MRPB 4M48H 5C0CB 4LSRL 4NZDA 3WIHH 1T03L 4P59H 5DJ6A 4YFEA 3DSFL 1P4IL 4NGHL 1HHGB 4P99A 2WBKA 2EZ0C 1JWSB 5C0DA 5J0BA 2EE3A 3RY6C 3F5WA 3IYLW 3AAZA 5F7NC 5C6WH 5GGSB 4MQ7B 4ALAL 4P5TB 5IV2B 4KKBD 2X4UB 1SJVA 4LNVA 4KTYA 3H3KA 4QT5A 2ITDB 5HJ3A 3VW3H 4Q9RH 1ED3A 3L3GB 3VFNB 1UZ6E 4TVPL 1Q9KB 1Z6JT 3QRGL 3SQOH 1YQ2A 4L4VB 1VGEH 1RULL 3DNKA 4Z7VE 3VWKD 1VPOL 3CFBA 4X6FA 3U79A 1MY7A 3UTZA 1DEEB 1HQRA 1FFOA 1U8MA 4RMQA 2YBRB 4M3JA 2FJHB 4HUXA 1MF2H 4F7TB 2C7UA 3ZLQC 4C4KO 4LRNL 4NWUH 3ULUD 1QBML 1CK0L 2EC9U 1FGVH 4H5SA 5JR1H 4ODVH 5CEZE 5FKAB 1NC4A 3BJLA 1I8KA 5DJCB 5KVGL 3TJHD 4OZ4B 2P8LA 4H26B 5DUPH 4RAUA 2IQ9L 3CVHB 1CLZL 3KPRB 1ZK9A 4GT7A 4HAFA 4PLKC 4UOJA 3MRLB 2WANA 2ESVE 2AAVA 1PQZB 3BXNA 1EHLL 3AMLA 5JXAH 4YPJA 4LSUH 5IT2H 3VFTB 2GIYA 5KTEL 1MQKH 5ICZA 5E8DL 3O6FB 2FWOB 2JCCA 3VGAC 4AENB 4R7DB 2YN3A 4OCNC 2FX8L 4MQXD 3X3GH 4G8GB 2EEDA 4XNUL 5IMOA 3T0VA 4JKLA 1DQJB 4PJIF 4XGZA 2YPLB 5L8KB 5DFVD 3TO4B 3SGDI 1ND0A 3WO4C 4P5KA 3MO1B 1M1SA 4G3YH 4RZCA 3VWKB 4O9HH 3C9NB 3KLHD 2QJDA 3V4UH 3D3VD 5D7JD 3NTCH 4EEEA 4GH7B 1X4XA 4UV4L 4HIHA 3TESA 3ZKQD 3L5XL 1SJHB 2AJVL 1JPFA 2BSED 1R3HB 1P7QB 4XCEA 4RMSA 5DEGB 2G5BA 3IGAB 3T2OA 1RZKH 5T3ZD 4F7EA 2YMXH 1BOGA 3RZCD 1M7IB 5ALBL 43C9B 5BV7H 4LSVH 4X7TB 2A77H 1FVCA 2FECL 1QFUH 1VKXB 4RFEA 1SYSA 4KAQL 2ATKA 1U93B 2E7MA 5LQBH 1F4HA 2WINB 3VXQA 3LKSB 5A16B 2CDFA 2ZOLA 1DZBA 4G6AD 3ZTNH 3GDBA 1MREL 3QHFH 1SYVB 1YECL 4QHNB 3VGFA 1S7SA 4HJ0D 4RSVA 2VKXA 5K9QI 3B5GA 4IRSC 3VRLE 1KC5L 1X5GA 3MRPA 3QAZC 4GKNB 2X42A 5CD5C 5HGBA 4HUVA 5FK9A 1ZA3A 1A1OA 3ARED 3CXHJ 1MFAL 2CRIA 1FFPA 1DTUA 1FZKB 4MXWL 5AUMA 4X6DB 1RU9H 3T0XA 3F65A 1KOAA 1U95B 3MRMB 1KFAL 1NUFA 3D9AL 2WWMD 3STZB 3W0WE 3Q48A 2DS4A 3C5JA 3HUJB 2Y36L 1X5YA 1MLCA 1KN2H 1IGIL 2NY2B 3RVTC 1ZT7B 2BSRA 1PG7L 4I77L 2R23B 3AREA 4ZOCA 4U6XA 3RZCB 5JOPD 3UCRA 2R2BA 2ICWB 