3O6LH

Anti-tat hiv 11h6h1 fab' complexed with a 15-mer tat peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWFCQTPEKRLEWVASISSGGSYTYYPDSVKGRFTISRDNARNTLYLQMNSLRSEDTALYYCARDYDYGVDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11H6H1 Fab' light chain
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lH01
3U9UA 1Z9LA 4XH2B 4LCWA 1KC5L 1A6UH 1T7VA 3RUGE 4AMKL 1G0XA 5HHPB 4JFHD 1D5ZA 2A9MH 1FZKB 4MCYB 3JTSB 4QHLA 3ZE0F 5KAQF 1NCDH 4PRIB 2NY4C 4LU5H 1GGYA 5TH2A 5F7EL 5EBLA 4QNPE 1EAPB 3GMPB 4ODTL 3CSPA 1XCTA 4X4XA 1X6LA 4X99A 4YDIH 4FQXB 1IGFL 2NY3B 4XXCC 2L4OA 5FECB 3FQRA 4P2OD 2WUBH 5GRYA 2XFXA 3ILQD 1XGQA 4LQ1A 3EZJB 2OJEA 1A6UL 4YPJA 1LP9A 4P2OA 4OCYH 3MYZA 3ULVD 3OMZA 2V5TA 1QSZA 3VFNB 1HYSD 1OAQH 3CFJA 1ZLUK 2H2PD 1NCDL 4Y4HB 5I8KH 3B5GA 3T0XA 3WKNA 3W5NA 5IB5A 1MREH 2VLLB 2XN9E 3DX7B 3HC0B 3MCG1 4ZOAA 3FB6A 5C0CD 4YDIL 3SE4A 3QDME 1V7NL 5D8JH 3NCEB 3SDAC 2WUBL 1QACA 2J5LC 5DJDA 1Y6KR 5C0CA 3VXRB 1WWBX 1CDIA 1QSED 5D70L 2EDQA 2HT3D 2XQYG 4JHZA 2P7TA 3ARDD 2F53B 4OCYL 2HVKB 1KJ2L 1QSEA 4M6AA 5KVMC 5EIIB 1OAQL 3B43A 5D2LF 3MRQA 2NY0B 3ARDA 2G60H 4L4VD 1FL6B 3EYFB 2B1AH 1LHZA 1L7TH 1MREL 1T3FA 3MRFA 4FXLA 4DFIA 4ETYA 4BKLB 4ZXBC 4NC1E 4L4VA 3V7AG 2BVPB 4LSVH 4BSVA 5D8JL 1KTLA 1U9KA 1U8JB 2HN7B 4KI5E 3X11A 4KKBD 5GPRA 5GS1A 1QA9A 4X6BB 1I4FA 3IVKB 3BH9A 3BKJH 2ZSWA 4HIIB 4L8BA 2BERA 2D7NA 1YEJH 3HE6B 3T1FB 3MRPA 3GFUA 3JWOC 1WT5A 3QDJD 4I4WB 1G6VK 4X6DA 2G60L 5ENWA 2B1AL 1L7TL 4JEGB 1S5HA 1UXSB 5IW1B 3QDJA 3P4LA 4FP8H 3SQOH 3WNNA 3CSBA 4LSVL 4J3VA 5C07D 4BSWB 1K5NA 2X2YA 4N0YH 3GK8H 3FKUS 4PJ8A 4QRQB 1DBJH 1KJ2A 4H25A 3HUJF 2YXFA 1C7TA 3WUWA 3OGCB 1CFSB 3NCCB 4RX4D 5ESVA 3BKJL 3MV9E 3VGGA 4PGZA 2FYYB 1JV5B 2GEEA 2HTKD 5DI8A 1X5AA 2FL5B 2AGJH 4RX4A 2R9HC 3IDUA 2DQDH 1TVHA 1G9EA 3QQ4B 4G9FB 3VXUD 4NQED 3QQ3B 4WI4A 1PD6A 3MA9H 5IW6A 3LB6C 4FP8L 3SQOL 2MTPA 3CFDA 1CTOA 2G75B 5F9OH 4NQEA 3VXUA 4EOWH 4I9WE 5TQ2L 4N0YL 1C5CH 3MRIB 2XT1B 1DBJL 3O4LE 3DUUA 4HW6A 1FNLA 1NGZA 1DANT 1KN2H 5IK3A 3TO4C 3V6ZA 3ES6B 4JB9H 4MJ4A 2AGJL 2AXGB 1UB6B 4BQ8A 3KPOA 1MRCH 2DQDL 5J9PA 5D7JC 5M94B 4DZBB 1UGNA 3L3HB 2RQ8A 1NANI 2NR6C 5E6ZA 3QDMA 3FT2A 3MA9L 5GGRA 1T1XB 2J5LB 5F9OL 4EOWL 2ID5A 2DWEA 5DJ6A 4YJZL 1MY7A 3B5HA 2BSSB 1C5CL 2BY3A 4ONGH 1LDSA 1GSMA 4HUVA 3PWVB 4ELME 5I1LA 4NNYA 1JYXA 1MHCB 2Q7YB 4F9PC 2ZNWA 1KJMA 4MX7B 1KN2L 3HC3L 5K33A 1ZE3C 1KTDB 1IGCH 1G9NC 1XGTB 4OUOA 1HQ4B 1MRCL 4ZXBB 4F58H 2R1YA 4HK3J 1DUZA 4TN9A 1ZLVH 4HJJH 3NCBB 4QHKI 4WUUD 1EFXB 4GKNA 3IKCA 4POZC 2W9EH 3UC0H 4DOHB 2ARWA 1NKOA 4P2CG 1OWRM 4LVNB 5BMFH 1T89C 1IEAB 3DGGB 4ONGL 5FV1L 3KYKH 2FJFA 2OX5A 1H5BA 3RBGA 4GG8A 1GAFH 3W0WD 1YN6A 4CVXB 1IGCL 3P11L 4PJXE 4F58L 3MGTB 1R3LA 3W0WA 5I1KH 2IAMB 4Y19E 3ROOB 4HJJL 3GMRB 4L8CB 1NFDF 1T1YB 3EJZD 5FGSA 4HFWA 2W9EL 2MMXA 4XBPA 1FC1A 1KPRA 2V17H 1NCWH 5E9DB 5BMFL 3I9GH 1S7UA 3L5WB 5MENE 4MJIB 4MXWH 5A16B 2GCYB 3QPXH 1S9VB 3HR5B 5DO2D 3MV9A 4FN0A 3KYKL 1U8IB 2IADB 3DURB 4HKZA 4WFGD 5AUMB 5SWZB 4KKLC 4AJ0A 1J87A 2VZOA 3MJ6A 1B4JH 4Z78B 3OV6A 3SHSA 4NT6B 4Z7QF 4NQSA 1I1RA 3S35H 5I1KL 4ZAKD 3FFDB 2DJSA 3FB7A 3IJHA 1C8PA 4KAQH 1P84K 4OI8A 1WAAE 1ODAA 4IS6B 5MEQB 1P4BH 2C1PB 4MD5B 4OD3H 3JV6A 2OTWA 3U7YL 2V17L 3O4LA 1NCWL 3SKJH 1EO8H 1NGWB 2R23B 3I9GL 5HHNB 3SJVD 5C92A 4KFZC 1FYTD 1S7VA 3QPXL 4LL9A 4YR6A 4R7DB 3TO4B 4UV7H 3QUKB 3TN0C 5C0IA 2DQTH 4WI5A 3WNOA 3ZKMC 3PUCA 3SJVA 2F8VA 4RFOH 3QPQD 3UPAA 2VIRA 4JY5H 4HBCH 1GVIA 1B4JL 1OF2A 5IBLD 4OGYL 2WV3A 1WBYB 2BHYA 4R3SA 5FYLE 4RAUB 5E7FA 1MSPA 2GAZB 4XMKH 3DX9A 3JTTB 2GUOB 1P4BL 4HWZA 1A2YA 3HPJB 3IF1B 4ELMA 4XVJH 3SKJL 3VG9C 5INDA 1EVTC 5J11C 1TIUA 4UV7L 4QY8A 2VXVL 1MCHA 4JANA 3TBSA 4F80A 2AJXH 2DQTL 4JREC 3VFRA 4JM2F 4LKXA 4FTVB 4RFOL 2D7QA 4OFKA 3CD4A 4ZFFB 3C6LB 1JHLL 5IROA 3ESUF 3PGDA 3QDGD 4HBCL 4JY5L 5IJKC 4Z5RA 3BP4B 1IKNA 2A0LD 2HLFC 5HDLA 5DRNB 1DSFH 5CINH 3VXMB 1OOAA 4G6FB 4XMKL 3JBG7 4NUJA 3KLAB 1JRHL 2XZQH 1WQVT 1RZ7H 2XA8L 3R06B 5DJAA 4P99A 5K59F 4XVJL 4Y4KC 5D1XC 2WBJD 4YO0A 4U1NB 2DLHA 3IFLH 1A6WH 4YPGA 2DLFH 3IDNA 5EWIH 1NDMB 3ZDXE 3CK0L 1ZV5A 1NDGB 5CZXC 2AJXL 1G7JA 2BSRB 3TBVB 3H3PH 4PJXA 2N4IA 3P0VL 3TZVA 3U0WH 3DXAD 5DJ0B 5DUPH 1G7QB 1UKQA 3QQ9D 1JL8A 5CINL 5CHNA 3G04B 1JNJA 4UTAH 5I18H 1HHHB 3QDHA 5DXWA 4ZNCD 3GUTB 1LDPL 3GSNH 1E6OH 1RZ7L 3BD4A 2P5EE 2ZCLH 3IU3A 3IFLL 1A6WL 2CIIA 4MCZA 3RVUD 2DLFL 5EWIL 1I8LC 4NKDA 4M61B 4PJBB 3PP4H 4WI7A 4D9LL 1DTUA 3H3PL 5HYEA 4B53A 4N9OB 3AUVA 4P59H 5DC9B 4JGUA 3U0WL 2PTTA 2WM0A 3CX2A 4MA3A 5C08E 1WAAA 2FJGA 4BQCA 2R2BA 4AZ8A 3TA3B 4UTAL 5I18L 2ICCA 3S96A 2VB5A 3ORJA 3KPMA 3DX8B 3ARXA 4S0TD 4QRRE 4ZUWA 2QKIB 3OKYA 3GSNL 1E6OL 5JO5B 1EPFA 3UTTB 4YXHH 1AGEA 4HAFA 2AI0H 2Y36L 5TJWK 2ZCLL 4IOIA 4JE4B 2I07B 1JPGB 5FDYA 4OCMC 4EDXA 1FNEA 4M7JH 4OZGF 3RVVC 3PP4L 5CMAB 3S7GA 3RL2A 2GKIA 5E5RB 4RMWA 1CDUA 1FL3B 4P59L 3H7BB 2NXZD 5KS9A 1KB5H 1E6JH 1K2DB 2OL3L 4PJGB 1BPVA 5IFHH 5EPMA 1F3RB 3VG9B 3WJJA 3UYPA 4GMSL 1XCQA 5DJXB 5EULV 3L1OH 4WIQA 1ZS8B 4YZFE 3V6FB 4JREB 4CJ1A 2H26A 3G6JE 3PL6D 4PP1C 4M7JL 