4HEPG

Complex of lactococcal phage tp901-1 with a llama vhh (vhh17) binder (nanobody)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
b'VQLVESGGGLVQPGGSLRLSCEASGFSFDDYAIGWFRQAPGKEREGVSYISMSDGRTYVADSVTGRFTISSDNAKNTVYLQMNSLKLEDTAVYYCAAGRFVTFGSAWSFVGGGPYGIDYWGKGTLVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BPP
publication title Viral infection modulation and neutralization by camelid nanobodies
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein
total genus 32
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hepG00
4MNHA 5JUEL 3AC0A 4X6FB 1P2CB 1S7XB 2YD2A 4Y19A 4DZ8A 2QQLH 1YEHH 3B9VA 1E6JH 4P3WA 4FFZL 3FCTB 3F5WA 4WHTB 2NMSA 3FN9A 1UWEL 2RHEA 1AGEB 5F9JA 4ZXBC 4H26B 3C6SB 3U0TB 5I8KH 1SBBA 3IJSA 5D6DA 5JDSB 4MD0A 1KTDA 1V7MH 4RISL 5JPMA 3LY6A 3QIBB 5GISL 4Y5XB 2AXFA 1D5IH 1XF3B 2ICCA 3HN3A 4U31A 3S96A 3HNVL 3F7VB 3QXVA 5IHLB 1H8SA 3B5GA 3CSYB 3BD3A 3G08A 3B9KA 1IC1A 1AIFA 1CQKA 4BZ1H 1NLBH 3RWEB 1VKXA 3QEQA 3I75A 4TUJB 2X4NA 1A3RL 1KPUB 3M45A 5C07B 4PTUB 5D72H 5C0IB 1OGTB 2I9TB 5L2KD 1A21A 1ZXQA 3LHPL 1CI5A 2G75B 4HHAA 3UX9B 2P5EA 3ZDZF 2XA8H 4DK3A 4H0HB 4PUBH 5FIEA 1IFHH 1UJ3B 1HCFX 1QFUL 2VDRL 2YXFA 4EOWL 2FGWH 4QYOB 4NFCA 5LGKA 3HZYA 2G9HB 3L3KA 1FVCA 2YC1A 3HUJB 4YEFA 3V4PL 4ZFZA 3ARSA 3PABB 4HS6B 1PX4A 4KVNH 3L5JA 4WU5B 2AJZB 1KB5L 4DEPC 4TSCL 3ZTJG 2HVJA 1VESA 2BVQB 5DGQA 4PRHE 2EE6A 4OTXL 3C5ZA 3O3BB 1BMGA 3NCYS 1JV5B 1QYGL 3P3YA 4LSPL 4R8WH 1NCAL 3U83A 2DTML 3KPMA 3QT2A 1EVTC 5SV3A 4QLRA 2PXYA 1BQUA 3ZKNC 4QTIH 2X89D 3IB4A 1AO7D 3BT2L 5KVGH 3E6FA 3UTTB 4XZUB 3MBXH 2VDQL 4MZ2A 4R4BA 3TBVB 1CZ8H 5HYQB 4U1SB 4HIJB 2BFVH 1QFWL 2RB8A 3ARPA 3QUYA 1GGIL 4OUUA 4AZ8A 1KLGA 3EFFA 5CJBA 3GMNB 1CFTB 4KC3B 5DK0A 1SM3H 2X4QB 2NX5E 1ZVHA 3HE7D 5EULV 4DAGH 2Y5TB 5D1ZB 2MCPH 5INDA 3PNWA 2ITCA 3RHWF 2FGZA 4K23H 3HPJA 4MCYB 3FQWA 1CFNA 1RZJL 1N2RA 3G6JA 2DN7A 3IFPA 5C0RH 3MJ9A 3L6FA 3VXQB 2EDFA 5FXCH 3GGWB 4EKXA 4KZEH 3IXAB 5T3ZD 3QZWG 2A0LC 2JJVA 5CMAB 5BCAA 2J8UA 2OJEA 3WHXA 4WENB 5GGVH 3REWA 5F96L 1PLGL 1FSKC 4I2XB 3OXRA 5ICXA 5D2NE 2P5ED 3ULSA 2QR0B 4KZDH 4AM0B 4Y4FA 4PLKD 2FDBP 1DBBH 1FBIH 2VQ1A 1LILA 4X5XA 4XX1E 1GOGA 2WSKA 4NBXB 1FRGL 1INDL 2MJWA 2ZOKB 2MKLC 1KN2H 3MJ9L 3MLUH 4KRMB 1A7QL 1OAXL 4U1MB 3VI4F 2AKRB 3GSUB 1C5BH 2Z92A 4UI2A 4CJ0A 4R90H 2VWEC 5GGSA 3MRGA 4OZGE 4PV9B 3U30B 1LK3H 5ERWA 3OJVC 4TOYL 3KHQA 3F7PC 4HWZB 3C5ZD 3NACH 5DJYB 5I2IA 3P4MB 1FORH 3OB8A 4I1NB 3WJJA 5J4MA 4LQ1A 3TVMA 5KN5B 4M43L 1QLRA 5GZOC 5EBLB 1UZ8A 1PAMA 2A1WH 3FB6A 1RZ8B 1KIPB 3A0OA 5FDWB 4E0RA 5J3HC 1KENL 4PJFE 2EIZA 3DVNB 1WAAA 3KXFA 4P9MH 3TBWB 3KJ6H 1F3JA 5ISZD 2XV6B 3PV7A 4HPYH 5HVHB 2ZWLT 3TZVB 4ENEC 4TVPH 3TM6A 4PR5A 1U8QA 1B6DA 2GUOB 3OBAA 1G7PA 4ZUSA 4GAJL 1XIWD 4ELKA 1BFSA 5HYSA 1H8OA 3VFNB 3L5HA 1FC1A 1Q8MA 3WFDH 4HLZG 2FJHB 3H9YA 1NUFA 3T0BA 3O9WB 2XG4A 1XR9B 2UWEE 4WTZA 3TO4A 4PJXB 5TE7H 1MHCB 3QFJA 3FN0L 5CD3A 2APWA 2ARJB 2BSRB 4M61B 2ORBH 2FIRT 3WO4C 1FZMB 2E27L 1MCNA 2BXZA 5GJSH 3BPCB 4UTBH 4ORZC 5TE6L 4P49A 5E94A 1MVUB 5GRXG 4KROB 3V52H 5AZEL 4XNUH 3JTSB 1LO0L 3TYGH 4Y4FD 4F15B 1BLNA 3RUGF 1WBXB 1CL7H 3X3GH 4L4TA 2HKFH 4U1HB 4X6EB 1VGKA 1P7QD 3UTSB 4PJFF 5CHNA 4F8TA 3RU8H 1A9EA 5K9KA 4FMFA 1T7YA 3ESVF 1IL1A 3QG6B 4JFFD 2F8OA 1H5BC 5JXED 1I9IL 2R0WL 5K9QI 3BKYL 1J8HE 1G7MA 3BGFB 1YMMD 3KPQB 1DBAL 4GKZA 1E4KC 1CS6A 4R96A 3TBTA 1X3DA 4EQ3A 3KYOA 2WZPD 1T22B 4DW2H 1DEEB 4M02A 4I0PB 3GRWA 5M94B 1QR4A 1Y6KR 1TZGL 1IEAB 5IT2L 4LBEB 2BNRE 1NCCH 3OMZA 1TZIB 3I6GB 3PXHA 4POZC 1ZEAL 2FD6L 3E3QC 3BWAB 1DN2A 2V7HB 4JVUA 4MX7B 1U8PA 3KXFD 1VFBB 1KBGH 1SJEB 1RUMH 2DRUA 5HGBA 1IGCH 3MRLA 2Q7YA 4X4YB 5E9DE 2HT4D 4GW4B 5ESVB 1P6FA 4NC2B 3JWOL 4V1DA 1NJ9A 3NCJL 5FEBA 3WCYA 2W92A 1JYNA 1I1AD 4C56B 3WKMH 2DWEA 4KPHH 3PWUA 5ADOH 3GRWL 1BHGA 3W9EB 2CJUL 1YN6B 2JJSC 3TO4D 1P9MC 2DBLH 3O6LL 1JGDA 5IJVB 2XZAL 3QFJD 4P0DA 5FUZL 2AK4E 4BSVB 1QPPA 3MFGB 1Y0LB 3TNMA 4EI5D 5D5MF 1ZHNA 2VR9A 1HILB 1UWEH 3DPBA 4DFHA 5DQDL 1LE5A 2XWJB 4YHKL 1K8DB 3EGSB 4QWWC 4RISH 5JOFB 5L2JB 4CNIB 5D7KE 5GISH 3KLSA 1A1NA 2IAMC 3HNVH 3QFDB 3PDDA 1E0OB 2DM3A 3ARBB 5IEHB 2EDBA 1QRNB 3L3GB 4PJGB 3R0NA 5DEGA 2EEBA 3L3OB 1QHOA 5DEFA 5D1QC 1A3RH 2IC2A 5GS2D 1FFQA 5AD0A 2Y25A 2Q7NA 1D5MA 2OP4L 5CEYA 3STBA 1I3VA 1K6QL 2Z8RA 2W0LA 2A77L 1TETH 2VNCA 1Y18B 1CFVL 5GRYA 5JORB 1F8TL 1KTLA 3MNWA 1R3JB 3DNKA 1VPOH 1ETZB 3C6LA 5E99L 4PJ8C 3IRPX 4GH7B 1QFUH 2VDRH 4YLQT 2BY1A 1U8HB 2DYPD 1NBVL 4A2MA 4Q6IC 5TGBA 1XT5A 5FAAA 4D0DB 5HI4D 2PYEE 4DOHE 1XGRA 1VACB 1IGJB 4FQHB 5HHPB 4WEMB 1QNZH 3V4PH 4YHML 5ACZA 2R56L 1AQDB 2BHUA 3QIWA 2J6EA 3GIVA 1KB5H 5KSUB 3QXAB 2XYCA 2VAJA 3QI9D 2Z35B 3C08L 4OTXH 1A7NL 1BP3B 4LSPH 4OZFB 1NCAH 3WEXB 4QRRE 1IGFL 2DTMH 3BUYB 4G9FD 1OL0A 4JPIA 5FYLE 5J06A 4EDXB 3QA3A 1BAFL 3ZT5A 4KJQC 4HUUB 3HC3L 4YAQB 1BIHA 3BT2H 1OAZL 4HXBL 1ED3B 4I18B 5L2KB 1HKLL 3HMXA 5E6IA 2VDQH 1MJ7L 2Q8BL 1BOYA 3DV4A 2J6EL 2BRRL 1QFWH 3FQNB 2YPLE 1GGIH 1S7RA 4D94A 2R1YB 2NY6D 1QRKA 35C8H 4HKJB 4PJIE 3UC0L 4ZTPH 2YXMA 2VZUA 1N5AA 2QADD 1JN6B 2DF3A 4QCIA 3ZO0A 4MJ2A 4Q9CA 4G6KL 1NGXB 