1FNSH 1AHWB 3RHWK 3HE6D 1UB5B 3U82B 3VXUD 2CLRB 5FFLA 2D4FA 1RUML 4HW6A 4ZO9A 4KKCC 4HH8A 4WU5B 4X4ME 4TTGA 4CDHA 3JVGC 2MHAB 4JFXB 3MJ8A 4X8JA 3ZMRA 1MREH 2MFNA 3UAJC 3H3BC 1RFDH 1LK2B 1LO3L 3UC0L 3OKEB 3CVIL 4U3CA 4Z5RB 1ZLSH 3MOBL 1A6AB 4LU5H 3S4SB 3WJJC 3QPXH 4QYOA 3STZA 4P23B 3T0AA 1KLUB 2KL6A 5AZEL 4JHBA 2E27H 4LASH 4QRRB 4CUCA 2ZUUA 3OKOB 3QUML 5E8NA 2D7OA 3SE9H 2LABA 1OW0C 5E2VL 4K8RL 4I18B 4K23L 3GHEL 4YDJB 3NPSB 3HNSH 3UP1A 4MLIA 1TPXB 3GMQA 3O2VH 1A64A 4JFED 3GKZA 1WAAE 5TE6L 1QSVA 4MDIA 2F53B 2XTJE 1MFDL 1VESA 4KV5E 3DURA 4KC3B 3VD4A 4P9ML 5T3ZH 3C8HA 2BFVL 4D9LL 2ZSVA 1K4DA 5FK9B 2PYFB 4NO2A 3EFFA 3D3VE 4XWGL 5I1CH 4RGMB 3U4BH 3ESUF 3OAYH 4FQ1L 4PREA 4UBDD 2OSLB 5F6IC 1M7IA 4OCXL 1QR4A 4RFEB 2H9GB 4PY8J 3E3QC 3MRHA 1Q9WA 4U6XB 3CNKA 4MZ3A 5GS2H 1TFHA 4QCIA 4F7EB 3UTPD 4A6YL 2X89D 3ALXA 3VFMB 2CKBA 5L8JB 3C87A 4QRTB 4XBGB 4YHLL 4B7LA 5M7QA 4MS8D 1WK0A 4KRPB 2H3NA 5AAWA 4U1IB 4ELMB 1YY9D 2HYMA 4ZUWB 4OLVH 4QRRD 5HPMA 2BNQD 4WW1A 4YHIB 3CDYA 4V1DA 3SDCA 3LQAL 4M93C 4KQ3L 5FYJH 1ERNA 3GB7B 3CC5A 4O58L 3GRWL 5IR1A 3LKOB 1RURH 5KSAA 4YH6A 4FQLL 4S1SL 2VDMH 3QFDA 4LLQA 4URTB 3RGVA 4L8CB 5DVMA 3RRQA 4LLYA 1S7TA 4C56D 1YPZA 4HLZH 5FUZH 1QACA 1S9WB 3MSPA 4GRWB 3X13A 2APVA 2MQ3A 2SEBA 4FHBD 4Y7MA 2EXYD 3S35H 3LVEA 3MLZL 4KK8D 2HT2D 1NCDH 4UDTB 4R3SA 5E24E 1K2DA 3OJDA 3BHBB 1QUNA 2GI7A 5KVDL 5CJXC 5IFJA 4L3EA 4H25A 4QXTB 2FX9H 5JHDE 4RGNB 4K7PL 1F3DH 4D3CH 3MCKB 2VTFA 4QOKB 2OI9C 3L3HB 1H5BC 1WBXB 4HAGA 2HLFD 5HYQB 3ULVE 2JCCE 5DC4B 1JWMB 3WUZA 4W68A 3UJTH 5BZWA 1FJ1A 5EU5B 1KN4H 1KNOA 4OLWL 5IOPB 2DQGH 5DQ9A 3PWPD 5EN2B 5BZDA 1OP9A 2Z91B 3W2DH 5C7XH 3BDXA 3V5HA 4K7PX 4PD4J 3L3JB 5BRZD 1JMXA 4NFBA 4CN6A 4U0QB 4RRPG 3LRSB 3UO1L 1WTGT 1KLGA 1YMHA 4NZTL 2Q8BH 3MRDA 3LAFA 4ODHH 3B2VL 4I18A 4OZGE 4EDXB 1C5BL 4G43A 4RWHA 3UAJD 1NMAL 3CH8A 1CD0A 5DO2C 4PJBF 