4HEPG

Complex of lactococcal phage tp901-1 with a llama vhh (vhh17) binder (nanobody)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
VQLVESGGGLVQPGGSLRLSCEASGFSFDDYAIGWFRQAPGKEREGVSYISMSDGRTYVADSVTGRFTISSDNAKNTVYLQMNSLKLEDTAVYYCAAGRFVTFGSAWSFVGGGPYGIDYWGKGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BPP
publication title Viral infection modulation and neutralization by camelid nanobodies
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein
total genus 32
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hepG00
5ANMA 1LE5B 5GRVL 2V2TB 4H8WC 3GHBH 5DMIL 3KPSA 4YUEH 3V0WH 2YPLD 4DGVL 4ONOA 1A7NL 1BECA 3FO2A 3O3BA 1VFBB 1ZEAH 4XPBH 5EA0L 3GRWA 3MXWL 4IIQC 3TN0A 1W8OA 3D18A 2I26N 4OQTA 1R0AL 2IC2A 2NY1B 4IRSC 1KJ2A 4XAKE 3V5HB 3TT1H 4PJIA 1AFVH 5IF0A 3IKCB 4K94H 3TESA 1LO2H 3L5WB 3W81A 1VERA 5J6HB 1A3RH 4ELMF 1IGIH 3R0NA 4TQEH 1N26A 3P9LB 4ONHA 3IETA 1P69B 4PY7A 3GKWH 4MD0A 1ADQH 4YBLC 4HJJL 1EZVX 4E9LA 3RDTB 3DX9B 2XACC 4R0LA 2OK0L 3QO1A 1ED3A 3A6CL 1SYSA 4KI5F 4HIJB 4ZODA 5D7LA 2H2PC 3IJHB 4GG6B 2P47B 4KHTH 4NKOB 5DF0A 1XCQA 4XMKH 1SJXA 5CSGA 1S9VB 1HEZA 2LAAA 4FZEH 2J6EH 4S0TD 2X09A 4HFWB 3S35L 4BM7A 1WICA 1WZ1H 3BP5A 1DQMH 4RRPG 4HXAH 3UC0H 3F5WA 1G7QB 2VLKA 1BF8A 1HSAB 3PP3K 4WW2F 5I19L 4ZTPL 5EU7E 5JIPA 3S34H 3OKNB 5HXMA 5J11C 2R0WH 3HMXL 2MQ0A 1CL7H 4ZNCD 4X98A 1BBDL 1CGVA 5IEHB 5DT1L 4M9OA 3RL1A 2WMPA 3SOBL 5DK0A 5IKCB 5HI3C 3EYUL 4BSVA 5JOPD 2YD4A 2EH7L 4MAYD 1EK3A 3MLXH 5DUML 1OAUL 3HPLB 1K6QH 3BVNB 1EAPA 4NM8H 4Y1AA 3RTQD 1RJLB 3HA0A 5A16A 1FYTE 3WBDA 1KFAH 4HDIB 2FJHA 1MRCH 3P30H 4EBQH 1NGYB 2AJ3A 3BP7B 3CZJA 2G60L 3DTXB 4U1NB 4YBHA 5C0IB 2E9JA 3CFJA 3MNVB 5I1IL 3QO0A 4V1DD 3VFVB 4DKEL 2WBJA 3WFCH 4A6YH 5KSAB 4XBGA 3DGGA 1F4YL 2DM2A 3VXPA 4PRNA 3QJFB 1MCEA 1CE6B 1G7LA 3QEHA 1VB9A 4OGXH 3B6SA 1BZ9A 3HMWL 4N8CL 2O5ZL 3GMPB 1CG9B 4PLJC 4LSVL 2XZAH 5HGAB 1UENA 3QPXH 4U6HA 2XNAB 3PL6B 5HPMB 5E8DH 1ETZB 3I9GL 1OM3L 4U1MA 4IMKC 1OB1A 1PLGL 4ZXBB 1Q72H 4JKWA 3TO4B 2IAND 3EOTH 5D1QC 5AUMB 4W4OC 4O5LL 1AKJD 3SE9H 5C0AA 3ZDXE 5HHXH 3QRGH 1LILA 1YEHL 3C6LC 4X6DE 5E99L 5LJYH 3LKPB 3P9MA 5DS8B 2R2BB 4YXLH 1BD2A 4N9GA 4NQEA 2FJFB 2ZOKA 1T0MB 1K8DA 3S9DB 2LAGB 2F5AH 3VRJB 3Q48A 3TGXA 3VFSA 1WWAX 3VH8G 3QPQD 4FFZL 4Y0GA 3OTTA 5F7NC 2W9LA 4WFGE 3QFDB 5F6IB 4ZO8A 4YX2L 3DX7B 1H8OA 1MFCH 4JN2A 4KQ4L 2G5BB 3OKLA 4J3WA 5I1CH 1OY3B 3RL2B 5DJ8B 4Z7OF 1AGCB 5DQJB 1M7DA 4IRJB 4XP6L 5C0GB 4JGJA 4HX1A 3SN6N 1NKRA 4WGVB 5MI0B 5GIRA 3SCMD 1P7QA 1DEEA 2AXJA 3IXAA 3T4YB 3IDUA 5D5MF 3E3QC 3SE8L 3SPVA 4XP4L 1KIRA 4RA3A 4BSWB 3GJEB 1I4FA 5EO0B 2FZ3B 3BO8B 2R39A 2R8SL 3SKJH 2H32H 5F9DC 3MJ9H 3RQ3A 4ZS6C 1MCKA 3G9AB 4QRPD 5BV7H 3C6SA 4LQ1A 1CVSC 3PNWA 2P48B 3D39E 5FB8A 4QF1B 3TYFA 4NCC1 5BVJA 4NFDA 1FH5L 3C09C 2VXTL 1RK0A 2V9QA 2DDQL 1SHMA 1QR4A 4PRIA 3TVMA 2L7UA 4NJ9L 1VGEL 3MACL 2CUMA 2ESVB 5DC0A 4HMDA 3IFLH 2V5SA 4TUJA 4YFLF 1UWGH 3RWGA 2X70B 4EXPX 2ARJQ 5E8OA 4UIMB 4KXZH 4UIKH 5T3XE 2EC9U 1GXEA 1CF8L 2H3NB 2EH8H 4UBDD 5C0DA 3VGDA 4U0QB 1AGEB 2A6IB 1F90H 2R0LH 2I9LB 2PO6C 3CDFA 5I66B 3IDMB 2W65B 2FR4B 1VACB 3PWPA 4OZHA 5BVPH 3CSYB 3QH3B 4QXTB 4ZFFA 1A5FL 4YAQB 2QKIB 3QEUA 1U8QB 1DQQA 2AJSH 5IT2L 2GK0B 3MNZB 5SWZD 3O0RL 2RFXB 2ADIB 1TQBB 3UTTA 2NY1C 5TDNA 4MNQB 4LQFH 5DRNA 3U79A 1GOGA 2IMNA 3VXUA 4LHJB 2FYYA 1A3LL 1G84A 2SEBB 1EIBA 1YEJH 3AM8A 1FSKB 1MWAH 1BJ1J 4XI5D 5CIPA 4GQ9L 2Z0BA 1Q9LA 2PCPA 1NAMB 1GC1C 5DMKA 2VDOL 4HQQH 3ARVA 1G7PB 3VFWA 4WI3A 3NAAH 1WIPA 4GBXB 4JN1H 3FJTA 3RDTC 3H3BC 4MD5B 2P5EB 5JPMB 4PJEE 1YDPB 1YN6B 3G5VA 5C3LD 2NW2A 3TO2B 4I13B 4NN7B 4IDJH 3EDFA 5BS0A 2FX8L 4W70A 4JPKL 5KVDH 1CD9B 4JVUA 1TVHB 4WI9A 3BN9D 4C58B 4QHLA 2VR9A 4XVUD 1U58B 3EOBA 1RIVH 1EEZA 1EHLH 1JNLL 4KKAC 3JV4A 3CMOL 5ISZD 4Z7UF 