4HV8B 4OZHB 3WHE0 1RZJH 1T5WB 3ZE0E 5B8CC 4IDJL 4JN2A 2VLRB 3LN9A 7CGTA 4NIKB 3HMXL 4ZUWA 5F1NB 1I9EA 1JF1A 3E0GA 1QLFB 3CXHJ 1JPSL 5FO8B 1I4FB 2VH5L 4TRPL 2AJUL 4KAQL 3SDDD 3ILQD 4FXKA 5F96H 1PLGH 1OGAB 4J8RA 4Y16C 1HXMA 5F7NC 4M03A 3U1SL 1GIGL 4G8IA 5FM8A 4EJ1C 3CVIL 4CADB 4DGIL 1BIIA 3LKQB 3N1FC 1CLYL 5A1AA 1VADA 2ZJSL 1K85A 4ZUVB 1Q38A 5F3HB 1DP0A 4J4PA 43CAA 5EU7C 3MOQA 4XXDA 3I6LD 1BZQK 1FRGH 1Z3GL 5J6GA 1INDH 2PO6C 1T1WA 1LD9A 4HLJA 4JM2C 4YEEA 5ETUA 2X9YA 2NX5A 3MJ9H 4BFIA 3IJHB 1A7QH 3RX8A 3HE7B 3MTRA 1OAXH 4G6AC 5I16A 3FT4B 4B5EA 4XCFL 4RMVA 2ICEA 5BXFB 4JO1L 3CFBB 3LV3B 4NN5B 2YA0A 4CDGC 5T1LA 1WFNA 4YBLB 1MJ8L 4TOYH 1WCQA 3MV7B 5A2JH 3BO8B 4H88L 4MVBC 1U8KA 1QO3B 2RR3A 5HHXL 1HI6A 5MHSE 1KT2B 5BQ7A 3E2HC 4PJIF 5CKAA 1QR1A 1LK2B 5EC2A 2M8XA 1N8ZA 3VRLF 1EV2E 3QWQB 3MYZA 1BVLA 4M43H 3SGJC 3MNVB 1O5DT 1T5XB 3KVQA 1I1FB 1LHZA 5C0EA 3GBLA 4LCUB 1KENH 3SGEI 1XF5A 3WLBA 5D2NA 1RJZB 4Z7QE 4JFED 1AP2B 5E6ID 4PRBB 2HFFB 4XGZA 1V05A 3CC5B 2BNQD 4LIQE 1NAML 5KS9E 5IB2B 3K4DA 1F6AB 2WBJB 1IQWL 4GAJH 3AY4A 1FAIL 1NFDB 1DLFL 2Z4QA 2CO7B 3RFZC 2ZUVA 3AVEA 4LASL 2IH1A 2R0KL 3BOVA 2CGRL 4OZGA 2O26U 5LBSL 3SOBL 3WFHA 3FN0H 2BSED 3BZFB 4LVHC 4JM2F 4M7LT 3BI9X 2E27H 4WV1B 1F3RB 3RDTB 3ARGC 1Y6NR 5F9WB 3H3BC 4OLEA 3VH8A 5I8EA 1Q1JH 5TE6H 4LAQL 2CDGB 4PY8I 2APXA 4PJFA 4Y2DD 5JR1L 5IBUG 2IALB 3B2UD 4W4OC 5AZEH 1NMAL 2FJGA 1LO0H 2FLBT 4XB8A 1NBZA 2GFBA 5KG9B 4X7DC 3PP4L 4PJEF 4KK9C 2ZOLA 1EA9C 3OKEB 3VJ6A 1XIWB 4L3CA 2PKDA 3TBYB 5D71H 1T2XA 5I30L 4X6DB 5IF0B 2IGFL 2ZNXA 2EYRB 1J0HA 1CD0A 3IDIA 4ALAL 1I9IH 2UWEA 2R0WH 3MRFB 3BKYH 4PRNB 3NZ8A 5I1GL 4P2RE 2QL1A 1NFIA 1DEDA 1SYSB 3PE9A 4S1SL 5C92A 3BIAX 2Q76A 1TQCB 1JUFA 3B6SB 3EKCA 3KDMB 4WFEE 5DJ6A 3AAZA 5C8JA 1TZGH 3E8UL 3D5OF 3JVGC 4R7DA 1U8IB 2EYTA 4GRLA 8CGTA 3Q48A 1S9VA 1DN0A 2CLRA 1ZEAH 4JZOA 1N59A 5K33A 1FJ1A 3RJQB 3GSRB 4MA7L 1WEJL 3KGRA 4J1UA 3KPSE 2XFXA 5HDQL 2EDWA 5CJOL 3LKNB 4YHNA 5GS2H 2IFFL 2B4CL 3JWOH 5I9QB 4H20H 5B39B 5E5MB 5KANG 2H32B 3NCJH 1UKSA 5EDXA 3HRZB 3MCLL 4WFGE 1PD6A 3GRWH 1I1RA 2HMID 4G8FA 4JFFB 2DBJA 2CJUH 4NQDB 4NQCD 3MBED 1H5BA 1J8HA 3HR5A 3O6LH 2XZAH 4X6CB 1YMMB 2PNDA 5HDLA 5FUZH 1JPFA 1F13A 5KSVA 2BVEA 4KTDL 1E4KA 5BV7B 2Y36L 3OKNA 5I71B 5JW4R 1IT9L 1H3VA 1J0IA 1RD6A 2GTZA 2BNRA 1FL6A 1YNTA 4O2FA 4IS6A 4P3DA 5DQDH 5DD6B 1YEKL 4YHKH 1R5VA 3G5YA 2VLJD 4M1CD 5MERB 3KPTA 1F4HA 4RAVB 2BY3A 3IDJB 3SDCA 3KLHD 2FHBA 4X83A 5E9DA 4ISVB 2FO4B 1T6WA 1LE9B 1S9YA 3W82A 3EOBB 3WS6C 4X9FA 1BVKA 4XMKL 5SWQA 4JRXB 5T1KD 3V6OC 1JZ7A 3PWPD 3VE0A 3DIFB 4RNRA 4UNVA 5IVZB 2HLAA 3NFPA 4X5WA 1I1CA 2OP4H 3LPGA 4MQ7B 2AK4A 5I8CA 1K6QH 2A6JB 4TSBL 1WITA 2F54E 2A77H 4OZFG 4TUOA 1MEXL 1CFVH 4MS8D 2FWOB 4ZUTA 3MRPA 1F8TH 1EEZA 2PYFA 4Y5XC 1X6LA 3NA9L 4XP4L 5E99H 4NFDA 4PG9B 5EA0L 1RZIB 4OLVL 5EO0A 1NBVH 3BW9A 1YYML 4N1CA 5FKAB 3D39E 2VZ3A 3D25B 4LKXA 3UTQA 4YHMH 1HYSC 2R56H 4XRCB 2OL3B 3DUSA 3ISWA 5KAQF 4P57A 2JJUA 3PL6D 2HTLD 3QIUD 3MREA 1G7LA 2IAMA 4JKLA 3ZYIA 5AZ2L 5FA4B 4PGCA 4YWGL 3C08H 5JHDE 1A7NH 3TNNA 5FUOL 4XWOD 3O4OB 4KK6C 2DQHL 3FB7B 4G7VL 1IGFH 2DIBA 4C54A 5HVWA 4JKMA 4YDLB 3LSOB 4ZPVB 4R3SB 4HX1A 5E4EC 5DD1L 4Z76A 2EZ0C 1UJ3C 1R5WB 3LQAC 3BEVA 5IM7A 3HC3H 3T1WA 1A7RL 1OAZH 1TVBB 4HXBH 4JVWA 4RGMB 2VLKD 5DJAB 1E27A 3LKOB 3MRDB 3V6BR 2Q8BH 1MLCA 4LP4A 2J6EH 2BRRH 4TN9A 2HG5A 3MRHB 1I9JL 1UM6L 4K3JL 3SDCD 2HAZA 3UC0H 4Q6IA 1N3NB 1QBLL 2AVGA 4KKLD 5ANMB 1L7TH 3CFEA 3HAEA 1FGNL 1NQBA 4G6KH 5C0CD 3O4LE 3EBAA 5DURD 1IQDA 3L3JA 3VWKB 3N1MC 3QI9B 1YEFL 4IDJH 4HWEH 4KUCD 4BZ2H 3O8XB 4GRWE 3HMXH 5TPWL 3ZLQC 1TFHA 2PW2A 1NDGA 3P9LB 2VABA 4UQ3A 1MUJA 4G9FB 3PG2A 1JPSH 4JAMA 2VH5H 1E28B 4TRPH 2AJUH 5C9JB 4KAQH 3LKRA 4LFHG 2CQVA 4OD1L 3Q6FB 4R7NA 3U1SH 1GIGH 1MFAL 1ROWA 3F7YA 3CVIH 4DGIH 1CICC 1CLYH 3FO1A 4G42B 5DK2A 4AYFA 3K1DA 3BUTA 3LMJL 5F7UA 3TT3H 3MRQA 5EZLA 4XPBH 4RWHA 2YPLA 4MJ5B 1Z3GH 3I9GL 1SEBA 1WVZA 2NY6B 4PJIA 1H3UA 1HN1A 2VZVA 1RAMA 1HCVA 3LKPA 2P5WE 4XCFH 5IMKB 2VRAA 2ZCHL 4JO1H 3LQZA 3RGVD 1T7ZA 2VAAA 1MJ8H 3V8CA 3NPSC 1PZ5B 5E8OA 4H88H 5HHXH 3VFSB 3VW3L 5K9OB 3H42L 4KDWA 2IPKB 4KTEL 4B7IA 3BP6B 3K74B 4X8JA 2IG2L 1OB1A 5JNYA 1W8NA 4PS4L 1SMOA 4JLRA 4KK5C 3WUWA 2J4WL 2KL6A 4FOMA 1L9NA 3DSFL 2C26A 3MRCB 3QWOB 4GRWF 4UT9L 4U1IA 3K46A 3VGDA 4U1JB 3RZCA 4NQSA 1YY9D 1NAMH 4PJHE 4NCC1 3HS0A 1X5JA 1IQWH 3D18A 1FAIH 1DLFH 4OKVA 5HHOD 4D0BB 2VLME 2R0KH 3OAUL 5E2VL 3NOIA 1JPTL 3FQXB 5FOBA 1JF6A 2CGRH 1WIUA 5C0BB 2FH8A 3SOBH 5FOJA 5E2WL 4ODXA 1UENA 3CX5J 2XICA 5EOTB 1B0RB 1HZHH 5CFHA 3FO9A 1RIUL 3DTXB 2YKLH 2VO5A 5HVHC 1LO4L 1YJDL 4LNRB 1UKTA 3F58L 3EYOB 1HEZA 4LAQH 3MRBA 2VZSA 5JR1H 1S7UA 5E2TL 4F7EB 4JFEB 4UT7L 1G7HA 2ATKB 4WUUB 3JTTB 4HAFA 4H1LB 3BESR 4S0TD 2A74B 2GTWB 2BNQB 2D7MA 3CFKA 3MRKA 5KS9A 3WIIL 3WS3B 3T4YB 2WK2A 2ESVD 3B4NA 4XPFL 2BSTA 3SDAA 3BISA 3QQ4B 3RPKA 3ULUC 1T4KB 2HRLA 4QXTB 5I30H 3I6KB 2IGFH 4NKQB 2X1WL 3QNYA 5F7FA 1A6ZA 5JZ7D 3ULUE 4EBQL 5C6TL 4HH9A 4PGZA 4M5ZL 5BOZG 5I1GH 4XP6L 3DX8A 3RWDA 4FQQB 5ITBH 4S1SH 5B38A 1PDKA 4HS3A 3QPQC 5KZCD 2DTSA 5EZIL 5LJYH 4L8DB 3D0LB 