4GMSH 2UY7A 1JE6A 3FCTB 4DTGH 4NHUB 2ZCHL 4RNRB 1NAML 2PNDA 4CDGC 2CLZA 4HWEL 1UA6H 3WFDH 4AEHL 3REVA 2ZJSL 5JA8B 2ED7A 4XT1C 2A6IA 4I0PC 3FFDA 5K9JH 3GSXA 3HI5H 4LGSB 1EJOH 4P3CL 3SDXF 4QTIL 2K7QA 3W82A 2OSLA 4ZPTA 5E00B 1SBSL 2XWTA 4YFLI 4WUUA 1FGVL 3IFNH 3BVNB 3DVFA 1VFMA 3FQRB 4GW5A 4HMEA 1W72B 5C09B 5IVXF 5HYJE 2R1XB 3SDDC 3ZE1F 43CAA 5ADOL 3LKRA 4OIAA 2VLRE 4JPVL 4NQUA 3U0TB 4KUZL 4NIKB 2VDNH 4PJBA 3AAZB 3VXNA 4M5ZH 2X4RA 4P4KB 1IQWH 3HMWH 3TWCL 4N0YH 3BE1L 1OT2A 1K5NB 4NUJB 2HTLC 1OVZA 3W2DL 5HHMD 3PDGA 5C08D 3D0LA 4Z78A 4X6CE 2IH1B 1ZOXA 1GHFL 1U8LA 1W0VA 5ESVB 4ZXBD 4F2MA 5A43C 4NC1E 2HRPH 1T5WB 2VLLA 5HYJD 5SWSB 4XP4H 3GMLB 4C54A 4EI5A 3ARVA 3OPZL 1NMBH 3MLYH 4IRJB 3DJ9A 4JEGB 4NZUH 1J5OH 2IG2L 4X5XB 4M1CC 1FRGL 4P9HH 5A2KH 1XF3A 2QHRH 3NA9L 4YHMH 1Z2KA 3EZ8A 1FE8L 1NSNH 3KPSB 4GW5B 3RTQC 4GS7C 1KPVA 3CFDA 3P2TA 1EIBA 5B8CC 4OLEA 3JV4B 5FO7B 5GXBB 1JZ2A 4LDLB 4M7LT 5BQ7A 5IUSA 2DN7A 1MHPH 3QXTA 5FOJA 2VITA 4KV5F 5EZOH 1OTSD 3PGDA 4IRZH 3DX7A 5IHUH 4J3OC 5C09D 4RNRA 3UZQA 5I1AB 5GJSL 5KSUB 2ORBL 4M6OL 3DBXA 2NW3B 4XMKH 1JWUB 4P2RD 1WEJL 3QIWD 4LFHG 3EAKA 1ZVHA 3IB4A 4DKEL 1ZT1A 3LY6A 2J8UB 3EOAB 2R4RH 4CW1B 5ACLA 4JN2B 4FQJH 2BJML 4KRPC 2C4FT 5C0BB 1HILB 5JO5B 2NY4D 1LO5A 3BH9A 1M7XA 4HXAL 4ZXBB 1IAOB 3D18A 2NY6B 3IXAB 3K4ZA 4XHJD 3ULVD 2WBJB 1QPXA 2L7UA 3O8XC 2W0FB 1A0QL 1G1YA 1IBGH 2P5EE 4X6DE 2Y6SC 3EDEA 5IOPA 4MNQB 4MQSB 5BS0B 1AQKH 5C0JB 3GSOB 2D0GA 3FHAA 4OZIA 5BZDB 3IRPX 2GJ6D 3KYNA 3MLUH 3QWRA 4QRUA 3QXUA 1JZ3A 3X3FH 4JRXE 4YHKL 2VXQL 2IBBA 5IEKA 1UVQB 1YPZB 5GIRA 3DTXA 2B0SL 2WK2A 5I73B 4F3FB 2VOTA 2FSEB 3BO8A 3GJEA 4U1GB 3C5SA 3EFDL 3OZ9H 5EBLA 3RIFF 4P57A 1GJIA 1II4E 4Z95H 3DX6A 3OXSA 5MEPA 2YPKB 2X1WL 4R26L 2JIXB 3BPNB 1JRHI 2OLDA 1QRNB 4EQ2A 1HKLL 3DUSA 1IC4H 5E6IC 4QXGH 1WTLA 5FV1L 2WZPD 2PYEB 3LKSA 4UQ3B 5TE7L 4TVPH 4WGVB 3MXVH 