5F8RC 4HUXB 5HI4D 4PJ5A 2AXGA 3VFPA 4E5XA 1IFHL 1MEXL 1E4KC 1Q9KB 5FDWB 5ADPH 5DJZB 3ZE2F 3OKDB 3ELAT 4UV4L 1UZ6F 3EHBC 3KXFD 1QQDB 3KPRE 3UAJD 5I8OH 4OAWA 5FYKL 2AJVH 3CZFB 3K80A 1HKFA 4WU7B 1WBYB 1YJDL 1JZ5A 3CNKA 3WFEL 3VFUB 1NDGB 2MWCA 1YYLH 5GSVB 1UACH 2FO1A 3ORJA 2E7LC 3MOBH 1HKLL 3BUYB 5F89A 2Q76A 3GMQB 1UXSA 1U0QA 2Y9RT 3TT3H 1OTSD 5D9SB 5MEQA 4AMKL 2AABL 2P8LA 1BIIA 5KSAC 3PUCA 4JDVA 3I50H 1VDGA 3C5SB 1C5DA 1ZVSB 2AV1B 1AC6A 1HHIA 4FQLL 4NO5B 5DHVA 5HVWA 1H8NA 4JZOA 3FB7B 4LHUG 4K8RL 1CZ8L 4U31A 3SDXA 3MYZA 1NDMA 1AD0B 1M05A 3OZ9L 5I8CA 4PJCA 5F7LB 4X4ME 2C1OA 3DV6B 4IMLA 2N1KA 1JE6A 4MZ3A 1MHEA 3PL6C 2QBWA 2VISB 5EOQH 2R2EB 3MLVH 4X80L 3QJHA 1BVKB 1LO4L 1E27A 4OZFB 5CSZA 4PJDA 5I1LB 3ZDZF 4ZXBC 2DM4A 3HUJB 3TO4C 2BVPA 5L2JA 5K9KB 5KW9L 5DJYA 2GJZA 3LZFH 2BRRH 2QSTA 3GSRA 4PTUB 3MOQA 3JWDH 4RWYH 4B41A 3TV3H 4JLRA 2DOCA 4DUWA 1UXWB 1OAZH 1QNZH 4OZIB 3ARQA 2EDWA 5CWSB 3HTLX 1YEDB 3LKSA 5JXAH 1CICB 3SKOA 3VG9B 3QUZB 2VITA 5IJVA 4ZO7A 3K1DA 2UVFA 5F6IC 4JPIB 3QHFL 4HWEL 1H3TA 3ARDC 5EZIH 3K3QA 3QCUL 5ETUA 4ODWA 2GSGA 3MRKB 4H25A 1SM3H 5ACZA 1IAOA 2FATH 5MI0C 1IQWH 1S3KH 1D5ZA 4D0DA 5HDLA 3WFHA 3NPZB 2Z93A 5EUOF 5HSFA 3O41B 1Q94B 4G9FD 2XYCA 1UQSA 2IG2L 4JPVL 3F7QA 4PG2C 4DGIL 4K3JH 1QBMH 5T33L 1TQCB 4KK8C 5DJXA 5EUKB 3EO9L 4PBXA 2APTA 1JGDB 5JOEA 1FNHA 5HYSA 5E94A 2I07A 3MV7D 1S8DB 1KCRH 4BSJA 3PWNB 1B6UA 2DKSA 4QTIH 2VLRB 4JFEB 2EIBA 3RBSA 3I6KB 1IARB 2HFGL 4B0MM 3IDYB 1K2DA 3RKPA 5LCVL 3H9SB 1UT9A 2E9WA 1CT8B 1ZHBA 3B4NA 3OX8A 5IB4B 1IKNC 3KS0H 2QADB 4U3HA 1G7IA 1TVDA 2BNUA 4NP4H 2LV4A 3ZSSA 4MWFB 4CNIB 5CD3B 1R5IA 2BERA 4L4JA 1RI8A 3B3IA 1ZXQA 3ZKMD 3VXTA 5DVNA 4J3XA 1P4IH 4KUCF 1CK0L 5DWUL 2FSEA 3D0LB 2AGJH 5TFSH 4O58H 5EIVA 4I2XA 3FMGH 4H1LH 4OCWL 1VA9A 4ODXA 5C0FA 3RAJL 1KT2B 4NHUB 2ICES 3EOYG 4M1CD 3GMLB 4XCNB 4ELKA 4RBPH 3NTCL 5JR1L 4O2CB 4B5EA 4OD1L 4ZPVA 3DRTA 3DMMA 1TQBC 3DUUA 1MAKA 4MX7B 5JW4Q 1YC7A 1FFNA 3L3JA 2D7TH 5J1AA 2CKBH 1ZA6B 4ELMA 5CP7B 5SWSA 1FSKC 3DBXB 32C2A 4P0DA 3CDGB 3RVWD 3W9DA 2DWDA 5DD1L 4M93B 3PWVB 4XBPB 1JPSL 3MPCA 4AENB 2YPVL 1ZS8B 1CTOA 4GBXC 5D7IF 5F9JB 1ORSA 4YHIB 3UJIH 1LHZA 2AJZA 3ZT5A 3O3DB 4NN7C 3IF1A 3IU4H 4K9EC 1Q9OB 5BQ7A 3CFIC 5D1XB 3O2WL 4F33A 4M5YH 1XF3A 2Y25A 5D6DC 2YUVA 5EO9B 1HHGB 4F2MA 3T0DA 2YWYA 3IAPA 4X9HA 4WW2A 1TVBB 3GUTA 4OKVB 1P7HL 5IVXF 4NJAH 2OYPA 3LHPL 1QLFA 4Z7VB 1FGVL 3H0TB 3FZUC 4TNWK 4F58L 5EFIB 1WTLA 2DQCH 3CC5A 1Y18A 3QFJB 2AK4D 1EXUB 3CFCL 4DZBB 2XZCH 1G7HA 2ZUXA 3IGAA 3GNML 6FABL 5HGDB 2UUDH 3VGAB 5EBWB 4J3UA 2GTWA 5IROA 1LO5B 3KYKL 4C56D 2BVOB 3FQNB 4WHYG 1BFVH 1FVEA 4HV8A 4I18A 4OFPA 1OAQL 1VENA 3QYCA 4H8WH 3GSWB 4M6OH 3WNOA 1JUFA 1PBYA 3BEVB 3ARFD 4OLUH 3TIDB 2CDEB 1SJEB 1A9BB 2CJUL 1A6WH 1KBGL 4MB4A 1MUJB 5TPWH 2OJZL 4JQXC 1A6ZB 1D5XA 1G7JA 4OLVH 1QLEL 2NX5E 2QQNL 3UMTA 2GHWB 1S7WA 5CMAA 3LQAL 4LCCB 3BSZH 2QR0B 1YUHB 1Z9SA 1J8HA 4KKLC 3ULUL 5EOTA 1B2WH 3L3OA 4AEIL 1I7UB 3F58H 5DXWA 1W72L 4LAQH 1G7MB 1RY7B 5FHAL 5DA4A 2OMNA 2ZKHH 3D3VD 4OIBA 2R2CA 5GRZA 5KN5B 2RJMA 3HAEA 3ULVF 3W39B 4M7KH 4GAFB 4CUCA 1KTLB 4ZTOL 4GKSA 5D7KD 4ZFZB 4LDOB 4ZUUB 5ID1B 5T3XH 3ES6A 4PUBH 5JLZB 1QSFB 5B38B 2ESVE 4QY8B 1HN1A 2KPNA 1LO0H 2YD7A 4R4BA 4ODHH 3ULSA 1QFWL 3C5JA 1GHFH 2VJXA 2D0HA 3QIUB 43CAA 5E08H 1FC1A 4YC2B 1CICC 3VG9C 3QUZC 4JY5L 2WSKA 2NXYD 3GMNA 4MJ5B 3TZVD 3GO1L 1U8PA 2Q7YA 4LF3A 2VERN 1RV6X 1PZ5B 2A6DB 4DCQB 2MQCA 4NQSA 3W11D 5MEOA 3KLDA 1AXSA 1MFAL 1TZGH 4I77L 4HKXA 4K3DH 4BK5A 4Z0XB 2FRGP 3ESVF 5JA8B 1N3NA 4ZYKB 4DQOL 5D5MA 5GSRA 1FPTL 4X6EB 5GZOC 3R06B 4BYHA 3I75A 4N8VG 4ORGB 4IOIB 5TQ2H 5I17A 2IAMD 4P46B 5GGSA 2V5YA 1MIEL 3SKMA 1EO7A 1TQCC 4Z77A 4MXQC 5GPRA 1E0OB 5HHQA 4M00A 2W9DL 3WE6A 3V52H 4MNQE 3SBWA 5EU4A 1T1YB 2JK5A 2XPGB 1ZANL 4JFOB 4ZNEA 