3O6LH

Anti-tat hiv 11h6h1 fab' complexed with a 15-mer tat peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWFCQTPEKRLEWVASISSGGSYTYYPDSVKGRFTISRDNARNTLYLQMNSLRSEDTALYYCARDYDYGVDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 11H6H1 Fab' light chain
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lH01
3EUUA 4EDXB 1S7XB 1PW3A 4PJ5B 5C08E 1RJLA 2F58H 1G0XA 1YJDH 3KYMB 3DROA 5CAYB 3TVMD 3U1SL 2ARWA 3GSUA 5AD0B 2ZUXA 3STZA 5I66B 1T4KB 5CEXB 4O00A 4KK8D 3VFWA 3DNKA 1JF6A 4JJ5B 4FFZL 1JZ4A 1CF8L 3WJLA 4I5BA 3H9SB 2VDQH 2A6JB 4FMKA 4K3GA 5E2UL 3TIEB 3FMGH 2ZP0T 2IWGA 5ESQB 1IM9A 4NO2B 3MLZH 4GLRI 3FCTA 1CICB 1FRGH 2UYLB 3HFMH 5JW5A 4ODXB 2ORBH 4NBYB 3NCFB 5SV4A 4OIIH 3NACL 4XH2B 4BSWA 3RX7A 5CSGA 2DS4A 2X4SA 5EU7E 3QUZD 1U8LA 3NCBB 3BP4B 4IJ3C 3QHTC 2HT4D 1DBKL 2MTPA 4JREB 3SQOL 3OJDB 4CN6A 4GSDH 4ZFZB 5J6HB 4KXZH 1CFVH 2H45A 1AXSA 2J8OA 1MAMH 2VLKB 1I8KA 2X10A 2NMSA 5D2LA 4OI7A 1WBXB 4P9HH 1U3HD 4P2OC 1Q0XH 3HI1A 4XP9H 3CMOH 4NZUH 1T2QL 3FKUS 4OUUB 3HUJB 2B4CL 5DWUL 2VLJB 5CJXA 4JM2F 4N0FA 3JTSA 4HV8A 1PQZA 1DLHA 4K7PH 5FM5O 1T3FA 2EDQA 2VDML 2X89D 1ZHNB 5DJCB 4KDTA 3UX9B 5I1AA 1YYMH 4RGND 5KVGH 5A3ID 2NY3D 3ZKXC 1C7SA 3MLYH 3CVHB 4ZXBD 1EGJA 2P5EA 1B0RB 4DOHE 3IFOA 2D0HA 3I6GB 4JVUA 3X14A 1J86A 1FVEB 4POUB 5CSZA 4JY6A 1NSNH 3G9AB 4Y19E 4LCWD 5GS0D 3EHBD 2ICES 4Z7WE 1CD8A 4BELD 1B2WL 4RQQB 4L1HA 4M7KL 4U3CA 3MNVA 5C0DB 4D0DA 1LP9E 1XIWD 2ZG2A 1FVCA 5GQBA 2CLVA 4P2OB 4O9HL 3CFEA 2VSCA 3HRZB 4W4OC 4X6EA 3VRLE 4BUGA 2QSQA 1EEQA 5HVWA 5L2KB 1T03H 1OARH 4R2GD 5INCB 2GHWB 5D5MF 2HLFD 3BWUC 1I1CA 3O2DL 1A5FH 1H3TA 3C8KA 3HRZA 4FQ2L 3GSNH 4X6EB 4M61A 4DJMA 5I75B 2PW2B 5CLTA 4JQXC 3MRBB 3TA3A 1JF1B 1V7NL 5EU4A 4CBPA 1YEEH 2VL5B 4LEXH 2X9YA 5HD8D 2AK1L 2FEDC 5HYJE 1VESA 4KH2A 5KS9E 1BREA 2BVEA 4N9GB 4XNZC 3O45B 4LHUA 3WEXB 1B0GA 1CFSA 1CK0L 1CICC 3ARGC 4YHPA 3OR6B 3KYNB 3WFCL 3BPLC 3S3SA 4M1GL 3PGDA 4YR6A 4F3FB 1WITA 1V7NH 3OF6A 4H8WC 3MR9A 3NZHL 2J8UE 4Y8DC 3NBNA 1FZKA 1S7QA 3CX5K 5EZLB 4D9QD 3LKOA 2FATL 4J4PC 4XNQA 2ZCHH 3KJ4B 1S9XB 2AXFB 4UI2A 4FQXA 1N59A 2VXUL 1P4LB 2DQUH 5ID0B 4G9FE 5IHZB 5CIPH 4F7TA 2IAMB 1DBAH 2WAHA 3DX6A 4Z78A 3QNYB 4N8PA 1CBVL 1DCLA 3WIHA 2DI7A 4O9HH 1MCWW 4IMKA 4PJ8C 1M7XA 1BVKB 3CDYA 3H3BC 4D3CL 4HG4J 3W82A 3MOBL 1A6UL 4HAFA 4LSVL 4CRPA 2FNBA 5D8JL 1LVEA 1F6LL 3SDDA 1QBML 3ARDC 1CD1B 3WDHA 1UXWA 2R23B 1IGIH 3FT4A 3PABB 5CBEB 5F9JA 4Y19A 4PRID 3LPFA 5EOTB 2J4WH 4X7TA 4Z7WA 5GGVL 4APQC 43C9B 3G5YA 3QXTA 4XMPH 2P42B 1BVLA 3V5KA 5J89A 3N06B 4PJHA 4CGTA 1WBZA 2RBLA 1HE7A 1G9NC 3OKKB 2W9EH 3P11L 3NMEA 4XNMA 5KBNC 3P3YA 2FO1A 1TQBC 4L3ED 1I1FA 4JFFB 1MFCL 1C08A 4AJ0A 1J8HE 1UFUA 4BQ6A 1RUAH 3FT3B 3MOAL 2BJMH 4FQJL 4MQSB 5KVDL 2AXGB 1X5YA 1HEZB 5J9PA 3FO9B 2XTJB 4OM0L 4WW2B 1OGTA 1EHLH 4NKOA 5C8JB 3HE7A 2QQQA 1PVHA 3EO0B 3RTQC 4BK4A 4OD1H 5I1CL 1TXKA 5DGQA 5D1QB 3NZ8A 3TO2B 3KPRB 4YPGA 4ZD3H 2EDTA 4XMLL 4PJBF 3OKNB 4L3CB 4HXBH 5LBSH 4N0UB 1I9IL 3MLXL 5AD0A 5DVMA 3O8XA 3QCVH 5F1SA 3RY4A 4NJ9H 5DA4A 5HYJB 3L7EA 5IG7B 1Z6JT 1ED3B 3UTTB 1DANT 5AAMA 1FE8H 4MLSA 1NL0L 1T6VN 3TJHC 3WMSA 5IMOA 1TZIB 5I18L 4U1GC 3WKML 3GMRA 1J8HB 3SO5A 5EDXA 3G6JB 3L3JA 4JFDD 5CEYA 3VRLF 5DVLA 3B9DA 4NNXA 2WINA 5EORH 3RX8A 3OKEB 2J5LB 3SCMD 1B90A 2R1YA 1F6FB 1VACA 3I75B 5L8JB 3DOSA 2QEJA 4AEIH 2J7LA 1BIIB 1MIEH 1BEYL 3MV9B 1JHLH 2XYCA 3TT1L 1VFAA 3R0MA 2MKWA 4RAVB 4B7LA 5MENB 1QSFD 4HULB 2OR8A 1U3YA 3X13B 1AI1L 4LCUB 4RNRB 1A7RL 4YDLB 4Z7NE 1Z0MA 1PEWA 3NH7L 1NC4D 4HPYH 2WNGA 3V52L 1RZJH 4NN5B 5E99L 1OAZL 3IAPA 3BAEL 1NBQA 2R2HA 1HHJB 4NC1C 1J0KA 1R5WA 2HT3C 1JMXA 1QVOA 5JXED 5IBUG 5D1QC 4PGCA 2EE3A 4I5BB 4J3WA 3W0WE 3WKNA 3QO0A 3TYFA 2VLRD 4HPYL 4DZBB 1XH3A 4WJ5B 1DANU 5ALCL 2DM3A 1JWUA 5E2WH 5C0AA 3ARPA 4I0PA 3QO0B 5ITFB 1AR2A 1KIRB 3BEVA 3BDXA 3C2AH 3HNSH 5C0IA 3IU3A 1MIEL 3RDTB 2XKUA 1G9NL 3EDEA 3WFBL 1OWRM 4V2BA 4QWWC 2AK4E 4YDLC 1TQBB 3SE4C 5FHBH 4QOKB 2OSLB 1PX4A 4L8CA 4CW1B 1FFRA 5FO8A 3O9WB 1IGFL 2V5SA 5DMKB 5MHSE 1UWGH 4WUUB 4LLYA 1HQRA 3RKDD 3QI9B 3HNVH 1MHHA 3KPSA 5HJ3B 1MNUL 3LKPB 3BT2L 3TYGH 3FOMA 4N5ED 5I8KL 4JN2A 4UDUB 1PY4A 4WU5B 5DF0A 4MHHI 4NYLB 4R3SA 1AGFB 3QXDA 4IEFB 1HHHA 3MV9D 4HWBA 4YHIB 3VDBA 5FOBB 4OCYL 3VGAB 4JN1L 3HMWH 4N8VA 2EXWD 4BZ2L 1N3NB 2OTWA 3O6FC 5F70A 3ZDZE 1RUKL 2BDNH 5FO7B 3MUGB 2EYSB 3OZ9H 5F1OB 3HPJA 4KAQL 8FABA 3CXHJ 2D7MA 4JZOB 2VZOA 1Y6NR 4U1LA 1KACB 4JHBA 1N4XH 2Y07L 3RWFB 4B5EA 2NY6D 2EDNA 2YKLL 4F7TB 4WUUE 1RMFH 2N7AA 4TUKH 4ZS7L 1QG3A 1S7RB 4XCYB 1BJMA 1JNLL 4K07A 3SKNA 3C5ZB 4Z7OE 3QDGA 5IVZA 3T4YA 1NMBL 4LDEB 2BSSA 4X7SH 2Z4QB 1LK3L 4GAGH 4U1KB 1V3JA 3CFKB 3VFUB 2HTKC 1JGLL 3WS6A 3MRHA 4U6XA 3S5LB 3V0VA 4KVNH 4LSPL 4HMCA 1UB6B 2Z4QA 1Q0XL 1MRCH 2DWEA 1A7NL 4PLJD 4JDTH 4W4NA 1NC2A 2Z91B 2NY1C 3L5IA 5ERWB 2ESVD 3BH9B 4L5FL 3V6OC 4BKLB 5D8JH 3GSNB 1WSST 2QBWA 4X8JB 4LNRB 1GGCL 5EN2A 5D93B 4ZOEA 5JHDE 1MI5D 1F42A 1NQBA 1IQWH 1UWGL 5JDSA 2RCSH 4MZ3A 3TBTB 3NFSL 4GG8A 1KPRA 3PWLB 1LHZA 5GZND 4S1SL 2ZUUA 1JK8A 3OJ2C 2VN7A 4WWID 3ARVA 3NFSH 3STZB 4L4VA 3U4BH 3TBTA 