4LIQL 3MC0A 3E8UH 4PJ9C 4F15C 4ZO7A 3V0AC 1F45A 2F5AL 2EICA 4UT6L 1T80A 4Y2DB 4PLOB 2AEPL 4MA7H 1WEJH 3UAJD 4JCMA 5FYKD 1ORQA 1WC7A 2W65A 3CVHA 5HDQH 4U1LB 2IFFH 1G9NL 2B4CH 4OGAD 5HDBE 1IAII 4U49A 1GGCL 3BGFC 3S3JA 3OAYK 1DBMH 2FX7L 2EDDA 3MCLH 4OZIE 3IDGB 4PYHA 3RNKA 2GSIB 4I0PC 5JW4N 2GJJA 2HTKC 1YY8A 3LPWA 3T08A 4J3SA 4NNXB 1BQHB 2W60B 2ZKHL 4K55A 2QKIB 2CPCA 4HEPG 4KTDH 5EZOL 2Y36H 5C0JB 1IT9H 3ULUF 4Y89A 3UDWC 5L7XL 3CVHL 4L8SA 3AM8C 3C8HA 3JVGA 2P43B 2XTJD 1YEKH 1M05A 2NYYD 3HKFA 3T0AA 1JGUL 5HPMB 4IMLB 1XGQA 5FECB 3CCHA 4P4RA 1N5YL 3VD9A 3KPSA 5IOPB 4C58B 3ULVC 2HRPL 3QNXA 1ZA3A 5GGTA 4GMTL 4RRPA 3HCVA 1V8HA 2D0GA 5IHUL 1IEBA 3ULVE 1MWAA 1U8MB 4KWUA 4TPRL 4XMKH 3VFOB 4MDJA 4ZDHB 2NNAB 3D0VA 4NQCB 1C16A 4LEOA 3MBEB 1QQDA 3H9SD 4G9DA 2DD8L 2BOCA 4UBDC 4TSBH 5I6XB 4YHOL 1B0WA 3EDKA 3PDOA 4UIMA 4FFWD 1MEXH 2ADJA 2NY2B 1MAJA 4OZIF 3TIEA 2G60L 4WI7A 3NA9H 4XP4H 1KLFA 3SE8L 4I3GA 1CXIA 5EA0H 1IC4L 3ARFA 4LLVA 3LRSA 5GGTL 3CUPA 3IKCB 4MJIB 1YYMH 3HRPA 2LTQC 3QCUL 3PGDA 3FT2A 2JJTC 3BDYL 3WFCL 1DQJB 2H2SC 3LN4A 4WFFD 5ID0A 2H6PA 5LQBL 4P9HC 5AZ2H 3GK8L 4BM7A 1J05A 4EXPX 4EN3D 4YWGH 3FFCD 3VWJC 5FUOH 4J3UA 3QUML 4JO4L 2DQHH 5T1KB 3K4AA 3PWPB 4G7VH 4P46A 1FCGA 2D9CA 3T2NL 5JDJA 5TQ0L 3RWCB 5D1XD 3ABZA 5DD1H 4GG8B 4OFPA 3RY4A 3SE3A 3M07A 2F54A 3ULVF 1A7RH 1QSFD 2Z31D 3G5XB 4LARL 4L3AA 1MELA 4P5MA 2E3VA 5IVXF 3OR7A 3PDGA 1D6EA 4PIRF 1D5XA 5C0GB 2PW1B 5EIQA 4MXVE 3VD7A 2IADB 4H25B 3BJLA 5GS0C 3ZKXB 1WTGT 1T21B 1FFNB 3I02A 3QDJB 4N0UB 1I9JH 3GNML 1UM6H 3X11A 1D6VL 2N4IA 3DXAD 2GKIA 1QBLH 4U0RB 1FGNH 2VL5A 4KGJA 3PL6B 1OTSC 5F8QC 5C0AD 2BJMH 1YEFH 3QAZC 4UB0H 2FATL 3KS0J 3LDBB 3GSXA 4PREB 5F71A 1U91A 5TPWH 4I18C 1MY5A 2CDFB 3DX6B 5HTSA 1F4XH 1K3IA 5FUCC 5C3TA 3R8BB 5DRXB 3IU4H 3MRRB 5FUCE 1UM4L 3QRGL 1S9WA 4S11A 4M93B 2DJUA 1MFAH 2FR4B 5DYOB 4P4KD 5GGVY 2V2WA 2HA1A 3ES6B 3HAEH 4PRPE 3CPLB 2K3TA 5IBTL 2H3NB 1DVFA 3LMJH 2NY0D 3KYKL 2X1QA 2F53D 4V2CB 1HHHA 2OI9B 2PETA 4Y0GA 3IF1B 2QHLA 4BQ8A 1FFPB 1PKQE 3I9GH 1HH9B 4B7LA 4PRAA 4G7YL 4NO0A 1NL0L 3SJVE 4L5FL 4L1DA 4HK0B 3MMEB 3NIFE 3O4LA 3ZHKA 3OXSA 5DJDA 3R06B 2ZCHH 5GS1C 3CFIC 4H8WC 4MXVF 3ZSSA 3ARTA 1UVQA 2X4UA 3VW3H 4YFLI 3H42H 3T8XA 4JFYA 4KTEH 4OD3L 3RY5A 2R0LL 4NT6A 1FN4B 4UDTA 2J4WH 4G6ML 3F6LA 5IKCA 1ZV5A 1IKNA 5IHBA 3DSFH 1KB9J 4GXVL 4KKAC 1T83C 3PJSA 4K2UH 3WNKA 4BFBD 1AXTL 1B3JA 1FFOB 5FYJU 4IIQB 4LF3A 4NN5C 3OKLB 2VE6B 5C86A 1S7WB 3OB0H 5MENE 1FH5L 4X98B 2P5WA 5E2VH 3OAUH 1JPTH 3DMMD 4H1LG 5J9PA 4LOUD 5I1CL 4RIRB 3OKOA 3G6AA 1CE1L 4LCWE 4G3YL 3U7WL 4WWKA 1MJUL 1T0NB 3O11A 3L9RA 1OQXA 2P1YA 2R15A 3FQUA 4HMEA 4ZPTA 1RIUH 4LCCB 4R2GB 3P2TA 2FYYB 4P2OD 2ZSVA 1WBZB 5FYKH 3VFRA 1UWXK 2R8SL 1JHTA 4OCRL 1P53A 3PWVB 1LO4H 2WWMC 5DHVB 3EZJB 3F58H 1GZPA 1OM3L 2WBJC 3QDGB 4YUEL 3VMNA 1JGVL 4OQ1A 5I17A 2KZ1B 5E2TH 3GSOB 5HYJE 4UT7H 1AXSB 4AJ0A 2WLYA 3WLWC 3DROB 4PJHA 3T65A 5I1DA 1Q0YL 1BZ9A 1RIVH 1R3HA 5FYJE 1W72H 3RL2B 3SPVB 1CR9L 4XPFH 3CH1B 4JPKL 1ZLUK 1UXWA 1LP9B 3W0WB 4F7PB 4JZJC 2AV1B 5EC1A 3WIHL 1VDGA 1GZQB 3DSNA 4WV1C 5C6TH 4EBQH 2J12B 1RJCA 3VXUE 3RDTC 4M5ZH 4O51B 4M7ZC 4XP6H 1OLLA 1H15A 5IFJB 3TLRA 2ARWA 4J3VA 1VSCA 1A9BA 5EZIH 3GMOA 3PHOA 4LIQH 4MNGE 4ZNEE 2V17L 3QH3B 4JPWL 1BQHG 4F7TB 5F3BA 4UTAL 4HBCL 1ACZA 4K7PY 4WU7B 2F5AH 3TFKD 4UT6H 4F9PC 5IEKA 5AYQA 2AEPH 3VGBA 3S5LB 2X4SB 4NKOB 5FA3B 4M7JL 4MD4A 2QHRL 5JIKA 4FQLL 3RTQC 1G9NH 5IQ9B 2ESVB 4UV7L 3MCG1 3JWNC 1PKOA 4CN1A 1GGCH 5DJCA 1OD9A 1FVEB 2DQEL 4ODSL 5EB9A 3FRUA 5GRZA 1T66D 2FX7H 1TQCC 4LHJB 3TV3L 3KNBB 4L9LB 4R0LC 1NFDF 5BZDB 3OJDA 2CLVB 4JDVA 4MJ4A 1RJYB 1LEIB 3FHAA 4RFEB 2ZKHH 2W91A 1UCTA 5F6IC 4MAYB 3IYLW 3UJTL 5L8JB 2L7UA 1EEYB 3PP3K 2ERJB 5EZOH 3IAPA 1EO5A 1WFOA 5L7XH 2P8MB 3CVHH 5JHLL 3V7MA 2NR6D 4HMCA 3HZKA 5C0DA 1GPOL 2Q1EA 1MY7A 2P47B 4JFQA 4PJAB 1JGUH 1ZANL 1WCBB 3RVWD 4OIAA 1N5YH 1NEZA 3GSNA 3MRIA 4YBQD 2QBWA 2YPKA 3OF6D 5IMLB 2VXVL 1A6AA 3O2DA 2HRPH 5FK9A 4GMTH 2E5EA 2GHWB 3U2SB 1JNJA 5IHUH 3FB5A 3TA3A 4OV5B 4TPRH 4DN4L 4Y4KA 4FMKA 4OZIA 3EJYD 5I71C 4OCXL 4BH8B 1FDLL 1UWGL 5T1DL 3GJEB 3RKDC 3LVEA 4X6DF 3P73A 4QRSA 3MJ7A 4WW1A 2V2XA 3BRDA 4ELME 2WIIA 4KDTC 1AKJB 4YHOH 4WO4C 2X4OB 3GSNL 4R97C 4KKBD 4PBVC 5KTEL 2RGSA 2G60H 1A6TB 3FONB 3SE8H 3O2DL 4PGDA 4OAWB 3SKJL 1IC4H 2XTJB 2OQJA 2VLLA 3P40A 5GGTH 3WE6B 4UQ2A 4JO3L 4NO5B 4RGNB 3WIHA 1VGEL 5AYUL 4NQVB 3UBXG 3SDXE 1I7ZA 2K9UA 2JB5H 1S9XB 3BDYH 3SBWA 5CZXD 2HWZL 3AFLA 4QRPE 2LFGA 3WNNA 5DRNA 5IFHL 5LQBH 1FNLA 4MD5A 3GK8H 5ICZA 1UYWL 4W4NA 1SYVA 2A83A 4P2QE 4OF3A 4P5TA 5IMMA 3QUMH 3D2UA 4JO4H 2D31B 5HHQB 1INEL 1MI5B 3JBG7 5BS0E 3T2NH 1CVRA 3HMWL 3HZVA 5TQ0H 2OSLB 3H9SB 3N9GL 4YDJA 4CVZA 2DQJL 4PB0L 2BY2A 4ZAKA 1T03L 4HC1A 4LARH 4QNPF 5F1IB 5GXBB 2VJXA 1TIUA 1T04A 1P5VA 2DL9A 5AUMA 5TE4L 1D3CA 1VFAA 3VI3E 3SGEH 1FYTE 1GVIA 3GNMH 1I7UA 4HUWB 3T0EC 3HE6A 4KJYA 1D6VH 3KPRE 3S97C 1TVDA 2HKHL 3O4OC 1C1EL 3SGDH 4XCYA 2D0HA 4YDLC 3ARYA 3T4AB 4PD4K 3FFDB 3BIBX 1G7IA 6FABL 1KCSL 2A73A 2UY6A 2I07B 3BWUC 4EN3B 4HC1L 2FATH 3FFCB 4JFXB 5DMIH 3VRJB 4OIIL 3GJFB 3L7FA 4RGMC 3SDXF 