2Y6SC 1MPAH 2F5AL 1V3KA 5BZWA 2ICEA 2H2SC 4JDVA 3TESA 1Z9OA 1MFCL 2X4QB 4KK8D 3PL6A 2KZWA 1KXVC 3BEVB 5H35B 4UDTB 3KPRE 3I84A 4CVZB 1E6JL 3GSNA 3VFMA 4XMPH 4DCQA 5EORH 5FM8A 4KXZH 5IFHL 2BNRE 3DMMC 4XCEB 4Q9RH 3AXLA 1IILE 3L1OL 5FOBB 3RGVD 5LGJA 1QRND 4KMLB 1A1NA 4YDVA 2X1XR 2VR5A 4F57H 2YZ1A 2LQRA 4HJ0C 1S78C 1QRNA 4HK0B 1MJJB 2YA2A 3VGHA 3O6FC 4K8RC 1MPAL 3EDKA 3NTCH 2OL3A 2MQ0A 2WIMA 5C0ND 4PJCB 1HHKB 3RVWD 4ZS6D 5I8EB 2YC1A 4U6XA 3UEZA 3QIBC 3ZHKA 2DAVA 1AQDA 2F19H 4TTDD 1ZHLB 5EN2A 1IM9D 3IFPA 1KLFA 3NZHH 1KENH 5FYKE 3CFBA 3L3OB 2X42A 4Q9RL 4PJHB 5F44A 1MLBA 1MI5D 1IM9A 4F57L 1MELA 3KHQA 5E5UB 1ZVSA 5FKPB 5DQJB 1D5XB 1BOGB 1FIEA 1CDBA 3FT4A 1MI5A 3RJDA 5C08A 3BWAA 3VRJA 3NTCL 2H1PL 5C3TA 4R7NB 5ESAB 4U0RC 3KPLB 3CSYB 5IF0A 5JQ6L 3BH8B 3FO9A 2ZNXA 2CRYA 3CDFA 3FOMB 1TCMA 3L95B 3HB3D 1JI1A 2F19L 4AH2B 4F2MB 3FRUA 3NZHL 2KH2B 1NAKH 1LQSR 2W9LA 3RWIB 4WTWA 3B2UC 3VD3A 3IS0X 5DJZA 4FHBD 1IZKA 3SBWA 4U0QB 3ZMRA 5F3BA 4QT5A 4HEME 4WNQB 2IH3A 4XVTH 1BBJB 2J8UA 2IPUK 3ARWA 1CLCA 1T1WB 5C0BE 4P5TD 1FVCA 4HLZH 4LCCB 2CXGA 4QWWC 1ZTXH 2PXYA 3RY6C 2YD3A 3MR9B 5MERB 4P5TA 3T08A 4XPFH 5H37H 3PP3H 2CRMA 4APQD 5KSBE 5DA0B 1E4JA 1N4XL 5D1QC 5EU3A 4OT1H 4JFEB 4XP1L 1F4XH 4JFDB 3I75B 5DJ8B 3G6JA 5SWSE 1YMMB 1U3HA 5HI4C 4APQA 3TPKA 1SY6H 3KPRD 5F1SA 5KZCB 1BOYA 2Q3ZA 4KUCF 2Y23A 3B9VA 4P9HH 4XVTL 4PJEB 3PV7A 1HQRA 5JPMB 3KPRA 1IT9L 5FK9A 4WU7A 1ZTXL 4L1DA 4JO1H 5HHQB 4Z95H 3N1FC 4NJAH 3VMNA 3DMMB 1W72B 5E1AA 4QRUA 5K9KB 4KJPD 5JPNB 1HXMA 3FO1A 4OT1L 5EU6B 4N0UA 3MV11 2EEDA 4NDMA 2ATKA 1T7XA 3O45A 4ALAH 4G8EA 3NCFB 2YA1A 3O6FB 1EDQA 4NNPH 1SY6L 4H5SB 5CZVH 4MVBC 5JA9A 5KG9B 3MCLH 2V7NA 3GSQA 4P9HL 4P48A 2AK1H 4X7SH 2NNAB 1QFOA 3LEVH 5JW4R 1F58H 1J8KA 2IEPA 4Z95L 4NJAL 4DAGH 3HI1B 3FONA 4XNXL 4JN2A 2DQCH 2XQYK 2EH7L 1B2WH 3LOWA 3IDGB 5E00A 2M1KA 3VI4F 4Y5XA 4U33A 1IAII 4P2RD 1VEOA 3I02B 4PY7B 4ALAL 2CKBA 5KSUB 5I71B 2QBWA 1XZ0B 2I9LA 4NNPL 5CZVL 2J7LA 4P3DA 5I8OH 2Q76A 3G5YA 3MCLL 4WW1B 3MRHA 4PJAE 4P2RA 4U0RB 4X7SL 3X3FH 1T21A 2F5BH 3C8HA 1U42A 2GK2A 2V6HA 1A4KA 4NQCD 5MEOA 1F58L 2FSEB 2GJ6D 5I1CL 1U95B 3ZYJA 3F12B 3B3IA 1JZ7A 4OZFB 4DAGL 1A64A 1EHNA 4L5FH 4NQCA 2DQCL 3VFOA 2GJ6A 3P77B 4U2ZA 4UDUB 4OF7A 5EOCJ 2E7BA 2XG5A 3BPOC 2F74A 3P2TA 1NFIA 4JVUA 5C0BA 5I8OL 3A6OA 1FLTX 3MREB 5DRZB 3CMOH 1IM3B 2WBKA 1ROWA 4EUPB 3WHE0 3X3FL 1S7WA 3ZZ1A 2F5BL 4QO1A 3WYRA 3MYJB 3BGAA 3C5JA 5KSBA 5CJQH 1PYWA 1XGRB 3WIFA 3EDDA 1OSPL 3AMKA 3TNMB 2Y7QB 2JE8A 4L5FL 4NKOB 4ONFH 4NZUH 3HUJA 2H32A 2YPKA 5CIPB 1CFNA 5AZEH 3WIIH 4EN3D 3O6KL 4ODWB 1R3IH 4POYA 2G9HA 3UTQA 5L2JA 2Y5TA 4LPXA 5LBSH 4UI2A 3HZMB 4RWYH 1T03L 5J0BA 5ERWB 1EUTA 4M02A 3D25A 5I1JH 3WS3A 2Z92A 3TF7C 2VC2H 1XF5B 4D0BA 2W59A 5HHOE 3K7UA 5CJQL 1BQHG 1AGBB 4JKKA 4PJBF 2PCPA 4JLRB 4OZHE 5AAWA 1YEDB 4G8IA 1N64H 4U6YA 4PJFF 3DI2B 4ONFL 4NZUL 2BNUA 3Q5YA 2Q7NA 4X4ME 1UKSA 1WZKA 1ZSDA 4QRSB 5AZEL 3WIIL 2IBZY 1OTTC 2NXYD 1EZVY 3VH8B 3VFUB 3MNWB 1FBIL 4GBXC 3IXTB 4HWEH 2OYPA 4EVNA 1FNGA 4RWYL 3FFCD 3HRZB 5DHYA 3BZFB 4KY1H 5I1JL 5F3HB 5BS0D 1FE8H 1XH3B 3BD5A 5D5MB 3FFCA 1AXIB 3THMH 3LKRA 1NBZA 1LD9B 1IGTB 3FHQA 4I13B 3IT8D 5BS0A 5DMYA 2HJFB 3MMEB 3DV6B 3IXAB 3RTQB 2HYMA 3VWJB 5DFVD 4HWEL 1DZBA 3H8NA 4QF1A 3O3BB 4DGIH 4JFFE 4DN3H 1D9KB 1BF8A 2YPLD 5JXEC 4ZTPH 5IHUH 2JB5H 5HYIA 5IMLA 4DW2L 2OR7A 1F8TH 4L3EE 1IZJA 1FE8L 3LPWA 2D9CA 5HY9B 4YHLH 3THML 3RWCB 3VE0B 2YPLA 3MRLA 3ZYZA 4CW1B 5GSVA 4KK9D 3BPOB 5E1HB 1TZGH 4PLNC 3L5XL 1MCLA 4P46D 1YQ2A 4OQTH 1ZLWH 4AIZA 1DE4A 3QA3B 1QD0A 1UYWL 4CADB 5J4MA 3MXVH 4XB8A 4CVUA 2W0KA 4JDZA 4P46A 4DN3L 1WLHA 4QHNA 2AV1B 4ZTPL 5IHUL 3X12A 1D6EB 3LDBC 3IB4A 4R0LC 1KB9J 3D69B 4FQQB 1F8TL 3NCJH 3UTSB 1AIFA 1KJ3H 5DJ2A 5DK0A 1FFPA 4Z7VE 3E8UH 2VXSL 3QO1B 5K9OB 2HJLA 2ZUVA 3RBSA 4WFEE 4RMQA 3SPVA 3BGFC 2VDNL 4XHQA 4JY4A 2VDMH 3FAWA 4PJCF 3OKOA 3O3DB 1YEKH 3K4DA 1FRGH 2FATH 4O5LH 4OLVH 2Z4QB 3TNNA 2E7LC 1S9YB 3EDEA 3DTXA 2AJ3B 1Z3GL 4OQTL 2Y07H 4CDHA 2EC9T 4OD1H 3MXVL 3JV0A 3W9EA 1FSKC 4PJHF 1IARB 3A67H 5F7YC 2B8OT 2J8OA 1FDLH 1BFOA 5EUKA 1KJ3L 3VWKC 1REIA 2C9AA 4XNUH 4X4MA 4MMXC 5IQ9B 3S5LG 4OTXH 1NLDH 2FWOA 1YEKL 1FRGL 1FVEA 3U6RA 4O5LL 3CFKA 4NQTA 4OLVL 4ZUUB 3C5SB 1GGCH 4OV5B 3OKDB 2QSVA 5DEFB 1DQQA 2R29H 3D0LA 4R4ND 2Y07L 2YBRB 4IOFC 4YWGL 1BMGA 1JWMA 4OD1L 1QSFD 4LHUG 1WWAX 4CJ0A 3X14B 2OCFD 5B39B 4MD0B 3A67L 2VABB 1HXYA 1BM3H 1FH5H 1FDLL 1OPGH 3F7YB 5HGHA 3HPLB 4MB3A 4K55A 4HWUA 4XNUL 2XZZA 4JM2D 5BVJB 1VKXA 3SKOA 1SMOA 4TQEH 4XX1G 5IFAH 4K9EL 5F88B 2VE6A 4ZO9A 4OTXL 4OQTA 1AGCA 1NLDL 4F9LC 3KYMB 5IJVB 1UT9A 4QYOB 1N8ZB 3T1WA 4XBGA 1V7MH 4LARH 4PLJC 2QQLH 4TUJB 2R29L 5I1AB 4XCNA 4HKJB 4XH2A 1HSBB 3L5IA 1RUPH 4PRID 4IRJB 1KEML 3D9AH 5HHPA 3Q0HA 4QRPB 3FJTA 4MCYA 3JTSA 1BM3L 1FH5L 5GGSA 3GIVB 4PRIA 4PJEF 2PW1B 3GSUB 4FQXD 2NY3D 4L9LB 5L88H 1EAPA 3GMPA 1P5VA 3QYCA 1JNNH 3F5WB 1I8MB 4QOKB 1U6AL 4LFHD 4FQXA 4KV5F 1KPVB 2ZPKL 3TFKC 5FECA 4X7EC 4OM1H 1V7ML 4LARL 4BELD 1XGPB 4JDTH 2QQLL 3KPSE 4H1LG 3TVMC 5LQBH 4HG4J 3ARSA 3LDBB 2D7MA 1WZLA 4WFED 1RUPL 3D9AL 