5HHME 3H0TB 1PDKA 3FFDA 3GHEH 1S8DB 1IQWL 4MD5B 5HDQH 3OHXB 5JHDB 5IR1B 1BX2B 1NGWB 5JHLL 3CZFA 1FSKC 4HIIB 5SWZD 1T89A 1KJ3H 1PYWA 5CSBA 4HS6B 4JGJA 3TV3L 3S4SG 2EH7H 4JAMA 4LLQA 1JGUH 3GHBH 1JZ8A 1MRCL 2FJFA 4RFNB 3O2DH 4OGAC 5IMLA 4XNZB 3W9EA 3NABL 5CCKL 2ZZUT 1P2CA 2XZAH 4F9LC 5E00A 2IBZY 3HCVA 2LFGA 3VJ6B 1QFWI 3DURA 1N8ZB 4R90L 4M1CC 2FLRT 3DRTB 1KCKA 3MRQA 3VXMD 3UJJL 3CUPB 1FP5A 3P0GB 3MX0A 4I0CC 5JQHC 4IRJB 3ES6B 5EUOE 1G9ML 5LCVH 4Z7UE 5HHPA 4GMTH 5IT2L 4UV7H 5J1AB 1RIVL 3CDCA 1K6QH 1KLGB 4Y8AA 2YPLA 2VISB 4KAQH 4WI9A 1MI5A 1CICD 5FUOH 4ORGA 1SYVA 2A2QT 3RWDA 4YPGB 1QSFB 1X7QA 4BZ2H 3MBED 1JV5B 4PJ9C 3KR3L 1NEZG 1P84J 5GRUL 1IEAA 2BVPA 3FQNB 4WW1B 1F4WH 3REWB 2O5ZH 1FYTE 2GAZB 4UBDD 1H3VA 3D0VB 3ULVC 1A4KB 1T1XB 1OPGL 4JY6B 5BO1H 1JV5A 4PREA 1ORQA 5CEXA 3D85D 3S88H 5GPRA 1EH9A 3S37H 3UPRA 4XHQA 4WHYH 1B9ZA 4ELMA 1CFQA 1WBYB 3MRIA 1WWCA 2CIIB 1NGZB 3NGBC 4HEPG 5DHVA 3FT2B 3H7BB 2XV6B 5FKAA 1MH5B 1MHEB 1OP9A 4Z18A 4HF5H 1N5YH 2OZ4A 4XBGA 3MMEA 2P8LB 3I50L 3Q6GH 2CRMA 43CAB 2MFNA 4CW1A 5IW1B 4O51A 3DV6B 3QRGL 5C86A 5D1ZC 3JTTB 3KLDA 2H1PH 3HNSL 5FK9A 1EUTA 2E8YA 4A2LA 4WV1C 1I7ZA 5TJWK 1KSRA 5L9DH 3NVQA 1JPSH 5DJ2B 3WDIA 4PJCA 5DJXB 4X7EC 2CJUH 4NQVA 4AIOA 1M05B 4IDJL 2G60L 5FYJD 3VE0B 4O2EB 3KXFD 5F6HI 3HAEH 1KGCD 2GEEA 2KH2B 4LRNL 4MS8C 5CJBA 2AJ3A 2DYPD 5GGVH 1FNGB 1KTRL 2MQ3A 2IPTH 3K0WA 1T7XA 2Z9TA 5J6GA 4U1GB 2A77H 4LVNB 4Z7UA 4ETQB 3FFCA 1JWUB 5IBLD 3L3IB 4HKZA 3WSQL 3C09C 1EEZB 1ZVYA 2YPLE 2ITCB 2X6MA 3N1PC 1R3HB 5ESAA 1MI5E 3QP3A 3VXUB 1AI1H 1WFUA 3QHFH 1JVKA 1AFVL 4CJ1A 5C0RH 1X5IA 4JQIH 2DTML 3O2WL 5JNYB 4LPUA 2EYRB 2VWEC 1IGCL 3PP4H 3GRWA 1TPXB 1ZWIB 4WFFE 4X9HA 2J88H 3OJVC 2X4NB 5F9OL 4JRWA 4AMKH 4GKZB 5EU6A 1FVCB 4P23D 2Y06L 5TF1L 3GBML 4BSWB 5ICZA 3PHQA 5FEBA 3R06B 3OKYA 2C3VB 3AB0B 2Q3ZA 1EZVY 3IS0X 3MRJA 3BFOA 3BPCA 4F33A 5TDNB 3HB3D 4PJXB 5DVKA 4KK8C 4J8RB 1XR8A 3PQYB 1FQ9C 4HWZA 3LH2L 3GI8H 2H32A 3CVIH 4JKKA 5E1AA 4J6RH 4B50A 3UEZA 5AZEH 4WUKL 1YJDC 2BFVL 2W60A 3S5LG 4IRJD 2WBJD 5GGUB 4DKEL 4PR5B 3TGXA 5I73C 2QQNL 2NCMA 3ZHKA 1XF2B 2LU4A 3M8OL 2R0ZL 3RPIA 2XG4A 3DTXB 5D2NC 3RPKA 4Y4FC 4D0CB 2A83A 3K46A 5I8CA 2DTSA 4QXGH 2B39A 4U1LB 4EVNA 3QUYA 3BPNC 5LGJA 5DTFB 3G6AA 1FC1A 4J3VA 3DUUA 5CGYD 4Y4KA 1J88A 5IBLC 4OM0H 2A83B 3E3QC 4NQCE 3BPNB 1FGVH 3LQZB 4OKVB 4PB9L 1XEDA 1MJ7H 3DX7A 1G7IB 5TQ2L 1S8DA 2JB5L 1BX2A 4GG6A 2B1AH 3BO8A 1RJZB 2R8SH 1AXIB 3QH3B 4MQXD 2JJWA 3KJ4C 4GMTL 5DR5L 1IT9L 4KK9C 4EI5B 2X42A 3O0RH 4X9BA 2EKSA 1S78D 3IJYB 4XC3L 3RL2A 5T3ZH 3DMMB 1KN2L 4WFHE 5ESQA 4UTBH 4X7TB 3VXTB 4WGVB 4PG2A 2F54A 2VAAA 5DXWA 4YDIL 5B38B 4XH2A 4U31A 3HB3C 2LAAA 3C5ZC 1JGEB 5EU6E 1ZLSL 3EYOA 1YMME 5C09B 3Q2CA 5KSBF 2EO9A 2SEBB 4L3EE 1EAPB 2X7LA 3INUL 3QDMD 3A67H 3BIKB 3QIWB 3R0NA 1NUGA 3IDGB 2WSKA 2C1OB 5B21A 4NWTL 1I8MA 4LHUB 4MNHB 2B1HL 4XXDA 1LQSR 2ZUSA 1KJ2A 3CLFL 2DYPB 3I3DA 1BFOB 1U8HB 4XGZA 2HVJB 5JW3H 1AKJD 1FRGL 3SY0B 3HFML 4LSTL 3RVUC 1BLNB 2VZSA 3I50H 3Q6GL 3B2UD 1SEQL 5ICXB 4HT1L 2DDQL 4HV8B 4JPWH 1ZA6B 5EO0A 3BKMH 1DSFH 4ERSL 2BC4B 1EXUA 5IMKB 1SVCP 4U1NA 4OCMC 5DJ0B 1EMTH 4OGXH 1QLRA 4WVRA 1J05A 4E0RA 2V2TB 1IL1B 2RJMA 3AAZB 3UPRB 1UACL 4Q9BA 3T0AA 4NO5A 5DMJB 4HUWA 3L9RA 1FH5H 3RWIB 1UH2A 1QFOA 1I8LA 1HHGA 1RHFA 1U41A 2NY4C 3BH8B 5EULV 1J0JA 1MHCB 1GGIH 4TQEL 4LHJB 1T1ZA 3BHBB 1P7KA 1ZT7B 3VFVA 3OKEA 4MNQB 4P2OA 3FOMB 5B39G 4FQHA 4JFFA 2AEQL 5EBLB 3CJJA 3VFPA 2FHCA 3QYCA 4CVXA 4PGEA 5KOMC 4ELKA 4OUUA 4P5TB 4XVUD 4KDTC 4HIXL 2F54E 2LTQC 4JRXD 5F7KC 4EOWL 3N9GL 4OLVL 4RZCA 2OJEB 5DJYA 4RFEB 1WUNT 4ONGH 1A6AB 4K7FB 4F7PB 3KLAB 2GK0B 4KJQC 4P2RA 5LGHH 2WM0A 3FQXA 3B9AA 2F5BL 1GGIL 3X14B 4OLUH 3RWJB 4LLMA 1K8IB 1LGVA 4ZO9A 5DJYB 4FG6D 3DARA 1PJ9A 5C09E 3VD7A 3LRSB 2N7BA 4P4KD 4N0UA 2QQNH 4Y19D 5KW9H 3DHJA 4P5KB 5HHOA 2GJZB 1WTLA 1NFDF 3PL6C 5F7MC 3RWJA 1I7RB 5D6CB 5KANG 4HPOH 2CLRA 3D6GA 5F7WC 1D9KC 5T1KD 4I77L 1WK0A 3VDCA 3NCCB 4U7KA 3O3EA 1H8OA 5F6HJ 4JPWL 1H0DB 4JQXA 5INCA 4JFOA 4KZEH 2WLZA 1P4IH 3U4BL 1IGFH 4JO3H 4KK5D 1X5GA 3NACH 3SPVA 3WFDL 5AG9A 2E5EA 4M61B 2VQTA 4DEPC 1QRKA 2P8PB 3NIGE 1OLLA 3OG6B 3GSWB 1CICA 2UYLA 1RZIB 1V05A 2UVFA 3PP4L 1NJ9A 1T7ZA 3PGFH 3LEVL 1TTGA 3QUXA 3M1BB 2H9GA 4QGTA 5DUPL 3KPMB 3QFJA 1KEMH 1AFVH 3UTQA 3EJZC 4CVZB 1PKOA 2RB8A 2X5PA 1MFAH 1YMHB 4OGAD 5ALCH 5IHUL 1NLDH 1UXSB 1X5XA 3IDMA 5EPMA 2BXYA 3BSZL 4L5FH 3BZ4A 4Q0XL 1OL0A 2A6KB 2AJXL 2DBLL 2D4FA 1FAKT 1FNFA 2R15A 3RWHB 4XXCC 1CFTA 3ARQA 4LVOC 4UTBL 1FLTX 4HKJB 1AKJB 1ORSA 3ARTA 3SDDC 5A1AA 1WAAA 1W8OA 4W68A 3L5XL 2HRPL 1ZMYA 3CZJA 3EDFA 5GGTH 3QUZA 1NMBH 4MAYB 3BXNA 3QWOB 2WP3T 2AEIT 3ULVD 1BQHG 3TZVA 3NZ8B 3TO2A 4APQA 2I27N 4M93B 4NOBA 4PJGA 3BN3B 1K3IA 3MBEC 4KRLB 3P77B 1ACZA 5DURD 1ZKAA 2YN3A 4PRBA 3OXRB 2E8ZA 4HFWA 1NMCB 2DQFB 4PJGF 1WJ3A 1R3LB 4NC1E 4YLQT 4F7CB 3FB8A 3LEYL 3UCRA 1MFAL 3TCLA 3DXAD 2FSEA 4OD2A 2FX9H 3OJDA 2UWEA 3G9VA 3NPSB 3ULSA 1YNTA 1C08B 3OV6A 2FZ3B 3BQUA 5B38A 4POYA 3BPOC 3VCLB 3BP6B 3TH4T 1OAUH 2EE2A 5JIKA 4ZUVB 1CT8A 2A9ML 3S98A 2QADB 3KHOA 2MQCA 4YHOH 3WFDH 