1E27A 3S98A 5KS9B 2VR5A 3LPGA 5C0GB 3QIBA 1EUTA 1BBJA 4M6NL 2VZ3A 5C9KA 5JTWA 2PN5A 4XHQA 3TJEH 2ADFL 1CD9B 1Q72L 5GISH 1UM4L 1E28B 2OP4L 3O6LL 1UM6L 3T4AA 1CFTA 1MELA 5HVFB 5IESL 1OP3K 4S0TD 2F19L 3NACL 2A38A 5BQ7B 3GSQA 3UTSB 1OPGH 2EZ0D 4HT1H 5C0AA 5L2KA 1CGYA 1F4AA 3DROB 1DQTA 4LKXB 5TJWK 2AQ1A 1AC6A 5CEZL 5IMMB 2XXMB 1RIUL 4KJQD 2AKRA 4G8GD 1RAMA 4G8EB 3IS0X 2ZSWA 5DJ2B 3E6HA 5DUBA 3BQUA 1DE4B 1YYMH 1K8IA 1CZ8L 1OTUD 3GKWL 4EI5B 4V1DE 2PYEA 4JAMA 5DLMH 3ZE2F 3GBML 3MRFA 5DYOA 1ACYL 3FO2A 1FHGA 3JTSA 2B1AH 4FQ1H 1XT5A 5ECJE 1JRHH 4M6AA 4ODUA 3HG1D 1OSPH 5CZXC 1CGUA 1HKLH 1QP1A 1Z9LA 2WBJA 2VLMD 2XQBH 5D71H 5HHOA 5FYJU 4FXLA 3I50L 2AV1A 4UNVA 3WDHA 2ICEA 4G8IB 3CSYA 1PEZA 3QCUH 4QRRE 5FYJD 3QDGE 1ZT4A 4KAQH 3RWFA 4ZUSA 5IQ9A 4MA3B 4BZYA 1NKOA 4TQEH 3ROLB 4EVNA 4XTRC 4PP2B 1YEIH 2KZWA 5LKNA 5I18L 1IGYA 4NRXB 5HHPA 4QYOB 1JYXA 3HI1A 4OGYL 5D2NB 2XZAL 3SDAC 3E6FB 2D7TH 2QKIA 5EA0L 3S96B 3AVEA 2QSVA 1YY8A 4HH9A 2XZQL 1OAQL 4AIXA 2OBGA 4PJEB 4P5MB 1G7MB 4OIIH 1NFKA 5TDNB 3P30H 2VIRB 5IB1A 4J7RA 1KTDA 1U6AL 3GO1L 3SCMC 2JJUA 1S5HB 4FFVC 5EC2A 1PYWA 2CUHA 4G6JH 3QSKB 3ZDXE 2UWEE 3KPSA 3X14A 1XR9B 2C4FU 2NY2C 2FGWL 5ESQB 5GSRA 3W11C 4YZFF 4Z76B 4C56E 3MLRL 3LMJH 4U4BA 3KYOA 5I0ZA 4RFNB 4R2GC 5JIKA 8FABA 4O51A 1JUFA 4ZFOB 4EN3A 3REWA 4MCYB 4C4KT 2ZG1A 3TGXA 4PJGA 1OQOA 2V9RA 4DGIL 4PV9A 4HF5L 2X5PA 5D1XC 2NY3C 3W0WA 1GAFH 4MCZB 2BNQE 5F3BB 5DUPL 2ERJC 2MQCA 4HFUH 3BQUC 1HHJA 4KJPC 2IFFH 5C3TA 3BGFB 3QA3A 4P5MA 3VFSA 5D2NE 3BZ4A 4HXBH 1C5DB 3FT2A 3N06B 4G6MH 3RZCC 2Q87A 3HMXL 4HPOL 1KPUA 3SGKC 4MJ4A 3CLFH 4E5XA 1YNLH 1KIUA 5CSGA 1CWVA 5DD0L 3MOAL 2EDWA 3FQWA 5KANI 2B1HH 5TDPA 5D6DA 2GFBA 3ZL4H 4X4YB 2VYRE 5I71C 1Q38A 2VMFA 3DUHA 3TN0C 3IGAA 3C5ZB 4Z7WB 2H1PH 1FO0H 4I18C 3C8DA 1J0JA 3BUYA 1MAKA 3MRRA 3QEGL 3WFEH 3WUWG 5HDQL 2X89A 2ADGA 3EHBD 1WWCA 2X4QA 1B4RA 