4XXDB 5GRVK 3FZUC 1QSVA 3VFNA 5ACZB 1UM4H 5EZOH 3CZFB 4Y4HA 1MCPL 3UDWC 1A5FH 2P5WB 2XIDA 5F7HA 5I0DA 3AB0C 3NIFE 2VLLA 1PKQB 3QUMH 1F6AB 2NTFB 3HC0A 4R9HA 1J1OH 3AM8C 5CILH 4LAQH 3VXRD 4J3WA 1UXWA 2OS7A 4IJ3C 4UU9A 4O9HL 4WHYH 4M93C 4OM1L 2F53D 3CDCA 5LG1A 2JCCB 2YR3A 4JDTL 1CDJA 1NGPL 3VXRA 2X7LB 3S88L 1VFAA 2NY0D 3SE9H 3KHOA 1WV7T 3KS0J 1FFQA 5EIIA 4U1IB 2C3HA 5EZOL 1ZHKB 4GRWE 1N2RB 1FL6A 3GSWB 1A5FL 3IRZA 4HJGB 5CEXB 2Q87A 3BP6B 3VI3E 4BKLA 1J1OL 5CILL 2OBGA 2C3XA 3LQMA 1I8KB 2GJZB 4LAQL 4JG0H 1RY7B 1SBBA 2BVPA 1QBLH 2BC4B 3TCLB 2XXMB 1CF8L 1U8JA 2HN7A 3S35X 1INEL 1Y0LB 4JFXB 3HE6D 3PWUB 1JP5A 3TLRA 4G7VH 3TIDB 3IVKA 1KCRH 3SE9L 4HIIA 2JJSA 1Y6MR 2PO6A 3HE6A 1RUML 3T1FA 3KLSA 4I4WA 1N0XH 3ARBC 3QI9B 1G7LB 2XQBH 4FRWA 4TYUA 4GH7B 1WWWX 3BQUC 1UXSA 1GPOH 5IW1A 1JIBA 5EZIH 4JG0L 4NFBA 1QBLL 4BSWA 5E95B 3QG7H 4QRQA 4FXGB 2N7AA 1CFSA 4G7VL 3NOIA 5FYJH 3E3QC 1KCRL 4G9FD 2R2CA 1D5MA 4MNQB 4Y2OA 2FJHB 2FYYA 4OCWH 2VO5A 1JV5A 3WBDA 4OCSL 2FL5A 3T0BA 1NC2B 2YHGA 4RWHA 3QQ4A 1GIGL 2B20A 2XQBL 4G9FA 3T0EC 3MNZB 5FA3B 4FFZH 3QQ3A 2VAAB 1GPOL 3D1MC 3TVMB 2HMIC 2D7TH 3LPGA 5EZIL 1H8NA 3RWDB 1P7QB 1SJHB 2E6JA 2G75A 4NOBA 5D71H 2FEEI 3MRIA 3DUSB 3QG7L 4KHXH 4I1NB 1K9TA 1FHGA 1WFTA 5GS0C 4RGNC 5F6IC 2B1HL 4FQJH 4PTUB 1B4RA 2PYFB 2NW2A 4OCWL 1JMZA 3ES6A 1U8NB 3IFNL 5DEGB 3CUPB 2AXGA 1UB6A 2OJZH 5E2UH 1WUNT 2DTMH 1UKTA 3BZDA 1H8SA 4DZBA 2XACC 3HNTH 3L3HA 1EEYB 3U4BH 4JKWA 1IAMA 4N5EC 3VGFA 4C83A 1T1XA 5D5MF 3AC0A 2J2ZA 5KVEH 4DQOH 5IWLC 1C5DA 3BIBX 1CXEA 4JPIB 5D71L 4RFEB 2BSSA 1MJ7L 4EJ1C 3QIUC 4KHXL 3I2CH 4DUXA 3PWVA 1ORSB 3C8KB 4DWHA 3PHOA 4WO4B 1MHCA 2HFTA 2Q7YA 5ADPL 4MX7A 4ZXBD 5IVXE 5T5FH 2BXYA 1KFAH 3GJFK 2QV2A 4FQJL 2DWDB 4GSDH 1EFXD 1OP9A 1XGTA 2C4FU 5E2UL 5ID0A 4FTVE 5F9JB 1HQ4A 2DTML 4JZNB 1JCKA 3OTTA 5EIQA 3QR2A 5C9KA 2DJUA 3HNTL 2DBJA 1EFXA 3U4BL 3T0DA 4ESKA 2N7BA 3WMSA 2YD6A 5GRWA 3L3IA 3EDJA 5KVEL 4DQOL 1KCKA 3SGEI 1F6FB 1IEAA 3DGGA 1O0VA 1PLGH 3I2CL 4JO3H 5EO0B 1IKFH 3UXFA 4ORGB 4JGMA 4R26H 4TUKH 5T5FL 2IAMD 4CVXA 3RKPA 1J10A 4XWGH 3BQUB 4GSDL 2QL1A 4KUCD 1XIWC 2RBLA 3MGTA 4LMQI 1UH2A 2IAMA 3ROOA 4L8CA 1MCFA 3GMRA 4D2NA 5E9DD 5EZJB 2YZ8A 1T1YA 3NIDF 4MJID 4DK3A 3QEUB 4G9DB 5TFSH 1JVKA 4OBRA 4PGCB 1FVDB 5SWZD 5E9DA 2ESVB 2CLRB 3HA0A 5F97E 3L5WA 4UUJB 5A16A 1L0YA 5I6XB 2GCYA 2BX5A 1S9VA 3HR5A 1I7ZB 5DTFB 3ULUE 1G84A 5EUOB 3VXNB 1ADQH 1U8IA 2IADA 2WUCH 1IKFL 3DURA 4JO3L 4JZJB 5SWZA 3RU8L 3WUZA 4R26L 4XPHH 3T0EB 3A6CH 4R8WL 1WTGT 2GY5A 3RI5K 4XWGL 4D9QE 4RAVB 4FQ1L 5DEZA 2AKRB 4KGJA 2EE3A 4NT6A 4NUGH 5D93C 3ZE1E 1OGAB 2A77H 4LBEB 4RQQB 3RZCC 4NBYB 1NCUA 4IS6A 3TO4D 3UZQA 5MEQA 2C1PA 4MD5A 1XGYH 1JF6A 5ESQB 5TFSL 4BUHA 2BFVH 1NGWA 1VESA 2R23A 5HHNA 4RGNB 5F6IB 5ISZB 2DLTA 3QXDB 4Y4FB 3RAJH 3UTTE 5AG9A 3QUKA 2NR6D 3RVXC 1ADQL 2WUCL 3BGMB 5INCA 2K3TA 3PIQA 1FPTH 4XPHL 4M7LH 3A6CL 5JMOC 1X3DA 5DUMH 3L5HA 4Z18A 4HIHB 1AE6L 1KPUB 5FCSH 4KK5C 1QFUH 3BXNB 4NUGL 1WBYA 2V7HB 4OZIB 2A77L 4RAUA 1AGFA 2GAZA 3QIUB 4LPWA 4PJGE 1XF3B 5C2BH 3HPJA 4F9PA 3TJHC 3RFZC 4FTVD 3S97C 1RHFA 1AKJA 3RAJL 3MBEC 3X17A 3TYFB 3OKMB 4C4KT 3CU1A 4FTVA 4M7LL 4NHUB 2J88H 1F13A 1WISA 3VXMD 4ZFFA 3C6LA 2ILLA 4IMLA 3GI9L 3BP4A 4FXKB 1QFUL 4AEEA 1BVZA 4X6FB 4YHYC 3VXMA 1Q72H 5HGGS 5KVDH 3KLAA 1YEIH 4MA8H 3R06A 1OY3B 5C2BL 1ADQA 1HOCB 2XZCH 1KNOB 1ORQA 2R56H 2V9TA 2JK5B 4NC0B 2FR4B 2AEWA 1J1PL 4WI8A 5I73B 1NDMA 5DVOA 1NDGA 2BSRA 3TBVA 1UJ3B 1IAKB 1NKRA 1WK0A 2WP3T 5J7CC 2J88L 3D48R 3MJ9H 3WDIA 3MUJA 1SYVB 5DJ0A 4ELKB 1YUHB 1LK3H 1G7QA 1DJSA 4P2YA 1A6VH 2R1XB 2MQCA 4JZOA 3G04A 2HLAB 1Q72L 4HCRL 5CSBA 1HHHA 1IC5H 2UYLB 2GI7A 1YEIL 1Z9SA 4MA8L 3GUTA 1KGCE 4Z0XB 3O8XB 2XZCL 1XR9B 3JV4B 4NQUA 3TEUA 5T3ZE 4IM8A 3I85A 4M61A 4PJBA 1ZT1B 5D93B 3CXDH 3D85B 2JCCF 3MJ9L 1N7ML 3TA3D 3W9DB 3GSXB 1LK3L 1PY4A 1NCCH 1HEZA 1A6VL 3UTTD 3Q5OA 1ZVYA 3TA3A 3ZKMD 4OF5A 4WWKC 3DX8A 1IC5L 2QKIA 2C3GA 3ECBB 1JF5A 3UTTA 2RR3A 5JO5A 2IGFL 2NYYC 1G6RB 5BCAA 3HNVL 4CUCA 2I07A 4X6CE 1JPGA 3EFFB 4HUXA 2IG2H 2VZVA 2WWMC 2X4RB 2R8SL 3OQ3B 3WSQH 5CMAA 5D2NB 3KLHC 4MNGE 3O41B 1FL3A 1G9ML 4GMTH 3P9MB 4AY0A 1BIHA 4OUUB 2WAHA 2IALB 4KKAD 1X4ZA 3O4OB 4HCRA 3O2VH 1HHIB 5TDNB 2QQKH 2APBA 3EYSH 1VFBB 3LRHA 4PJGA 1CFQB 2B2XL 3OB8A 2W0PA 5DJXA 2Z31C 4JQXC 4U6TA 3MBEB 1QFPA 1WWCA 1MAMH 1A6ZB 3V6FA 1OHQA 3ARGC 2HLFD 4CBPA 3CVIL 2IG2L 3MJ9A 3WSQL 1BD2B 3B9KA 3EIFA 2X4QA 3FQTA 4GMTL 3BEVA 5GJSH 4UDTA 3O2VL 2ED7A 4M1CC 2QQKL 4CVZA 4DVRH 1F3DH 4PREB 5CZXD 2BY0A 1DEEA 1OARH 1JYWA 2AEIT 1IGJB 5E8OB 5FOBA 1ZT4B 1QR1B 1MAML 1N6UA 2G5RA 3P30H 2WNGA 3OB0H 1MIEH 4N0CC 5T3XH 4JHAH 4NQDE 2CO7B 3BOVA 1U3YA 2XTJB 1FV1B 1MJJA 3O0RH 4HK0A 3HAEG 4MHHI 4PGBB 5A1AA 5EU4B 3QZWB 4PJCA 1L9MA 1HHKA 4C55A 4Z7WB 1B90A 4RAHA 5I8EA 3VJ6B 2EE2A 3I6LD 3EOAB 4DVRL 1WCBB 1I7RB 2W60B 5C0FB 1OARL 2XXCB 5EG6C 3L3OA 4PJHA 4PJ5B 4HS8H 1JUFA 5IMOB 5A3IC 3U82B 1MIEL 3EYVA 3LZFH 5T3XL 4JHAL 5FKPA 3M1BA 3PV6B 5DQJA 1D5XA 1BOGA 3GMNB 3ALWA 3HG1E 3O0RL 3MA7B 4WVRA 5DS8B 3ARRA 4Q9BA 4R7NA 5ESAA 2FH8A 1TJGL 3KPLA 3CSYA 3TH2T 5IP4A 