1XGRB 5CJOL 3BP7B 1A6VL 4UUJB 3EZ8A 5FYLH 3BD3A 2HTLC 2FJGA 5LXGH 4Y1AD 3DX7B 2NTSP 2UZIH 3LN4B 5FYKU 4N0CC 3PWLA 3RI5F 4ESKA 1K9TA 1R3IL 5L6YL 1AGDB 4WY7H 5H2BA 4PJ7E 3NAAL 1OHQA 1CFNA 3L3DB 3QIUC 3B9EA 4OTXH 1HXYB 2CXGA 5KSAD 4JGUA 2NYYD 3B9KD 4P5MB 3DV4A 1NEUA 1MF2H 2PXYA 3KLSA 3PNWA 4HKBB 4Q6IA 4HX1B 2C7UA 3ULUL 4DVRH 2QSCH 1WICA 3VW3H 2EDYA 3SDCB 4ZUSA 1X4YA 1XH3B 1JRHL 2VE6B 4QHKI 2QQLL 3BYTA 1U93B 5KAQF 3VXRA 5E8OB 3U46B 4AENA 4KROC 2OQJB 2G5RA 2Y25A 1T21B 1HCVA 4UNTA 4JPVH 2NW3A 2GUOB 4E41E 4L8DB 1U93A 4OCWH 1AGEB 2IH1A 5AZ2H 3JWDH 4X6DB 1GGBL 5JR1H 5D7KE 3EO9H 4L4TA 5MEPB 1N64H 3C5JB 4XAKE 3QEQA 3P4OA 1HYSD 1S7VB 3MOBH 4L9DA 4LMQI 5TDOB 2BMKB 5E6IB 1MELA 1GAFH 1MAJA 1CDHA 3ILPB 1HINH 2CDEA 4U6VH 1L9MA 5BVJB 5IFJA 1WZ1L 5DRZB 3CSYB 2A0LC 5IB3B 3ZKQD 5CP7A 1EEZA 1FDLL 3W39B 4GW5B 5K33A 5LGKA 5J3HC 3FQNA 1H8NA 3VGHA 1W8NA 1D5BA 1YNKL 4JJHA 1GZPA 3U79A 1KXVC 4N8VB 4HH9A 2VJXA 5L8LB 4LRIA 5D2LE 3CVHA 4JQVA 3LRSA 1SM3L 2CUIA 1CGXA 1RI8A 3ETBF 4X80L 3MV01 1NFDB 3SO3C 4LEOA 1NGXA 4Z0XB 1ULVA 2R0WL 1FVEA 1AC0A 4PJDE 5DJDA 5JW3L 4O4YL 4LK4A 5GGRB 5L88H 2J2ZA 2ESVA 5E2JA 3CD4A 4K94C 1AGBA 2PW1B 5DURB 3QA3A 4QTHA 4JRYE 1P2CB 1KCUL 4O2FB 1A7PH 4RIRA 5F7YC 1ZHBB 1LWRA 5IQ9A 2ZOLB 3FO1A 5I1CH 1TPXC 2H32B 4F8QA 3QA3B 4IMLA 2EYTA 2KL6A 3F58L 2ED7A 4ZFZA 3KYOA 4S10A 2I5YL 1DQLL 4KPHL 1JP5A 2Y36H 3O6FA 5IB5B 4DN3L 5TGBB 4ALAH 4EZMA 4DAGH 2GTZB 4WO4A 1NCDL 1NUFA 5T3ZL 4L4TE 1KCLA 3OB0K 4P3CL 1S9YA 2QQLH 5D7IF 4JY4A 3QEQE 1LEKB 3X3GH 3OX8A 3PHOA 5C0BE 4MXQD 3RKPA 1NAKL 3KJ6L 1FC2D 1X4ZA 2AV7B 4MNGE 8FABB 3W9DB 4XMPL 4X4MA 4LLAA 2FX8L 1MRDL 3TEUA 1EAJA 5KSAC 5IM7B 3FRUA 4N1EA 3WFHA 4LKXB 2YA1A 3RZWA 3GIZL 1T2QH 1HSAA 4G8FB 2AV7A 2QTEA 3W9DA 5HYJA 2FX7L 3FQWA 3LIZL 1HHKB 4PGDA 2N1KA 3EDDA 5C0BB 4YXKL 3O81A 1PEZA 1IGYA 2EKSB 3IJYA 2OZ4L 3MO1A 1YYLH 4UINL 4U6HB 4QXGL 1UZ6F 3UPAA 1RQ5A 2A74A 4NT6B 4ZSOB 3V6OA 4F7MA 3VRIA 3V79C 3AMKA 2VUYA 2YUXA 3MV7A 3ARFB 2FATH 1AO7E 1VACB 2IC2A 4KJWC 3ROOB 3IU3B 4BKLA 3GSVA 3WE6A 3JTTA 3GIVB 3AROA 3IFNH 2D7TL 3CNKA 1BBDL 4CADB 4TYUA 4KKCC 1N7MH 4EIGB 5E9DD 2X44D 5E1AB 1MQKL 2VL4A 2ZSVB 2X4SB 2C1OA 1I8MB 4P23B 2PCPA 2WV3A 4X0KA 1F90H 1U95B 1QUNA 2VXSL 5KG9B 1BBJA 1DE4A 4QNPF 4EDWL 4ZFOL 4CMHC 4BFEA 1L9NA 4I9WE 3VFNB 1HHIA 1YEEL 4KRPC 3U7WH 3MCLH 3C60B 3HE6A 5BQ7A 1E4XI 2HWZH 3P9MB 5FGCB 1KELH 4NN7B 3I3BA 5H94A 4PBVC 1OGAD 1RY7B 2DBJA 1Q38A 3P9LA 4H25B 3ME0A 2DTMH 3O2WH 4QHMA 5C0GB 2BNQD 2AJZA 3DETC 4U1MA 5D9SA 3U0TA 1MCPL 1TIUA 4TNVF 4U1NB 4FG6C 3VH8A 1ADQH 3Q5TA 1CCZA 1G7IA 1E4XL 4GMSL 1YEGH 1A4JB 5I71C 1CL7I 4M7KH 4MNGA 4OLXH 4JZNA 5SWQB 3OAZK 4X4ME 1RMFL 1O5DT 4QO1A 3O41A 2GJJA 3VRJB 3V95A 5IJVB 1BD2E 3FZUC 5GXBB 4YH6A 2P5ED 2CKBA 3ECBA 1KC5L 2BVYA 4X6CA 4K71B 1I7TA 1INDL 3VGEA 5I76A 3DHMA 2DM7A 5F9JB 2VH5H 1FG2A 1QLEH 1SEBB 3CH1A 4WFGE 2YUVA 5DEFB 5INDB 3BKCH 4BQBA 5CGMA 5K9QI 2QLVB 3QG7H 4K3HA 5HSFA 4DEPB 3OGCA 4OQTA 4FQCL 3BUTA 1FG2B 3MV7E 5GZOD 3QNZB 1N5AA 3K3QA 5I1EH 4WIQA 5T1DH 4LCIH 2D3VA 1G6RB 1P4IL 4XPAL 2EC9U 5C07A 1J0HA 3IFLL 1DUZA 4NRZA 2BVOA 4F7PA 3VWKD 1Z9MA 3AM8C 1HILB 1UEMA 5AAWA 2PXYB 1K8IA 4QHLA 3QUMH 4HX1A 4M8QB 5FO7A 4NIKB 3KDMB 4ZDHA 2B8OT 1YEHH 3A6CH 3KYNA 4JDZA 5CILL 3LKRA 3S37L 4JZOA 4QKXB 1N6QH 2X2YA 1OTSC 1BVZA 3IDXH 4PLOB 1UYWH 2Z31D 3E6FB 3I2CH 5J11B 5LJYH 2JB6B 2X70B 1JI1A 4XI5D 3O4OB 4GJTB 5K9JL 3CFDB 5EUKB 5ESAB 1FFPB 2CUMA 3NCMA 1MWAL 3S8WA 3HC4H 3LPWA 1NBVH 4JO4L 1QFWH 4PTUB 2W9EL 4KUCD 4N0RA 3BQUD 4HUNB 4LLUA 4YE4L 3RNQB 5C2UB 4TNWF 4GRWH 1HK6A 4UT9L 3C5JA 3UTSE 4Z9KB 4NDMB 1GJIA 1B3JA 1A14L 5FO8B 2DWEB 2E7BA 3E3QE 3QIWC 3ZT6A 5IFAL 1OAZH 1EO5A 4Z76A 4RA3A 1UG9A 5EOTA 2A6IB 5ID1B 4X6CE 1HQRB 1R3KA 2C3XA 1MCLA 5T3ZD 3F7VA 1A7RH 1DEEA 5J11C 4ZO7A 5IV2A 3EZJB 1PZ5B 3K1KC 5DJAA 3MPCA 4PRDB 4MNQD 2EDLA 3NIDF 4MJ6B 1XGQB 4XPBH 4R0LA 1BFOA 1XMWA 1BZ7B 2VLRB 4Y2OA 3KPPA 1AKJA 4JRXE 1KEGL 1ZEAL 2WLYA 3SGDI 1QYGH 4XBEL 4P5TD 3UJIL 1XGQA 3KPSE 3OHXA 4H8WH 1T0MA 2EDOA 4S1QL 4YDKH 2VXSH 3FN0H 4NKOB 1A2YB 5CMAB 3VD3A 5KSUB 1EEUA 2Y5EA 5DGRA 4JR9L 5ALBL 5IB1A 2B20A 4Z8FL 1NUDA 3E2HC 2R4RH 2F53A 2NY3C 1CLYH 1P5VA 4OCRL 2DJ4A 3LD8C 4RFOL 5FDWA 3REWA 1XGPA 4G6JH 1LNUB 1FDLH 1HKFA 5J13C 4OSUL 3H3PL 3KWWA 3L9RB 4QRRA 4Y5YA 3IFOB 1YC7A 4PY7B 1MHCA 1YEKH 2VDNH 5HTSA 4QRPA 5E8DL 1A1NA 3LB6D 1XF4B 3I02A 1GRWA 2DQGL 3VCLA 3W11C 4FP8H 1VGKB 3QI9A 4KU1A 3NFNA 1F11A 4OZHB 2V7HB 4OLYH 4JB9L 3QUYC 2IQ9L 1MCJA 3PWPD 4DW2L 3FHQA 3IU4L 5BV7H 5IVXB 1RUPH 4Y4KC 1KJMB 3QDGE 5DD5H 1JGLH 4YC2B 5HHXH 2YPVH 3HPLA 5IFHH 3EYUH 1FORL 1PKQA 1KF9B 4JFPA 5EZIH 1FSKB 3IKCB 1KTDA 4Z95L 4JDVB 2A73A 3EYUL 4N0FB 4LBEB 2YN5A 3BOVA 1JNLH 2VYRE 5D7LE 4QYOA 3S96B 4F58H 4TVPE 3MV8D 3QDMB 5F1NA 3UC0H 5I1AB 1JGDB 1VDGA 1U8HA 2XQBL 1MWAB 2A73B 3B6SA 3LSOB 3SY0A 3IF1A 4YHPB 4DTGL 1X4XA 1MLBB 5JHDA 2VMFA 4DCQA 3MRKA 4FQPA 4NN6B 1JZ7A 5HI4D 4BA8A 4BH8B 2DI8A 4H1LB 1IGJB 3VFMB 3TZVD 1KPUA 2UZIL 4J3UA 2HH0H 4WCYL 2YWZA 5IJVA 3C5ZA 1VA9A 3FB6A 4HMDA 1DQJA 5JLZA 4ZOCA 1A6VH 4L4VE 4HKXB 5IEKB 3ARDD 3CFCL 1I1AA 