3T4AB 3QULB 5I17A 1BIHA 2H26A 2G5RA 4WFFE 3WFBH 1ZA6B 3D39E 2IBGA 2R0KH 2F54B 3ECBB 3KPRA 1Q94B 2BNRD 4M1GH 4EDWH 3NN8A 1MIEL 1J8HD 1F58L 3BWUC 4D9QE 3ISWA 3ULVL 3KR3L 3EOTH 2R2HA 2LE9A 4MNHB 4PB0H 2VZOA 4LLUB 1GOGA 1PDKA 1BIIA 4JANA 3QB7C 2HA1A 2ZUQB 4XCEB 3O8XB 1HI6B 1NDMB 2C7UB 2UZIH 3ROOA 2HVKA 5JMRA 1U92B 3QHFL 1RJLA 4MA7L 4QY8A 4TSAL 4GSDL 3MNVA 3H9HA 1NDGB 3C60D 5I30H 1Z3GL 4GW1A 5A2FA 1FNGB 2X09A 4CMHC 1INEL 3T77B 1LNUA 1YN7A 3KLDA 4P59L 3BYTA 2BHUA 2FEEI 5HVGB 3MRLA 2NR6D 1T5XA 3QUYB 3V2AR 2V5TA 4PYHA 1WICA 1KIRA 3GI9L 1SMAA 4WFED 3QDMD 5E1HB 1GGBH 1AO7D 4YXKL 4M6ML 3PUCA 5B4MD 5KSAC 4TTDC 1FNHA 2Y4SA 4NOFA 7FABL 2N1KA 1NAMB 2HJLA 4PY7B 1KJ2L 2A9NH 3U30B 3LN9A 4PLKD 2I9TB 4G6KH 1CFVL 3ARGC 3BP6B 1Q9LA 3UJIH 3QO1B 5CUSL 1FH5L 5ISZD 5J1AA 5EPMB 1ZANH 2EIZB 3HA0A 1MCJA 1UEYA 1IAKA 5KSBF 2HT4D 3BMVA 2FD6H 4F58H 2GT9A 4OV5A 5MHSE 2HT3C 4HKJA 4JY4B 5EU6D 3RIAK 1F00I 3DGCR 1CF8H 1NC4B 5IMLA 4I0CC 5TDPB 1F11B 5B8CA 3MGTA 1GIGL 2D7QA 2VABB 3FZUD 5F89A 3VRIB 5TE4L 2VLJB 2APFA 3IDXH 3BH8A 2IAMB 1J0HA 3IETA 1JV5B 1R3IH 1NCBH 1KUMA 4Z77A 2A6KB 1T5WA 2XT1B 4KMTH 1MNUL 5K33A 1OP5H 5IT2L 1PG7W 3C6SA 3MLWH 4Z9KB 3NFSH 4CNIB 1N8ZB 1NCTA 4JRXA 4DKDC 5I76B 1NDGA 4NN7B 4IRJA 1T1WB 1CGWA 1I7RA 3CH1A 3WS6C 4ZO8A 5BV7B 1N2RB 3K81A 5HI3C 1IARB 5IJVA 5C8JA 1EH9A 5F8QC 1OD9A 1IAIM 4HS8L 4Z78B 4JGUA 4U1GC 4APQD 2VZ1A 1VGKB 3PF2A 3EOYG 1G7HA 3QUMB 4JDVB 5F6HJ 5TF1L 5GS0D 3O3DA 2HH0L 3X14B 4JO1H 2W9EH 4EUPG 3S37L 3ARBA 3MRRB 2VDQL 1PAMA 2DBJA 3ZYOA 5I74C 6FABL 3OJ2C 1FVDB 1OCWL 1QSEA 2CXGA 1B0WA 5CGTA 1QD0A 4LLAA 2DI8A 1LHZA 4OM1L 4PJGB 3GM8A 5IM7A 4TNWF 4W4OA 3RZWA 4NPYA 1LDSA 2UY6A 5I66B 4TSBL 5MHSD 1CE1H 1UXWB 2P46B 5I1EL 2DMKA 3M07A 3VD5A 4UOW0 5I15H 1RZKC 4EOWH 4LLDA 1P84J 1CVSC 1N2RA 4YPGA 3O2DH 5E00A 2DQCL 3T1FB 1Q0YH 2BNQB 1R3IL 3IJSB 4QHUA 5K9JL 1MWAA 1RZJC 1T7VA 