1B4JL 3VXOB 5SWSD 1EFXA 3RVXD 4FTVD 3UYRL 3MACL 4BKLA 5D1XB 1XFPA 1OAUL 1NC4A 2Z93A 1UM4H 1XZ0B 3QRGH 1R0AL 3P30L 1FAKT 3NIDE 4UUJB 5DUML 4BYHA 3TBSB 2P48B 1B2WL 2Z31B 3F12B 5SWZD 3VXMD 1JZ4A 2YBRB 3D3VE 1BX2B 4FRWA 4E41B 3MLSL 5IBTH 1BBDL 1OTUC 4NZTH 3IGAB 3ARDA 3KYKH 4KQ4L 1S5HB 2NXZD 3S34L 1GC1C 3L5IA 2AEQL 4G7YH 1Q9LB 1PBYA 4MNHB 3T0DA 1NL0H 4L5FH 5ESQA 3FTGA 3DXAB 2XWBA 4Y19B 5I66A 1PY4A 4NKDA 5C08D 3Q5TA 1WK0A 4OBRA 1Q9WA 4RGOL 3U9UA 4RDQG 2LAGB 4NC1E 5E8PB 5TDNA 2ZUTA 4LLQB 4ZXBD 3MA7A 3TH3T 4MD0B 3QSKB 4Z7VB 3J8F7 5JPMB 1KPVB 5DJ8A 4OD3H 2R2BA 3ZE1F 5C2BL 1KCRL 3CH8A 1IC7L 2I5YH 2R0LH 2BOBA 3S96B 3P9WB 3Q1SL 4G6MH 1BBJB 4IHOA 3G08B 4ZAKD 5IB4A 3B9KB 5EPMA 4GXVH 2EC8A 4PRPA 3RA7L 1WT5A 1OAKL 4OLUL 3VXSD 1AXTH 1VKXB 3QEQB 4IRJD 1TTFA 3M17A 2NY0B 3V2AR 2F53B 3BPNB 2X4NB 1PKQA 1CGXA 4D9RE 5D7LE 1FH5H 3SJVA 1CLCA 1AFVL 1X7QA 3VFUA 5GGSY 1A7OL 2W1NA 1ES0A 2WUCL 1ERNA 2Y4SA 4LVNB 3FO2B 3BPOB 5I1CH 2VITB 4Z7UE 1CE1H 4G3YH 3WMSA 4PRDB 4FXGB 3U7WH 1MJUH 1IAIL 4K71C 1U8JB 4HKZA 5GS1A 5J6HA 3KJ4C 1JGEA 1X6NA 3DRQA 3GB7B 4Z5RA 3HG1E 3L3KB 5D2LB 2R8SH 3C9NB 3U4AA 2W0FB 4OCRH 1F11A 2NXYB 3S88L 1OM3H 2IMMA 2A2QT 4PRIE 4YUEH 5TFSL 1JGVH 3F8UB 1TPXB 3O6FA 1YEEL 3ROOA 4JZNA 5E00A 2BZDA 1QACA 1Q0YH 1CFQB 3KPMB 4P23A 1CR9H 2BC4A 5D96B 2L0DA 3BGMB 5MENA 3BH9B 3AS3A 4JPKH 1HHJA 4G43A 2D9QB 1K5NB 1ZHKA 2DLTA 3ZKND 2G2RB 3BQUC 3WIHH 4LCWA 4E42B 3U4EB 4R4BB 4GJTB 2MKWA 1EXUA 5CS7A 5HI3C 2BX5A 1T20A 4LSUL 3QUZA 8FABB 2SEBA 5DK0B 1NMCC 1IAIM 4PY8J 3B9DA 1I8LA 3TJHC 1BD2B 5INDB 2V17H 3PNWB 2ITCB 4JPWH 3HPJB 4UTAH 4HBCH 4Z8FL 2MHAB 3FQWB 2JTDA 1N7ML 1W0VB 1MJJA 1GYAA 3WDIA 1AQKH 3IFPB 3V6FB 1G6RA 1A47A 2DIJA 1UB6A 2QHRH 2XY1A 4HK3J 2AJ3A 4C83A 4FQLH 4UV7H 4RCAA 1NC2D 5FKPA 2J8UB 2NY7L 2A0LD 5CEXB 2DQEH 4ODSH 1A6WL 3DBXA 3TV3H 4U6XB 3SCMA 3GBNL 5DZLA 4APQA 4JZJA 2WINA 3VXUA 1KF9B 2GSGB 5GRUH 2NTFA 3T1FA 1H3PL 4JFDE 1EVUA 4X5XB 5DD5L 1HSBA 1LEKA 4L8BB 5BMFL 3UJTH 2RAMA 5F21B 4CMMB 1P7HL 4LLYA 3UYOD 5HHMD 3T2PA 1G6RL 4MNGA 3MV8E 3GZKA 3UTPE 2GK0B 5JHLH 2A6DA 1MFCL 4MNQE 4HJJL 1ZS8B 1GPOH 1Z0NA 5DLML 3MRGB 3NCFB 3RY6A 4P2YA 1ZANH 1T3FB 4YHPB 2D3VA 2YHGA 3TVMB 5DJ2A 2VXVH 3QDAA 1GOHA 3UJIL 3W39A 3RTQA 4YGVB 3FB6B 2YA1A 5GZOD 4DN4H 3T04D 4E0RB 2IAND 4Y5YC 2EIZB 4OCXH 3O3DB 3TJEL 1UWGH 3ARVA 4OCWL 5J3HD 2JIXA 1LVEA 1REIA 5DEZA 4Q9RH 5T1DH 2IFGA 2VDKH 4PR5B 4ENED 1U8QB 2RCSL 1U3HB 2C7UA 4ELKB 3GSNH 1FL5A 5HYSB 4A2LA 3V0VB 5C70A 5KTEH 5MI0B 2UZIL 1T2QL 2FSEA 5DVOA 3O2DH 2X70B 5EOCL 3SKJH 5D7JC 3ZE2F 4D9QD 4JO3H 5F9OL 3AMLA 5EIIA 5CD3B 5AYUH 2EDEA 3ZSTA 4BUHA 4DCQA 1A02N 4PGBA 4NO2A 2HWZH 2W9DL 3S9DB 5IFHH 2H8PA 4XPAL 1UYWH 2ZSWA 4HUXA 1DQDL 1VA9A 4OT1L 2LVCA 2CXGA 1INEH 4XC3L 5GIRA 4NN7B 5IG7A 2NY2C 3QXUA 3N85L 1JWUA 1FL3A 4NGHL 3T3PE 3RNQA 1F00I 2J2ZA 3S4SA 3VFWB 3GEWB 1BLNB 3NCYP 3KHOA 4ELMA 3NN8B 2DQJH 4PB0H 4L4TB 1T03H 3VXPA 1VGKB 4HK3N 1F90L 3PGFL 4OD2A 5CHNB 1RUQL 1QBBA 4GQPH 1A9EB 3VFPB 2BCKA 3IDYB 1IL1B 3WNOA 4GKNA 5T3XD 5TE4H 4YO0A 4Y4HC 4FQXA 1G7MB 2DI8A 2XKNA 3V0WL 4WNQB 3VXRB 3SDXA 2HKHH 4R96B 3TBTB 1I8IA 1MCRA 1KIQA 1C1EH 1UH2A 4HUVA 2R4SH 4QRPA 2A9NL 3ALXA 3MJ8A 3OG6B 4Z7WB 1A14L 3HUJE 6FABH 1KCSH 3SN6N 2Y1VA 3UXFA 4P2QA 3ZKMC 4LSRL 5D6CA 4OIIH 1N4XL 4OZ4A 5BS0A 1B4JH 3UYRH 4DK6A 1U8PB 5C0FA 3MACH 1U8LA 5IHZA 1D9KC 5B3JE 2CRYA 2Q7YB 1OAUH 3THMH 1KPRA 4PGEA 2BHZA 2YD7A 1R0AH 1ONQA 1FO0A 5DUMH 5A3ID 3SKNA 2EDQA 3C60C 1B2WH 4V1DB 4OF6A 2C1PB 1F4WL 3T3ME 3IDMA 1C7TA 5EN2B 1YMHA 3MLSH 4HFWA 2DWEB 3JV4B 4U0RC 4XAKE 1BBDH 3PWUB 1XGTA 3HNTH 5EU6E 4ODUA 4KQ3L 4KQ4H 5JO5B 2DIAA 1FYTA 2FEDC 2VDNL 3S34H 4AIZA 1V7NL 4CVXA 2AEQH 1JGDB 3M1BA 3KPRA 5ICYA 3LDBC 5IBLC 2WNGA 5JOPD 5F7MC 4JHZA 4U6YA 3RQ3A 3GUTA 1ZHNB 4RGOH 1B0GB 1KJ3H 2X7LA 1FP5A 2BHYA 1TENA 3OKDA 5CGYC 1LE5B 2XRAL 1G9ML 1CD1A 4KI5E 2AERT 1DSFL 3HHRB 4FTVB 4QWWD 4LL9A 5C2BH 1IC7H 2AXGA 1JRHI 4BFGA 1A1NB 3H7BA 3BZEA 2Z8SA 3BD4A 3I3BA 3Q1SH 1YC7A 1NCWL 5F9AC 2GW5A 5B21A 5CEZL 5DJXB 5SWZB 3VXMB 3BVNA 3D3VA 3RA7H 4RA3A 1OAKH 3P4OA 4OLUH 4OI8A 3AREA 2XG5A 1DDHA 2EDJA 4HIEA 5DEGB 2XPGA 4OGXL 5F1OB 4X5LA 4PJDE 1DUZA 1LEGA 1UA6L 5CEYB 4HWUA 5J56B 1AFVH 1KGCD 1TJIH 1A7OH 2E7HA 2Q3ZA 2WUCH 2V9TA 3WJLA 4MA3A 4IRSA 1IAIH 1T2JA 4HQQL 3FOMA 4GAYB 4ZXBB 4NWTL 2X9WA 3QUKA 4PJ8D 2CRMA 1EJ6A 3MRMA 3VCLA 4OV6F 2R9HD 1XGRB 5H35A 4BQBA 4JFHE 1BJ1H 3S88H 2IMNA 5ACZB 3QIWB 4IIQC 5KANI 5TFSH 4JE4B 1YUHB 3HTLX 2X44D 1YEEH 3IETA 4I4WB 4Y5VA 1SQ2N 4QY8B 4OF5A 3VXSB 3OG4B 1A3QA 1DQTA 2VERN 5D7LA 4NJ9L 1MH5A 3PQYB 3KPRD 3L5WA 5CEZD 3GI9H 3EO1B 4KJQD 4PB9H 2PTVA 1QEWA 2XN9D 4Z7UA 1AD0B 5CD5C 1CL7I 4R2GC 2ITDA 3INUL 1I8MA 9CGTA 1IC5L 5IW6B 4OFKA 3DV4B 3BHBA 1YN7B 3QZWA 1NDMB 4LSUH 1S7RB 4M8VA 4ZS6C 4X9BA 3HG1A 4XVUC 4K94L 4LGRB 4X6BA 5J13C 2B5IC 4JKPL 3OKKA 5AG8A 4Z8FH 4PRIA 3SHSA 3IFNL 4NDMB 1N7MH 3QUXC 1XR8A 4BUGA 4PRHB 5KSAA 2FCBA 4L4VD 4DEPB 3TYFA 1FV1A 4HGMA 4KHXL 4ZUWB 4XPTL 1JF1B 3AXLA 5EUOE 3AUVA 1MCLA 4Z77B 3OGCA 2NY7H 1UEMA 4Q9BA 4LLUA 2I9LB 3TF7C 4QRTA 4J8RB 1A6WH 4NUJA 1JL8A 2VOTA 1Q9KA 4Y16D 4U7SA 2CKBA 3GBNH 2H26B 