5T1DL 3LAFA 3IGAA 4PBWD 1W0YT 3H42L 4LSSH 5C2BL 1KIQA 3LS5L 2EKJA 2CK2A 3AB0C 2OL3B 3MJGX 3WBDA 5F9WC 4PJ5E 5C08B 4RDQF 4WV1B 3DGGA 4NKDA 3CSBA 4OZ4A 3ARBD 3BE1L 4XX1E 4HZLB 5H94B 2G5BB 2ATKB 4H8WL 3RU8L 3WHXB 4LNRA 4YBLC 4XP4H 4MA3A 4F57H 2OX5A 4EI5D 4AMKL 5JXAH 3SDYL 3QEHA 4X99B 5HYFA 1P69B 3WFBH 4O58H 2VABB 1CE1L 1CZ8L 1YNLL 3QG6A 4Y2DD 2VZ3A 1H3XA 2OXHA 1A6ZB 4HH9B 4Q74A 1JNNL 5EC2B 3BGFC 3GJFA 5GRZA 4D0CA 5CP3H 1P4LA 1LE5B 4C56D 2G9HA 1UKSA 3PE9A 4N68A 5IROA 3C60C 5IR1A 4PJ8D 3G08A 1MEXH 5H37H 1M7DA 3L5XH 4HC1H 3I6LD 1MJJA 1JGVL 4YAQA 1IQDB 1HH9A 2ENSA 4P23C 3FHAA 1EBPA 3MXWL 3WIIL 2FJHB 5D7IA 2X4PA 5E99H 1IKNC 3U36A 1N26A 4YX2H 2G60H 4OAWB 2JE8A 1ZS8A 4EXKA 4OD2B 5I8OH 1NAMH 2ZG1A 3UBXI 1CVSC 3CXDL 5HY9A 2IPKA 3OR7B 3OKKA 1LDPL 4IS6B 5DK3A 1X5ZA 2I07A 2YD4A 1UYWL 3DMMA 2XTJD 5EOCJ 3QEQB 5C9JB 3HAEA 4PRPE 1BM3L 1HWHB 4LL9A 5HGDA 2AI0H 4PRIA 1SMOA 5I6XB 4WY7L 4OGYH 1CFVL 3HS0A 5DD6B 2XKNB 4AZ8A 4J1UA 1JI2A 2X05A 2VLLB 1HI6B 1C5BH 4KKBC 1DBKH 3MUY1 3PL6A 4PJ5A 4UINH 4PRHD 3E6FA 5C6TH 1CXHA 3SQOH 3ELAT 3HMXA 1W0WA 2DF3A 2VQ1B 1QPPA 3G6JE 5C0EB 1JPTL 4OLEA 3K2UL 2HJLA 1HXYA 2PYEE 4LU5L 4L8BA 1C5CL 1JN6B 4W6WB 4PJCE 3HZKB 4NPYB 3THML 4YPJA 1YY8A 3MGOA 2FX8H 4TVPH 15C8H 4NUJB 1K3ZA 4OD1L 4YXLL 1NAML 4FZEH 3RVWC 3VXMA 1Q0YL 1TZIA 1X9QA 3BRGC 2VNCA 2NY5H 2C26A 3HZMA 5C9KA 4YIQB 1OTTD 4EOWH 2DRUA 2IFGA 1S5IL 2YWYA 5DSCB 1YDPB 3KS0J 5EBMA 4J12A 4XNXL 4DFIA 4XBGB 3VGBA 1YQVL 3MCKA 2ADGA 3ZTJH 4LP4A 2E7LA 3W9EB 4PTTB 4I8DA 2FYYB 1BIIA 3I85A 2FSEB 4IDLA 4F8TA 5BXFB 2Z93B 4XBPB 3WUZA 5C0BD 1MCNA 3V7AE 3VGGA 3KLHD 1KYOK 3ARWA 3GMQB 2PO6D 4AT6A 2Q8AH 1JNNH 3O9WA 3WLWC 2J4WL 5BVJA 5E2TH 3QEGH 4MS8D 4QRUA 3QUZC 1FH5L 1NC4A 3BESR 4O4YH 4NKQB 3QDHA 4NC2B 4QHMB 5GSRA 5C0GA 2AJZB 4WFFD 2H6PB 3RX5A 3ULUE 4NZDA 4DGVH 4Y2DB 1L0QA 4CN4A 5CZKA 1G84A 1O7SA 4N5UA 3S96A 4P46B 3G6AB 3ULVL 1MQKH 3WJLC 5DUPH 2OTUB 4PRHB 5HDQL 2VRAA 5JTWA 4Y2DA 4OFVA 4RAHA 5TPWL 2ZCHL 5JOPD 3IAGC 2PXYD 3BVNB 4NGHH 2DMBA 4LSTH 1NFKA 1JYWA 1T66D 3QPQD 5ANMA 2Q87A 4LGSB 4G6MH 4QRQB 1KXTB 2EYSA 2V9TA 5KVFH 2HP4A 3T3MF 4Q6YA 4G8EA 3QIBD 3VMPA 3IDJA 4I9WD 1SY6H 1F11B 4KTDL 4OZHA 5ANMB 1BGXL 1NDGA 4PLNC 3N85H 4W70A 2BNQB 4LEXL 4G8EB 4GG6E 1IAOA 5I1HH 4PGBA 1UWXK 4U1IB 4MSWB 5DI8B 3KPTA 4HIHB 1A5FL 2KZWA 2F54B 2VAAB 4NO3B 5CJ8A 3SPVB 1SY6A 4OCWL 3O3DA 4WNQA 1OARL 4YBHA 4TSBL 3FB5B 1IZJA 4ORZC 5CJXC 4EIZC 3QIUA 3MRRB 1HZHH 2V2XA 5KZCB 4GQ9L 3A6BH 2Y4SA 3S35X 2Y6SC 3WXWH 1OB1A 5D7SL 3DWTA 1NLBL 4IOFD 4P3CH 5JZ7C 4CVZA 3P73B 5DR5H 2NY2B 5IFJB 8CGTA 4I3RL 1PG7L 1JWMB 3HMXH 1EERB 4GKNA 4L3EA 2VDOH 1A64A 4ZTPH 1J12A 5D6CA 3DECA 3AREB 3SDDB 3VXSB 5GRYA 4KUCF 3VXPA 1I9EA 2LV4A 1OTSD 3QJHB 2AK4B 1ZLVK 1A6WH 3I6KB 2IPUK 3HLAB 4XPGH 3VRIB 2P5EE 3HE7D 4ZUWB 3CMOL 3PL6D 3VFGL 4APQB 4M7LL 32C2A 1RIUL 3EYFB 2ESVB 4TPRL 1ES0B 3QNXA 4N8CL 3EYVB 3GK8L 1L7IH 4EUPA 4NHCL 3TA3C 1V3KA 1FL5B 3JSSA 4RIRB 5LAXB 5ICZB 3R06A 3QDJE 5T3ZE 3OR7A 3TWCH 4M48L 1NBYA 5E70A 2NX5D 1RPQA 2ZSWA 5E7FA 2OL3H 4OZHE 1IKFH 2ICEA 3EJZD 3EYOB 2EE6A 1H3PH 3G5YB 5SWZE 1SJEB 4HFUH 1A7QH 2YRZA 1T22B 1IC1A 3QJFA 5FCUH 2YD8A 2BY3A 4GW5A 4NQSB 4LRIC 3BKJL 4JPKH 2KQMA 4MDIA 3SGJA 4JQVC 4J4PA 1XCQA 1EEYA 4FQXC 1I3GH 4QHLB 1MSPA 1H3WM 5F88A 1HWGB 4LVOB 5SWZB 5ICYB 4JDZB 4L4VB 3LKRB 1IGTB 3MZTA 3A6OA 1EEYB 4IMKC 2D31B 5FYLE 1R24B 1U3HC 4MB3A 2ZPKL 4OCXL 5EBGA 1MIML 4RISH 1SYVB 3VFTB 3ARDA 4H20L 5DFVC 1TVHB 1YJDL 1LD9B 5FYKH 2F58L 3GMPA 2J8UA 4HLZH 3F7QA 3KNBB 3V6FA 3TPUB 1NBZB 2R0LL 4P5MA 3BMWA 1KV3A 3H9HA 3ZDYF 3WJJC 2IBBA 4FNLH 3VXMB 1GZQA 3CIQA 3MRMB 4M1DH 3ZMRA 1MJUH 3WN5C 5T3XH 3T77B 5IB2B 2H3NA 3HAEG 1FAIH 4IDJH 3OMZA 5DEFA 5INDA 1WTGT 4TVPL 5HHOE 1PLGL 5E5MB 3R1GL 5E08H 4PIRF 3HZVA 4DWHA 2OQJA 3MRNA 1Z5LA 2P5WB 2PYFB 5K9KA 5GS3A 5FKAB 1CGYA 4XZUA 4NRYA 4WRLA 1DQMH 4XP1H 3IDXL 3C9NA 3ALXA 2P47B 1QRNB 2VQ1A 3NCYP 4QCIB 1ONQB 3F8UB 1VKXB 5DT1L 2R2HB 3HE7C 3IDIA 1G6RH 1GH7A 5F72S 5DEZA 3DVNB 2VXVL 4JHAL 4QY8B 1I7ZB 2LABA 3NIFF 3MA9L 1AP2B 1WFNA 4OUOA 2X1QA 4RFEA 5E7BA 3GO1H 2A9MH 3VI3E 4DZBA 4ZNEE 1L7IL 4WW1A 1A3LH 3IAQA 4MMZC 2NY2D 3UTPD 2BFVH 4N8CH 3QO1A 4R8WL 3TO4C 2AJYH 1A2YA 5CMAA 4YEEA 5HVHB 4J6RL 3VFGH 5KSVA 2X41A 1KJVB 4XVSL 1LDPH 3GI8L 1CDJA 3U0TB 1FZOA 3GDBA 1Z3GH 5ICXA 2FBJH 2Q8BH 1I3RB 5EOCH 2AJVH 2P8MB 2YS4A 4GW1A 5GRUH 3MLTB 3B9VA 1G7JB 5BZDB 5T3XD 2ADGB 1OAXL 4KC3B 1B6UA 4J3SA 3N9GH 4OLVH 1X3DA 2IFFH 2VDLH 4RGOL 4I3SL 1BWWA 1AGEA 4ZTPL 4EJ1C 1WGOA 1GGYA 5BVPH 1WEJL 5FYJU 4NO5B 5D5ME 5K93A 5CJ5A 1R3LA 1V3MA 3FB8B 4WTXA 3HE6C 4X0KB 5KSBA 4AH2A 2RGSA 1HOCB 4DGIL 4NO0D 4HZLA 3RWGB 2JLLA 3L7FB 4QOKA 1QSVA 3D2UB 2NQCA 1IFHL 3LPGA 1RJCA 4R90H 5CHNA 4LARH 5DHXB 4PJ7F 1OD9A 3MUHL 3L5WB 1T3FB 3BZFA 1IC4L 4XTRC 1R5VB 4Y16A 2OTUA 4M5ZL 4PRHA 2FWOA 3MROA 1QHPA 5I1HL 4UZGA 3LN4A 4KMTH 4R7NA 4F3FA 3LN5B 5JPMA 3RWFA 3UBXG 5KSUA 2F53D 4LCYB 1RHHB 3PHOB 3OX8B 5FOBA 3VWKB 1SJHB 3BKJH 3DVGB 3P0VL 3JV0A 1A6TB 1RK1B 2NY6B 2NLJB 5BMFL 1JPST 3DX9B 3ARUA 4Y4KB 5FCUL 1A6PA 1F13A 3RVXD 2EICA 1TJIL 4EUPG 2BSTB 4HFUL 