4X0KA 2W60B 4H1LG 4HFUL 4B7LA 1T66D 4NQXA 3E0GA 1BOYA 3BW9B 4KUZH 4KK5D 5IMLA 4O9HL 3QNXA 3IDYC 4QRRD 3AREB 3WFDL 2AQ2A 4PP2A 2HKHH 3MJ7A 3PDDA 4XP9H 5T3ZL 1QHOA 2P5EE 2MKWA 4JFHD 1RZKL 3PHQB 2KZ1B 1CFNA 3KHQA 3O11A 1HILB 2QADC 1YEFH 1KCSH 4PREB 2C3GA 5DZOA 5DJDB 1FO0L 5J8OA 1PJ9A 1S5IL 4UV7L 4ODSL 1MNUH 1UWEL 3Q5TA 4DFIA 4N0FA 5CINL 3V5KB 4FZ8L 3REWB 4I0CC 2CMRH 3RNKA 4P23B 1DL7H 2YPKA 3DX8B 2HT4D 2FIKA 1A22B 5IESH 1ZGLB 5H35B 3WUZA 4Q2ZB 4U6VH 4LNRB 3FO9A 4WO4B 2HJKB 1AQDA 3GDBA 1LQSR 4NBYB 2V7HB 1IVLA 1SYVB 5DRWA 5HGBA 4YXHL 4S1SH 4M6NH 5I1HH 1HHHB 3EW3B 5FHBL 2MCG1 1QYGL 2LVEA 1YECL 3BKCH 2VB5A 4GT7A 4IRZH 4PFEA 1NGPL 4OCRL 4PB9L 3Q1SH 5HHVH 1M6OB 3X11A 2W38A 4YDIL 3BQUD 2F54B 3T04D 1T1XB 2IGFH 4NHCH 2P5WB 3IFOB 4XWGH 3AXLA 3DYOA 3IVKB 4GXVH 4HIHA 2GCYB 4M93C 3D25B 3GJFH 4LLYB 1NFIA 1O7SA 4GKZB 5SV3A 4Q6IA 4D9LL 4N0CD 4ENED 3EUUA 2R0KH 4KJYA 1WFTA 4ZS7L 5FUOH 1ZLUH 4WJ5A 4L5FL 1MFBL 4KRPB 5D1XC 3WNPA 3FQTA 4L3EB 1S7TB 1NCAH 1RUAH 5T3ZD 1J5OH 1W0YT 5DD6A 4Q9RH 5JXED 5FM5M 5E70A 1JWSA 1YEIH 1FNLA 3ECBB 1TZIB 3L3IB 1NUGA 4OZHE 4Z7UA 5F7YC 1V7NL 3M8OL 4OFYA 3MV8A 5DHYB 25C8L 4KZEL 4WU5A 5DK2A 4IS6B 1OAYH 3X12B 3SY0A 4KKNA 2E5EA 5HJ3B 3HUJE 2HKFL 1EA9C 4HK0A 1T7YA 2EE3A 4Q6YA 2D3VA 3GBMH 3VGAC 1NSNL 1AXIB 3BYYA 4WWKB 5JQHC 4RA0C 4X8XA 1G0XA 5DFTA 5MEPB 2H1PL 1IEAB 4P3CL 3EFFA 5I1DA 3HI5L 1K4CA 3QI9A 3FONA 1ZT4A 5IW6B 3VRIA 4OZIE 4QTHA 4GLRI 4XCYB 3AY4C 4JO3H 3MA9H 2A38A 5DYOB 3UBXA 4YFEA 4M43H 1N64L 1FAIL 2Q6WA 4KJWD 5HY9B 1LE9A 3TH4T 4L4VA 4YWGH 3L9RB 4NWTL 2XKNA 1A02N 1KYOJ 1IAII 2OTUB 4G8EA 1S9YA 4MQSB 5BOZG 3CVIL 2FX7L 1RULH 4LCCC 1PG7L 1GC1H 3F7VA 4YDKL 4WUUE 4UDTB 1T2QH 3BP4A 4Y4HD 3UZEA 3QIBA 5J3HC 2R1YA 4H26B 3TM6A 1NLBH 5B39A 1XAUA 5JOFB 3ULVL 1AJ7H 2CD0A 2R0ZL 2MNUA 4XCCL 3NN8A 3WDHA 4PG9A 4P2RA 2VDPL 4LGSB 3G5ZA 3MLSH 2EECA 4OF7A 5GGUB 3VXRB 1EHNA 3HC3H 4OTXH 4YHYB 3GIZH 3LOWA 1HXMA 4YBQD 1HH9B 3H9SE 3KYMB 4RNRA 5EZOL 3RKDC 3STZA 3IDGB 4GXUM 4PTTB 3D85A 2XA8L 3QIUC 4CN1A 1JCKA 4YC2C 1T0NA 3CLEL 3KYOB 1BM3H 5CJ8A 3WIIH 1YNLH 2O5YH 1ACYL 2YD2A 3WL9A 3G6AB 1I3GL 4P5MA 4L29B 4U6YA 1CLOL 5C6TH 3BKYL 3O6MH 3TNMA 3N1GC 4ONGL 4XXCC 1CS6A 2H41A 2VLJD 5IG7A 3VI3E 1PFCA 3JZ7A 3VFNB 4CW1B 2I27N 5EB9A 1IC4H 5LGKA 3O8XB 2CUHA 1ZT7B 1FV1B 1S9XB 5EUOA 3L3HA 1VFOA 3B2VH 2HVJB 3X3GL 2Z4QA 3EKCA 5T5NG 4BFIA 4LPCA 4KAQL 5FKAB 4X4XA 4KJPC 4LVEA 4P46C 1OAXL 1P2CB 4TSAH 1KEML 4OCSL 5GS1B 1EJOH 3UTZB 5I1AB 1DUZB 1DUYA 4F57L 5EU6B 3VJ6B 1BOGA 1QFHA 4WFGD 4ERSH 1OTTD 3CSBA 2W9EL 1RK1B 3FFDA 3T2OA 5IVZB 2B8OT 2F53B 4RZCA 4R7NB 4K3EH 2X1XR 4FXLA 3C5ZD 4TYUA 3K46A 3FHAA 3L7FB 1C5BL 3BZFA 1KB5L 1QFOA 2Y5TA 4KVCH 3QWQB 4ETYA 1LEKA 5C8JB 1J0YA 4XX1G 4RDQF 4JO1L 4IHOA 4TNWF 3AREC 3ZYOA 4GQPH 4NN6B 2BMKB 2X4RA 5HYFA 3FRUB 5D72L 3ZKXB 5F1OB 2Q1EA 4YZFF 3MOAL 3BX7C 5LGHL 1FZOB 4KY1L 2GT9B 4IRSD 2A0LC 2P43B 4F37F 5CLWA 4G5ZL 1IE5A 1WCBB 4QHMA 4XPAH 2PYED 3I3DA 3TA3B 5I2IA 3RUGF 1PYWA 4P23C 4JDTL 4CMHB 3JTSA 4GW1A 1BFTA 5EU3B 3ARYA 3HNVL 3ROLB 4HZLB 4ACPA 4Z7WB 1N59A 1FVDB 3DVGB 1QSEB 3ZE0E 3GK8H 4FTVA 5GGVH 4HGWB 4Z7VE 4PP1D 4FABL 3BJ91 2I9TA 3U6RB 1JGUL 4UT9L 3QFJE 3TCLA 1I3RA 3B8YA 2H2PD 3GI9H 1IM9B 1BFOA 2HAZA 5IB5A 1ORQA 5L2KB 2VABB 3SDDA 3U0PB 4GAGL 4NRYA 2B1AL 1KF9B 3NA9L 4I1NB 1FCCA 3IFPB 3O2VL 3MXVL 2HJFA 1BQUA 5C0BB 3EYVA 4FQCH 4CBPA 5HYJB 1JWUA 4DKDC 5HHPA 2DQUH 5DLML 1RUKL 3UPRB 4APQB 4XCFH 2A74A 3DXAD 1HINH 5E2VL 2J7LA 4KQ3L 5D7IA 2WBWB 1KCUH 1VADB 5E2JA 4J7RA 5I1JH 4JFQA 4XVSH 4L8BA 1Q0YH 2FBOJ 3RWJA 4KRPC 4WY7L 5C7XL 4NT6B 2QQLL 2XY2A 5GGRB 4NKIH 4NKQB 3VFTA 2AJUL 4F3FB 1FNEB 1YZZA 3BHBB 4HIEA 1YNKL 1NGZA 4WFED 4ODVL 3CFDA 5L7XL 4JDZA 5IVXA 5DJ2A 1T83A 1WITA 1XGTB 3B5HA 3ARRA 1I7TA 1P84J 2YD9A 1IGML 4EI6B 5CILL 3NIDF 4KK9D 1HDMB 3BZ4B 