3BH8A 2FNBA 2ZCKL 5GRVL 3FOMA 3LVEA 2D31B 3O3AB 3HKFA 1B6DA 3L95A 4JRWA 4TVPH 4I0PC 4AH2A 4F2MA 1W72L 1KCUH 3MLUH 2RCSH 1A8JH 1EJ6A 3DWTA 3RWIA 1PAMA 4HS8L 3N1MC 2PYEB 3LZFL 2ZKHH 5BOZG 4WNQA 1BBJA 4W70A 5I1GH 3D5OF 2X4NB 5E2JA 3T77B 4OLWH 1T1WA 4FQ2L 5IB3B 1YN7B 4LCCA 3WJLC 5HVWA 4WFHE 1INDH 3MR9A 3TO2A 5MERA 3CFCH 5DJCB 4JFED 2FZ3B 4JFDD 1PZ5B 5T3XD 4PP1D 2HVJB 3H9ZA 1YMMD 4MHHG 3NZ8B 5KZCD 4TVPL 4JFEA 4YX2H 1KCUL 2VZ3A 2RCSL 3I75A 3MLUL 4PRDB 5DJ8A 1KXQE 5TPWL 5DQDH 3OKNA 1YMMA 1CDYA 3LHPL 1KYOJ 1BQUA 1YNKH 3QUXC 2P24B 4R6UA 1IFHH 4UOW1 2ZKHL 5D7SL 4PGDB 4PJEA 3LMJL 3PNWB 2JKXA 5I1GL 3VGAB 3DPBA 3VW3H 3K46A 4OLWL 5JPMA 3DMMD 4NJ9H 4YHIA 2QR0B 1NMCC 4H26A 5L7XH 4K3JL 4EUPH 1ITBB 1INDL 5EUOF 5HHQA 3CFCL 5EU6D 3S3SA 4LKCB 3G5VB 3DMMA 3I3DA 2BOBB 1W72A 3CLEH 3LKQA 3O6FD 4YHNB 5K9KA 3PQYB 5JPNA 2AJSH 4KRNA 4YX2L 2IWGA 3O9WA 4NCC1 5DQDL 1HH6B 2NY1C 2HKHH 1OW0C 3O6FA 1YNKL 1O7SA 2APVA 4H5SA 5B38B 5KG9A 5FB8B 1IFHL 3KG5A 2E9JA 3K1KC 5E2VL 2NNAA 4TVPD 3OJ2C 3DX6B 4NJ9L 5L7XL 4GKSB 2QLVB 4PYGA 5C09E 3QIWB 5HI5D 3BDBA 3CLEL 3HI1A 5JXAL 3HMXH 4O2EB 3OAZH 1QNZH 3HZYB 5F7DB 2AJSL 3RWHB 4L8SB 4I2XB 3I02A 4PY7A 5KSUA 2HKHL 4OZIF 4G6KL 3JWDC 1XZ0A 5DLMH 4XCFL 1C1EH 3H9HB 4WW1A 4R2GB 2LU4A 2ICWA 3ZE2E 4RISH 2CRIA 2PR4H 4P5MB 3B2UD 2FSEA 4RIRB 4LP5A 1ZXQA 1U95A 5FM4A 1MCKA 4OZFA 4L3CB 4Z7NF 2NLJB 3E6FA 5FOJA 5IVZB 4HF5H 3HMXL 2EYRB 5CP3H 5TGBB 3L3JA 1QNZL 3P77A 2XWTA 3SOBH 3PDDA 2CPCA 4UDUA 1X5GA 4PY8J 1TZHB 5DLML 1ND0B 2ERJC 3MREA 5DRZA 1IM3A 4EUPA 3L3GB 4K3DH 1MF2L 1WVZA 1SM3H 1RI8A 4N68A 4RISL 4YK4C 2PR4L 1X5XA 3VXQB 1TTFA 1HNFA 3C5ZC 2A9NH 1MHEB 1XGRA 5DZLA 4X4ZA 3TNMA 4U6VH 2Y7QA 1CXFA 4NKOA 4HF5L 4AYFA 4OFVA 2NY2C 5CIPA 1NUNB 3SOBL 1P4LB 4ODWA 4TTGA 3QFJE 2V9QA 3QUYB 3QCTH 1KELH 4KTEH 3HZMA 3QXTA 2FDBP 5MI0C 5ERWA 4K3DL 4TVSa 1SM3L 3WXVH 2BSED 3WXWH 5IVNA 4HKXB 1MCWM 5FF6B 1XF5A 3HMXA 5CGYC 1MH5B 1A4JB 5GGTH 1AGBA 2A9NL 4RBPK 4JLRA 1I7UB 3F7VA 5JHDB 5KSAA 4AEIL 3X13B 2NY1B 1YEFH 4QRSA 2EDWA 3OAYH 2EDYA 4LCYA 3VH8A 1P6FA 3VFUA 2GT9B 3MNWA 2XYCA 1E4KA 1B0GB 1I9JH 2BMKB 3BUTA 3H0TB 1X4XA 3QCTL 1KELL 2I5YH 5IVXF 5CLWA 2XWBB 2XI9A 4Y2DC 3HRZA 2LVEA 3BZFA 2IANB 3BIAX 3WXVL 2A1WH 5F3HA 3WXWL 1S7SB 3GJFA 2VLKB 2YD7A 1QRKA 1XH3A 5D5MA 3FCTB 5CP3A 5GGTL 4DW2H 1LD9A 1IGTA 3CX5K 3R1GH 3RTQD 2KL6A 4JRXE 3G5XB 4XHJC 2HJFA 3DHMA 3W5MA 3MMEA 4OM0H 3DV6A 3IXAA 3IETB 3RTQA 5EZLB 1D9KD 3VWJA 1RIUH 4ETQB 2EO1A 3U46A 3KPPA 4WW2C 2I5YL 4G8FB 5CJBA 2W65B 3O3BA 4OCXH 1D9KA 3V5HB 4D9RE 2A1WL 3V6OE 4LLUB 5IG7B 1A9EB 4ZFGH 1J88A 3SGKA 3RWCA 3VE0A 4TPRH 3K0WA 3CC5B 4RRPA 4CW1A 1MCOH 4XMLH 1U8MB 4GUPB 4MXVF 1A7OH 4HPYH 5F7MC 5LVEA 3S34H 4E9LA 4WEMB 3C87A 5F1NB 4KJWC 1HN1A 4OM0L 5IESL 3AROA 2CSPA 3MRGA 1RK1B 1RIUL 2ZG1A 3CNKA 2VDPH 4FZEH 2CIKA 3QA3A 3HC4H 4CADA 2YN3A 3ULSB 3UTSD 4BZYA 3C5ZB 4OCXL 1Q9KB 1JPTL 4PRNA 3MCKB 5GGTA 1U2HA 3D39B 1D6EA 4I5BB 4FQQA 3D69A 3UTSA 2DQJH 1T83C 1JRHI 3WFBH 2NY2B 5E56A 3QO1A 5K9OA 2YD4A 4L8DB 1MCOL 2W91A 4XMLL 3BZEB 2L0DA 5J1AB 3AS0A 1A7OL 3MUHL 5C7XL 3S34L 4K7PL 3O3DA 2VN7A 4Z7WF 1NUGA 1U8KA 1MCSA 1PKQE 5L9DH 2EE6A 1S9YA 1MFBH 1OAXL 5D7LE 3QWOA 1MCWW 4FZEL 1AD0B 4GRMB 2BJMH 2CGRL 4NYLB 4PRHE 3IDJB 4H0GA 5AEAA 1NGQH 2X4UB 4EBQH 1CR9H 1NFKA 3HE7C 1IC7H 2DQJL 3GHBL 3WFBL 1FO0A 5J6GB 3QJHB 5DGRA 3U36B 5IQ9A 3L5JA 1N26A 3FO2B 2FD6H 4GXVL 1UVQB 4KTDL 4GFTB 3T09A 4KVCL 3DETD 5L9DL 1F97A 3GNMH 5I9QB 1ZEAH 1MFBL 3JSSA 3C5SA 2YD2A 4OV5A 3OKDA 5DEFA 3V4PH 4RNRA 2YBRA 4XRCB 3KPNB 5CSGA 2BJML 3MSPA 4Y16C 3ARFA 4TRPH 4NZJA 3X14A 4MD0A 3W11D 1OD7A 2VABA 1NGQL 4BK5A 5D6CB 4ENED 4EBQL 1CR9L 4LLMB 4V1DE 3QH3B 3ZDYF 1IC7L 3F7YA 5JNYB 5EIVA 1AQKH 4O02H 4BQBA 2H3NB 2Z8RA 3HPLA 1KCSH 3EO0A 4PR5B 5CD5C 1LEKB 3EJJX 5F88A 5JXED 4OB5H 1MY5A 3KYMA 4AG4L 5IJVA 4WW2B 4QYOA 1KOAA 1CXLA 1N8ZA 4IRJD 3KXFB 1I1YB 3GMQB 4TUJA 5JXEA 5I1AA 4QRPD 4GJTB 4HKJA 3ZDZE 3V6OA 5T1LB 1HSBA 1PG7W 1BECA 1EXUB 4TRPL 5C0AB 3TBWB 2IF7A 4IRJA 3Q6FB 4ZSOE 4AENB 5I15H 3M8OH 5CEZE 4QRPA 4L9DA 4P2QB 3GIVA 4OSUH 3E0GA 3T2QA 1BIIB 2Q8AH 3KPQB 1A1OB 4EZMA 4QOKD 4MNQE 5GXBB 2PW1A 1AQKL 4G8GB 1AFVH 1KCSL 4L9LA 5GZNC 1KN4H 5F89B 3F5WA 2IH1B 2HJKA 3KYOB 4OB5L 1H3XA 1IC1A 1P84J 1KPVA 4WJ5B 3SGDH 4F8QA 4WI6A 1QUNA 3SDCB 3ZKXB 4FOMA 4IMKC 3WFCH 2VQUA 4YDLB 1OQOA 3LY6A 4XXDA 1UENA 5I15L 2P5WD 3M8OL 3NCYP 1T0MB 5HYQB 3BEWB 3SY0B 3UJIH 1AHWC 4OSUL 5ACZA 2X41A 2Q8AL 3CZFA 4N5UA 1CLZH 2LV4A 4ACPA 1AFVL 2P5WA 4MQXC 2R1WB 1KLUB 1KN4L 1PKQA 1F6AA 5D9SB 5DC4B 2NTFA 3U4EA 3F7QA 3MC0A 1YPZE 1JFQL 5JW3H 1KIPB 3B6SB 3WFEH 4B50A 3LN4B 1AJ7H 2VXQH 3HNSH 2QADB 4PRHA 1MHPH 1A7BA 2JCCA 5FM5O 3OF6D 3WFCL 1M7XA 2X1QA 1Z0MA 2X7LA 1DL7H 3HE7B 1CXKA 3N1GC 2C7UB 4YGAB 1N3NB 2MFNA 1J05B 3DUHA 3OF6A 3K8LA 4TNVF 4KXZI 3ARUA 3UJIL 3CMGA 2W0FB 4U1IA 1ZHKA 3F58H 4IOFD 1N2RA 4XX1E 5I66B 3GSWA 2JJTC 1W2KT 4HJGA 5JHLH 5CEXA 1L7IH 3BP6A 4OIAA 1RMFH 5IBUG 2GJZA 4Y16B 5JW3L 3MRDB 5T5NG 3WFEL 4ZAKB 2BC4A 3TCLA 4TNVK 3NFNB 2VXQL 4PY8I 1MHPL 3MOAH 2BNQB 2ZUWA 5JOFB 1NEUA 3SEPA 5HYJB 4Y5YC 1Y0LA 2X10A 4JFXA 