1TLKA 3TFKC 1IC7L 2EH8H 2B1HH 3ARSA 2YC1B 2A1WL 4JKWA 4F7CA 4IMLB 1JNHB 2R4SH 3FB7A 4Y4FD 4RBPH 1CGTA 4ODBD 1EVUA 4WEMB 4YGVB 5FM5M 1VFMA 1ZVHA 3LRHA 4X7FC 4KKBD 2VDPH 3F6LA 5I1JL 4XCFH 2I60H 3CMGA 2QV2A 5KSBE 1JUFB 1PG7W 4OLZH 3RPIB 3ARGD 3D3VE 1XF5A 1MFDH 4QOKE 1ETZA 1ZV5A 4KRPB 3RGVC 3QDME 5TE6L 2GI7A 1U8NB 4PRDA 5DC0A 2OS7A 5HPMA 4D9RD 4K3JH 2VLRA 4HIIA 4DAGL 4M02A 3UBXA 4LGPB 2Y9RT 4YO0B 1SJVA 2JTDA 2CIKA 2Q20A 4G6AC 3MLYL 4PRHE 4XVTL 3HLAA 4FP8L 1T0NB 1YPZE 2NY7L 1OTTC 4LLUB 3E6HB 3RNQA 2L4OA 1RUKH 2BDNL 4G8GD 5AUMB 1RULH 4TUOA 3RY6A 4WWKC 4PJAB 3T3PE 4EI6A 1JCKA 3BPLB 4RRPG 1EV2E 4GUPB 2O5XL 5LAXA 2LQRA 3WS6C 3M8OH 4DUVA 4L9LA 5EB9A 5IEKA 1MLCB 4U6YA 5DDHB 4CL7A 2N56A 2BNUA 3ZO0A 2QQKL 4ELMF 4HCRA 4LCWB 1P4BH 4Y4HC 1U2CA 4PBXA 4M3KB 2AXHA 1JPTH 2IH1B 1UKTA 2VXVH 2DM2A 3CDFA 2GSIB 5HHPB 4ERSH 5D1ZB 4HHAA 4I1NB 4L4TB 5HI3C 1XIWB 3RVXC 5E00B 4OFPA 3TPKA 2EDFA 5C6WH 2BRRL 4G8IB 4PG9A 2XY2A 3DX8A 3P9WB 4C83B 3MRQB 4E42B 1QSFA 1X7QB 5IVNA 3FO2A 3MODL 2ADIA 1AD9A 3DIFA 3OKLA 4ZAKC 5F3BA 3CFBB 3O11B 5FHBL 1HCFX 5DQJA 2ZG3A 3SE8L 1WZ1H 3DX8B 3R1GH 3MLRL 1BFTA 2DIAA 1G6RA 3WLWD 5C07B 3EDKA 2JIXB 3QUKA 3UYPA 4X4XB 5GGSA 1T89C 3O8XB 5T3XL 1YEDB 2W0PA 1QSEE 1GAFL 3QDAA 4P57B 4AIZA 3TLRA 4L8BB 1QLFB 3H9HB 5DHVH 3FRUB 5HPOA 3MOQA 1IC4H 3WIFB 1GOFA 4H26B 3MRMA 4YBQC 4S0TD 4JM2C 3X12B 3FL7A 4U33A 4R96B 1FGNH 3B8YA 3CC5B 1MUJA 4MCYA 4X6CB 5T1KB 4F9LA 5GISL 4G3YL 5E94B 1IFHH 1NMCC 1U8QA 4WDIB 3OKDA 2YBRA 4X98A 2H2PD 4NHUB 3X12A 4NZRL 2ADFL 3RVWD 1G7QA 3FTGA 3QPQC 3EFFA 1V8HA 4GLRH 4MSWA 1DQDH 2IAMD 4TNWK 1RZKL 2CK0H 2R2EB 5HHMB 4J2XA 4HJ0C 5IGXL 4P46D 3MJ9A 3ZDXF 4HKXA 5DMGD 3HNTH 1YNLH 2PTVA 1K5NA 3HI5L 2M26A 4X6BA 1OAXH 3RJQB 1T5WA 4DGYH 2AEPL 2YZ8A 4KHXH 4DFHA 2JELL 4MJ5A 4X4ZA 3V6OE 2P45B 5IEHA 1S7UA 4LHUD 1EK3A 2H8PB 5EOCL 3RL1B 1IKFL 5KG9A 2R2CA 4QYOB 5I8EA 3Q3GA 4WO4D 3GM0A 1RZFH 3LN9A 5IBTH 4H88L 4M6MH 5LXGL 5DJ2A 4MQTB 3X17A 2H6PA 4K9EL 4TN9A 4XPAH 2GK2A 3MGTB 4XNQB 2HFTA 3CFJB 4FQXD 1P53A 5BW7A 5I8KH 2KQNA 5HHVL 4MA7H 2OTWB 1BD2B 5I30H 4MA8L 5B8CA 1S9VB 3GB7A 2DJSA 4KKLD 3SGDH 3U6RB 4UMGA 5J8OA 4HKJA 3SJVD 1F3JA 4OCNC 5GGVY 4UOW0 1S9WB 2D7QA 3ZE1E 5D7JC 5F9OH 4DTGH 5HGHA 3TA3D 4PJXA 3K2MC 4ZO8A 5GGRA 5HYQA 1BVLB 3P4MA 1DBMH 2YC1A 4PJHB 4WV1A 2W9DH 1MCWM 3MSPA 1MPAL 2ZSWB 3UMTA 4XNMB 1JYXA 5E2WL 1NLBH 3W11D 1A02N 3FO0L 4PRBB 3C2SA 1B88A 1KB9K 4LSQL 5T5NG 3OKOB 2X4OB 3H6JA 2OXGA 3TCLB 4KI5C 5DD5L 1FN4A 2XI9A 4KQ4H 2R2BB 4PLJC 3ALPA 4D9QE 5I6XC 2DQJH 5TFSH 4EVNB 5IROC 1ZT4B 3S34H 4XC1L 3C60A 5E8PA 2NNAA 5EC2A 1XFPA 1OW0C 1M71B 2GTZA 4NZTL 2QADC 2BRQA 3EFDH 4NQTA 2ED8A 2K7QA 1TZHA 1ZHNA 2CLZA 3LB6C 5DHYA 4JDVA 3QUZB 2P5EB 2IEPA 5HI5D 5D5MB 5KVFL 4O58L 4F2MA 1QNZL 3T0BA 3H7LA 3D9AL 5F3HB 3UTSB 2XN9B 3HZYB 4NRXB 1J0ZA 4B7IA 4XHJD 4OFDA 2AGJL 4XWOC 3OAUL 2EXYC 4KZEL 4BM7A 4WFED 3TNMB 5I2IB 3VXTA 4HEME 5CEZH 1A9BA 5EWIL 3WKMH 1MFNA 1J11A 2UUDK 4L9LB 4PV8B 2NXZD 2A74B 1JJUA 3I75A 1G7HB 4M6NL 3FB6B 3S88L 5DJZB 3G6DH 2K3TA 4WFHD 4WI8A 2P46B 4IM8A 1FYTB 1OF2A 1A6WL 5D2NA 3RUGB 3OXSA 1L7TH 4K71C 1FO0H 3F5WA 1G7MA 4QOKD 1E6OL 1T22A 3AXLB 3QUMB 5I0DA 1JK8B 3UTZA 2DQIL 3RDTC 3TC9A 5ETUB 5GRJH 3I3EA 4MDIB 4JG0L 1INQB 3NIGF 1YN7B 3HE6D 1P7QD 1BHGA 5EO0B 1AHWB 3CLEH 2ARJQ 2VXTL 3KDMA 4CDGC 4HIXH 2X9WA 4HIEA 3HC3H 3MLVH 1ACYH 3BDBA 1KCSH 4FQXB 2DQTL 3HI6L 4HK0A 4JFEE 5I19H 4XGZB 2A0LD 4IHOA 2Y5TB 3DX6B 4P5TC 3OKNA 1MFDL 1YECH 1FLRH 3A6BL 1U6AH 3ZSSA 1K85A 5I15L 2VDMH 4OF8A 1T80A 2J5LC 3VGFA 2H26A 4FXKB 3MJ6A 4JRXA 3IDNA 4S1DD 4JFED 3NPSC 5DD3H 3RWCA 5HHNA 3BVNA 4MJIA 5JXEA 3SE3A 3BISA 1NKRA 2GSIA 4LHQB 3N1QC 1J1OH 3O4LB 4Y5XA 3MBXH 4PG2C 4L8CB 4DKAA 1RJYB 4EEEA 5C92A 1U8LB 1AE6L 5IB2A 3O9WC 4PY7A 2XQYG 3FTGB 4LLDB 1L6XA 1UVQA 2Z93A 4MD0A 1S5HA 3PWNB 3DETD 4D0BB 3F7PC 4FABL 1SY6L 4PJXF 1DZBA 3T08A 2YPLD 3ZT5A 5K9OA 4Z0BH 1P7KB 1ZT7A 4CVUA 4OSUH 2CRZA 1JYNA 5LKNA 5BMFH 5GIRB 4Z0BL 4KKAD 4G6FB 5J9PB 3SQBA 4Y2DC 2GAZA 5I17A 5D2NE 2XA3A 5DJ8A 2DOCA 4FFVD 3GJFB 4QXWA 3G6JF 5T33L 1FNGA 1ZGLB 4P5KA 3FFCD 4WO4B 4HWNA 4OF7A 3B9KB 2HFFA 1TJGL 1A6TA 1EPFA 3OKDB 3ROLA 3WNKA 3HR6A 1N6UA 5EU3A 3VGAC 1UB5B 1NC2D 4KWUA 1NH6A 1S7XA 4C58B 1AO7B 1N59B 5JW4R 1ROWA 4PRAB 2YXMA 4V1DA 4WW2C 2HG5B 5D7IB 3U6RA 5J7CC 1NAMA 1TJHL 4HDIA 1RZ8A 5FYJE 1C8PA 3NFPB 1FL6A 3VWKC 1RULL 3RNKB 1ZVSA 1D6EB 3MRGB 2NY4D 1PFCA 1T4KA 3VXQA 1AXTH 1KIPA 1CLZL 2B2XL 3MRHB 4HZAA 4H1LG 2D7NA 4GOSA 3TBWA 4PJFE 4BQ8A 1JHLL 5EIIB 3CLEL 3IGAB 2DAVA 1WCBB 5KOVC 1UA6H 2B1AL 4MVBD 4NO2A 2VL5A 5I8EB 1Y0LA 1EGJH 4ZSOA 4F7MB 4U1JB 1FYTD 3RHWK 3NOIA 2BOBB 1XR8B 2E7CA 3BW9A 1DFBL 4Q97A 2E3VA 5GS2H 1WBZB 4YXLH 4J1UB 4I2XB 4RMUA 4ZPVA 1IJ9A 5I16A 1NBVL 5CLWA 5EO9B 4GG8B 3JBG7 4D9LL 1JWMA 1LEKA 2QL1A 5AWNL 2DJUA 4M8VA 4WI6A 3VXUA 1JTOA 2QKIB 3ARRA 1QVOB 1HEZA 4GKSB 1BZ7A 5F1NB 4PLKD 4XCEA 1FZJA 5FYKE 1P84K 2I9TA 1LE5A 3SKMB 1MCFA 2ZCKH 5CEZL 3LS4L 2R29L 3GSXB 3JTSB 2VR4A 4GUPA 2HFEA 1F5WA 3HKFA 3MRKB 4X6FB 1ZLUH 4ZQKB 4LFHG 5FOJA 4HFWB 4S1RH 1CFBA 2DQHH 3WS3A 1HNFA 3ARGB 2DKSA 5F7DA 