2AJXH 2OM5A 4UT7H 3ZL4L 1EVUA 3THMH 3H3PL 3QXVA 3S97C 3C08H 5M7QA 3WS3B 5K9JL 4MQXD 2APBA 1BQLL 1SVCP 2GJ6D 1VSCA 4NQDA 1G9MC 2AP2A 3R4DA 4WWKC 4DN3H 2PXYD 2FX9L 1WTGT 4PLJD 8FABB 1F2QA 1QSFE 1A7QL 2B0SH 3EYOA 4MJIA 4NYLA 3HLAB 4BKLA 4OM1H 2H9GA 4KHXL 2R69L 1K3IA 1NC4A 5GRWA 4EUPB 2GSIA 2PYFA 4UNTA 3QA3A 2OZ4H 2HTKC 1YPZB 1MJ7L 3FHQA 1BVZA 3C6LD 3FO0L 4I0PD 5LVEA 4X5LA 4YNYB 4XCEB 3UX9B 1W0WB 2X4PB 4O51A 3WDJA 2XIDA 3MJ8B 4KKBC 4M6AA 4HF5L 2IH1B 1HZHH 1LK3L 2BZDA 2ID5A 3QDGD 2ITDB 3LIZL 1NEZB 5B3NA 1NAMH 5DTFA 2AJYL 5IF0B 4LSUH 4YHZL 4LSTL 5ESAB 4QHNA 3RVUD 4MXVF 1GH7A 4U1LA 3ZT7A 1ZLSL 1QLRB 1L9NA 1CDJA 4PY7B 4CVXA 1JRHI 1KACB 2WWMC 2BCKB 5T1KB 3ALWA 1KCLA 1GVIA 2ZCHL 5D7LB 4YHYC 3MRQB 5B22A 2IQ9H 4LLUB 1D5BB 1OSPH 4U1KA 4LP4A 3SDAA 3X13B 1NGWA 1KLFA 3HZVB 4GMTL 1I75A 1MLBB 1MCRA 4X7CC 4JY4B 3KHOA 3GIVB 3UDWC 4LCUB 5HPOA 2VRAA 3U4BH 4U1JB 3RA7L 3ILQC 5I0ZA 1KN2L 3RL1B 4RMTA 3MRNB 4JR9H 4L3CA 3BWAB 4WCYL 4HXBL 3O8XC 1NCBH 2A9NH 1EPFA 4I9WE 3MODH 4NO0A 3REVA 1J8HE 4OLYL 1T1ZA 3B8SA 2Y06H 4Y1AB 4GLRH 2DQFB 5GS1C 5DI8A 3LS5L 4PJ8B 4JRYA 2ZPKH 1XIWA 1R3JA 2BOBA 3UYRL 3LQZA 4YEEA 1I9IL 3L95B 1LP9B 4WFFE 3FB8B 5DUBA 3SQBA 4JRXB 3RWCA 2F54E 1IAIH 2MPAH 3VFOB 2CGRH 2OQJA 2P5WE 3DSNA 3IU3B 2RCSL 3BKJL 3EDKA 3VGFA 5GS2H 2XWBA 4KPHL 1E28A 2PO6D 1KB5A 1CDHA 4YXKL 1Q1JH 3A67H 3V6FB 4WWID 5FYLE 2NR6C 4NN6C 5JO5B 4DVBA 4PRNB 2DQEH 5HYIA 3G9VA 5I15H 3E6FA 3NH7H 3TBSB 2XY1A 1S7QA 2X05A 1A64A 1GGBL 4JB9L 1N4XL 4XHJD 3OR6A 5IB3A 5J6GA 1J0IA 4HZAA 2XOTA 4L3EE 4OZFH 1RZJH 3LB6C 4PY8I 3L3KB 1LNUA 5LG1A 3TA3C 4R26L 3BZEA 1SY6L 4CMHC 5ALBH 2VDKL 2ZP0T 3OJVC 4UMGA 1CDIA 1P7KB 3M1BB 5SX4I 4KK6C 2VDQH 2I24N 1MRDL 3DHMA 3JVGC 1I1AA 1T3FB 4WI8A 3PP4L 4NQCA 3IJSB 3P9MB 1WUNT 3CVHB 5GGVY 1BD2B 4N9GB 5FF6B 2ZOKB 3DO7B 1JV5A 3WDIA 4H20H 1K8DB 2V17H 3OHXA 4XMLL 1OOAA 5EC1B 1J1XL 3CUPA 5E9DA 1NBVH 4E42A 2DAVA 3N0PB 2VLME 4PJFA 4FG6C 2VXQL 3O3EB 4N0YH 2VAAA 4KKAD 5TGBB 5ICYB 3T0BA 4APQC 1YN7A 4CADB 3O6FD 3JV6A 1KXVC 3H7BB 3QULB 1D9KD 5DD5L 1RJZA 2YPLB 3EGSB 1Z5LA 3EJZC 1BZ7B 5IQ7L 1EMTH 1AFVL 2MFNA 4K94L 1RU9H 3DROA 4KDVA 1MF2H 4YR6B 3VRLE 1R6VA 4QNPF 4QHUA 2XN9D 5C3TA 1IGIL 2EE2A 2IANA 4TQEL 1SMAA 3QUYA 5TH2B 3VFGH 3U36B 3V4VL 5MENA 1NBYB 2QQKL 3O2DH 2E8YA 1REIA 2YSSB 4M5ZL 4QWWC 3C6SB 3Q6FA 3EDJA 3MRHA 4BZ2H 4ZPTA 2JIXA 4P99A 5FB8B 3WD5L 4XMKL 1RK0B 2FCBA 3UCRA 5JNYB 4D9QE 3U4EB 1W2KT 4PRPD 3QT2A 2V2WA 4R4FL 3UC0L 4F7TA 2H6PA 4RGOL 1WC7B 4L4TD 4QOKD 3VXRE 5T1LB 2Z92A 3UJJL 5IFHL 2R0WL 4ZFOB 3T08A 4U7MA 1CL7L 4GRWB 2B4CC 4Y16A 4G8GE 3Q0HA 4HIIA 8CGTA 5CGTA 3L3DB 4LIQE 1FG2B 3BUTA 3EFDH 3MLXL 2VL5A 1LK2A 3LRSB 3KR3L 3TPUA 2IMMA 1QBAA 4NM8L 3K4AA 1H3GA 4MVBC 4MAYB 3PWPB 5FCUH 2Z31D 4HSQA 1MRCL 3RRQA 4QRPA 2XZQH 4LLVB 3MV9D 5F1IA 3EO1B 4P5TD 1ZWIB 3FN9A 3RTQB 2R29L 1NGXB 3VE0B 3U1SH 3NCBB 2XTLA 3QEQB 4QRQB 3UTTB 1V05A 2C1PA 4PJHB 1FYHB 5DRNB 1FBIH 3T8XA 1DLFH 4XZUA 5BCAA 3V4UH 3TCXA 1GGIH 5EU6E 4Y19D 5CIPB 1CBVL 4AH2A 3NMEA 2BHZA 3KYNA 4OGYH 4OGXL 5E5MA 3ARDD 5IFJB 5C0JB 4G6JH 5DRXA 4L8CB 1A6VH 1FRGH 4G42A 3LDBB 2NNAA 2VDNH 4LSQH 2XZAL 3S36L 3QPXL 3NIGF 5JIIA 4EXKA 4URTB 1ZHNB 5CBAA 1TJHH 3LKNB 1KLGA 4FRWA 3G08A 4PJGF 1SMOA 5E8DL 3T0EB 2J3SA 3VG0H 3BPNB 5E8NA 3KLHC 4LEXH 1MOEA 3ZDYE 2A6KA 4N1CA 1TCRA 4AL8L 3QRGL 1UFUA 4M7LT 5A3IC 1KPUA 4QYOB 3MLWH 4UU9A 4NUJA 5GJSL 5CP3A 1CLZH 1AKJB 1HQRA 2AXGB 3HE6D 3LS4H 3MCG1 4OD3L 4PJ5B 1JWMA 1KELL 4M7JL 3G5YB 3HC0B 5FOJA 1P4BL 3C8KA 1OCWH 2Y23A 4I5BB 4Z7WE 3V7AG 5AYQA 4P4RB 3ILPB 1QSEE 2V2XB 5KZCB 1YMMD 2ARJA 4F8TA 1VEPA 3RIFK 1KIQB 5JA9A 4HUVB 3MRLA 4CJ0A 2DL9A 3KLAA 4PJ8C 4YJZL 2BHYA 3M07A 5IFAH 3FCTA 5C70A 5H2BB 3STLB 2Y36L 4QRTA 4RFOH 3BMWA 5F89B 4WI7A 3FL7A 2Q76B 2VC2L 3PV6B 2IADA 5CCKL 3TP4A 3N1PC 4N9OB 4PGBB 