4MA1C 5DT1L 1BIIB 3ZYOA 4HDIB 4MJ6B 3UTSE 1KN4H 4BK4A 2XKSA 2NLJA 1H3PH 3EFDL 5ELIA 4DKEH 5DD5H 2E7LC 4XXDB 3ALWA 4Q9QL 5BMFH 5J6GB 5I1KL 4MQXC 1T1WB 1LD9B 1G6RH 3CAFA 2PO6D 1MFEL 1MCHA 5E03A 3RVUC 2BSSA 5EFIB 4M62L 2D7QA 5CGTA 1MFCH 1DZBA 3VMOA 4HJJH 5DTFB 4OGZA 2ICEB 1EFQA 5DLMH 4Z0XB 5T1LB 5FO9B 2A38A 3WUZA 4JQXC 1ODAA 2JJWA 1P1ZA 4ZD3L 1U8KB 1HI6B 5BQ7B 2CKBL 2VYRE 3WFEL 1QR1B 2X1PA 3DUUB 4MVBD 5HJ3A 5CJXA 1ZGLP 4Z78B 1BVLB 3UJIH 2GJZA 1NC2B 4AIXA 5CBEA 1XGPA 1FSKB 1XF5B 3RJDA 3WLBB 1IVLA 5D2NB 3TJEH 4OCLC 1MCWM 4OCWH 4WI5A 3TCLA 4XGZB 4K3DH 4JFDA 3SO3C 4M48L 5LVEA 4UDUA 1E4XI 1I1YA 2GK2A 3HB3C 2AJSL 3U4BL 2Z4QB 4TVPE 1DCLA 2IH1B 5HHMB 3TEUA 5IJKC 4S1QL 2ZG2A 4MNQA 3RWGB 2UZIH 1T2QH 4TTDC 3QWRA 1F58L 4DUWA 4OZGB 4FFVD 4RZCA 5EOCH 3RWFB 4DKFL 5CSGA 5F9OH 3VA2C 2I27N 5E24E 1C12B 4WEUD 3R0MA 3K7UA 3V4UL 2W9DH 4C55A 3KWWB 4Y1AD 4OM0L 3U48A 1MNUL 3TP4A 4JFPA 3ARGD 3MNZA 4QKXB 3VH8B 1DQDH 5I8EB 5IIEB 3BD5A 4OT1H 5MEOA 2IANB 1M7DB 4PJFB 4XC3H 3N85H 2FJGB 2ED7A 1NBZB 1FE8L 1QPXA 2MTPA 1QRNE 3HC0A 2ZOLB 1NCDL 5HI5D 1S7SA 3VJ6B 2EO1A 4KK9D 1U3JA 4GBXC 4L3CB 1S5IL 3PGFH 3NAAL 1RUQH 5IROC 3FAXA 4F2MA 4X6FA 1S7XA 1GHFL 3DLQR 5FFLA 2ICWI 4WHDA 1QSED 2DKSA 1QFPA 2N7BA 1NFIB 4YIQA 3V0WH 4GG6F 5DR5L 4H26A 3C6SA 4ETYA 5GGRA 4DUVA 1JUFB 4JRYB 5JDSA 5DJ6B 2XI9A 2DI7A 4FNLH 2OTWB 2A9NH 4GXUN 3WO4B 4N8CH 3BP4A 4EUPH 4YFEA 3QIBA 4XP5L 1A14H 4R7DB 4LLDA 1F3DJ 2CLRB 2V7NA 1JI2A 4IJ3C 4LSRH 4LHUD 1ZWIB 2HJKB 1N4XH 1N59B 2N56A 2X41A 4JZOB 2I25N 3WBDA 3CSYA 4H0GA 3BXNB 1O7SA 4DN3L 2GIYA 4BA8A 3ROLA 4J1UB 5LGJB 2XFXB 2HFGL 3BGAA 5DFVC 2EDTA 1PGRB 3RWEA 1XF2A 4N9GA 3RVVD 1F4WH 1R3LA 3V6ZA 1F2QA 5D5MB 2FO1A 5C0IA 1AR1D 1VB9A 1OGTA 2I9TA 4G8FB 4KQ3H 1EUTA 2G75A 2HFTA 1V5JA 5L2KE 12E8L 1H5BB 1J8HB 2VDNH 1V7NH 1PEZA 3HR5B 5F7DB 5C7XL 5TQ2H 1JPFB 4L8CB 4ZO6A 1HINL 2EECA 3OKNB 1DLHB 1B6UA 1CDJA 3J7HA 4QYOA 2DQIL 1L7IH 4NKIH 3HUJA 3OL2A 2BNRB 4JQIL 1FL6B 1YNTB 4IS6B 5EIVA 3I84A 4GW1B 1RI8A 4YC2C 1R5VB 3MZGB 3G5YB 1G9MH 4OZHE 5EU3B 1MQKL 2ATPB 2LV4A 1DSFH 2EYSB 1X5XA 3LRGA 4U3XA 2P49B 3MLRL 5E9DB 1JV5A 3ZMRA 1NCWH 4R6UA 4R4ND 3RI5F 1FZOA 5CEZH 5IB3A 1YDPA 3JV0A 4BH7B 1BVKB 3I2CL 5SWQB 1NGPL 5EU6A 4OGXH 1AO7E 4XZUA 4JVPA 3BMWA 4I3SL 3X3FL 1WWWX 2HLAB 3NFPB 4N5EC 2HJFA 1UA6H 4U1NA 3TBVA 4HJGA 5HYQA 1NMBL 4HIJA 5I8CB 4U05A 5D6DC 4P59L 4X4ME 2Z9TA 2A6KA 4NN6C 4ZUTB 4NNYB 4MDIA 4O00A 4RX4D 2X4QA 2ZUYA 3QISA 4HQQH 3JWDL 4NBZB 5D1ZA 3LB6D 5CLWA 3V8OA 4NWTH 4MCYA 5EO0B 3OHXA 4OFIA 5F70A 3FQTA 3R8QA 4LKXB 3UTQB 3VA6A 3S3PA 1GCFA 2UYLA 1IGMH 3VXQA 4HKBB 1G7LB 2IAMB 2VZOA 4KDVA 3IXAA 5GPRA 3DETC 5T3ZE 5JXAL 3TNNB 5C07D 5J1AA 1NAKL 2XY2A 2EH8L 2FX9L 4JY4B 3WV0A 4M7LL 3FQRB 4KK6D 4PJDA 4M6AA 4YHYB 1YZZA 2DQGL 2QR0A 4NJ9H 4Z76B 2P5EE 5D1QB 2WV3A 3BEVB 2EZ0D 2ZUSA 2WW8A 1K3ZA 3INUH 32C2B 4YXKL 1IC5H 1JP5A 2NXYC 4F58L 4UNTA 5DA0B 4U1MA 2AKRA 3GSUA 1CXLA 2FBJL 2LABA 2HG5B 2X2YA 4YJZL 3GFUA 5IB5B 4YQXL 2PYEB 4PV9A 4DOHB 4K94H 3BPLB 1G7JA 3C5ZC 2V2TA 4Q6IB 4JKPH 3K2MC 3CFEB 5DJYA 3MV9D 3D85A 3P4MA 2XT1B 1MCCA 3OAYH 1CVSC 5E95B 3IFNH 2PN5A 4PTTA 5KN5A 1ZOXA 3L3JB 2PXYC 1RZJC 1T1XA 4QEGA 1ZHBA 2EIEA 4KHXH 4UOW0 3GBMH 1R6VA 5I18L 4QRRB 1DQLL 4XPTH 1NDGB 1RIHH 4FQCL 2YSSA 3SQOL 4ZG1A 1MUJB 3DVNA 5CILL 3UTTD 1J0ZA 3LKRB 5ID1A 5ISZE 3TZVA 3QUYC 3C2SA 1AD9B 5D93B 1U2HA 3ARWA 5DK2B 3FO1B 4PJCE 1K9TA 4ODVL 1MRFL 1IM9D 1CICD 3EFDH 5BOPA 1GH7A 3MRQB 5DWUL 3IFOA 4Q9QH 3WD5L 4TULL 1ZSDB 5I76A 3F62A 3O9WA 1MHHB 5I1KH 1FNEB 1XR9A 5L6YL 1SEBB 3NCBB 4PJIB 1MFEH 1MHCA 2J5LB 4HJ0C 5DJZA 4FHBD 2BSRA 4OFYA 4M61A 4U6TA 5GS3A 4B50A 1OAQL 1GGBL 2EXWC 5DMYA 2VAAB 3DYOA 2V5TA 4ZNCD 4JANA 1MAML 5E8OB 4L4VB 5DI8A 2Z91A 5B8CB 2CKBH 3WFEH 2FZ3B 3BJ91 5LWYL 5EUOA 1A3LL 1OB1B 4Y4FC 2O61B 1CFBA 3FT3B 3VGFA 4JLRB 3WUWB 1HE7A 4HMDA 4KK5D 4HG4K 1WBXA 4U1HA 4X6EA 3UTSA 3MV11 3PGCB 1ZLVK 5TDOB 3WFBL 3X12B 3MLTB 3MR9A 3HS0B 3X13A 3QG6A 4PY7A 2HVKA 4M48H 3DVGA 4JFFE 1B90A 2AJSH 5DO2C 4NQDE 3EZ8A 2PO6B 4JM2B 3KPQA 4S1QH 4X6CE 1SMAA 2OTPA 1YMME 3WJJC 5FOBB 2YRPA 3TVMC 1DANT 1F58H 2E7MA 1Z9LA 4KRLB 2VISB 4HLZH 4DKFH 1JPST 1IEAA 2A6IB 4F37K 4LBEA 4ODXB 5KW9L 1X5LA 3G6JF 1JWSB 4RMUA 3FO9B 4UU9B 3E2HB 4NQTA 2V7HA 4OM0H 5DF0A 1Y6MR 1MNUH 5E8NB 1SJEA 3SKMB 4X9HA 2VR4A 3TZVD 2GITB 2ZCKL 3C5JB 1JTOA 4LLWA 3PXJA 3VXNA 1FBIL 3MRBB 3MROB 2B39A 3C8KA 3TN0A 1I1AC 1EPFA 3MRKB 4CN4A 4C56A 5KS9B 5ESAA 1C5BL 2X4PB 3W9EA 3TO4C 4ONHA 2F58L 4R90L 1YN6A 4TNWF 4WEBL 2BSTB 1CGWA 3SDAB 3NAAH 5IJVA 1JRHL 4U7KA 1GHFH 3GMQB 4EI5C 1A6ZB 1QBML 4YDVB 3T2QA 1Y0LA 2V5YA 1XMWA 3DX8B 2R2CA 3IAQA 5SX4I 1DQQA 5DR5H 4FP8H 5B38B 1BM3L 1IJ9A 1U0QA 3O2VH 1T89A 4XCCL 4Z7NE 4NN7C 1K8DA 5HGDB 2CK0L 4H5SA 2AEIT 3QPQD 4NHCL 2XA3A 4S1RL 4Y1AB 5I73B 4CNIA 4XP5H 4MLIA 1I7RB 1NBYB 3VFVA 5DMKB 2VXQL 4DN3H 4XVSL 3MOAL 2QJDA 2R1XA 3B8YA 2HFGH 1QRNA 1ORQB 1WC7B 3L3GA 4PJGA 5I19L 1WAAF 4JQVA 2CUIA 1Z2KA 3JWOC 1A4JA 4IMKA 1XAUA 2FLRT 4GBXA 1C5CH 5D70L 5GHWL 2IH3B 1NCUA 3OB0K 4NFBA 2Q86B 1Y18A 12E8H 4WY7L 1OP5K 4I0PD 1X5HA 5C7XH 2HTKD 4P2RB 3G04A 5GJSL 4AEFA 1QSEB 2DQUL 1RZKC 