9CGTA 4LASH 4E5XA 5HVHC 1BOGB 1CG9A 4N0UE 3EOAA 5D72H 1WFTA 3MLZL 5I2IA 1RZ7H 3GIZH 1BIHA 3SKOB 5E2UH 3WFEL 3QUXC 1DDHA 3JV4A 1VSCA 4JFHD 2EEAA 4YDVB 4TULL 2IALA 4OZGE 5B4MD 1NCCH 2MHAA 1AXSB 3P2TA 1FORH 4JRYB 4LVHB 5D7IE 1MHPH 1F4YH 4GRLB 1OAKL 4WGWB 2R0LH 1SYSB 3E2HB 3QXAA 4RMRA 3F5WB 1Y6KR 5AYUH 1U3HA 2DLEA 5FYKL 2I5YH 2FD6H 3HE7B 2XFXA 4FQQB 4UQ3B 2FGWL 4MD4A 1F4XL 4BFIB 3CGTA 1AXTL 1NLDL 1FCCA 5TQ0L 4GXVL 2R56L 3MLWL 2PF6A 3RQ3A 2VZTA 4DGIH 2XZCL 1MFBH 4R7DA 3BP7A 1OB1B 2XNAB 3TZVC 3V5DA 4BQ9A 3MJ7A 4FRWA 4QTIH 3ZHLA 2DKUA 1WIPA 3KNBA 3V6FB 3OGOE 5DC4B 1J1PH 4JFZL 1TFHA 2VB5A 3WN5A 5GJTH 3S35L 5JW4Q 1JGDA 2IMMA 4JO1H 1KB5B 2C4FT 4NNYB 3GSUB 5ENWA 2WK2A 1C7TA 5FO9A 1U8QB 4WDIA 4M1GH 1UC6A 4X98B 3IDJB 5IMMA 2W0FA 1MFEH 1WAAE 5DJ0A 4B41A 4X80H 1EJ6A 2O5YH 3GEWB 5I18H 4FTVD 4RMQA 4L8SA 5I76B 1TQCC 4C56E 3BQUC 2YOCA 4XAWL 2QHRL 3I6KA 4YFLI 4FMFA 3CFCH 5J12C 3VJ6A 5HYEA 1T1WA 4R26L 2AW2A 4XMLH 3SDAA 4NNPH 3FT4B 3IDYB 2L7JA 3MA7A 5B3JF 3QFDB 3K7UA 1HOCA 3SJVE 3GBNL 2YHGA 4XPHL 1EFXD 4LLWA 4PV9B 3TO4A 2Y7QA 2I24N 1B0GB 2UWEE 5IESL 3EOBA 3QFDA 5FUZL 3IS1X 1MVUB 1DEDA 5KAQG 1RUQL 3MNZB 3KPRE 5IFAH 4PGCB 4MDJA 1GZPB 3EO9L 4MA3B 4K55A 1W0WB 4ZODA 3V4UH 1VCAA 4Q6IC 2IBGA 4UV7L 3AS1A 2UZYB 3MNZA 2W0KA 4FXLA 3D25A 3VXOB 4LKCA 1NGWA 2CXKA 2VZVA 1IAIL 1UZ8B 1Q94A 4I0PD 1DBJL 4P0DA 2B7DT 2ZNWA 4GS7C 4K7PL 1ZSDB 1HHGB 1CD0A 2IADA 1HZHL 4PJ7A 3O8XD 5E5UB 3F6IA 4HUMB 4XP6H 4ELMB 5DQDL 4HS8H 2VXTH 4G7YH 4NWUH 4LQFH 3ULUH 4ZUUB 5FKPA 3LMJH 1TQCB 3TBSA 1JZ6A 3MRGA 4OTXL 3FCTB 3K74B 4Q9RH 4D0DB 1S7TB 1D6VL 2EYTB 3ESVF 2EDRA 2PO6B 2X4PB 3U36B 2OI9B 1GZQB 1Q9WA 2A6IA 2UVEA 5ID1A 4N5EC 3VXRE 3CFKA 3VFUA 5GJSH 5ANME 5IQ9B 1HKLL 3H3PH 1AGCA 1D5IL 2OMNA 5A16A 3GHEL 1XZ0B 4BZ1L 1JHTB 1AD9B 1DL7H 5FYJL 4AEFA 4XZUB 1H5BC 1I4FA 2OM5A 5TH2A 4G8GA 4U05A 5ICYA 4LVHC 2FIKA 1HSAB 1KJMA 2VLLA 1P6FA 1HI6A 1KIUA 2QKIA 3VU2A 3WD5L 5DLML 3LY6A 4YR6B 1T1YA 4DK3A 3BEWB 4I18A 1ZLSH 1RZ8B 5J1TC 3D0VA 1G7LA 5F44A 1CGVA 4M5ZH 1RJZA 2OP4L 4JDTL 1X5KA 5KS9A 1IM3B 4M9OA 3GZKA 1NBZA 2COQA 4Y89A 4EN3B 5ESVA 3U30C 1HINL 4M1CD 4GXVH 3OB0H 2HJFB 4ZYKA 4W6YB 4P48A 4Y5YB 4NHUA 1ZWIA 4CU8A 4PS4H 3GSWA 1RZIA 5A40E 4NNXB 4NJAL 2FL5B 4MCZB 3KHQA 1E6JL 5L2KE 3VXUD 2UY7A 2R1YB 4MAYC 3CFEB 3OF6D 1FFOA 3WO3B 3KPLA 5C0IB 3BH9A 3L1OL 4TTDC 4CDHA 5KZCD 5DSCA 1IAKB 1EJOH 1N4XL 1YEJH 2Y07H 3GSOA 2YEZB 4L4JA 1FFNA 3GKWL 2DD8L 1J18A 2MCPH 5FAAA 4PJFB 2D0FA 1M05A 1WC7B 3GRWH 1CFTB 1RZ7L 1ZT4A 1WV7T 3CXHK 4OIAA 3ZTJG 3QZWA 2Y6SD 5KSAA 1FFQA 2HJKB 2ADIB 3DIFB 4M62L 3VXSD 5J6GB 1J8HD 3HG1D 1JE6A 2DLGA 4ODWA 3T0VA 3QUML 3MV8E 3Q6FA 1Q72L 4GRLC 3HUJA 5SWZA 4XNYL 2FR4B 4G8GE 4G6FD 3BDYL 3PWVB 1CGSH 2NZ9D 2BVPB 4FQLH 1VFUA 4MA8H 5C6TL 3EOTL 1GOGA 2F54D 4OZFG 1KB9J 4Y4HA 2ZCLH 1Q9LA 3GMNB 4X4YA 5HYSG 3C6SA 2BSED 4OGYL 5HGBB 3LIZH 1F58L 4TSAL 4O2CB 5TF1H 1HXMB 5I74C 2DMCA 1YNTB 3KXFB 4MNGB 4FQ1H 3OBAA 5HYQB 4MCYB 1S5HB 3PWNA 4P4KB 3VFVB 4O2CA 3VRJA 1TVBB 3C6LD 2CKNA 3FT2A 3H7BA 2V5MA 3FQUB 1RD6A 4EUPB 2DN7A 5ADOL 2GY7B 3U7YH 5BJTA 1NDMB 3P30L 3MZGB 3BIAX 5GS0L 1A1MA 5CWSA 2VISA 5EUOB 3SCMC 1IAMA 1KJ2H 1D5MB 3DVFA 3RWDB 3RRQA 4DVBA 4M8QA 2BZDA 3TO4B 1VKXA 1CFNB 5A2IH 1YEDA 3CDGB 2VABA 3QG6B 4QXUH 5I8CB 3AFLA 2VIRA 2HKFH 4LLMB 4Q2ZB 4G9FD 2BHUA 3RBGA 2CJUL 1ODAA 2DLIA 2W59A 2ZUYA 4J23A 4MWFB 3UROR 3R8QA 2R69L 3EO0A 4KJPC 1FNHA 2E6QA 5FM4A 1LILA 5DEGA 2H1PL 1HYSC 1TNMA 3TVMB 1I3VA 1M7DB 2E9IA 3L3GA 4AM0A 2KZ1B 2A9NH 1ZT1A 4EDWH 3QCTL 4QRTA 1KENL 4JG1L 1V5JA 1N5YL 2FBJL 2Q8BL 4GW1B 4PJ7B 3BN9C 4I0PB 3BX7C 1CDCA 4P3DA 1PX3A 4NDMA 1PAMA 1CTNA 4QRTB 4ZUUA 1QFUH 4MAYD 3MBEB 3BRDA 4R8WH 4WW2F 3U83A 1BJ1H 5CIPA 4ZOBA 5DJ6B 4A6YH 5E4EB 2YRLA 3D5OF 1CI5A 3PGCB 1MRFL 4YEFA 1F58H 4MNQA 4TSAH 5GRXG 3JV6B 5F1IB 2HKHL 4ZD3L 3CLFH 5I16B 4MDJB 4AG4L 1YDPA 2Z8VC 5JA9A 4U3XA 3BDYH 3RIAK 5C0JB 1E28A 3KPPB 1C1EL 1LO3L 1Q72H 3S36X 3O6FB 3CSGA 1FO0B 1WQVT 1W72H 4PJEF 4XRCA 5CINL 1SJEA 1HDMB 4XPFH 5B8CC 2DYPA 4Z77A 3BD5A 1AGFA 3KLAA 4HSQA 5IT2H 3LQMA 1BZQK 5E08L 3CFBA 3O11A 4ZPTA 5D7JA 4FFWD 2OR9H 3CPLB 4YHYB 5I9QC 5IWLC 5LGHL 1QA9A 4YXHH 3AC0A 3TT3L 5FKPB 3GKWH 2R1WA 4LPWA 3L3OA 1VEMA 5F8RC 5CD3A 4FXKA 4E5XB 4UB0H 3FO1B 4K23H 4G6KH 3ZYZA 3G5VB 2LVCA 5EFIB 3T1FB 4KY1L 1W0VB 4XPFL 5JOEA 4EN3D 2BERA 3SBWC 3ZLQC 4HMEA 3BH8A 4M93C 4HGKC 2Q7YB 4HW6A 4M4RA 1CFQB 1WBYA 1BGXH 4OFYD 4Z7QE 2RAMA 2P8PA 1A7PL 1U8KB 2VDNL 1I3GL 4WUUA 1OW0A 4JLRB 2XG5A 4ENEC 3GMOA 2AV1A 1D5XB 3KPQA 1CE1H 1CZ8H 3GSOB 4ZUVA 2R0ZH 2R2EA 5JQ6L 5DJZA 2CKBH 1TZGH 2XFXB 4FQQA 5H35B 3PV6A 2QHRH 4MNQE 5D2NB 5EO9A 1EMTL 5DI8A 4ODTH 1MCDA 3PXJA 3BZFB 3RU8H 4Z8FH 2CLZB 3AUVA 3TWCL 2CDGB 1FYHB 4P2RB 3X13A 2FWOB 2FDBP 4CNIA 4UNVA 4NQUA 1KENH 4JG1H 5J1SC 4NHCH 1R6VA 5DJCA 4CUCA 4UIMA 4LSSL 1QYGL 2D7OA 5CBAA 1JFQH 2IANB 4TNVK 1OGAE 1OSZA 1FZMB 4LHUG 2GSGA 3T4AA 4JRYD 3ARED 2D03H 1CFSB 4D8PB 3B4NA 1D5IH 3MLUH 2BOCB 4YUEH 4QTIL 2FBOJ 2GCYA 3ZE1F 4JQIL 1LK3H 1FL6B 2PYEB 2DIBA 3O6KL 3EFDL 4L8SB 4XNUL 5DUML 3GSVB 5TQ0H 3QHFL 3QDJD 5DRXB 1G7JA 2AQ1A 2V7NB 