4ALAL 1NMAL 5HYJE 1NC2A 5JPNB 4YHPA 2ICWJ 4LRIC 1WK0A 2P46B 4OCNC 4MLIA 2D03H 3SCMB 5I76A 4QO1A 1U91B 4OFKA 3S4SB 3SKJL 3QQ3A 2YN5A 3QHZL 1DDHB 4JZOB 2GY7B 3LN9A 5A2JH 4DW2H 3RJDA 3MNWB 1FP5A 5FCSH 4LCYB 3OGCB 2VLLA 1JRHH 1A14L 1T1WA 1ZSDA 3L5XH 1C12A 1MCWW 5ACLA 3A6BL 1INQB 5HHNA 3GSVB 3RUGA 4Z7NE 5TE6L 1MVUB 1WEJH 2BXYA 5KVEL 2F19H 4JY6B 5IOPA 1OWWA 1YEEH 1SQ2N 2P5ED 5L6YH 3OPZH 1OQXA 1VHPA 4NWUL 2WK2A 5IMMB 1XMWA 4MHHI 1BX2A 3HR5A 2F5BH 3EDEA 3L1OH 1EGJA 2YRZA 1DQDH 1E4XL 4PRAB 3V6OE 4EVNB 1KLUB 3PE9A 1I1FA 5LKNA 3TBTA 4Z95H 2J2ZA 3WFBH 5LAXA 3O6LH 3P9WB 3SKOB 3PWUB 3AS3A 3SJVD 2KBGA 5BVPL 3OXSB 2ZUWA 1EX0A 1X6NA 4TUOA 5LGJA 1DBKH 1F4WH 1DFBL 1IGFH 1B0GB 4ODWB 1HHJB 5GRUH 3VXOA 3QNYA 4JVWA 4LQFL 1XR9B 3UTSD 3T1WA 1IGYA 3ESUF 1YPZE 4RGMB 2YD5A 4OV5A 2FBJH 5SWZB 5MERA 1MJJA 2P24B 3ZYJA 1DBBL 1MWAL 4NOFA 1I9RL 1R3LB 2G5RA 4UTBH 5IHBA 4YO0A 4HBQA 4KGLA 3EO0A 3CK0H 1ADQA 2VOTA 5DGQA 3B9KB 4AQ1B 5FKPA 3OKOB 3H9HB 1G0DA 1MI5D 1IL1B 1CD1A 2VWEC 3FQUA 2ZSVA 3GSUA 3BXNB 1XF4B 3FOMB 1JHLL 5I6XB 3QUXA 2D7PA 4BQ9A 2DTMH 3OXRB 4G7VL 2R1WA 4JM2D 2X4SB 4XXDB 5JHLH 5A2LH 4GW4B 2VXUH 1U8OB 4PGDA 5F9OH 3W0WA 4XPFH 2J6EA 3O6KL 3QWRD 3F12A 3GMOA 3MLPA 4G6AD 5KSVA 1RIVL 1ZHBB 4OD2B 1UEMA 5D7JA 2F74A 3ZDXF 3B43A 1YYML 3PGCA 4X6DF 3BMVA 3KPOA 5ICXB 5SX4H 1U8JA 1JYVA 1H3UA 2JCCB 1MCFA 5KSUA 4KKLD 1I8LA 4JHAH 4QCIA 1A4JA 5ADPL 2VZUA 2B5IB 2VXSH 4WEUD 5ISZB 3PWLB 1BBJB 2FEEL 5I8EA 2EEAA 2FDBP 1F5WA 1A6TA 4JHZA 4AZ8A 4YGVA 3IXTA 4Y7MA 2A83A 4KZDH 3KXFB 4MAYC 1P9MC 4ODUB 5ADOL 5AG9A 3MV7A 4LKXA 3RTQC 3BI9X 1UM6H 1F4XH 1AGDB 3MCKB 5TE4H 4HC1L 3KS0J 4R3SB 5CD5D 1Y0LA 1ROWA 2C7UB 3CCHB 3HNTL 4WUKH 4K23H 2GKIA 5FYLH 4A6YA 4FQ1H 5EULV 2FHCA 2ADJB 5SWSB 3CFBB 2LABA 5IMOA 1LP9E 5HYSG 1TETH 4JRXE 5E03A 3K8MA 4JAMA 3DURB 2AEPH 5ESQA 5C0CD 4K7PH 4N90E 3MGTA 3WIFA 3TF7C 3BGMA 1JPFB 1FL3A 1IAKA 2YMXH 1AI1L 1MQ8A 5CZVH 5IB2A 5E00A 4X5XB 1OARH 4PRHA 4OBRA 4EQ2A 1CXKA 3CPLA 3LEXB 1XF3B 3T0EC 5FO7B 5IW1B 12E8H 4F7EA 2NZIA 3BPNC 4L1HA 4NM4L 3RNQB 3MRBB 5FUZH 4NBZB 3KWWB 4MXQD 5JW5B 5IBUB 2AS5M 1QBLH 1TJIH 1UJ3A 3LZFL 4QRUB 1QLFB 3FQXB 2NYYC 4H88H 4M61A 2A73B 5C07B 4I48A 2VLRD 3MO1B 4JFED 3LH2L 3FAXA 4RWYL 5MP6L 1JK8B 3U0WH 3TV3L 1TZHA 2E7MA 3D2UB 4WEBH 3UO1L 1RHHA 3DGCR 3OAUL 3SGKC 1OAZL 3MR9B 15C8L 3LEVH 2I5YH 5BW7A 2L7JA 3BIAX 5JXAL 2FLRT 3HRPA 4OLWH 3S5LB 5C09D 3HNSH 5CBEB 5FV2A 1CE1L 3QPQC 1HNFA 3LY6A 4M7LH 4AIZA 5EZIL 1A1NA 4HWZA 4FQXB 2EIZB 5TF0A 5KBNC 2XQBH 2FATL 3AMKA 4OJFH 5I1EL 5AG8A 5EU5B 3TIEB 2XRAH 3S98A 4F7CB 1HSBB 4UTAL 4NZUH 5DFVC 5B38G 1JZ8A 3SCMC 4K3JL 3MLUH 1QBML 3O4OB 5C08B 3UJTL 1UCBL 1AIFB 5DD0H 4G9FB 4J3SA 3PXHA 2E3VA 4NPYA 5DK3A 1GGYA 2YPLE 5EORH 1PGRB 2H32A 1IZKA 3MJ9A 4GUPA 4F9PA 1S7WB 4I4WA 3BDBA 4JKLA 4PJEF 3QXDB 4EI5A 4ZSOA 4L8SA 3UYPA 1U3HB 1N6UA 5EOTB 1UM5L 1LEIA 4UQ2A 2EO9A 4PV8B 3OBAA 1KUMA 1RVFL 4EN3A 1ND0B 1BVLA 4HWBH 1JZ6A 1FZMA 1INDH 1IC5H 3C60A 43C9A 2VWEE 4XNXH 3MLRH 3JXAA 5FYJL 3GI8H 1RIHH 1O5DT 4LIQH 2AEQL 5T5NF 3FTGA 4XPGH 2IEPA 2AW2A 5GGTL 2I25N 1CXIA 5AAWA 3ARFA 4XRCA 1P5UA 5I71B 2EDOA 2AGJL 2QHRH 2J5LB 5EIIA 3HCVA 4HS3B 1U8KB 2FB4H 2EYRB 1ZTXH 2N4IA 3GKZA 2JB6A 4XP1H 3ME0A 4GRWE 1RZFL 1X5HA 2Q7YB 4KDTC 3B83A 5FK9A 1FC2D 2J12B 5D1ZA 1H8SA 1QUNA 5T1DH 4YQXH 5HBBA 5J7CC 2FD6H 4K71B 3GMMA 4B50A 2HMIC 4G6MH 4F80A 5JOPE 4X6BB 1D5MA 4RGMC 4KGJA 2HLFD 2NW3B 3LV3B 3EJJX 3RX8A 2RHEA 1RUQH 2XKSA 5ERWB 1MWAA 4U3CA 3L7EA 3K0WA 1YQVH 3GSXA 2VKXA 3QEQE 4ZUTA 1WIUA 3MBEA 4RWHA 4PJHE 4XI5C 1U6AL 3B9KC 2ADFL 2DYPA 3GHEL 3NFNB 3UJIL 1A0QL 5F1NB 1M7XA 1UB5B 1AXTH 4V1DE 5JHDA 1AQKH 2FGWL 1Y6NR 4RMWA 3K4ZA 2CLRB 5I6XC 4JFPB 2OR7A 4M5YL 4Z0BH 3ARGB 4DOHB 5BRZA 2W07A 3QIWA 4QXUH 1GZPB 1ZVHA 5IQ9A 1K4DB 4RQQB 1X7QB 3I6LD 4JFDB 1U8IB 3E2HB 