1ETZA 3WFZA 1JF5A 1H0DA 1H3GA 5HI4C 3KYMB 4D0DA 2DQIH 1VACA 1IGJA 2Z8VC 4L8SB 4JQIH 3EOAB 3KYNA 5ANME 1FNGB 1L0YA 1G84A 1YEDA 1MQKH 1XGQB 3L7EA 3MRNA 3CCHB 5KSUA 2NPLX 3P9MB 3MLRH 2AS5M 3RU8L 4C56D 4OZFA 1OT2A 4TQEL 3OKMB 3BUYA 1CGYA 4KJPD 4OI7A 3QNXB 4KVCL 1ZA3B 4G9FE 1UH3A 3HCVB 1GGYA 3K8MA 1MWAB 3FHQA 3I2CH 5HGAA 4K3GA 1NGPH 2J8HA 4HUUA 1JFQL 4Y88A 2HLFC 3DRTB 4EUPG 5L2KA 2IQAB 3D0VB 3ARRA 4I3SH 4LEOB 3X3FH 4DW2L 1QQDB 4G9DB 2BOCB 3ALPA 4QGYA 1NMBH 4XI5C 4P59H 1UACL 4UBDD 1FG2A 4PBXA 1FYHB 3PDOB 3FQNA 1UB5B 2ADJB 5E4IA 4ZFOB 3QO1B 4HKJA 2FHCA 3TIEB 3JWDH 1CDHA 1NGXA 3UPAA 1DE4A 1VCAA 4OZHA 2R2EB 1CD9B 1T5WA 4GUPB 3QEHB 3ARBD 3FT2B 2R2HA 3Q2CA 4ZOCA 5F1NA 3LN4B 1QLFA 1ZLUH 1J87A 5CBAB 5DJ0B 2H6PB 1TZHA 3ILQC 5FO8A 3QDMD 4ZTOH 4YPGB 1DBKL 1NAKH 2X89A 2APBA 2EH8H 2FX9H 5CUSL 4P46B 1AO7A 3ZDYF 1EO8L 4M7LH 4MYWB 2WANA 2VXTL 3LKQA 1DANU 2DQGH 1S9KC 1F5WA 3D6GA 3C6LC 2DLHA 2YMXL 1FNFA 4TYUA 2HP4A 4ZUVA 1WIOA 2L4OA 4X4MA 5IP4A 4YPJA 4A6YB 4P5MB 3I6LE 2Z0BA 4YXKH 2C9AA 4J12A 1ZT4B 1T0MA 4MXQC 1EUUA 4F58H 1I3RA 3HE7A 5L9DL 3QIWC 4TVSa 2FBJH 4TNVF 4HIIB 3LV3A 4WI6A 3I02B 4YQXH 1D5BB 3O3EB 3D39B 3MV7A 5GZNC 1KT2A 4ZFFB 1LK2A 2WM0A 5FHBL 1E4XL 3CDYA 1FZJB 3MNVA 2B1HL 1AGFA 5JHDB 1OTSD 2Y9RT 1KB5A 3FL7A 3GSXB 5I18H 1A4KA 1U91B 1A7PL 4UV4L 1DQLH 4X99A 4LCUA 3CFDB 4FQCH 5E6IC 3SQOH 1RJZA 1TETL 5CILH 3FN3A 1AP2A 4JFEE 4PRBA 2HFFA 4CBPA 3AGVA 3CC5A 3PP3H 1S9WB 5EO9B 1TDQA 4IM8A 2BNQE 1VPOL 5E4EB 4HULB 5ABDE 5IB2A 4LDOB 4WDIA 1C08B 3H3PL 1R3KA 4ODVH 1MRFH 1HQ4A 2Q87A 1DVFB 2ICWA 1QNZL 3UBXI 3CU1A 1HHHB 3JUZA 3KG5A 4ETQA 5DWUH 5T3ZL 3WD5H 3MSPA 1EDQA 4TULH 2KBGA 5L6YH 4PRAB 4QHNA 5HHNB 4NO0B 1DUYB 4R4FL 3BZFA 3R1GL 2VLRD 3O4LB 4JG1H 3MV9B 2JB6A 1OAQH 1GGBH 2KUTA 2YWYA 1ND0B 3BH8A 1U93A 4X0KA 1OHQA 1MAMH 1UVQB 4NKMB 2CXKA 4OSUL 1ORSA 4RFNB 4GRWB 2X4UB 1OGAD 5AAWA 1FLRH 2CDGA 3T8XB 5LWYH 4JFYB 1MFNA 2RIKA 1A3LH 4X7TB 3QQ3A 5ISZA 4JJHA 4XP1L 5ENWB 5KG9A 4J4PC 4UDTB 5A43C 4F57L 5KVDL 3OKEA 4WTXA 3RWIB 1XIWA 4PJCA 1RHFA 3WFBH 35C8L 4KKAD 4ZTPL 2Y07L 1IM9B 1CICB 1U41A 3VG9C 1H9VA 1S8DB 4LF3B 2EYRA 1G1YA 1JTTA 3MRFA 4PRNA 4LFHD 3GMRB 3JV5A 2P5WB 3MV7D 4KRPB 5L88H 1SYSA 3G6AB 1QVOB 3ILPB 3KDMA 4WWKB 4DVBA 1R3IL 2DDQL 4XNMA 1A1MA 4ZQKA 4NM8L 2I60L 4M1DH 2DM7A 1U8IA 5KW9H 5E5UB 3NPSB 2ZPKL 5D2NC 1YA5A 3H9HB 3BZ4A 4YZFE 3GSRA 1F6LL 2HT3D 3MUY1 3T0XA 5IR1B 1IAMA 2ZCKH 1GZPB 2WWMD 4N90D 1L0QA 1NFKA 5I17B 3AY4C 1MCBA 1MRCL 2KPNA 2WBJD 2XQYG 4FFYL 1NGQL 5I0DA 1P7QA 4BJLA 5IGXL 4HEME 5E5MA 3T65B 2UVEA 5I1DB 3HRZA 3VGEA 4GLRI 1JZ3A 1Z9MA 3JUYA 4KH2A 4JFFA 3TCXA 3QJHA 1X5FA 1KJ2B 2ED8A 4NQDA 2F58H 5JXEA 1LWRA 1P4BL 4WEBH 5KSBE 4NQCE 2CIIB 4X6CA 1SVZA 1YMMA 1JRHH 4XPHL 5EC1B 3EYVA 3K80A 5ITFB 3OPZL 1QBMH 3SE4A 5KOVC 1QD0A 2MOVA 2P24B 3RDTD 5D7SL 1OT1A 3DX9A 1BM3H 1JTPA 3UCRA 5E7BA 5DD6A 1A9BB 1KFAL 1UXSB 4XCCH 4I5BA 3GMOB 3PHOB 2CK0H 2A9ML 4NHCH 4RAVA 2VLJE 4YXHL 1KCKA 4S1RH 3I50L 4CW1B 4ONGL 1MOEA 2GCYB 5KJRL 5F3BB 2V6HA 4ISVA 4ZYKA 1O0VA 4U1KA 1LE9A 5IEKB 2YD5A 2MQ3A 2VXQH 3CDCA 4XVSH 3MOAH 1UH4A 4WW2C 1AE6L 5A2IH 5BV7L 1W0WA 1I1AA 5I19H 4GS7C 2CMRL 3PWPE 1WQVT 2B4CC 4LHUG 3GKWH 3MLWL 2H2PC 3FRUB 5D70H 4MQ7A 3PWJA 5GHWH 3TPUA 2A6JA 3B9EA 3WN5A 3KLAA 3OJDB 4KMQA 4JDVB 4O02H 2FWOA 4EI5A 4WY7H 1FNHA 1U95B 4LU5L 4GRLC 3W11C 2DQUH 4XVJL 2FIKA 4OZGF 2CH8A 1KCLA 2OTUB 1JNLL 3VGGA 1Q1JL 1AY1L 3L3DA 4N0UE 1DTUA 3IVKB 4K7PX 3HZKB 4PJ9B 2HTLC 4XRCA 2OL3A 2OCFD 3QXDA 1CGVA 3FB8A 2P8LA 1NEZB 5FA4A 2MNUA 2YPKB 5D71L 4TQEH 5DMJB 3FB7A 1A6AB 4W6YB 1RJLA 1PY9A 4NQDD 4KVCH 3T2OA 5FK9B 4AT6A 4C57C 3TA3B 5SX5H 5FGBA 5DRWB 2KH2B 4OZIB 1SEQL 1JFQH 4QTHB 2VTFA 2Q8AH 4AEIL 2VLKE 4WW2F 2DOCA 3Q3GA 1KNOB 3LKOA 3RIAK 3P73B 2IBZY 2OL3L 2V2XB 3RKDD 2VN7A 5DHYB 3UROR 2UWEF 1UACH 2DYPA 3DO7B 3PIQB 3SDCC 3MRHA 4WO4D 1QZ1A 4UMGA 4OZFH 1N3NA 1W2KT 4XPGL 5ANMA 2B20A 4PGDB 5C0CE 4PD4J 5HPOA 3AS2A 1CDIA 2UUDH 3VWKA 1RY7B 4H20L 1T1ZA 3QI9A 1XH3B 1I7ZB 3VMPA 4OB5H 3GDBA 4JRXD 3OQ3B 1AC6A 3P9LA 4I3RL 3GMMB 5ILTL 5DRNB 1RFDL 5C3LD 4G9FA 1IZKA 4MD5B 1E28A 5C9JA 4QOKD 1DBKH 2A83B 3MXWL 5IVXB 4P5TB 3N50A 5IMMB 3D2UB 3TH2T 5CUSH 3Q6FA 1EO8H 1U58A 4JFOA 2VXTH 3HI1A 4G42A 5HDOA 3EDFA 1WZ1L 2YMXH 1NUNB 2XXCB 3G9AB 1NGZA 3C87A 4MJ5A 3DECA 2APFA 1ZT1A 3MRJB 1CFSB 3W5NA 4Z6AT 1WSST 1MFDL 3QCTL 5L9DH 4NQED 3RGVC 3NABL 5AUMB 4UAOC 4PG2A 5IMKA 4HZLB 3QHZH 1RURL 4QRUB 4UOW1 3ELAT 2NW2A 3T0ED 1PZ5A 2LTQB 3VFSA 2XWTA 5FHBH 1CWVA 1E4XH 3HFML 4YHYC 1KV3A 1RULL 3BP6A 2B1HH 1G7IB 2A73B 1D7FA 2FECI 3QDMB 2PTUA 5FGSA 3SDDA 1KCVL 1A7PH 4UV4H 3L7FB 1EBAA 4PV8A 4NRZB 3VWJB 4PJ5D 1EFXB 3MRCA 1QSZA 2C1OA 2NY3B 2AEWA 4PLJC 2Z93B 4HPOL 1I8KB 1HHIA 4IDLA 4CMHB 3BPLC 1U36A 3H3PH 1J0YA 1A2YA 1CYGA 4M6NH 5HHOE 3O3AB 3QEUB 3Q5YA 3OR6B 1MRDL 5T3ZH 3EO0A 3VWKD 3HI6L 1IM3A 4K8RL 2VC2L 1UQSA 4R4FH 3FTGB 1LDSA 1JNNL 1WZMA 3IT8D 3R1GH 3G5VA 3O8XD 4YGAB 3QCVL 1RK0A 3L5XL 5EOTA 1K4CB 1Q94A 2AAVA 1Q9WB 3CK0L 3HC4L 3U9UB 1OD7A 3DTXA 1TTUA 1BJMA 2F15A 4CRPA 5TDNB 4LNRA 4OSUH 1X5IA 5INCB 1IBGL 1R24B 1OSZA 3MA7B 3LN5B 1S3KL 3QAZB 2DICA 3N0PB 5D93C 