3QPXH 4JE4B 4NM8H 4YBQD 3QI9C 4JZJB 5DZLA 5IHZA 3BEVB 2BSSB 3DV6A 2HTLD 2J6EH 1PG7H 3RDTA 4HS8L 5C07D 1NSNL 4KQ3L 2NXYB 1OAKH 2X4NA 3UZQA 4QRRE 5EH1A 5KS9F 1D9KB 2CO6B 4IOIA 1DBJH 4HUXA 1A3QA 4QRPE 1YN7A 3I84A 2I9LA 3T0WA 3MNWA 1OSPL 3CSYA 2B4CH 4BFIA 5BV7L 4P5TA 1PZUB 1RURL 4CKVX 5TQ2H 4OZFH 1A0QL 5HHOD 4LSUL 4S1RL 3UPCA 5JXEC 3SE3C 3DTXA 1PKQE 4Y5XC 1F3DH 2XZZA 4LSRH 1DBBL 4QHUA 4JRXB 1K4DB 2PNDA 3X11A 1QSEB 1U91B 1JWSB 5D7LA 1I8IA 4TUJB 1C12B 1K4DA 1LO0H 4LCIL 3VXNA 1MCSA 4PLKC 4ZXBC 2ORBL 3VA6A 4GG6F 4ZUWA 4NQXA 1U9KA 4OCRH 4RFOH 4M6ML 3MV11 3L3KA 3B8SA 5H37G 1JWSA 3C2AL 4DKFH 3GJEB 3NFPA 4D9LH 3T3PF 4WTZG 1LP9F 2XIDA 2DQEH 5LQBL 2NX5B 4OBSA 5E5RB 4LPCA 3U4AA 1IMHC 3BKCL 5IVXE 1QO3A 1LDSA 3UAJD 3QSKB 2X4UA 3DI2B 5MI0B 3K4ZA 3W5MA 2GT9B 1DVFB 4OLWL 3RL2B 1I9RL 4K94H 1JNHA 4ELME 3CDGA 3JV6A 5F1IA 4GAYA 1MY7A 1J1XH 4G80B 2FB4L 1J1PL 3CX2A 3L3HA 1YC8A 1HQ4A 1E6JH 3QWRD 2WZPD 4ZDHB 3Q5OA 4NJAH 3MQIA 2AXGA 2H9GB 2AJSH 4EBQL 3HAEB 4M1DL 1RV6X 5DTFA 3I9GH 1OGTB 4RAVA 4KV5F 4OZIE 3EJJX 4GKOA 4PP1D 1URLA 1U8NA 4H0HB 5I66A 1MJ8L 3QEUB 4PJBA 3T65A 3GMLA 2EZ0D 1UACH 4P3DB 2IAND 3CK0H 5JXAL 2BNRB 3ZYJA 1TITA 1IKNA 1NCCL 1AR1D 3MCLL 3TIEA 4TULH 4OB5H 3TNMA 5ISZA 1I7UB 5I71B 4KI5E 5J4MA 1AD0B 1SQ2N 4CU7A 4K3DH 3RVVC 1DSFL 3TZVB 3SE8H 2ZJSH 3ARFA 1QHOA 2WBJB 1SEQH 4JANB 3Q0HA 1N7ML 1FNSL 4KK5C 2EIDA 3DMMC 3I2CL 3IDNB 3QXWA 3IKKA 5EBWB 3EOAB 3O9WD 1K2DB 4XP5L 4M4PA 4K3EL 1EHXA 3P4LA 2J8UF 1KIRA 2C3VA 3MRJB 1SMAA 1T83C 3C6LC 3WYRA 3LKNA 4XRCB 3HCVB 1OLZA 2WWKO 1UKQA 5IIEB 2JCCE 1DQTA 4LLVB 3E8UL 5CGYC 4Z7VF 3BGFB 3PV6B 3C87A 1AE6H 3BJ91 3ILQC 3TN0A 2APFA 2Z35B 1AP2A 4G7YL 1AY1H 4NWUL 4H25A 3IETB 5IB1B 2XQBH 1RUAL 1WZLA 1QEWA 3RAJH 3ZHDA 1MCKA 4AQ1B 1MRDH 3TN0B 1UWEL 3CVHH 4X6FA 3L3IA 2BC4A 4XC3H 4L29A 4CMMB 3T1FA 4E41B 4YX2L 1IAIH 1HHHB 1A21A 2H2SC 1EJOL 1N0XH 2NY0B 3FQWB 3B5GA 5CEZD 3B2VL 1OCWL 3WN5B 3C5SB 3IU4H 2JB5H 4CN1A 3ALWA 2XN9A 3G5ZA 1DQLH 1GGTA 3F7YA 1F8TH 1RAMA 2GJZA 2OLDA 5FUZH 2JCCF 3D2UD 3V5HA 1SEBA 3CH1B 3SDXA 4PRAA 3AU1B 5IESH 3K1DA 1I1YA 1KXQE 2P5WE 2YD7A 3FRPG 5EOQH 3VXRB 4RWYH 4JY5H 1OM3L 5BOZG 5JIIA 3ULUD 1BQHA 1H15A 1HSBB 4YHKL 3MMEB 1A3RH 3QXAB 1CE6B 1GIGL 4NQDA 1CVRA 2D03L 5FV1L 4NRZB 3UDWA 2HN7A 4OV6F 3NZHH 5L7XL 4G5ZH 4G42A 2CMRL 5I17B 2JJSA 2YD5A 2I9LB 5GGUA 2GITA 4M00A 3BE1H 3PJSA 5IEHB 4LPXA 1FZKB 1IM9D 1S7QB 4KRPD 4PJCB 5T1MB 3C09B 4HXAH 4UILH 5ETUA 2JCCA 3WCYA 2MMXA 3VFOB 3ET9F 5MERB 4P59L 1UWXH 1ZTXH 1UXSA 1LEGB 1OTUD 1Z2KA 4JKMA 5EPMB 3G04A 3MUGA 2C1PB 5C0CE 5IB3A 4N8VG 5D9SB 1TZGL 4XI5C 2DL9A 5TPWH 4L8SC 1IM3A 4Y0GA 4R97C 3H9SE 4HBCH 5DRXA 1DQJB 2BNRD 2CH8A 3HG1B 3DX9A 4LKCB 3LHPH 3C6SB 3ZE2F 1NANI 3LZFH 4M7ZC 4R4ND 1I1AB 5AEAA 4RWYL 1WLHA 4GW4A 3SDAC 1MJJB 2P43B 4I0KA 1LMKA 2DQDL 2NW3B 2GUOA 1K4CB 3RWCB 4NZTH 3AAZA 4YDIH 2WIIB 5AYUL 4U1KA 4XC1H 3AMLA 1J1OL 1CL7L 4XP6L 1KG0B 5F97E 1DLFL 4YFDB 4KGLA 4X6DE 3BP5B 3Q48A 4QTHB 3S5LA 3V0VB 4FXGA 3GIVA 4UB0L 1QO3B 3IJSA 4LF3A 2HT3D 4GAGL 1RZJL 5SWSB 5BCAA 4QGYA 5EU7C 4XHJC 4WHTB 5B38G 2GT9A 5DJAB 3TT3H 1MVUA 5IOPA 1TMCB 5IHBA 2OJZL 3LCYA 4DQOH 3BZ4B 5F9AC 4ODSL 3QZWB 4Y7MA 4DW2H 3VWJC 4NP4L 5DMIL 2EDDA 2GQHA 4KTYA 4XNXH 4XP9L 1A9EB 3HG1E 2BY0A 4KZDH 4Q9QL 1P7HL 2ARJA 3FN3A 3G5XA 1PY9A 4JFFE 2HFGH 4XMKH 1ZSDA 5F7EL 3EAKA 3QCUH 4OJFL 3WNOA 1LO5B 1K8DA 2AP2A 3IDUA 4PJBB 3RKDC 3T65B 1XF3A 5AUMA 1Q9LB 4X4YB 4GBXB 4AK1A 3DROB 4LKXA 3VMNA 5J0BA 2BNRA 4OCLC 4M7LT 4OIIL 1MCEA 4YDJA 5AZEL 1FBIL 2O93L 5C0CA 4PTUA 3MUJA 1J0YA 3K2UH 3BO8B 4HXBL 5HHNB 2CSPA 3VFTA 5AG8A 1U42A 5CEZE 1QFUL 3H9SA 5D1ZD 5FECA 4NRXA 3DSFH 5C0NC 3WIFA 4H26A 1CU4L 4K3DL 1C5BL 3N1GC 3RWIA 2UWEB 3PDOA 4YIQA 3HNVL 4EXPX 3DURB 4R96A 1KT2B 1KFAL 3H8NA 3KPOB 3DRQB 4XP1L 5E8OA 4F9PC 2H2PC 3PWPA 3PWJA 1EGJL 1G0YR 3TBYA 25C8H 1QNZH 3FONA 1RIVH 4UQ2B 4PGZA 3RFZC 3SGJC 2D2OA 1I85A 2F8XC 2AJUL 2P8LA 5IIEA 3HZVB 3FO2B 4I18C 4POZD 3ZZ1A 1IARB 5ACZB 3OKLB 5F3BB 3SKJL 2CDGA 2BVOB 5FIEA 3TBYB 3U0PB 1O7VA 4EUPH 3MA7B 1B0WA 1RJLB 3FAWA 4NRYB 1HDMA 4R0LB 4NZRH 2OK0H 4FTVE 1AGDA 1NC4B 2V6HA 2OJEA 2A6KA 3HI1B 2HT2D 5HBBA 4ZSOE 5MP6H 1KJ2B 3UP1A 3O6LH 3FQXB 5E6ZA 1X5FA 3RWHA 1TCRB 2NTFB 2FB4H 4ZS6C 4MLIA 1NEZA 3D0LB 1AD0A 1EIBA 4HS3B 4I13B 1T1XA 2HWZL 1R3JB 3WUWB 2L7UA 3CU7A 4RMSA 1WWBX 2C4FU 3WJJA 3WL9B 4IBLT 4JHZA 3MO1B 1F6AA 2YUZA 4LSQH 1E4JA 4MAYA 5TE7L 2CR6A 5JW5B 5ADOH 2F5AL 4NBXB 3CC5A 1X5HA 5T33H 1KJ3L 1XGPB 3VI4F 4KDWA 2J8HA 2JJTC 1DBAL 1SBBA 5K9JH 4KHTL 2DM4A 2FEDD 4P46C 2I25N 3VFRA 2IAMC 1N6QL 1XCTB 5C09D 2YD6A 4C54A 4MA1B 4X9IA 2CLVB 4HF5L 3QI9D 2RCSL 5ITBH 5KVMC 1GPOH 3TIDB 3P4OB 3R8BB 4NC0B 4O2FA 5DD1L 2VKWA 4FABH 4UILL 3TNNA 2VKXA 2BOBA 4MJ2A 1CE6A 5KSAB 4JPIA 4XNYH 4NO3A 4DKDC 3IFLH 1KBGL 3MJ9L 4GRLA 3K4AA 4A6YB 2Y1VA 3D39D 1PQZB 3L7FA 1P4BL 4YHOL 1DLHB 2ICWA 3PWPE 5E6YA 4M7LH 3T3ME 1DR9A 4JFPB 3MBXL 5JIPA 4JPIB 5LBSL 4HBQA 2F9BT 4LBEA 3MRPA 2X4OA 1QFWM 1OSPH 5GZNC 4FTVB 4XTRD 1IGMH 1G9MC 2F8VA 3QQNA 4HUUA 5CUSL 3RI5K 1XF2A 1EHLL 5EZLA 2P24B 5I19L 12E8H 4TUJA 4MXWL 1EO8L 1WFOA 1UA6L 5DJDB 