3BT2L 4WHTB 4M4RA 4P3WA 4Y89A 3SJVA 2MKWA 2YKLL 1S5IL 3SDDB 3RVWD 4CBPA 3IFNL 2F5AH 4M4PA 4KY1H 2ZZUT 5HGBB 4Y5VC 3C5SB 3S4SA 3UTTD 2NYYC 4JRYB 1OM3L 4HV8B 2XZZA 2FRGP 1A4KA 2BZDA 5DDHA 5C0FA 1J5OL 4Y16A 2FIKA 1U8NB 3LQZA 1S78D 4W4NA 5CJOL 3BN9D 3SGJC 5EORL 5EU5A 4DGVH 4ZS6C 5TPWH 4HK3N 4YE4H 1OGAE 3DSNA 2YD6A 1YPZF 5K59F 1A6UL 4KJYA 3Q6FB 1IJ9A 3MLVL 4ODVL 3TVMA 1UKQA 4K7FA 5IKCB 3TF7C 2HRLA 4L4TB 1FYTB 1R5WB 4FQXB 4YHNB 5JORB 4BSWA 2R8SL 2YPVL 4TSBH 3MGTB 1UT9A 3MRKA 2B4CC 4G9DA 2X4TB 1KN4L 2DJ4A 4OLYL 4GG8A 4CJ0A 4O2CB 3TBWA 1QTYT 1ZHLB 2ZP0T 3GHBL 4KPHH 1J1XL 2QLVB 3S3PA 3Q6GL 2HFFA 1JGUH 3L3OA 3SHSA 3SQOL 1OARH 3T0DA 2KH2B 1JZ8A 4PRNA 3HHRB 5C9JA 3SDDD 3FKUS 25C8H 1T6VN 2CRYA 5JXED 2HG5B 2VNCA 1MCWM 1PG7X 1T21A 1WZLA 4FP8L 5BJTB 5D7JA 1V5JA 3LKOA 3LHPL 3DRTB 2F5BL 4MNQD 5FV2A 4ZMAT 5DJ6B 4J4PA 4NO5B 1RUQH 4LCIL 4LMQI 4OFPA 1DQLH 1LEGB 4Q0XL 5D8JL 4MAYC 2J8UF 1AIFA 2A6DB 1NL0L 3MJ7B 5BOPA 1J11A 3GB7A 2EYRA 5ITFB 5SV4A 3V4PL 1MRDH 1MFDH 3F7VA 3V6BR 2VZTA 4XPAL 3MLRH 3G5ZA 3RNKB 2BFVH 4D9LH 4LLWB 4IMKC 1XGYH 4IOFC 3QIBD 3DXAB 2X4OB 4U1HA 3FFCB 5ETUB 3T4YB 5JW4N 5TQ0H 3S34L 4X4ZA 3BQUB 1HCVA 4K23H 3AY4C 4Y2DA 2GUOB 2HFEA 4I3SL 4XWOD 4B53A 3OB0H 5BJTA 3MBEA 3IKKA 1OSZB 1CXEA 2PYED 2XFXB 4F33A 1YECH 5CIPA 4DZBA 3I02A 4FQHB 1GPOH 1DQQB 3Q2CA 1WAAA 4PGEB 1IKFL 5IW1A 2B7DT 3LRHA 5D93C 4DGYH 1OTTC 4HJJH 4M03A 1QRNE 4KKAD 4ZUWA 4OI7A 5E8OB 4LRIA 4XZUB 1L7IH 1KELH 3F7VB 4CVZB 4WFFD 3BUTA 3RTQA 3GSXB 4C57C 4ZYKA 3UTSD 1G0XA 1O0VA 3F7YB 5HHOE 2HFFB 4LVHB 3OHXA 1RIVL 4NZRH 2X7LB 4MQXC 3DX7B 1WBYB 4HT1L 1RU9L 4KJYB 4O2EA 2F8VA 3EJZD 5FA4B 5L0QB 3N1GC 1BX2A 1MLBA 1HINH 4G80A 3FCTA 4XVUD 1I7ZB 3VFGL 5L9DL 3ARFC 2EDHA 5HVHC 3BKYL 5IIEA 1A9EA 4HZAA 4EDXA 3VI3F 2HVJA 1C16B 5EWIH 3MV8D 4P2OB 1UM6H 1A4KB 5DLML 4OSUH 4EN3B 4ZFOA 4L3AA 3QJHA 3V5DA 3RX8A 1KTDB 3ARXA 4QTHA 