1DL7L 3QI9D 5F72S 3OBAA 5C86A 1FNAA 5IV2B 1FYTB 4LDOB 2KBGA 3PGCB 3QI9A 3F58L 1G7LA 1QHOA 5IQ7H 5DYOB 4KGLA 2EDHA 5C3LD 2F54B 3QAZB 5JHLL 4YXKH 2A73B 4X5WA 1RMFL 3OSKA 1FFRA 2O5ZH 3U48A 3NIGE 4D0DB 3SKMB 2CK2A 4Z7UE 5ILTH 1FZMB 4FXGA 1BFVH 2B5IC 2B0SH 2I60H 2LU7A 4H0HB 3OKLB 5JW4Q 3IJSB 4P9ML 1E4WL 35C8H 5I1EL 4LGPB 5I30H 1CZ8L 4MNQA 3RWFB 2FJHA 2X1OA 4Q58C 1AXSB 1NC2A 3TVMD 3T3PE 3VRLF 5IQ7L 3SE3C 1DN0B 1RJLA 1KG0B 5HDBF 4YXKL 2VAAA 4YDJB 1AP2A 2DB8A 4MWFB 1RUQH 2O5ZL 1P7QA 3FZUD 1SJHA 1L4IA 2DICA 1WC7A 4U1LA 1JHKH 4RZCB 5CSZB 3SDXB 2DQHH 3DUSA 1BFVL 4EXKA 1B6UA 2B0SL 2DMKA 3JVGA 3ZTNH 1AHWB 1TETH 3B2VL 3ZYIA 1IEHA 3ABZA 3OXSB 1ZLSH 1EFQA 4ZFZA 4PTUA 2PYFA 1U8NA 1MQ8A 5DEGA 3CUPA 5C0DB 1F4HA 5KAQG 2DRUA 3MUZ1 5LCVH 2VDKH 1UM6H 2AQ3A 1BQSA 1A02N 5GRUL 3DXAB 3D3VB 4MXQC 4XWOD 4XGZB 5HVHB 3V0VB 4MZ3A 4GO6B 5CUSH 4JPIA 1JHKL 4YBLC 2EZ0D 4RFEA 2E7HA 2DQHL 4IRSC 1HI6B 1U3JA 3WIHH 5B8CC 1ORSA 3C8KA 4NWUL 3ZTNL 4OAWB 1TETL 4WO4A 1RJYB 5H2BB 5GS0H 5ITFB 1ZLSL 1CFVL 2DWDA 4G42B 3KJ6H 1YY9D 1JGUH 2YEZB 3RIFK 4PGJA 5F9WC 5F9JA 3UPRB 4JZNA 1QFHA 4KQ4H 4Y8AA 2VDKL 4N1EA 5AYQA 4MZ2A 5ALBH 5L2KE 2GTWB 5CUSL 3PG2A 4ZTOL 1MNUH 4ODHH 2HA1A 3CGTA 4XCYB 5FDWB 4PJIB 4C58B 3BQUD 3VXSB 5EO0A 2ZUUA 4HEPG 1TJHH 2CK0L 4NBZB 4ORGA 5D7KE 5GS0L 1TNNA 4JR9H 4XP6L 3KJ6L 1DP0A 4HPOH 3AS2A 1JGUL 5FA4B 4HLZG 3HFMH 1LO3L 3QFDB 4KQ4L 1P9MA 1A6TB 4JPKH 3H42L 4H1LA 2ESVD 3FB8B 1CE1H 4HH9B 4Z7UA 2OK0H 2ZOLB 4U6HB 5ALBL 1QPPA 3QEUA 1ACZA 3QEQB 5H37G 4G9DA 4PGCA 1FVDA 3WS6A 2CLRA 5E6IC 4C54A 1MNUL 4ODHL 5D7IB 3T0ED 5DTFA 1DBMH 3KNBB 3BYYA 4YAQB 1ZA3B 4LLVB 5EUOA 3RGHA 3VXNA 2ARJB 4JZJA 2HMID 3T0EA 4UTBH 1OGAD 2MPAH 4BFIB 3GZKA 1DQML 4HULB 4RAVA 1PY9A 2ZOKB 2AKRA 3HFML 5EO9B 3NFSH 3S37H 1OGAA 4LBEA 3GHEH 5IW3A 4ODVH 3U30C 5GS0D 4RGND 5ISZD 2OK0L 4Y4FD 2AEPH 2PNDA 4PJ9C 2VZSA 5ESQA 3Q3GA 1BGXL 1HWHB 5ISZA 3L6FA 5IOPB 1RURH 4Y4FA 1Q1JL 3EZ8A 5HTSA 4C59B 2E7MA 4Y8DC 2DQEH 1QLFB 3BGMA 1RZFH 4N5ED 3C60C 1IEBB 3RWGB 4UTBL 3K80A 4RDQF 5BW7A 2MPAL 2D3VA 4HIHA 2P42B 3VFVB 1KPUA 1IQDB 1UB5A 2M26A 4B7IA 3QIUD 1OM3H 3BXNA 4JG1H 3NFSL 3S37L 1A6AA 3SGJC 2V7HA 3GHEL 1Z5LB 3DYPA 4ODVL 4YBLB 3EO1B 4GG6E 3QIUA 4JPVH 2AJZB 1X5HA 1XF3A 2HT2D 5E08H 4A2MA 1XFPA 3UAJD 4Z76B 3NACH 1RURL 3H9SB 1F2QA 4F7EB 1I3VA 4XPAH 2DQEL 4WFFE 3T65B 1RZFL 3TYFA 2GHWB 3MLTB 3WLBB 3OKMA 4WW2F 5DQ9B 3RRQA 4NHUA 4LQFH 1KB5B 1YJDC 1QFWM 1CLYH 2W07A 4HFUH 3DRTA 4WTZG 4FXKA 3NFPB 1OM3L 4JG1L 4X6FA 4AIXA 4KDTA 4LEXH 3MLVH 2CJUH 5D7KD 3VDBA 4WV1C 4OFPA 4W4OA 1JWSA 4I18C 4JPVL 4M7LT 3LD8C 5E08L 4PRPB 4CU6A 1HOCA 3BRDA 1KNOA 2PW2B 3MV7B 3NACL 2JK5A 2VMFA 1F3JB 1D3CA 3GRWH 4XPAL 5GGRY 4OQ1A 2VDOH 1J11A 3OAUH 1UJ3A 1CG9B 1IAKA 4LQFL 1CLYL 4ELKA 4HFUL 1YUHA 1L0XA 2HRPL 5F93C 5KJRH 2ZSVB 4JKLA 2R1XA 3PGFH 4ZYKB 3OJVC 2H9GB 4QXTA 4LEXL 3AVEA 3MLVL 3O8XD 2HLAA 3STLA 3D87B 4P23B 2NY7H 3B8YA 2AERT 2DQGH 2P8PB 4OLEA 4YBQC 2UUDK 3HCVB 4UOJA 4ZNEE 4ZMAT 3UTOA 4Z0XA 3O8XA 1T6VN 1XR9A 4E0RA 3D85D 4HV8B 5JIPA 3GRWL 4QXGH 4PJ5E 1LO4H 4WGVB 2AABH 3IJYB 1C12B 3D85A 4KQ3H 1U93B 3MX0A 3NGBC 2AJYH 1OT1A 5JA8B 1GZPA 4LSDA 1U0QA 1QKZL 4J8RB 5KJRL 5DD3H 4Z7OF 3RVXD 3PGFL 4NM8L 3O6LH 3AFLA 3QBTB 4ZUSB 2NY7L 3MRRB 4U3XA 1ZHBB 2DQGL 3ECBA 4LMQE 3WDHA 4OV6F 4P4KC 1QBBA 3VFTB 2V2TB 1QHPA 4X7CC 1G6RA 2BRQA 4KK5D 5DT1L 3C09C 3EFFA 3O2WH 4LOUD 2XZAH 5J13B 4ZS7H 1RK0B 2X4RA 4F7MB 1LO4L 5HI3C 5D2NA 5CJ8A 4L4TB 3BZ4B 3V7MA 3O41A 4RFNC 4KQ3L 4LSRH 3P9MA 3EUUA 2AJYL 4G6JH 4OUUA 2IALA 5K9JH 1VERA 3PJSB 1HHIA 1S3KH 5TDNA 4MYWB 1VFBA 3AGVA 3MBED 2OQJB 1VACB 3O6LL 1CFQA 1AXTH 4C56E 4LVOB 4PBWD 1JE6A 1CICC 3GRWA 4ZD3H 2DJ4A 4XPTL 1A6ZA 1BD2D 1HHGA 4OLXL 3QWRD 3O2WL 3ZT5A 2XZAL 4ZS7L 4KROC 3PDOB 5IB4B 3MGAA 2DM2A 1KEGL 1BD2A 3FQNB 1FN4B 5LXGL 1VB9A 1SBSL 1AR1C 1ZLVK 1UACH 3QWRA 4NPYB 4G6JL 4E41E 1FG2A 5K9JL 5A2FA 1RZKC 1S3KL 4I18B 1MFDH 1AO7E 4GAFB 4ZO8A 2Z8VC 5L8LB 4PREA 3CAFA 4DEPC 1AXTL 2KDGA 1KF9B 1A14H 2BZDA 1P4IH 4UAOC 5E8OA 3T3ME 8FABB 2XTJD 4TULH 1Y6NR 1YDPB 2LE9A 1QR1A 1MAKA 1IL1B 3GBNH 1HIMH 3K2UH 2FO4A 3I50H 1FV1A 4E5XA 1GOGA 4PPTA 4PGBA 2Z91B 5JW5B 1UACL 3VU2A 3CDYA 5EU4A 1A7PH 3QZWA 3VJ6A 1MFDL 4PJ5D 1MIMH 3EOAA 1WCBA 1I7RA 2W60A 2R0ZH 1PX4A 2OP4L 1TQCC 1A14L 3BN3B 4J2XA 4KHTH 1VCAA 1P4IL 4PJ5A 4TULL 4XP9L 1KSRA 5IMOA 1CGYA 2X6MA 2OXHA 4N8VB 2QEJA 3K2UL 1HIML 3NGBB 3I50L 4EN3B 3QJFB 4QRTB 1T1ZB 2CUIA 3DI3B 5DS8A 1I3RB 3MACH 3GB7A 3P9WB 1K4DB 4HGWB 3EYQC 4PV9B 1A7PL 3ZT6A 4LFHG 25C8L 1S8DB 1QQDA 2WWMD 3O3AA 1QBMH 4HKBB 1MIML 2DL9A 4OKVB 3KLHD 1K4CB 2R0ZL 1UZ8A 5E8NA 2PYED 2AJVH 2CDFB 3C09B 3CIQA 4KHTL 3GMOA 2OLDA 4TSAH 1PEWA 5JDSB 2PYEA 2ZZUT 4RFNB 2Y1VA 3KAAA 1G7PB 3V0AC 3W81A 2X4NA 3T77A 4FQLH 4HAGA 2DYPB 4KPHH 5IB3A 1YN7A 2VWEC 3MACL 2D0FA 4PJIF 4FG6D 4TOYH 2A6KA 1T5XB 4OJFL 1I8IB 4UNVA 5HGDB 4C56A 3VCLB 2FZ3A 2QSQA 4J3XA 1CICB 1PZ5A 2FHFA 2XWJB 1B88A 2HVJA 4EQ3A 3NZ8A 1XAUA 2CRZA 5D1ZC 3QDAA 3TT1H 1FLRH 1FAKT 2AJVL 1MHHB 4PRDA 4KROB 1PKOA 1GZQA 4KZEH 1FJ1B 4M1CD 4TSAL 4ODSH 3ZKSD 4LGRB 1J12A 1N5AB 2P24A 1BJ1H 3HS0B 