4JY6B 5FV2A 5DJ8B 2J88L 2R2BB 2CRIA 4JFEA 5FV1L 5KVMC 1MQ8A 2BOBB 4LRNL 4XP1H 4H1LA 4JKWA 2GTWA 2BNQA 2O5ZL 4JO2L 5FYKU 3SQBA 3V95A 3CSGA 4F57H 5IB4B 4LLMA 5KVDH 2F19L 4RMTA 4OF7A 2ESVE 1OW0C 1ZMYA 4PRPB 1HHGB 2J5LC 3QQ4A 5I1AB 3VG0L 1G7QA 2Y07H 3M17B 1HOCB 4QXTA 1L7TL 5JLZB 3BX7C 5DRZB 1PKQB 1PW3A 1NGYB 4OLXL 2QSCL 4DVRL 3VFUB 3DX7B 4POYA 2WBKA 4HT1H 4NUGL 1ES0B 1V3MA 4HWEL 4BZ2L 3O81A 5IWLC 1N6VA 2X6MA 1BFTA 1R3IH 2DDQH 3D0LA 2FEEI 3DARA 2I60H 4NM8H 5GS1B 1EAPA 2DQFA 2ZG1A 1OTTC 1JGEB 4YHLL 2ZPKH 4K8RD 3DRQB 2WQ8A 2WAHA 4PJAE 4Y2DA 5DD0L 43C9B 4ODTL 3RZCC 1JBJA 1F11B 5B22A 1YJDC 4ZUUB 2OMNA 5FYKE 4LPTA 3TT3L 4FFYH 1MRCH 4XPBL 4HUMB 5EBMB 2F74A 4JZNB 5E00B 5C09D 1NGQH 3LKSB 1HDMA 5IGXH 1J0JA 1P69B 3IDGA 4IOFC 4P23B 1TVHA 2GSIA 5T1MA 5MENB 2NCMA 4ORGB 1NAMA 5C0BD 1P4BH 4MB3A 1BQHA 4G43B 4BQCA 2W60A 2HFEB 4XPHH 4XNZC 3OPZH 4LCWB 2EIDA 4XCNA 4X7FC 1I85A 1L4IA 4I9WD 2Y06L 1RUAL 5ALCL 4NRXB 3L3HA 5D7SH 1EXUB 5DS8A 4ESKA 3ZE0F 1KFAH 2MQCA 5HI3D 2XTJE 3S7GA 5HPMA 1DFBL 2A9MH 5FECA 2H32H 2XTLA 4YXHH 1XGYL 4WUUD 1ZLWK 3I50H 5B4MC 4ONGH 5KJRH 1MCJA 5DUPL 2EDXA 5IOPA 1U8OB 3SGDI 2ADFH 5HYJB 5JW5A 5C0ND 2X5PA 3SDAC 2MFNA 3QJFA 4KGLA 5MP6L 1AE6H 1U8MA 1NGWA 1UB6B 5BV7H 2UY7A 3VFOA 5HD8C 3K3QA 4ZDHA 2CMRH 5FKPB 1G9NC 5KSBA 4RMWA 4NQCA 3MBEA 3MLWH 1OVZA 3K8LA 5K59E 3H9SE 1KJMA 2ICWJ 4PJ7E 4APQB 4JZJB 4S1DC 3UYPA 1HZHL 4B41A 2G5RA 3HI5H 5I73C 1NSNL 1A1OB 2YKLL 4LU5H 5H37H 5F88B 2YUZA 4M7ZB 4XVJH 5L0QC 3VD4A 3C5SB 1HSBB 1LEKB 3ZYZA 1JNLH 2YUVA 2Y5EA 1ZT7B 4HZAA 1AY1H 4MNGB 5GSVA 2VLJA 2EEAA 3QXWA 3MA9L 3BDXA 5BVPL 5D7IE 1TCMA 4X80L 4MWFA 2CK2A 1YNKL 2X1OA 2GAZA 4S10A 5JW3L 4WFFE 2JCCE 1JZ5A 3U46A 4ZFGL 4NPYA 4K3HA 5DQ9A 3NFNA 4Z7QF 3K1KC 3FFCE 4WW2A 4LSSL 5T1KA 3PWPA 3W39B 1V3KA 1QTYT 1YPZE 2ZUQC 3RTQB 5KS9F 2BVTA 4GG8A 4MCZB 4KRNA 2C5DC 5ITBL 2OXHA 2P7TB 1SEQH 4DZBB 3G5XA 3K8KA 1QSFE 4J7RA 4R0LB 3UBXA 1CXKA 4AEIH 3ARZA 4L8SC 5C0GA 2PW1A 2OL3H 4OUOA 3Q5OA 5FHAH 2IADA 1T7WA 2G5BA 5F6IB 1P4IL 4N0UA 1FL5B 3FOLA 4NBYB 4QXWA 2Q20A 1MCDA 1CDYA 1MCQA 4NQUA 5D9SB 3DXAE 4XPGH 3OX8B 4RQQA 2YRLA 1HQRB 2XNAB 1U8NA 3PL6A 3QIUA 1OF2B 4LNVA 1X4XA 3D9AL 1A22B 4X7EC 5C0AE 1DBML 4DCQB 4PREA 4NO2B 4LQFH 2CDFA 3DX6A 3LD8C 4I3RH 5ILTH 2W0KA 3MODL 4Z7VE 3VD5A 1RFDH 2F9BT 2H8PB 4WI2A 1PX3A 2JCCF 3MXWH 2AP2A 2W38A 3B83A 4MMZC 5IG7B 4GAFB 4P4KC 1JWUB 1FL3B 1U6AL 2VLKA 3LRHA 1TNMA 2NY2D 4N0FA 3ES6A 3BMVA 3NVQA 2EDLA 4ELMB 4W68A 2H3NA 1WZ1H 3ARFC 1ZGLM 3GO1L 2F53E 3IF1A 3VXPB 5BRZD 4LEXL 1FFPA 1HH9A 4OD2B 4WO4B 4KMTL 4MJID 1A8JH 4R97B 1MFDH 3QCTH 3LZFH 3QXTA 4GKNB 3NABH 5C0CA 3Q0HA 3R06A 3RWHB 1RURH 3EYFB 3KPOA 3CU7A 3OV6A 2NY4B 5CGMA 3SDXB 3A6CL 5I74C 1I8IB 1EERB 1KIQB 4P46C 4HUVB 4N8VB 3HFMH 4M5YH 5EBWA 1RULH 5D2LE 3DUHA 3MJ8B 3SE3C 1BFOB 4X4ZA 1G1CA 4QOKB 1KCVH 1FN4A 1PSKL 2YD8A 5D6CB 1XCTB 4OZ4B 5BS0B 5C0FB 1CBVH 3MGOA 1CLOL 5IHZB 3HLAA 4XNQA 1KPRB 4QF1B 4HPOH 1D9KD 1ONQB 1FO0B 4P3CH 2K1MA 3SKNB 3PV6A 3C60D 1S7WA 1FIGL 3QDJD 3IDMB 1WUNT 4X98A 3MJGX 3BYTA 1PG7X 1HIML 1YMHB 5BW7C 4XBPB 1J12A 4NQEB 5EH1A 4HIHB 1MRDH 1FYTB 1HNGA 3RGVA 2CRZA 3IU3B 3M1BB 1T0NA 2F5BL 2FEDD 3HI6H 4YX2L 4K8RH 2VC2H 5DFWH 1JNNH 3T0EB 1WGOA 4OFVA 2DWDA 2DQCL 3QCVH 3L5XH 4P5KB 3LOWA 4HSQA 3CK0H 3HC4H 2EDYA 4LCCA 4MB5A 3VGHA 2FYYA 2VR5A 3MUGB 2X7LB 5DHVA 1C5DB 1Q0XL 1IBGH 5AAMA 1KCUH 3DYPA 5CGYD 1A6PA 1S3KH 1CD1B 1S7QA 4PJ5B 2C4XA 2J88H 2WP3T 1AXSA 1M6OA 1DVFC 4LRNH 5GJTL 4IOSD 5SX4H 1NPUA 2O5ZH 4JO2H 6CGTA 4OQTL 2VKXA 3MUJA 3RP1A 1GGUA 3SPVA 2F19H 2PTTA 3BVNB 2XACC 3CH1A 4XXCA 5TF1L 3VG0H 5HHOA 3QQNA 3MLPA 1DDHB 2AV1A 2XPGB 5E1AA 2F8XC 1GZQA 1OOAA 4WJ5B 4OCNC 4R26H 5EORL 1DUZB 4OLXH 3STLB 2QSCH 4DVRH 2W9EL 4YDIL 2BDNL 4LCYB 4RFNC 5DSCA 5IFJA 1SBSL 4NUGH 2BJML 4UB0L 2VDOL 4JHAL 4M00A 3DVFA 2YRZA 4IRSB 5DVNA 3B9AA 4H1LH 1F4XL 5IV2A 3FOMB 3QH3A 2BRQA 3IU4L 4F7TA 2QTEA 5HVFB 4YHLH 1IKNC 5F7KC 4WU7A 2E6QA 4M8QA 5DD0H 5H35B 4ODTH 4NKOA 3IRZA 2RJMA 4JGUA 5A40E 4F7MA 1J88A 5FM5O 4MAUL 5IQ9A 2ESVA 2BVOA 5H94A 4Y5VB 1UEYA 4BSWB 1FZKA 4KRPC 4DUXA 1OW0A 4G8GD 3OJMB 4GW5A 3KNBA 4L9LA 2RFXB 1XF1A 4WWKC 2CLVA 5D7LB 3VDCA 3KPPB 3EUUA 3NPZB 1ZVSB 2QQQA 5J0BA 5AWNH 3L5WB 1YEIL 4JGMA 4LMQI 1QKZL 4Z7UB 2FBOJ 4MAYA 4PJBE 1CN4A 5L8LB 3HR6A 4R2GD 5IWLA 2Y06H 1RUAH 3QEGL 5ALCH 3RZWA 5LAXA 1AHWA 2NR6C 4K71B 3BHBB 4XH2B 5E6ZA 3QZWB 3KJ4B 4PJAA 3QDGD 4RA0C 3HG1B 2CDEA 1DFBH 4XVUD 1XGYH 3V5HB 4K2UL 5DUPH 1EHLL 5FDYA 5EUKB 3QUXD 5BJTA 15C8L 2DKMA 5C09B 1FV1B 4XNXL 3TYFB 4DFIA 5MP6H 3EJYC 1LO5B 4JKKA 3W0WD 4ONFL 5KVEL 1R5IB 4LKCB 3AXLB 5JOEA 1KULA 5BVJB 2M26A 2DQDL 4F7CA 1MCKA 4LLUB 3GJEA 1UADC 1W72A 4M1GL 4PBWD 4Q97A 4LDLB 4UILL 1Q9KB 2PR4L 4F3FB 5DC9B 3EJZD 3S3SA 3BQUB 3C8DA 1INQA 5GGRY 3HPLB 5HHVL 5EZJB 1NSNH 2NY1B 5FYKL 1QOKA 2NLJB 1AGDA 3FONA 2LU4A 5DC4B 3WE6A 4KV5E 4MQXD 4PJBF 5CLTA 1T1YA 2GT9A 3MA9H 4NQVA 3BKML 2P8PB 5IW1B 3KPNB 1NMCB 3RIAF 5CZXC 5BVPH 3RVUD 1S9XA 2LQRA 4X80H 4YHZL 1YNKH 1RIVL 1CE6B 4JJ5B 1W72L 5JW3H 3EDDA 1FIEA 3QULB 1P1ZB 4Z7WE 4ZFGH 3E6HB 4LSSH 3MCKB 2D31A 3PWNA 5MEPA 1TNNA 2GJZB 4PJHF 3U0WL 3CFJA 