4QWWC 2B1AL 1CGSL 2YRLA 4QXWA 3BSZH 2DQHL 1K3IA 5DWUL 4JM4L 1FG9C 3KYKH 4PUBH 5E03A 3RL1A 3BP4A 2AK4A 3U7AA 3MBXH 1RZJL 5SWSA 1GVIA 3WS3B 4YXLH 5KG9A 4P23C 4PY8I 1AP2B 5L2KE 4ZPVA 4ZFGL 1EHNA 1RFDL 1C1EL 1J87A 2DI9A 5ELIA 1BP3B 2NY4B 2E8ZA 5DMIL 3B2UD 4UT7L 3MODH 3BDYL 3K80A 4GG6F 3JWDH 3W5MA 2CDEA 3OKDB 3H9SE 4R90L 1U3YA 5TDNA 1NLBL 4I0PA 2V7NA 3P3YA 4G80B 5F7FA 4HJGB 4TQEL 1EEZB 2DLHA 2E27L 4JM2F 1YEIL 3WLBA 2CDGA 1A7PL 2IMMA 4KRLB 4XVTH 2OTPA 3O0RL 4G8IA 4WHTA 4U33A 4LCCB 1CK0H 5E2VH 3TYGH 1X5KA 1ZV5A 2E7BA 4PGDA 3QUXB 4Z7WF 1DCLA 5D71L 5JPMA 1QOKA 4LBEB 1KSRA 4O2FB 1JN6A 3LIZH 3N1MC 3VCLA 5HVHB 2YPLD 1EAJA 3DBXB 3CMOH 1TQBC 4JLRA 1QFOA 3FN0L 2V2XA 3BKYH 3RDTA 2WMPA 4YAQB 2GSIA 2ICWA 1QO3B 3FQTA 1AJ7H 2B2XH 3TN0A 4TVPE 4Z95L 4YHYC 2B5IB 2VAAA 5CAYB 3MJ7A 5ERWB 1ZEAL 4OD2A 2VXTL 4UT6H 4ACPA 2VQTA 3TIDB 4XNUH 3VGDA 3FO9B 3M8OL 4HWZA 2ARJB 4P2QA 4YHPA 2W65A 1XF4B 2VERN 3JV0A 3OGCA 4LLWA 3T65A 4GXVL 4DKAA 2G5BB 2YEZA 5CJXA 4BH8B 1YJDC 1R5VA 3MODL 2YSSA 4HKXB 3TT3L 1PY4A 4G7YH 4FFYL 3ZKSD 3TBYA 5FYLD 1RHFA 5I1IL 4X5WA 5JOFA 1TETL 1U91B 4XP5H 3KPMA 4G6ML 4PJ7E 1U42A 3HC0B 4LCUA 4YHOH 4IOSD 4ETYA 5CBEA 2LVEA 3TV3H 1MCCA 1BJ8A 1DQML 5K9KA 3OXSB 4TULL 1IILE 4MWFA 3NH7L 4YIQB 2AXGA 4TUOA 3KYMA 2GY7B 1G9MC 1E4XH 3U9UB 3H6JA 5HI5D 3D0VB 4LF3B 3QO1A 3SCMA 5KAQG 1A1NA 2APBA 1SMOA 3ZDZF 4OZIB 4R0LA 1HNGA 4U3HA 1H3WM 1UFUA 4YZFE 1OLZA 1QFWH 1X4YA 3DX8A 2CLVB 3NCEB 4RCAA 5ENWB 3QIUC 3ILPB 3KPMB 1AD9B 1RZFL 1ZTXH 5GHWL 3LOWA 1NGXB 2YD7A 2Y06H 1FO0L 5CS7A 1RZIB 1G9MH 1JWUA 3U4AA 4XNXH 3VDCA 4U1SB 1FE8H 5I1GH 4KK9C 5A3ID 5BRZA 1GXEA 1A7RL 2K1MA 1TENA 5I1HH 4GKOA 4P4RB 5CLWA 1KCSL 4OZ4A 3CZFB 1HCFX 2HTKD 1GRWA 1MUJB 4NQVA 3BKCL 3WFHA 1OWRM 1HI6A 3RY6A 2LAGB 5IMKB 1IKNA 4YAQA 2EXWD 1RJZA 4RRPA 5I1JL 2GEEA 3O3DB 1E6OL 3DMMA 1MJJB 2VRAA 3D3VB 3WL9B 1D9KB 3EDKA 4MA1C 5FHBH 