4KRPC 4PGDA 4OCRH 4JAMB 4LLAA 5E4IA 2F8OA 1I7TB 4WHTB 5D72H 5EFIB 4KPHL 2QR0A 2YSSB 3QCVL 4JRYB 4LCWE 2BVTA 1G7HB 2EKJA 2X4OB 4TOYL 3PQYD 1JGEB 2EC8A 4NN6B 1WEJH 4LSSH 4LKCA 3G5VA 4N0CD 3RWJB 6CGTA 5D96C 1WITA 3RZWA 2BOBA 1KUMA 4YHNA 5B4MC 3PQYA 3KLDA 5JHDE 4JFHE 1BWWA 1CL7I 3TT1L 5DFWH 4ODXB 1HH6A 3QXAB 4ODSL 5B38A 4LPYA 2PKDA 1K8IB 4OCRL 4PJ7F 3DX6A 5D72L 5DFTA 3QIWD 2ATPB 1NFDB 2MKLC 3EYUH 6FABH 1LP9E 4GKSA 1UCBH 4R4BB 1WEJL 4LSSL 1TQCB 5IB1B 1CLOH 2VLKE 3QIWA 2UZIH 4UIMB 1OAZL 2ZCHH 3ULVE 1JGVH 3HZYA 5F7WC 1V8HA 1WJ3A 4R2GD 3RWHA 4L8SA 4I2XA 3QRFM 2RFXB 1HE7A 2SEBB 1J0HA 1BZQK 4WHYG 1S7RB 3H9HA 1X7QB 1TLKA 4M48H 4P5MA 1N59B 6FABL 4RIRA 1UCBL 1TQBC 1FCGA 4L3CA 1QSEE 2NLJA 4HX1B 3UO1H 4DKEH 5IVZA 2UZIL 2EYRA 5TGBA 2ZCHL 4CU7A 1JGVL 3RVTC 1H15A 2VH5L 4FA8A 3B4NA 5F8QC 3HI6H 3V5DA 4GW1B 3U0TB 2VLJB 1TZHA 1WBZA 2CH8A 4A6YH 4NN7B 3WO4C 1ND0A 3WJLA 3C2AH 3BI9X 3GKZA 1CIDA 1HKLH 3L3GA 1DLHB 4X7FC 5FGBC 2WK2A 4M48L 4XVUD 3BX7C 3N85H 4YHOH 3WN5C 3DSFH 4D3CH 3LEXB 1QSFB 2FX8H 1MHEA 3D39E 5C1MB 4CU8A 1NEZB 3UO1L 4DKEL 2FCBA 2GJJA 4X6DE 5I1DB 3G6AB 3QUYD 2ADIB 2WLYA 1AI1H 2VJXA 4JM2B 1P4LA 3HI6L 5F7UA 3QUYA 4U1HB 4B5EA 3TBTB 1ZGLM 5EOTB 4PP2B 3P0YH 3SDYH 4P2OC 4M6NL 1HKLL 2E8YA 1K6QL 3ILQC 5JHDD 1CT8B 4YHOL 5JLZB 1Y18A 1I1AB 5C07E 4D3CL 4HKXA 2NY1D 5FF6A 2DIBA 2FX8L 4UB0L 1A4JA 4NZDA 5LAXB 5JHDA 1T6WA 3LKPB 3X13A 4LLDB 2H2PC 3FN0L 1RVFH 4G80B 3SE4C 2NX5B 1FAIL 3DVNA 2BVOB 2IAND 3UP1A 2GT9A 3O6MH 4X5XB 2X40A 3DRQB 1B0GA 2MWCA 3ZHLA 4KK6C 2BMKA 4NQEE 3VXUE 3H0TA 4BQ6A 5A40E 4LRNH 3QEHB 2VLKD 2XWBA 4LEOB 3P0YL 3SDYL 1TVBB 4HXBH 5L0QB 3HMWH 2IANA 2ICWJ 2IQAB 3IFOB 4PGEB 3V5KB 2YD1A 2A9ML 3C9NB 3VRIB 4S1DD 1S7SA 2BY1A 2VLKA 3FCTA 2JF1A 1BAFH 3ARDC 5K93A 4LU5L 2C4XA 3BT2H 2RB8A 1A7NH 3OKEB 3FTGB 1R3HB 1INQA 2EC9U 2IFFH 3G5XA 4PG2C 1U92B 1RVFL 2D4FA 4X7DC 3IGAB 3IETA 5DHXB 2FX7H 5EZLA 3F8UB 3O6ML 4ETQA 4N8PA 5DWUH 4PJDB 5I75C 4LRNL 4G8FA 1K3IA 4HXBL 4LLWB 3HMWL 3V5HA 4KKBC 4M1DH 1GOFA 1UWEH 5IG7A 1WT5C 1UH3A 1A9EA 1BAFL 3LKNB 2KZ1B 2OTPA 4UOW0 3BT2L 5I8KL 1JMXA 3CC5A 1A7NL 4P2QE 3VFWB 5E99H 4AM0B 1U8MA 4GUPA 4K3GA 2IFFL 4G7YH 4NZRH 5EBWB 4OZGB 5AWNH 2ITDB 5F1NA 1E4XH 2DBLH 4Y5VB 3H6JA 4FZ8H 3C5ZD 2FX7L 5D4QA 4PJ8C 1RK1A 2V5YA 3D39D 2EDTA 5DWUL 3RDTC 3WN5B 5C8JB 4WUUE 3ULSA 4I3RH 3C5ZA 3DO3A 2NY2D 3MCKA 1QLEH 2Q8BH 2V2WA 4S2SA 3D39A 2P8LB 4M1DL 4NQVA 4I5BA 3PP3K 1UWEL 1JNHB 1V3JA 5EU5B 2BVQB 1HCVA 4L8DA 3QUZC 5E99L 3BZEA 5J1AA 2QQNH 3GM0A 1LGVA 4G7YL 1XGQB 3W0WE 3D2UD 1R3JB 1P53A 5AWNL 1E4XL 2DBLL 1I9IH 1T22B 2A6IB 5CGYD 3NN8B 1AD0A 4GRMA 3WNPA 2UUDH 5TDPB 4I3RL 5BRZB 5C07A 3IDJA 2NY4B 5GS2H 1QLEL 3MUGB 3AMLA 2X4UA 1YEJL 1UCTA 3QUMB 2P43B 2EECA 5J6GA 3QJHA 1M71B 1DDHA 3EAKA 4WFGE 2QQNL 1HDMB 3FO2A 1UVQA 3CSGA 2G2RB 5DJDB 4MB5A 1I9IL 4HK3N 3VDAA 1CXHA 4XI5D 3GK8L 5EBGA 2DM3A 1W8NA 4POUB 4XRCA 2EKSB 3KPNA 2AK4B 3V52H 1CGVA 1W0VA 4CMMB 2MSPA 3MRQB 2RJMA 2AEQH 4XHJD 4DN4H 3UROR 5D6CA 3QH3A 5B3JF 5JNYA 3SJVE 1FYTE 2H3NA 3ZKND 4NC1C 4IDJH 1TXKA 4PR5A 4BSVB 3KXFD 2XPGA 4XZUB 1LEKA 1EGJH 3SDAB 4GXUM 4KI5C 3NH7H 4GS7C 2WMPA 5I75B 4WW2A 5T1LD 5C0AD 4JQVA 3IAQA 1I1YA 3GMQA 4DKDC 3V52L 4P2QD 4ZODA 5T1LA 1H5BC 3TBWA 5CJOH 3Q6FA 4AENA 4G8GD 4KJWD 5J12C 4KDVA 1NUDA 4P2QA 1BIIA 4JB9L 3KPQA 3MODH 1A1OA 4R97C 1FZJB 4RCAA 4G8GA 2UWEE 3PWPB 1U8PB 3MOBH 2E3VA 4IDJL 4JFZH 3PXHA 5F89A 3SDCD 3RUGB 1EGJL 2ADJA 2IH1A 5GS2D 2VQ1B 3KYOA 2NY5H 4PYHA 3RDTB 3R8QA 3FN3A 4WJ5A 3QDGE 1IAIH 4HMDA 4WUUA 3SDCA 3EJZC 2R0WH 3LIZH 4M1GH 5DI8B 4OBSA 2UZYB 2NY6C 2LTQC 3RP1A 3SDXE 3ARYA 5HYSB 1ZHNA 1T0MA 3DARA 3BEWA 5HYQA 3SY0A 3QUZB 3S4SB 2O5YH 3MODL 2CUMA 5I76B 4JVWA 1KIUA 1UJTA 3CFDB 4EXPX 5E94A 2MHAA 3V4UH 3MOBL 4NN5C 2R1WA 1KLUA 1P7KB 2LVCA 4JFZL 2QADD 5D9SA 1YEHH 5IGXH 3VD9A 2LFGA 5TE6H 4MJ6B 3UC0L 2NY5L 3MFGB 4JQIH 2B4CH 1KIPA 3IU4H 3LN4A 3DXAE 3HE7D 2ADGB 1N0LA 4RMUA 1IAIL 43C9B 4LLYB 4ZG1A 2R0WL 3LIZL 5IK3B 4MAYC 4M1GL 4NWTH 1R3KB 2XN9B 2C7UA 1N3NA 4QHMB 2DQIH 3X3GH 1J05A 1GAFL 2D9QB 2W0FA 1TPXC 5GGRB 4LPVA 1EGJA 1CFTB 4JY6B 1EUUA 1YC8A 5I66A 4Y16D 5KN5B 3QPQC 1F2XK 4L29B 1LEIB 4X0KB 5IGXL 1YEHL 3QNXB 2BNQD 5HYJD 1B3JA 2B4CL 4Y16A 3MRDA 3UTPD 3IU4L 5CD3B 5I1LB 4ZAKA 1UQSB 3NFNA 3K8MA 1KJMB 2BNQA 1FQ9C 5JOFA 3S37X 4MXWL 3K1DA 5DUBB 5AG8A 4O51B 5B3NA 5HYJA 3GMLB 4CRPA 4NWTL 1X4YA 2R1YB 4HHAB 1FYTA 5D7JB 3X3GL 5IV2A 2F54D 4LPCA 1A3QA 3PGCA 1RSFA 4Q9QH 1IKNC 2ZG3A 5DYOA 4GS7B 3S35L 2F54A 2XV6B 3ARPA 3QRGH 1V5JA 5KS9E 4KAQL 1XF4B 4LIQH 2DIJA 2E9IA 4OD3L 4UBDC 4NKIH 2ZWLT 3MRKB 3SKMA 4F15C 2FGZA 1EO8L 1FZMA 1YYLH 4OCNC 3OZ9H 3QEQE 2NPLX 5FEBA 3VD5A 5J12B 2AQ1A 3HN3A 1CN4A 3OKLA 4E42B 3IJSA 2Q3AA 3FQWA 5D7IE 3BUYB 4JGJA 3PHSA 4R97B 4OI9A 3RWFA 3TZVC 3GEWB 3MZGB 2UWEA 2X4PB 4PUBH 2UZXB 1H3GA 1AXSA 3IYLW 5DD0H 4Q9QL 4HFWB 3UYRH 5DSCB 1KG0A 5BO1H 3QRGL 1J9CT 1HH9B 4YDJA 3BPCB 1ZLWK 3QDGA 3QQ9C 4IMKA 4K23H 2VKWA 4MWFA 3MV9B 5DGQA 4TSBH 4ONOA 2NY6B 3G9AB 1I3UA 4K71C 4RZCA 1YYLL 2Q20A 5CSZA 3OZ9L 3SDXA 4MQXD 1W0YT 4LAJH 1YZZA 3E6HB 2ICWI 3RNKB 1FFNA 2WBJA 3OXSA 2QQQA 