3HHRB 2P49B 1AP2B 3QXAA 2OTPA 1A2YA 4N0UB 1QVOB 1T4KB 3ARTA 3KNBB 4XVUC 1J7VR 2DQCL 4G43A 3T0EE 4DZ8A 1RSFA 3WUWA 1QFUH 3VMPA 2B5IC 4PR5A 5IVOA 3FFCA 5JQ6H 3VFMA 4P2QA 5J3HD 4JFXA 5A2IH 5AYUL 5HI4C 5D2NA 2X4OA 4LLQA 3P0VL 2FWOA 2AK4B 1YMHB 5E6ID 5GRVK 1ZT1A 2G75B 3FO9B 4OCMC 4GSDH 4HHAA 3UAJC 2JJTA 3QG7H 5HGBB 1RFDL 4UOW1 3BDYL 3QDMA 4LCIL 3V5DB 2D9CA 1QRND 3MRIA 2IBZY 1Q9WB 4GG8A 5EOCJ 5IEKB 2Y07H 2DQDL 1F8TL 1H5BA 4C56B 4R4NC 3S6CA 4WTZA 1QSFD 1MCSA 3RKDD 5TDPA 4QRRA 4FXGB 5K9QI 2OP4H 1CLCA 4MDIB 3HG1B 3GB7B 3WIHH 1U3JA 1BAFH 1OTSC 1QACA 4X99B 1IKFL 3BIKA 4Y5VB 4X5WA 4MQTB 1NFIB 3UPAA 5FGBC 3MCLL 2V7NB 4CMMB 2B2XH 4FQIL 4LVNB 4Q0XH 3PIQB 4K7PY 1FJ1A 1T89A 1FNAA 2IPTL 3FQTB 4PJGA 3W9EB 2PW2B 1WVZA 3BYTA 2HFTA 2VDLL 2BNRB 5JMRA 2BNQD 4LAQL 5DMGD 5DD6B 4Z5RA 4CU7A 1JPTL 1SJHA 3KJ6L 5F7EL 5DJAA 2E27L 3PQYB 5HI5C 3WLBB 1F02I 1R3HB 1X4XA 3LAFA 3ROOB 1CDUA 4HW6A 1KG0B 3DI2B 3N85L 4LEOB 4YHKL 5EC2A 2YRLA 4WI2A 3Q6GH 1A21A 3WN5A 3NZ8B 2XICA 4HS6A 5T1MA 3IDJB 3DO3A 2X2YA 3BN3B 1IAMA 2JKXA 3WEXB 3ARED 3HC4L 4Y5XB 4AG4L 1TNNA 2B4CH 4R2GB 4OSUL 1J0HA 2GY5A 1ZA3B 1N7MH 1B6DA 4HUUA 4MB5A 3VXSD 4JZJA 2L0DA 2P7TA 3O9WA 2F58L 3MRDA 4X6CB 1YJDC 4R7DB 1OF2A 3S96A 4IOSD 1ZHKB 4LFHG 5I1DB 1HK6A 4FQXC 4EUPH 2NXYB 3GSOA 1HXYB 5DR5L 2VDML 3QI9B 3FONB 4M1GH 3TZVB 2DMBA 1UEYA 3VRIB 4P3WA 5ALCH 1QD0A 3WKNA 3TBYA 4XPTH 4K2UL 3HFML 3O4OC 4GKNA 4ZMAT 4X7SL 1NCDH 1AR2A 1MJUL 2BFVH 4G8EB 2IAMB 2DD8H 1JNNL 5SWZE 4K8RC 1Z3GL 3NGBB 2IALB 1UGNA 3VWJD 1A7OH 4PRDA 5CAYB 1U3HC 1UKTA 3LEYH 4NRXB 4HKBA 5CJQH 1UZ8B 2BJML 1JZ4A 4OLZH 3OL2A 4XWOD 1F97A 5EO1B 5E2UH 4GXUN 5LWYL 4XP9L 3MUJA 1N6QH 5EOCL 1RZGB 1W72B 3MUY1 2X4NB 3U0TA 3N06B 1JN6B 2X1QA 1YEFL 1WQVT 1JJUA 4FFYL 4N8VA 3HPJB 5BXFB 3QB7C 4NGHH 3BD4A 1P4LB 4KMQA 1QSVA 1UC6A 4NZRL 5I71C 5TF1L 4DKFL 2J5LC 3V0VA 4CAGA 4P59L 1FZJA 3ZKMC 5I30H 2CK2A 1T0NB 5GQBA 3VMNA 3X3FL 1W8NA 1FYTA 1SEBA 2JCCE 1NCNA 4H1LA 1UM4L 5F3BA 4M6NL 4DGYH 5F7HA 3ISWA 5ISZE 1KIPB 3BKCL 2CR6A 3HI6H 1K8IA 1J1OL 4X4YB 3UBXG 2ATPB 1K5NB 4K71C 1U95B 4D8PB 4M1CC 4NBXB 4Y4HA 2IWGA 3KXFE 1I8KA 3B5GA 3NPSB 4P4KB 2VXVH 2Q8BL 1DVFD 2CKBA 5GRYA 4L9LA 2Q3ZA 2NY5H 4JQIL 4YK4B 4YHNA 3BQUB 1K3ZA 5C0NC 4LARH 4HG4J 4XBEH 1S7VB 4XVJH 4MHHG 1XGUB 4G3YH 4PJBB 4E41D 2R23A 1A4KA 4UILL 3T2NH 2J88L 2CO7B 5CEXA 5FUOL 5B39G 3P77A 3MRMA 1LD9B 3AB0C 1XF5B 4UDUB 1FZKB 1RUAL 3ARGC 3INUL 4FQPA 3PJSA 1EBPA 1OGAD 4PGZA 3SDCD 3KDMA 3E2HC 1D3CA 4X6DA 1J0JA 3FAWA 3H42L 3RVVD 1JBJA 5I1KH 1FO0B 1B90A 3O3AA 4PJXE 4OM0H 2IFFL 2ZUYA 4IOFD 4QHMB 3I02A 3T77B 1OHQA 1MCQA 3P73A 5ID0A 4IBLT 5F3HA 1MQKL 1HYRC 1YEGL 3FB5A 3CVHH 4PJ9A 1BLNB 2L4OA 3OF6A 1VEMA 3ZHKA 1P6FA 1YNTB 3A0OA 5C07E 2ORBH 2OR8A 4YIQA 1KPVB 1MLCA 4TSBL 2NY7H 2LTQB 3H3KA 5IP4A 3QZWB 5DVLA 4NC0B 1T22B 2GK2A 4XNQA 3MA9L 5FO8A 1C5CH 5ITFB 4FXKA 4M43L 2OR9L 3IDNB 3D9AH 5HYQB 3Q5OA 3GFUA 4S1QH 3NFSH 3RWHB 1C08A 3IJYA 1NH6A 2UWEB 4OLXL 4NO2A 4Y5VC 3KPPA 3HI1B 2NTFA 1EEYB 1U92A 2GFBA 1AGBA 2ZSWA 5DO2D 4KU1A 5MHSD 3KPLA 3P0YH 5IR1B 3D39A 4LVNC 2WUBL 4RMSA 2NY6D 3AAZB 4LSPH 5GGRY 3F65A 1IEBA 4BH8A 4UQ3B 4R8WL 4R96A 5C08E 4PJ7B 2B20A 4G9FE 2ATKA 3SE3C 2YK1H 1KCVL 3VFTB 4F7MA 3W2DH 1A6UH 3GSQA 2UZYB 3NFPA 1WT5C 1CCZA 1AJ7L 1X5KA 4TUKH 4UB0L 3DOSA 1RMFH 4J4PD 2F53D 4HJGA 3ARPA 3DVNB 1XF2B 4D0CA 4JFFD 2H2SD 5HD8C 4JKPL 4LCWB 2EKSB 2PKDA 4OT1L 4L1DA 4P57A 4GAJH 4AEFA 1B4JL 1NEZG 2NR6D 4Y5XC 1CD0A 1A1MA 1F3JA 3CD4A 3MGOA 3UTQA 4GRWH 1MHHA 1HIML 4R2GC 1OAKL 1NMBH 3LKRB 1YNLL 1XGQB 2XWJA 4RAUB 1ZHLA 4E0RB 5C6TL 3P4LA 1S7SB 2VO5A 5HVFB 2DQTL 3LRGA 1F13A 2NXYC 2P44B 3DPBA 3EYOB 3LB6D 4MJIB 4NYLB 3VXMD 3QI9C 4FQ2L 4MA8L 3TZVC 3KGRA 4D2NA 4XAWL 2VLJB 3L3GB 4NNXB 1ZLVK 2YBRA 2OL3L 5FM5O 3RJQB 3W11C 5IGXH 4MA7L 4KTDL 2GSIB 2ZCKL 1QO3A 