2OSLA 2JK5A 3QYCA 5JIIA 3TWCL 3H9SA 5ACMA 2VL4A 3D69A 1KIRB 4PJ7A 2GJ6B 5B39G 1MF2L 3UPRA 4MAYD 3BE1L 3HA0A 5F1IA 1J5OL 5HVGB 2FECL 3GMPA 4JFDB 1KXTB 1JWMB 1J9CT 4WGWB 4PP1C 3ARXA 2VIRA 4UDUB 5C6WH 2YWZA 3L95B 1X5ZA 1U92B 1P4IH 4D2NA 3HB3D 3MV8B 3HZMA 4HUWA 4GAGL 4NYLB 1BFVL 5D7IA 4ZS7L 4K7PL 3B43A 3O6ML 2O5XL 3FFDA 5GSRB 2JCCA 2AV7A 3TA3C 4DKAA 3D9AH 4Y4KC 3QBTB 4EN3A 3FFCA 4GO6B 4ZSOE 3WNPA 3VXOA 3MODH 5H37G 1YPZA 5SWSE 2OJZH 4FTVE 4JFPB 5D1XA 3MNZB 1Z5LB 3P0VL 1XZ0A 5MEOB 3H7LA 1AKJD 3V5DB 4HCRL 3TBSA 5ACLA 2NW3B 2Z31A 1QSFA 4Y5YB 2ZP0T 1U6AH 2W0PA 4YBHA 5SWZE 3VXME 4N8VG 5I75C 1J1OL 3SY0B 2PCPA 3IGAA 3ZDZE 4NO3B 4DGYL 1S5HA 5CIPB 3VFMB 4N0YL 3GO1H 4I48A 1JNHB 4LEXH 4LMQE 2EH7L 1Q9LA 4KMTH 4RGND 2LE9A 4GKOA 4F2MB 3DXAA 3SBWC 4G8EB 2C3GA 2XQYK 5IVOA 5JPNB 1H3TA 5C08E 1RZ7H 3EJJX 5DK3A 1RVFL 4LSQL 5D7JB 3ZHLA 5E8PA 1P84K 4YIQB 1LNUA 4YHIB 1V3JA 3A6CH 5C0AA 5GGRB 4P5TC 3KLDA 4LLQA 4GOSA 2FRGP 1II4E 3ZT6A 1JYXA 3ARQA 4WFHD 3H0TA 4Z7VA 1KPVA 1MI5D 3S98A 3P0GB 3BP4B 4NZJA 3TIDA 3FMGL 4LLDB 4B53A 2V7NB 4RBPH 2MMXA 5HDBF 1PSKH 4ZAKC 5F7EL 1BBJA 5JW4Q 2CR6A 1TLKA 3ROLB 3QUMA 1CLOH 1AXIB 2FEEL 4P4KA 4FQJH 4IRJC 5J8OA 5KOMC 1XF2B 2YEZA 5DFVD 3VXSE 3RKPA 4N9GB 1RZFL 2F53A 5F7HA 1YQ2A 1DBJL 4LPVA 3HE6C 5BRZB 1ZGLB 1FIGH 4MXWL 1R3LB 3V6ZB 1HIMH 3PQYE 3RVTC 2JB5L 3IDNA 4JN1L 3FO2A 2VITA 2CLZA 5IQ7L 4PRDA 4FXGA 2DM4A 2F5BH 4YX2H 1RZGA 1U8JA 4OGYL 2R1WA 4Y4HB 4NJAL 1XF4A 1JZ6A 1LMKA 2DQCH 4GLRH 3GB7A 1EEUA 3CX2A 3DV6B 5F1KC 2NY3C 5D2LA 3C9NA 2W0FA 3FZUD 1PZUB 4XHJD 1Q0XH 3DHJA 4CMHC 4OCSL 3X14B 1ZLVH 2C3HA 1T0PB 1P4LB 1EBPA 5KVFH 4WRLA 2CKNA 5T5NF 5GJTH 4PP2A 4E41D 3ARDC 5I1LB 1D9KB 1VEMA 4OQTH 4J3TA 1CFQA 3MYJA 2R69L 2DAVA 1FZOB 1MAKA 5IB3B 3BGMA 1YDPB 3C60B 3BH9A 1J18A 1JI1A 1K5NA 1QG3A 5TF1H 5JIPA 4Y19D 2G2RA 5EU6B 3UEZA 3CZFA 5BW7A 3DMMA 4AENA 4E42A 1J8KA 3VI4E 3U4EA 5EORH 2HJFB 5DHVH 2J7LA 3GIZL 1I3GL 4U1NB 3NZHL 4NQXB 2W9EH 4HJGB 2BDNH 4N5ED 4ODWA 4YDIH 1SBSH 4GKSA 4TUKL 1AR2A 1OP3K 2VDOH 2A6KB 2EDOA 5DMIL 4JHAH 8FABA 3N1PC 4MDIB 4C4KO 2VMFA 4P2OA 5FCUH 1BD2A 3KPLB 3V5KA 1ADQA 3WIFB 4CJ1A 2MHAA 3P11L 3OHXB 5F89B 1W0VA 1HNFA 3G5ZB 3B9KD 3FQTB 5IB1B 1IARB 1WT5C 4KY1L 3V6FA 4AEHL 2UYLB 3DWTA 2VN4A 3QEQD 4NZTL 4D9LL 4MAUH 5GRJL 2L7JA 4B0MM 5CEXA 3DETD 3IXTA 4K3EL 5J1AB 4N0RA 4U6XA 4UIKL 5HGHA 3RPIB 3QNZA 4PJDB 5JA8B 2GSGA 4L29A 1ADQL 5FGCE 3ZZ1A 2FL5B 1YEIH 3EOTL 5K9JL 4O5LL 1QKZH 4N0CC 4L8BA 4MLSA 2IBBA 2J3SA 1OARL 4CMMA 5I8OL 1HYRC 4QHLB 5I1IL 5IFAL 3QEGH 3HNSL 5HHME 2GK0A 1SJHB 2NXYD 2ZUXA 2I5YL 1QFWM 1ZS8A 3O6FC 5DQJA 3U36A 1G7JB 1JPGB 2V2TB 2VWEE 1T3FA 1I9RL 1KACB 4YHPA 4ZMAT 4KJWC 3D85B 1ITCA 2XQBL 1ULVA 4E5XB 4P23C 1FVDA 4IOIA 2EKJA 4PTTB 1EHLH 5DUBA 4KK8D 1WBYA 2NY5L 3IKKA 1T1XB 3T09A 5A2KH 15C8H 2PXYD 3RUGE 4YGVA 1ZHBB 4XNXH 3MFFA 4WCYL 4G8GB 4HG4J 1FC2D 4ONFH 1OP5H 5KVEH 3VGAC 2IANE 2YSSB 1J10A 3O3DA 5MEQA 2DQDH 5ID1B 1KTKE 4LRIC 4M1GH 5CZVL 2UVFA 5EWIL 2WP3O 3ETBF 4L9DA 3QUZC 4UILH 4PJBA 2PR4H 3QUYD 2E9WA 1U3HA 1ZLSL 5HHVH 1I8LC 3V0VA 3NIFF 2GYSA 1K4DA 1JJUA 1BD2D 1Z6JT 3IFOB 2X70A 5I76B 4OBSA 1MHPL 4YR6A 1JMZA 4D9QE 3BKMH 5DJZB 4JREC 1PJ9A 4CVUA 5J13B 2ADGA 4HJ0D 2B5IB 3IDUA 2FNBA 1LO3L 4YHZH 4JRYE 3OF6A 1KEGH 2YR3A 2EXWD 3QUXB 3TT1L 1KOAA 3MZTA 4JANB 1ZTXL 1XGUA 4U6HB 5DI8B 2Z91B 3SCMC 3AU1B 3AS0A 1A6UL 3UTZB 4WHCA 3W81A 4APQC 5EUOB 2IWGA 3U0WH 1FNSH 3VFWA 3TWCH 1UT9A 3NN8A 1MF2H 1ZHLB 1GJIA 4DTGH 3BE1H 3BN9C 1KEML 5IMOA 4O2CB 4MA1B 1J5OH 3MR9B 3VFPA 5HY9A 5D5ME 4N9OB 4ZOEA 3X13B 3RY6C 4PY7B 2HVKB 2H45A 3DVGB 3UP1A 4IBLT 3WSQH 5T3XE 1AH1A 3SKUD 3WL9B 1XCQB 2NZ9D 5DO2D 7FABL 4G80B 2AGJL 4WNQA 3VXRA 1AQKL 4GAGH 1BFVH 3EYUL 4ZS7H 5IBUB 1AJ7L 4I0KA 5H2BB 4K7PH 3V4VH 3TVMD 3OAZH 3O6MH 2O5XH 1I7TB 2YUWA 3REVB 2QSQA 1WICA 2I24N 4Z7WA 1M71A 4Z9KB 1RSFA 3GSQB 3BRFA 1BZ7B 2B2XL 3MGTB 3E3QE 3BEWA 5GRUL 2OLDA 5A3IC 3P0VH 4LLWB 3VXNB 3VRIA 4HCRH 1ZA6B 3C8KB 4U6VL 1U3HD 2R23A 2C1PA 2QEJA 3TN0B 3U6RB 1CK0L 5A16A 2HT2C 5EN2A 1J1OH 4MA8L 4QHKI 1OAYL 3JV4A 5ESAB 1OP9A 3O2WL 4AMKL 3SO3B 4DGYH 4ONHB 4GG6B 4N0YH 5JO5A 3F7QA 5IK3B 2EH7H 1RZKL 3P4NB 5JUEH 3GJFH 3B3IA 4M3JA 5JOPE 4FFZH 3A67L 2Q6WB 1B0GA 1RVFH 4LSQH 4HBQA 1CTNA 1GGTA 3CLEL 4Q2ZB 1DQQB 2EE3A 4XBGA 4LSDA 4ZSOA 2EXYC 4H5SB 3L3IA 3ESUF 5SWSA 4FTVA 4F9LA 3FMGH 2VDML 4PPTA 3TPKA 3CDGA 4KKCC 4Q9RL 1JYVA 4RMRA 2VDKL 1QHPA 4NCDA 2W59A 3VFVB 2E7CA 4FQIL 5F7EH 4L4TD 4V2BA 4S0SD 5DJXA 4L3EB 5SWZA 2IPUG 4N8PA 2R1XB 3VXMA 3VDBA 2R4RL 1Z9OA 3AB0C 1RZFH 4FQXC 1I3UA 1DBJH 4MSWA 2NY4C 1A4JB 2C4FT 4GBXB 4MXWH 2K7QA 1TCRA 3VXRD 4CGTA 1KGCE 4TSAL 2D7TL 4JN1H 5FF6A 3LHPH 5C08A 3OJ2C 5IQ7H 3G04B 4OGYH 1BOGB 2X4RB 4NJAH 2VSDA 1EZVY 5TDPB 3JV6A 4GAYA 2BMKB 1H0DB 4ZXBA 4EOWH 4YFLF 5LXGL 2R9HC 2CSPA 1Q9OA 3CSPA 2YOCA 4JY5L 3KYNB 4HGWB 2QLVB 3LEXA 4LVEA 3VFTA 1S7VB 3PHQB 4OCSH 4IJ3B 1YEDB 1YUHA 4O2EB 3L7EB 3MRNB 4TSCH 1G9MC 4V1DD 5EU4A 5CCKL 3EHBD 4I4WA 1MCWW 4AH2A 1LGVA 4QY8A 1QYGH 3CSBA 3RWJA 1MLBA 3VXSA 4QHUB 4ZOBA 4IRJA 4UINL 2R69H 2J8OA 1CIDA 1WTLA 5CJ8A 4ELMF 3PQYA 5HGAB 2EDNA 3NGBC 1PG7L 1PQZB 1S7TA 1GAFL