4M8QB 3DIFB 3N1QC 1QRNE 4PUBL 3D3VD 5DD0L 5C0DA 2P1YA 1EJOH 3UYRL 2OTWB 1DSFL 3G5ZB 3O4LB 1H3UA 5BO1L 3DXAA 3BHBB 4OGZA 5GGSY 4K23L 4XGZA 2XZQL 3V0VA 4MAYB 4TSBL 4XCCH 2IBZX 2MCPH 1CFBA 4MQ7B 2H8PA 1EZVX 2AP2A 2IFGA 1J0JA 1HI6A 1T2XA 3QO0B 3VXTB 3U7WH 4OAWA 5H2BA 1RJYA 5ITFA 4I77H 2YRZA 4PJFB 2JJTA 2QHLA 4G42A 2AXJA 4PJDF 5DUPL 1MI5E 1J0YA 1ES0A 1EJOL 2R0KH 4OFYD 3WFHB 3UPRA 2R69H 3L3DB 4ELMB 2R2EB 2NXZC 4J1UB 2VR9A 3WJJC 1ULVA 2ZUSA 1PBYA 3VXSD 4XCCL 2MCPL 3TN0B 2GTWA 5J1SC 3G9VA 1T0NB 1HSAB 5ETUB 3AREC 3STZB 3EHBC 5FDWA 1CQYA 4PJIA 3U7WL 3TBYB 3VXSA 1ZMYA 2AXFB 4Z5RB 1M05A 5TF1H 7CGTA 5CJXA 2J8UE 3PL6C 4M4RA 5FA4A 3QHZH 2JJUA 4KMQA 3QXUA 2R0KL 3MRNB 3QEQD 1A6TA 2YMXH 4KK8C 2BOCB 1IJ9A 4F15B 3FB8A 4HH9A 1IAOB 2D0GA 4NO3B 4U6HA 1DQDH 5J11B 1UZ6E 3QEQA 4Y0GA 1J7VR 1IGIH 5FO7B 4YXHL 4OZFG 1G7JB 2AI0L 4PJXB 5D7IA 1TNMA 1DUYB 2X9YA 3QHTC 4XPGH 3TZVB 3WNLA 4YAQA 1ZA3A 4LLVA 4Y19B 1NC4B 2ARJA 3T4AB 3RNQB 5TF1L 4U1GC 3ZE0E 4OF6A 3T4YB 2D4DA 2I26N 5JMRA 1D5BB 1R24B 4NO0B 4BFIA 3BISA 5KOVC 1R5WA 1LE5B 4ODUB 2ZOKA 5MENB 4HWNA 1MCIA 3WE6B 1KB5L 4EUPG 5C2UB 1P1ZB 4Y4KB 5D1XB 3WL9B 1NQBA 1DQDL 3ZTJG 1WZ1H 4NOFA 1W0WB 1IGIL 3OR7B 5IOPA 3L9RB 4N0UE 4XPGL 2A74B 3ZL4H 1QLFA 3RGVA 5EDXA 1MCDA 4MXQD 1F90H 1IEBA 3WV0A 3IDYC 1KLGB 3RWGA 2A6DB 5EBMB 2RHEA 3VFVA 1IQDA 4L4TE 1CCZA 3EGSB 2R39A 4XMPL 5EORL 1Z5LA 3EO1A 3H9SD 4IOIB 4F7CB 5DD5H 5C0JB 2AJZA 4EDXB 3HB3C 4HIXH 4Z76A 3SKNA 3SBWC 1IBGH 3H9SA 4F7EA 3SN6N 1G7MB 1R5IB 4PRBA 3ZL4L 3T65A 3BJ91 3MLTA 5FHAH 3WLBA 5DQ9A 1F90L 5D2LE 1KB5A 5BJTB 3VH8G 4P2RE 4X8JB 2EYSA 1U8LB 2PXYC 4BH8A 4OGXH 4BSJA 2H6PB 4P0DA 4P5TC 3F62A 3NFPA 1OAUH 3T8XB 3MGOB 4PRPD 3MRJB 1V3LA 1RZ8B 3MV7D 3AREB 5JOPD 4D8PB 5DD5L 1MCJA 1HZHH 2H26B 3W2DH 4P5KA 1KENL 4HH8A 4NQCE 4PRPA 1U3HC 4I0KA 2GJ6E 4APQC 2PW2A 3MV7A 4HIXL 4Q6IC 1F3JA 1IBGL 5GQBA 3RUGF 2Y25A 4FFVD 1YY8B 4OI7A 1DBKH 1BP3B 5GGVY 1CG9A 1CE6B 5K9QG 1YJDH 4HUWB 3W39B 2ED9A 4DCQB 1VPOH 4P23D 4OGXL 2AJUH 4I48B 4EEEA 4QNPF 2FGWH 4HWBH 2ZSVA 4YGVB 3DROB 1OAUL 2H9GA 1H3TA 4P23A 2P8PA 1VENA 1HZHL 3HCVA 4MLSA 3W2DL 1NAKL 5EOCH 4KDWA 3HUJE 4RRPG 4KJPC 5KBNC 4U1GB 4HV8A 1OP5K 3QQNA 2OSLB 1DBKL 3IJYA 4EI6B 1C12A 3D0VB 4U6XB 3V79C 1U93A 1VPOL 2W92A 4J3OC 3T2NH 2AJUL 1AC0A 2P5EB 4J8RA 1N6QH 1UEMA 2OZ4H 4D0CB 4XPFL 3C60D 4V2BA 4ZUSA 3MRRA 1F4XL 4WEBH 1I9RH 2FECL 3I6KB 3VFTA 3OL2A 4YNYA 4F37F 2VSDA 4GOSA 4L4TD 5C08B 1RK0A 4LVHC 1ZWIB 3M17B 4F7MA 5DJYA 4EDWH 4H8WH 4L4TA 3GBMH 1A9BB 4QRRB 3SGJA 4UQ2B 4GQ9H 3QIBB 5E4EC 4ZOBA 3T2NL 3PJSA 4JO1L 2EDNA 1T04B 4F37K 4U3HA 4NHCH 2OQJA 2OZ4L 1VACA 3FFCE 2Y72A 1JNLH 4PS4H 4NSKA 1WFOA 4LRIA 4HXAH 5BS0E 4KI5F 1I9RL 4X9BA 3O11B 4NRYA 4F7PB 2QJDA 5IR1A 2JLLA 4P49A 5D2LA 5J6HB 3BDYH 4XBEH 2PXYB 3PDOA 3MRCA 5IB4A 2RIKA 2AK1L 4XNYH 4EDWL 5FO9B 4R96B 4H8WL 4NP4H 3BPLC 1FN4A 3FQNA 3GBML 4DZ8B 4GQ9L 3BP5B 2UVFA 3LEVL 1IMHC 4JJHA 1KIRB 5T1MB 5DMKB 2BSTB 1ACYH 1OVZA 1VADB 4NHCL 5B39G 1OCWH 1QFWI 4GAJH 1B2WL 2VL4A 4Q6IB 2YPLE 1JNLL 4G6AD 4PS4L 1SY6A 3VGBA 1OAYH 4HXAL 4N1HB 8FABA 4F3FA 3UJJH 1NBYB 1YDPA 2BCKB 2FEEL 1IL1A 3AU1B 3RA7H 4C4KO 3ARTA 4XNYL 2J8HA 4KZDH 4NP4L 4JO2H 2Z91A 2BNRB 5JW5A 2YRLA 2OZ4A 1EK3A 1HYRC 2JIXB 3FO1B 5D1QB 2RAMA 5HSFA 1JGDB 1ACYL 1NFDE 3LQAH 1S5IH 4HQQH 4IHOA 2ATKB 1OCWL 1TTUA 4GAJL 3Q6GH 3CX5J 4WRLA 1OAYL 1XR8A 3CXHK 3UJJL 2W9DH 5SX4H 1H9VA 1RJZB 4N8VA 5HVGB 1CGWA 4XAKD 2EDXA 4XTRD 3CMOL 3MV8D 3QJFA 4EN3A 5FGRA 2ZUQC 2NXYC 4ZUTA 2FH6A 4QRTA 1I85A 1T1ZA 2WP3O 1I3RA 4JO2L 4NKMB 1K4DA 3FONB 4HGWA 1RJCA 4KJQC 4P4KD 4PV9A 4LLQB 1X5JA 4Z7QE 2Z93B 4QGYA 1EHXA 1S8DA 4KKCC 4U1MB 3LQAL 1S5IL 4HQQL 3SGDI 2G5BA 4HKBA 3Q6GL 4FS0A 1K4CA 1T4KB 2CDFA 3G5YB 3RKDD 3LV3B 2CQVA 3CPLA 2HP4A 2VDQH 1R3IL 2W9DL 4ELMF 2DYPD 5D6DA 5JDSA 4MQSB 1LWRA 5LBSL 3HR6A 4WTZA 1G7PA 5E4EB 4K07A 43CAB 2EIEA 2DYPA 5DFVC 5IEKB 1CICD 4W6XB 4YXLH 2WQRA 2PTVA 4TUOB 3BO8B 12E8H 1TVDA 5L8KB 2VC2L 2YWZA 3H2WA 1T5XA 4X9IA 1I8IA 5HGDA 3VCLA 1CICA 1MFEH 4KROD 1QSFE 2XWJA 1N64L 2XA3A 4WI9A 4S1RH 3WHXB 4U1KB 5C0BB 1MFNA 1SJXA 4WU5B 1MHHA 2VDQL 1FJ1A 1T66D 3MLSH 1N5AA 4JRYD 3HS0A 3OPZH 5KW9H 1QLRB 2I25N 4ONHB 4WDIB 3RHWF 4JAMA 1DVFC 4WHTA 1I7TA 5EFIA 2V5MA 4KY1L 4YXLL 2YSSA 2VAJA 4ZPVA 1JK8A 4PJXF 1HWGB 5IT2H 1G7HA 1EEZB 3IDIA 4UIKH 5SWSB 5IHZB 2H32B 1JGEA 3LH2H 4W4NA 4L1HA 3RWJA 1CFNB 1J18A 4R90H 1LNUB 1MFEL 3LEYH 4PRIE 3DV4B 4IRZH 4S1RL 3RHWK 5K59E 1JYNA 1CD8A 1NBQA 2XRAH 4RGMC 1IE5A 4ODXA 1PJ9A 1CBVH 3LAFA 1MRDH 1II4E 2CR6A 2NX5E 3MLSL 3OPZL 1K8IA 2A6JB 3L7EB 5BZDB 3RWEB 3L3KB 4BFBD 4DGIL 3D18B 2O93L 3C8DA 2CLZB 2GK0B 2JB5L 4JFPB 1NFDA 4U6YB 5GRJH 3S3PA 2VLMD 5IT2L 4JHWH 4UIKL 4R4BA 4YHLL 4PFEA 3VDCA 4DK6A 4R90L 5IB1A 5H94B 2GW5A 1WAAF 4UIMA 2OR9H 4IRZL 3UYOD 1TZGL 4MJ5B 3RIAF 2XRAL 3EYQD 5IFJB 1CGUA 1CBVL 3V2AR 3RY4A 5GZOD 3M07A 5FUCE 2SEBA 2GYSA 5F7LB 5E5MB 3TJEH 1S7RA 4MDJB 1X7QA 2DQFB 4JCMA 4P3WA 4HS3B 3BDXA 4R4NC 2P48B 4O58H 3VXRE 4NRZB 1MAJA 2ICES 1N59A 5GRJL 3NCJL 1T2QH 2F53E 4GXUN 4ZDHB 3REVA 3E8UL 3IKKA 5IB2B 4HX1A 2VZTA 2OR9L 4PJAB 2VLJD 5C6TH 