4DGVH 1A7NH 2HT2D 1NAKL 5EA0H 3MXWH 4WI5A 5FM4A 1ZLWH 4JG1H 1R0AH 3I2CL 4NRZB 3HZYB 3O81A 2IAMC 5IWLC 1ODAA 5L2KD 4O51B 4UUJB 3WKML 4PJEA 3NGBC 3MMEB 3VXQA 2OSLA 3LQAC 4LL9A 5DTFB 4EDXB 1J1PL 5LQBL 5C0BD 1NPUA 5J0BA 5CHNB 3ULUC 3C5ZB 3W5NA 3KPNB 1QA9A 4HJJH 4P5KA 1T66C 4APQD 3IDIB 2OK0H 2VH5L 3OG6B 1KENL 5F70A 4HUWB 1SBBA 4M8QA 5GRXG 1S9WA 2X4TA 5IBTL 4OZHF 4YDVB 3GRWL 5B4MD 1E4WH 3EJZD 3MRPB 3D48R 1YY8A 4OCXH 3C8HA 4DOHE 3BIBX 3S35H 3V95A 4OF8A 5F96L 4IMKA 5HVHB 4IRSB 4MCYB 3IAGC 1PW3A 1HQ4A 3KPRA 5D1QA 3HUJF 1IM3A 4JFDE 2HVKA 5I19H 4ZTPH 1T20B 5CUSH 4Y2DD 3S37H 3C6LA 4NO3A 3EOAA 3HMXH 4J1UA 4N0UE 4B53A 3FOLB 2I60H 2HT4C 5DT1H 1KNOB 2VE6B 3WSQL 3LKQB 2EH7H 5DC9B 5TDOA 3EDDA 1MCPH 4JPWL 3S37X 5DUMH 1V3KA 2WQRA 1OAUH 4ISVB 4WEMB 4TVPL 3WXWL 4CVZA 2AK4E 4OZIF 4Q9QH 2PR4H 2FJGA 2XFXA 3I85A 1PD6A 3TWCL 3G04A 2ZNXA 3NPSC 4YPGB 5F9WB 4P4KC 3TFKD 4YK4C 4TSCL 3GBLA 1XR8B 2ICEA 1LWRA 2G60H 5EZJA 3BQUC 2GTZB 1FIGL 4G80B 5BZWA 4C56E 5I1IH 3TLRA 2Q87A 1KIUA 4DKEH 2DQHL 1A9EB 3GJFA 4MDJA 4YEFA 3KPQB 3DXAB 1R5VA 3BEWA 5I1JL 1F4YH 3HG1E 4X4MA 5DVOA 1T03H 2CLVB 4ZOEA 4PGCA 4RGNB 4UOJA 1KB5B 4PGEA 1CFTA 4M7ZB 1JF1A 2C9AA 2HG5B 3KPSD 3HMWH 2IH3A 4N8CH 1LDPL 2O5ZH 5IHZB 4BQCA 1KOAA 2LE9A 4PLOB 3CFEA 1N8ZA 4LSVH 4XNMB 5DD3L 4ZUWA 1RJYB 5KANI 1RZKC 3VI4E 4KTYA 5INDA 3BZDA 2EDHA 2BNRE 1DE4A 2R4RL 3GBNH 3MLZL 2Q7NA 3I9GH 4AM0A 4LSRH 4TOYH 1BQHB 3B9VA 5GISH 1OM3H 1PLGH 4UT7L 4HGKC 2X1WL 4O5LH 3QUKB 3PQYE 3CU7A 2ED9A 1YEHH 5J1TC 2WIIA 3CX2A 5E99H 1MHCA 1U8LA 3D6GA 1J05A 4DN3L 3MROA 1UWXK 3C87A 3D3VE 1K9TA 4OUUB 4FP8L 5EBLB 4CGTA 1U8MB 4HKZA 4UINL 1C1EL 5D7LD 5J9PA 2X40A 2GJ6B 1T5WB 2B0SL 3VI3F 1Q0XH 2R1XB 3RY6C 5I16A 4XTRD 2PXYB 4FFZH 5IW3A 3TBWB 2LTQC 4P3DA 2W0LA 2A9ML 5AAMA 2EYTB 1LE5A 1QOKA 4LKCB 2V2TA 2OZ4L 4X6CE 2VLKD 4X7DC 1R3IL 2FO4B 4O2FB 4KQ4H 1VFBA 2ZNWA 5J12C 2WWKT 3VFRB 1R3KB 5F88A 1CFSB 4X7TB 4JFYB 2GEEA 6CGTA 4XP6H 3U7AA 1U2HA 5BJTB 1RURL 2HN7A 3V5HA 4YHLH 3IKCA 4I0PB 3L5WA 1HI6B 3SE8H 5J6HA 4XP4H 3ZTNL 1NAML 2AEIT 2W0PA 1T5XA 1BMGA 3DVFA 3P9LA 2DI9A 5CJXC 4AYFA 1IGCL 4HS8L 4QHUB 4Y1AD 3K74B 3QDGB 3LKOB 5B8CB 4U1SB 3RDTA 3DX9A 4PJ8D 3RHWF 1I1YB 3EZJB 4HIJA 3I3EA 3I84A 3IJHA 2PN5A 1T83C 4NKOA 4TULL 2WBJD 1S9VA 2VZSA 3ULUE 1FH5H 2ITCB 4WHDA 4ZUVB 2VXTH 3MBXL 4HFWA 3QQ4B 5F97E 4NJ9H 3NCYS 5K93A 1G7QA 1HSAA 4YBQC 4D0BB 4NNPL 1TCMA 3ZE0F 5JORB 4JFHE 2BVUA 4Z7VF 5IEHA 3V6ZB 5DA0B 4J3OC 1SEQH 1E4KA 5IKCA 2HFEB 3BH8B 2NCMA 1MRFL 3PWJB 4K07A 1CF8H 5SX5H 1D5IL 1ES0B 3DECA 2CIIB 4C54A 3HPLA 5L0QB 3BVNA 1KJVB 1RJLA 3OKMB 3MX0A 4HDIA 5E7BA 5K59E 2Y06L 2UYLB 1A5FH 2ZG2A 4C55A 5C0AD 3MUGB 2E7LA 3BP7A 3DTXA 2ZPKL 4U1NA 3MNVA 2NLJB 4WDIB 1MY5A 1BD2D 4NQED 3VFVA 2W0FA 1GPOL 1NMCB 1FE8L 3I3BA 1I3VA 3V9FA 5KSAA 4TTDD 2MPAL 1A3LH 4BFBD 3TYGL 3U9UB 1RUML 4GQ9H 1HHKB 3QJFA 4X4ZA 1NCUA 2VDOH 1CE6A 3A67L 5KVFH 2YXMA 2EDDA 2DQEL 4M3JA 3G6JB 4MCZB 4PJBE 3GMPA 1CG9A 2HT3D 3ULVC 5HGAA 2D4FA 2IQAB 4EIZC 2YC1B 5DJCB 1TITA 3VU2A 3RI5F 3VXNB 2XNAA 3PL6A 2VQ1B 1RZJL 4JPKH 5HPMA 1R24A 1ETZA 2MQ3A 4M4PA 4ZXBA 5HVHC 3MLTB 1JFQH 3TO4A 3BDXA 1BJ8A 3CXHJ 4P2YA 1F4AA 4KMTL 5AUMA 5T3ZE 4XNYL 5ALBL 2JJSC 3NCYP 1JNLH 3OQ3B 3CMOH 3LKPA 3FT3B 4D9RD 5DS8A 3ZTJG 2R2BA 2FJFA 3S4SG 1T0MA 1IFHH 3WFZA 1X5AA 1MEXH 1GYAA 1QFWI 3KLSA 3OKKB 3VRJA 2V17L 5D7SL 3EYSL 4PP1C 2KQNA 3EYFB 5KOVC 3CDCA 3DARA 5E5RB 1EAJA 4QT5B 1WLHA 5J13B 1YJDH 4ONFH 4PRID 3TVMD 3WFEH 3U2SB 3QFDA 3DX7A 5F9WC 3TNNB 2BVQA 5T1LD 5E8PB 2G5BA 3RL2A 1HKLH 5DJ8A 4HBCL 1AGCA 4RAVB 5DQJA 3RIAF 4IRJA 2YD1A 5C0GA 1TJGH 2NX5A 1U3ZA 4HLZG 3T4YA 3PHSA 2HJLB 4AMKH 2AABH 1GOHA 1HH6B 2EYSB 5KTEL 3OJDB 4OKDA 5ILTH 3G6DL 3O6FB 3CH8A 3QBTB 4BSWA 1RU9L 3GZKA 3GJEA 4PG2A 3RPIB 5EO0A 2FZ3A 2P8MA 1D9KB 4FQLH 3BO8A 4RGNC 3DV4B 4IDLA 