4GRLC 3DHMA 4Q58C 3AROA 1D5ZA 4JQIH 4GRMA 3KNBB 4WWID 2YOCA 5CJOH 2YN5A 2P42B 2PTTB 5IBUG 4ORGA 3SBWA 4QRTA 1JHKH 1U8QA 3TT1H 3L3GA 3MGAA 3VFNA 3WJJA 5I66A 3EHBC 4QCIB 1EFXA 1YEGL 5AAMA 1A6ZA 2GTWA 4LSQL 4G9FA 1KULA 2H41A 3BEVA 5DRXA 4RWYH 2OTUB 1G7LB 3UMTA 1NFDA 2DQUH 1PW3A 2AJSL 1HZHH 2NY0B 5I1GL 5T5NG 3OSKA 3BISA 3B2VH 3X3FL 1EFXD 2Z0BA 3IJHA 1NBVH 3TBTA 3ULUH 5DD1L 3VMNA 2DQEL 2XNAA 1BM3H 1CDJA 3T2NL 4OF6A 4Y8AA 3QQ9C 3VU2A 4KRPD 4X4XB 3S5LA 2ZCHH 5C8JB 4U05A 3AFLA 5BCAA 4DAGL 1EZVX 3IDXL 4E9LA 4KKAC 3DIFB 3OKKB 1YUHB 4GS7B 3RY4A 4YFDB 1D9KD 3MRGA 3RWEB 2D31B 4NZUL 5CSZB 5DJYA 4GRLA 1YDPB 4JZOA 3CCHA 1NUGA 4S1RL 5GGUB 5ESAB 3LN4B 4M48L 3VFOB 5DGRA 4NHUA 3W11D 5EC1B 4M93B 3HZVB 3FN3A 2OZ4A 2YUZA 4OFYD 1G84A 4J1UA 5B38A 4KGLA 1DQJA 1BFVL 1NGPL 2FBJH 5IGXH 1J8HB 4XP1L 3QXWA 2R0LL 2IH3B 2RBLA 1RVFL 1S5HA 5FEBA 4PRDA 4ZPTB 1JUFB 2HAZA 2CLVA 2PO6A 1YPZE 4FN0A 1NGYB 1K5NA 3NFSL 4NUJA 1C12A 1PKQE 2CIIA 4KZDH 4GKSA 4FTVE 5CBAB 4XNYL 4NKDB 2BC4B 5DT1H 3EDJA 3TJHC 3EYFB 3MUGA 4MB5A 3IDJB 5INDB 1CBVH 1UH3A 3OJMB 5IB4A 3MLTA 4XVSH 2EO1A 4QF1B 3VXOA 3GJFB 2DDQH 3G04B 3GMNB 2EYSB 4EIGB 1RUKL 4P23D 1IM9A 1RJCA 2RHEA 4WUUB 4D0CB 4WIQA 2AQ3A 2PR4H 1AGBB 4LQFL 4MYWB 2C3GA 3UJJL 5ITBL 1ZHBB 4N8VA 1A5FL 2NTFB 3MOQA 4BKLA 4MJ6B 5HYQA 3S96A 3HC0A 1Q94A 4J12A 5C7XL 1XCQB 4ZFZB 5EO0A 4M7JL 4PJ7F 4L8BA 3TH3T 1QFHA 2GHWB 4KHTH 4KI5F 4M1CD 1K6QL 2X4NA 4OAWA 5LCVL 4OZIF 3TVMD 2IQ9H 2JELH 4J3XA 5DVLA 5D7LE 1WCBA 3DETC 3DVNB 1R5IB 1RJYB 3MNWB 4PJ9C 3LH2H 1ZS8B 3SEPA 3JUYA 5FB8A 2OL3A 4OZHF 3C5ZA 1WZ1L 1FP5A 5IROC 4RBPH 4I0KA 1H3TA 1WBZB 4FQJL 4FTVB 1CXHA 4ZTOL 1KIQA 4U7KA 1U8PB 4OCWL 4UNUA 2IANA 4RFNC 2OL3L 5JPNA 2V5SA 1FVEB 4DZBB 2BY0A 2ZNWA 4ZQKA 5JHLL 2IPTL 3VA2C 1LEIA 1MVUB 4BELD 2HFGL 1I1YA 4OF3A 4PLJD 3VE0B 3HAEA 4FQXD 4W81A 4FQIL 2GUOA 2HFEB 1IQDB 3WNMA 2QL1A 4MA8H 4PJEF