1OSZB 2VDML 4HUUB 4XNZC 4CGTA 4GBXB 1L9NA 5HD8D 5MP6H 2FATL 4LDEB 5FGCB 2OMBA 2V5SA 4GW1A 3M45A 3MROB 3U0TA 2VLJA 4OZGE 1KBGH 4OFIA 3TJEL 5IMLB 4PV8B 1BVKB 3Q48A 1DLHA 1X5FA 3KS0H 1BX2A 1HCFX 4O58L 1OTSC 4DGVH 4X7TB 1F11B 5JW4M 3VD7A 3B8SA 3LEXA 1IGMH 1QSFA 1OD9A 4Y1AB 4WGWB 1NEZA 2GSGB 3IRPX 4G3YH 5I1DA 3G6AA 5C6TL 1BWMA 2XKNB 1S7TB 2NY3C 2ADIA 3QNZB 1J1XH 5MP6L 2HWZH 4JM2A 1JYVA 4X83A 1F00I 1GGCL 1DVFB 3I3BA 4QHNB 1VDGA 5LKNA 3ZDXF 4U1HA 1I1AD 3TBTA 5EOTA 4PP2A 4PBXA 1CT8A 2HJLB 4DGVL 1JTPA 1FZKA 1I1AA 2J12B 1KJVB 3MO1B 1OPGL 4K9EC 1B9ZA 4Y4HC 5LAXA 2J6EH 5T5NF 2NX5D 5DZOA 1ZANH 1RZIB 3OB0K 4LLDA 4TQEL 5IFAL 4G9FE 4G80A 3T04D 2NX5A 1O5DT 5MHSD 1J1XL 2BVOA 5HHOB 4X5XA 3DRQA 2DOCA 2ORBH 4OZHB 4P57B 1WSST 3QEHA 4R0LB 4LEOA 1DCLA 1SHMA 4FFWD 3QXVA 2AK4E 2IQAA 3ETBF 3IFOA 4PGEA 3V5KA 3C9NA 3VRIA 3BGFB 3U4AA 2J6EL 1FYHB 3OKEA 3FTGA 1R3HA 3E1F1 5L88L 3DX7A 5JZ7D 1JNNL 3CLFH 1DQQB 5JDJA 4RSVA 1U92A 4KRMB 2VISB 1BJ1J 1WZMA 3QSKB 2V9RA 1FSKB 2EXYC 3ARQA 5SX5K 5LQBL 2IMNA 2HT4C 4PJDA 3W82A 4MA1C 4XC3H 4U05A 4LLWA 2F53A 2HVKA 4RA3A 3CZJA 2JJSC 3RVTD 3VWKB 2Z9TA 2PO6C 1EX0A 4ODTH 2EXWC 1UM4L 4H88H 4XNZB 1IGFH 1LMKA 3EYFA 4X5LA 4YIQB 3VFWA 4AM0A 4XBGB 3QUML 3OXRB 2KQNA 3T0WA 4DJMA 4JFFB 1QP1A 5EBWA 4OZGA 4YZFF 2ITDA 4Y5VA 3HZVB 2CLVB 5DVNA 5E8EB 4L3EB 5FGBA 3G6JF 3GMMB 4DOHE 4NFCA 3GGWB 5GGSB 3WN5A 5C8JA 1BFSA 4XC3L 3HZKB 4X6BA 2QSTA 5FYJE 2J6EA 1F4AA 2P8LA 1A0QH 1AGDB 1JNHA 5EU5A 2BVQA 1T20B 4H88L 3U9PH 4F7TB 1V7NH 1B0RB 3QG6B 1R3JA 1VHPA 5D70H 3UCRA 4JJ5B 3CH8A 5BRZD 1T22A 2A6IA 2NY4D 3ARZA 3NN8A 1KJ2H 4Z7VB 3MLXH 1ED3B 3WKMH 2Y5EA 5E9DE 5TDPA 3KYNB 5BRZA 3OGCA 4MJIE 4OKDA 4U7KA 3MJ8B 3MUGA 1CDHA 1A0QL 1OP5H 3JWOH 5SWZE 3QUMA 3V6BR 2FHCA 2X1PA 2Y9RT 1N0XL 4KK6D 1DR9A 1UXWB 1M71A 3U9PL 4UU9B 4W6YB 4XXCA 3UBXB 1HDMA 1Q9LB 3MLZH 1PGRB 3F6IA 2G2RA 2AK4D 2YA0A 4LGSB 1VFAB 4DUWA 1H3PH 1Z0NA 3P4NB 1A3LH 4GKOA 5F7FA 3MLXL 2EKSA 2AK4A 4OD2B 1IVLA 1CYGA 3WKML 4CMMA 5EH1A 1AC6A 2H45A 5FYJL 2DKMA 3H3BC 2E8ZA 3T2OA 3AB0B 3F65A 3JWOL 4FMKA 1ZA6B 3SDAD 2X9XA 3OAZK 1TDQA 3G08B 4PG2A 5DHVB 3AS1A 2F15A 1MVUB 4IJ3B 3VI4E 4FFZL 2NW3B 4M93B 4XZUA 3SDAA 3MLZL 2GFBB 3ROLB 2D7TL 2JTDA 4MA1B 1PFCA 3MNVB 1H3PL 1UA6H 4LVNC 2WIIB 5A2IH 1A3LL 1TITA 1EMTH 2PO6B 4GW4B 1MUJB 4GKZB 5CGTA 1H3WM 3LN5B 3PWPD 5C0GB 1JGLH 1KTDA 4PJ8D 5TQ0H 5E0QA 4NO2B 2OJZL 1FZJA 4ZXBA 1NMAH 3RDTD 3PWPA 2IAMC 1U8PA 5KSBF 2Q86B 5TQ2H 3RUGA 5FYJD 2VQ1A 3ARVA 3RDTA 3VXME 3OR6B 1UA6L 4NBXB 4Q74A 4EI5C 1D5MB 3QUZD 1EMTL 5FFLA 2P44B 1TENA 3ARBB 2A83B 5LGHH 5HYSA 4N0RA 1KFAL 3QUZA 1JGLL 2V5RA 3S4SA 1EVUA 1G9NH 4AQ1B 1BFTA 5TQ0L 5I76A 2BHUA 3KPSB 1NMAL 3BESR 1P7KA 4U1SB 4LNVA 3OG6B 4MJ6A 1AH1A 3BJLA 5E6YA 2XN9D 2ADGA 2R9HD 43C9A 4LLYA 3HC3H 1S9KC 4MJIA 1KT2B 1FCCA 5DURB 1PLGL 1BZ7B 2NW2B 3D6GA 3DO7B 3QDMD 1U8OB 1UWXK 1R3KA 2XN9A 5AUMA 1SEBB 3LB6D 5LGHL 4QHMA 4TUKL 4PJBE 2X4SB 1G9NL 4HMEA 4Z78A 4C83B 4PJFE 1CFTA 2YD9A 4JY6A 3OAYK 5KN5A 3MJ7B 3FFDA 4L29A 1C5DB 1LEIA 4X0KA 3QNXA 4ZOCA 1EHAA 3P9LB 3QZWG 5CD3A 5B22A 3PHOB 1UQSA 1DQJB 3DVFA 5C0EB 5D7JD 4IIQC 5DA4A 5DUBA 4GRWB 4PJAF 4O51A 4R7DA 3TO4A 3GMLA 1I1FB 5ICZB 3P11H 5ID0B 3Q1SH 4KI5D 4HHAA 5D7JA 1OTUC 3C6LC 5FYJU 4ZO6A 1TTGA 2HFFB 2OXGA 1CDCA 3L3IB 2WBWB 1ZT7B 1XF4A 3JTTA 2GUOA 1KXTB 1S7QB 3SCMC 1XGYL 4YH6A 4M00A 3MRKA 3BYTA 3IF1A 2ZUTA 2BFVL 3MZTA 4ODBD 4OZ4B 1MFAH 1OWWA 4E42A 4BFEA 3BUYA 3Q1SL 4POZD 4Z8FH 1FPTL 4N1CA 3K74B 5DUML 2X4PA 1U58B 5KOMC 1F6LL 2YUZA 3MV9D 5DSCA 3U7YH 2NY6D 5DRNA 3O3UN 1HH9A 3BPCA 4EI5B 5TDOB 1T89A 5KSVB 3EJYC 5C71A 1DN2A 3ULUC 3KDMB 4K7PY 1NAMB 2OM5A 3K3QA 4U1NA 1MFAL 4YBHA 4NQXB 3E6HA 4I9WD 2R0LH 3RNKA 1PX3A 2OMNA 2X9WA 4OGYH 2C3WA 4XPBH 4Z8FL 3MRBB 4M8QA 1XIWB 4M8VA 4R4FH 1T7YA 4KVNH 4S10A 3DIFA 3O4LD 4K94C 1MWAB 4OZHF 1T7ZA 3LS5H 4MAYD 4DKAA 5I17B 5M7QA 3BMVA 1VA9A 2JJWA 2AQ2A 3G5ZA 4PJCE 3TA3C 5C6WH 3BHBA 4KKLD 3K8KA 5KVDL 2XOTA 1BLNB 2LABA 2VXVH 4MAYA 4AL8H 5INCB 4MQ7A 2VOTA 3S8WA 3PIQB 2R56L 3QO0A 3VXTA 4PJHE 3I6LE 1JHLH 2R0LL 1QBAA 2DKSA 4XPBL 4PJFA 4R4FL 4MQTB 4KVNL 1AGFB 2X70B 3MUY1 5B38G 3KYAA 3RZCB 1JRHH 3WFHA 2CDGB 5LJYH 1T5WB 3LS5L 4I0CC 2XA8H 2KKQA 3L3DA 2COQA 2R2EA 4YHKH 3TN0D 4KKAC 4J1UA 4Z0BH 1BBDH 4XNQB 5IVXB 3BFOA 4IIQB 3TH4T 1AKJB 4AL8L 3CK0H 3TN0A 5L8JB 1T0NA 1HSAA 5ETUA 1CD0A 1P2CB 1DBBH 3STZA 3P0VH 3LS4H 2X05A 1CTNA 3EYOB 4M62H 3TBYA 5FO8B 1OL0A 4IMLB 4GAGH 2AXFA 3B9KC 3PE9A 5F6HJ 2BK8A 5FYLH 4UBDD 2XNAB 3CXDL 1ZKAA 3H7BA 3CH1B 4UMGA 3MRNA 5J8OA 1V05A 1LDPH 1NCCL 3SCMB 5F21B 1K2DA 3VGDA 4TSCH 2BOCA 4YHKL 1FNHA 1IAOA 4Z0BL 1ORQB 4NO3A 1BBDL 1XF2B 4Q6YA 5F1IB 2P46B 3ZO0A 4G43B 1UEYA 3TZVD 4Y19D 1NC4D 3BW9B 5FO7A 2VDLH 3VG0H 1ZS8A 4D9LH 1DBBL 2VQTA 4JFEE 4BUGA 2P45B 2VYRE 4JFDE 1DUYA 3LS4L 3PWNB 2C26A 1G9MC 5T3XE 4NO0D 4M62L 3MV01 1MCNA 4Y19A 1NC4A 1YMME 1HINH 4GAGL 1Q9WB 3T4AA 5IJKA 1FNSH 1OLLA 3RNQA 5MEND 3GI8H 5ALCH 4KTYA 5FYLL 3T4YA 5C0RH 4PJEE 4JZOB 1D5BA 1R24A 4NO0A 4Z7VF 3QULB 4YHYB 1KIQB 4HUNB 5H35A 4Y4KD 5D1XD 1LE5A 4ODUA 4EIZC 1QPXA 5MENA 3WE6A 3P0GB 3DBXB 3DNKA