1WIUA 2OBGA 1U3JA 4OZGF 4ODUA 4ALAL 2GTWA 2BJML 3ZKND 3BWAB 4NNYA 5ENWB 3V4PH 3C08L 1SBSH 3CFDA 1KPUB 5EUKA 4KKNA 4OD3H 1P7QA 2OJZH 1E4XH 2YD3A 3ARBC 3JUYA 4DUXA 5D7SH 3RUGE 1NCWH 5HYSA 5SX4H 1J5OL 3ZKSD 3S37X 3DGCR 4PB0H 2VITB 1E6OH 5ACLA 3JV5A 5E4IA 4NFCA 3VFSB 2I60L 1H0DA 2VZ1A 4TQEH 4BSVB 3S4SB 1RUPL 3KPQB 1RIHL 2XWBA 1FJ1A 4W81A 4N0YL 4G7VL 3UYRH 3EGSA 4Y16C 3JXAA 4HUXB 1QBMH 2AJXH 3SE9H 5IOPB 2FRGP 3N0PB 4Q2ZA 3TV3H 1MNUH 3TYGL 1MAML 4C56A 1Q8MA 3NCJL 4ZFGH 4WFGD 3NTCL 1KEML 5CJQL 2AABL 3IFNL 3LEVH 5FA3B 3PGFL 2DQUL 5EU6D 1BFVH 5ID0A 1ZHLA 3DUUB 4Z7WF 3ARBB 1DL7L 3UTSD 3IDGA 1INEH 3RGVD 4G9DA 4JM4H 2YMXL 1BFVL 4M7ZB 3JWOC 3T4AB 5F7HA 1UZ6E 4RGNC 4QNPE 2R4RL 3AVEA 4RAUB 3X11B 4OBRA 4JR9H 1E4WH 3O6MH 4ONFH 1WZKA 3U30B 1HYRC 4G9DB 2W1NA 1KULA 1GGCH 3KAAA 5DDHA 3W2DH 3GSXA 4WI5A 4YFLF 4HIJB 2IGFH 4G5ZL 3V5KB 4K8RC 3RZCC 5GGTA 2FO4A 5SWSA 1GGBH 4LVEA 3TP4A 1LE9A 2DB8A 3RGHA 5HGBA 5DA0B 4G6KL 1ZS8B 2UWEF 3B5TA 4QRRB 1II4E 1VFBA 3QIWD 3KXFA 1Z9LA 1NUNB 3FQTB 2E27H 2H32H 4KTEL 4U1HB 1CDGA 5E9DA 5DFVD 4PJDA 4OT1L 3RUGA 2DL2A 2CGRH 3RGVA 1F8TL 5HHQA 3AXLA 1HQ4B 3QUMA 3V4PL 2EECA 1DBML 4DN3H 4JRYA 1A14H 4D0BA 5M95B 2Y7QB 1BWMA 3MV7D 4KPHH 3T0EE 1WEJH 2L0DA 5BVPL 1AQKL 5JO5A 2FEEL 3O4LE 1SYSA 3SGKA 4M6OL 5C0FA 3IDIB 4MGXA 4PG9B 1RUQH 3D1MC 4P2QE 4JKPL 1LO3H 5L6YH 1ZA3B 3O3BB 3MYZA 1U0QA 4W6XB 3MRCA 1J9CT 5E8NA 3RY6C 4WWKA 5EZOH 2C4XA 3D3VA 3WNNA 5LQBH 1Z3GL 1IC5L 4H1LH 4Z7NF 4UNUA 2EO1A 1DQQB 1NFDE 5I75C 5FYLL 4U7SA 1FNEA 3QDMA 1F2XK 1M6OB 3MRCB 1A6AA 4K7FA 4MWFA 1XGTB 4L9LC 2GSGB 3F7YB 1HH9B 1IQDA 3LSOA 3D85B 5CP3A 4NN6C 5EC1A 4BH7B 3MJ9H 3DV4B 4K9EH 4X83A 5C0BA 4PD4J 4XAWH 3QZWG 3EOYG 4RGMC 1AGBB 2PW1A 5FB8B 3QCUL 3VWJB 5F7EH 1NGPL 4KKAC 3STBA 4UQ2A 2AQ2A 3GSRB 1JZ3A 1AIFB 3B3IA 3T0XA 3LEYH 2V7HA 3LVEA 3D9AH 4A2MA 1KB5H 1A1MB 2D0GA 2LU7A 1MCCA 4PY8J 1MH5A 3TJHD 4FQJH 3SDXF 2H8PA 4KI1A 4ZAKA 1CLCA 4JO1L 1FCGA 4KHTH 3S35H 5DJ6A 1L6ZA 1I9JH 1I1RA 2ZJSL 1H5BB 3JWDC 2VDQL 4PRIB 3WHE0 3KXFE 3WEXA 5IB5A 5TGBA 1EHNA 5EO1B 4OB5L 4Z7UB 5E9DE 4ETQA 1HHIB 5JZ7D 4OFYA 4R3SB 1Y18A 4B0MM 2ITCA 2CDEB 2APTA 5MHSD 2R1XB 3ILQD 1AO7D 4KQ3H 2BP3A 3J7HA 4G43A 3SDCD 4JM2A 3T0EA 4IRZH 2GCYB 2DI9A 2XWTA 5J56B 4H5SA 4BH8A 4R4NC 2EC8A 2KUTA 5E8EB 1IAIM 4XB8A 3BZEB 3ZT7A 1WF5A 3QQ3A 4BFGA 4Y1AA 2CLRB 35C8H 5DO2C 4BYHA 5EUOF 3MLSH 3PHQB 3DPBA 1CR9L 5KSBB 1NFDA 32C2B 3EYFA 3GB7B 4JCLA 1ZGLP 2IQAB 4FQ1L 4X6CF 1C12A 3MLUL 2Y23A 3QWOA 1OVZA 1I9RH 3QDGB 3QRGH 3T4YB 1EUUA 1U2HA 3UO1L 2ATKA 5EIVA 3ARYA 1OQOA 2AJVL 3IRZA 3BKYL 3DSFL 5C0JA 5K59E 2XA8L 2EEBA 2R29H 4L4TD 1BBDH 4KRNA 3GMQA 3TH3T 3KPMA 3DLQR 3M17A 4NJ9L 2ERJC 3DJ9A 2V2XB 3OJMB 5D2LB 1ZK9A 5JQ6H 4GT7A 5BW7C 5ABDE 4PP2A 4UV4H 1FPTL 1RZFL 2CD0A 3P9MA 1LP9B 4R2GB 2GJ6B 5JDSB 3GGWA 3QEQD 3AGVA 2BVQA 3OKMB 3GSQB 4P99A 4ZXBA 4FQIL 5DT1H 1KPRB 4YQXL 4QWWD 2NY7H 5TDPA 4GBXA 4M03A 4KZDL 1LP9A 5D70H 2EE9A 4YO0A 3MJ8A 4QHNB 3HI5H 5C07E 2OMBA 3QUYB 3HTLX 3TCXA 3G5VA 4ODSH 3UC0L 1CXLA 1PSKH 1T0NA 3GJEA 3V4VH 3BGMA 1JRHI 1IGCH 4QRQA 1MFCH 2WWMC 4DQOL 1N0XL 4D8PA 1X5LA 1QBAA 4FFYH 3WIHH 2ADFH 1ITBB 2CGRL 3OXRA 1JTPA 4LIQE 4AEHH 4M43H 1WT5A 3DXAE 4G3YH 2FJFB 4Y1AE 1Q9KB 4ZO6A 3WXWL 5FO9B 2EDJA 4U6HA 4WI7A 4PJIB 4ZUSB 3SDCA 4FNLL 3HRPA 1I1AD 3RAJL 1KTLB 5LWYH 4ETYA 3MUZ1 2F8OA 3FONB 1JUFA 4ODXA 3T2OA 3DBXB 3NABH 5F89B 5CCKH 4NQDB 5F7UA 2IPTL 1H9VA 4PJDB 2WQRA 5IHUH 4OCXH 3PL6B 1INQA 5EU5B 3DO7B 3MLPA 1D5MA 4XNUH 3DVNA 2BX5A 3B43A 4XAKD 5DRNB 5EIQA 1JPSL 4AT6B 2ATPA 4G9FA 4JM2D 2P1YA 2VXUH 1HHJA 1KCUH 3H0TA 4JZJC 4MD5A 4J7RA 1P9MA 4QRUB 5DQ9A 3HE6B 1S7WA 3LKQA 1XF1A 1ZTXL 2P49B 3MJ7B 4G6AD 5HDOA 1R5IB 3J8F7 1KB5L 5C7XH 4EI6B 5HI3D 4U7MA 1T66C 4QXTB 1OD7A 1BF2A 2P8MA 3FN9A 4X5LA 5IW3A 4YJZL 4H1LA 5C71A 5A2KH 4LPVA 4KMTL 1UH3A 5JMOC 1XGTA 1ZT1B 5CD3B 5E56A 3QCTH 5EBMB 5FXCH 5BRZA 2ZUQB 1JMZA 2VWEE 2OSLA 4AIXA 1RVFH 5C0CD 4GH7B 3MGAA 1J8HA 2AQ3A 5DMKA 3OSKA 4NCDA 3O4OC 2PR4L 4FXGB 4U6VL 3ARZA 2F5BH 4X6DF 4C83A 2PKDA 3TN0C 5CZVL 3PWJB 5HI4C 3UTTD 4JFDE 43CAA 4O02H 3RY5A 3WIHL 1R3KB 5MI0C 1DUYA 1IE5A 2W65A 4KY1H 3EYQC 3QEHB 2HRLA 2GJ6E 3NA9H 1K6QL 3VXSE 2VLJA 5H35A 5E03A 3HPLB 4ACPA 5C9JA 1BECA 4O02L 2W07A 1QFPA 3IDYC 5CP7B 2EIZA 4APQD 4JG0H 1N3NA 2XRAH 1BOYA 4OT1H 3WNLA 4KV5E 4OZIF 2NW2A 2YSSB 5CUSH 3REVA 4YK4B 2R1XA 5K9QG 3GBNH 2J3SA 1EFQA 3FFCB 5GRVK 2J6EA 4XVSH 4U0RC 5F8QC 4P4RA 1RVFL 1F6AB 4KROB 3V0AC 2C1PA 4DKEH 1JF5A 4TVPD 4HAGA 1RUMH 1A3LL 4Z5RA 2FJHA 4IJ3B 2NPLX 1UQSB 4D94A 4I18B 5IM7A 2HT4C 1R3IH 4R6UA 3F62A 1KCRL 1QD0A 2BNQA 2VOTA 3QJHA 3UDWC 1BVKA 1LO4H 1Y0LB 3L6FA 1RZGA 2X1PA 2WINB 1DVFA 4XP5H 3GUTB 3TBVA 2OTPA 3RNKA 3PXHA 4WNQB 4EI5C 1Z5LB 4MJIE 1M7IA 3CCHA 5ECJE 4BZYA 1KIPB 4RBPK 3KVQA 5IK3A 1XZ0A 2NY5C 4C56B 1QRNA 1FL5A 3D69B 1PLGH 4RX4A 4HJ0D 1KPVA 1A7BA 2DLFL 3CXDH 3KPLB 3OR6A 4FFWC 2LAGB 3WHXA 3S7GA 3UJTH 1FN4B 5TE7H 1E28B 4XCCL 1QKZL 4CADA 3V8CA 2FD6L 1H3UA 4NO0B 4P2QB 1A1OA 4CNIB 1R5WB 2GJ6A 4JFYA 3QEGL 1UM6L 5D93C 5LWYL 1VB9A 3KGRA 1MHPL 4F15B 2BCKB 4WW2A 5A2FA 1CLOL 5MP6L 4LRNH