1OP5H 2UWEE 4M7ZC 5CEZL 1UB6B 3PWPD 1CZ8H 2EDJA 1PQZB 1WF5A 3JWNC 4U1HB 4Q74A 3BP6B 2JELL 3OZ9H 5DC4B 2XN9B 2E9BA 4QF1A 3VH8B 2HFFB 3H9ZA 1N5YL 3DJ9A 2YA1A 3QEQD 3UTTD 4BZ2L 4PJ7E 1ZSDB 3VXUD 2EIEA 3MRCB 4X80H 1LO4H 3ARBA 4H0IA 4N5UA 5HHNB 1NCWL 4JO2H 2ESVA 4UI2A 5F44A 1MAMH 2G9HB 1IKNA 5KW9H 5C92A 2D31B 1B9ZA 2YUWA 4KK9C 3QDJB 2EDEA 2WV3A 5KSBB 4UIMA 2BSSB 4LCWE 4PRPB 4NOBA 2XQYK 4L4TB 4MQXC 1OLLA 4QOKB 4YFDB 2H3NA 4G8IB 1H15B 4POUB 2XTJB 3HR5B 2PXYC 1IBGL 2A6IA 2I9LA 5I66A 4N0RA 3T0ED 1CXEA 3IDMA 1IT9L 3FT2B 4GW5B 2W65A 3NCJL 2FR4A 3EIFA 5IV2B 3CSYA 4QXTA 4YAQA 4OF5A 1OPGL 2QKIA 4HPOL 4HWEH 2GK0A 3MNZA 2OZ4A 2Y7QB 3DNKA 3QCUH 2XZQL 4TUOB 5GJTL 1CFVH 2ADIA 4GAYB 2BY2A 2NYYD 4MNQA 4PJ5D 4MAUL 5BO1H 2VLJE 4XH2B 2Z31B 3U1SL 4O2EB 4I0PC 4RDQG 1IZJA 1IGTB 1U42A 3MV9B 3N9GL 1FBIL 3VCLB 4P5TB 5HDBE 2IG2H 2SEBA 3MYJB 2DQGL 1MFEL 5KZCD 5MERB 1ONQB 4DGIH 2EE6A 1NAMA 2APXA 3V4UL 5CEZD 1G7PA 1GGIL 1PSKL 1U2CA 5B8CC 4GBXA 1XH3B 4MD5A 3EO9H 2P5EA 3C9NB 5EPMB 5JPMA 4Q58C 4RAHA 3RVUC 1OVZA 1A6AA 4RISL 1YDPA 1YN6A 7CGTA 4G6JL 4Y19B 2CDGB 1A6VL 2YA2A 3CXDL 2FEDD 1FFPB 2VUYA 3ARDB 1OP3K 4ETQB 1T21B 2HFGH 4RX4D 5D6DA 5LCVH 5ICZB 1TVHA 5DFVD 1U58A 2WUCL 3WO4C 1KTDA 2OCFD 1T04B 4N1HB 3WNMA 3AGVA 2ERJB 2Z91B 5D7JB 4HUXA 3HB3C 2Y6SD 4XGZB 3T65B 3NCMA 4C83B 1Q9KA 5FDWA 1U8JB 5DJZA 1CDCA 5DWUH 3LS4L 1QQDA 2NTSP 3CZFA 4WU7A 4XPHL 5L0QC 3VMOA 1WBYA 2PYEE 1KTRL 4OCWH 4YHML 3HE6B 3VFUA 1EHAA 1NDGA 4ZOBA 2EE9A 3RAJH 4DTGL 5GSVA 3NTCH 5JR1H 3BUYA 1YMMB 5JZ7C 3C2AH 5D6CB 4OD1H 3GMQA 1DN0A 4Z76A 1ZVYA 3BRFA 4PY8J 1QPXA 1NMCC 5D9SA 4HKJB 3ZE1E 4EDWL 2RIKA 2X6MA 3C5SA 2MHAB 1ZVSA 1HWHB 2AV1A 1KC5L 5JDSB 5HHMD 3ZKSD 4JQXA 3BH9B 3VRLF 4NO5A 4FOMA 3IS0X 1JZ2A 1INEL 1JPSH 4MXWH 1I7ZB 1VPOL 2YPVH 3FB7A 5IMOB 4OCLC 2P4AB 1AD0A 3DXAE 3LVEA 3S5LG 1H0DB 4ZDHB 4HWUA 2DLTA 2DM7A 2EDKA 3QCVL 1KN4L 3DV6A 2GUOB 4RGNE 5DQDL 3O2WH 2HMID 1IGJB 2VISA 4G9DB 4XHJC 1S5HB 2VNCA 2R2EA 3BE1L 1BVKA 1LMKA 1KJMB 4OZFA 3MV11 5I1LA 4N1EA 3HUJA 1T7WA 4ZAKA 3OKEB 1ITCA 3J7HA 5LXGL 2NY2B 2QTEA 3LHPH 4FS0A 1R5WB 5FECB 5L6YL 3HRZB 4PB0L 3B9KD 1FGVH 4F58H 4PTUA 5DRZB 4WFEE 3DSFL 1FLRL 2NY3D 2W1NA 4WHTB 5J4MA 5ESVB 3CFCH 5E2WL 1UXWA 4WNQB 2BRQA 3CX5J 2EXWC 3GNMH 3F7YB 4OZIA 5CWSA 6FABH 1YEDA 1CICA 5J13C 3QUZA 2Z35B 4LHUB 4Z95L 1N5AB 3FT4B 3KYKH 1VFUA 1EUUA 4HAGA 4JPIA 3Q3GA 4GOSA 3ALPA 4Z9KB 4RFEB 2GJ6E 3OAYH 3MRKA 1SBSH 1NCCL 5F7MC 1M7IB 2DL2A 1H3PL 2R4SH 3OB0H 3QP3A 4FHBD 3LN4B 4X8JB 1OAQH 3SJVB 2M8XA 2IPKB 3O41A 1Q94A 2P8PB 2UZIL 3EAKA 5FO9B 3O6FC 1D6EA 1XGPA 4WUUA 1KBGH 4JJ5A 1D9KC 4NQUA 3ARZA 4D3CL 3UTSB 1QLEH 5EUKA 2QQNH 1L7TL 5AZEL 1S8DA 3LQAH 1FVCB 3PWNA 3O2DA 5IHUL 5HHOB 3ULUH 1A7RL 3DMMD 4R4ND 4ZOAA 1OW0C 2NXZB 3I6KA 4TVSa 2O5XL 3QEGL 2DJUA 1LEGB 5E8EB 4AEIH 3QDGE 5GS0L 1V7ML 4UQ2B 3H9SA 4K7FB 1MI5B 1W72H 4OQ1A 5JHLL 2CIKB 1U93B 5SWSD 5FHAH 1CT8A 1KYOK 3AS2A 5IB4A 3CU1A 5FGRA 1BHGA 2XKUA 4I3RL 3ZDYF 1MREL 4ZTOH 4JM2B 3S8WA 3RWFB 5CD3A 5BZDB 3WS6C 1UVQB 4KI5D 2OJEB 4MJ6B 3H2WA 1Z6JT 2QHLA 1H9VA 3D0LA 2H8PA 3OR7B 3OAZK 2XTJC 1P53A 1QFWH 3GGWA 4NNYB 2FNBA 3E3QE 4Z7WF 3NZHL 4OZGB 4Y4FA 5EIIB 3HCVB 4JY5H 3RWDB 1KT2A 1XCTB 4NHUA 5FOBB 3GO1H 3MREB 5HI5D 3C2SA 5AWNL 1AHWA 4O2CA 3D0VB 5KANG 2QSQA 3K8KA 4BFEA 4I77H 1CU4L 4MX7A 4NZTL 5C07D 2Z31C 3D2UD 3SDYL 3BPLB 1PEWA 2ZJSL 1ZA6A 4P5TC 1ZV5A 5CKAA 5CP7A 1DBML 3DBXA 1GAFL 2V5RA 4TRPH 3CDGA 4OF6A 5DSCB 5GGSY 4EIGB 4K94C 1N0LA 1CXLA 1Z0NA 3PWVA 4XBPA 5FYKD 1O0VA 3PHOB 5IK3B 1ZS8A 1TTUA 2W9DH 4GRMB 1GSMA 5F9JA 1MWAB 2EDRA 4PV9B 3PP3H 1JP5A 4JM4L 1ZANH 2A6JB 3GSXB 5C0EB 4FQXD 3T3ME 3O3DA 1Q9OA 5D1XA 4O4YL 3LD8B 2HA1A 1RAMA 1Y6MR 5C0CB 5GGQL 1DQTA 3WFDH 3G6JE 5T3ZH 1HHGA 5DHXB 4Z7NF 3QIWB 1TVBA 1RZKH 5C08D 4OKVA 3BAEH 3P4OA 2Q8AL 3DLQR 1MPAL 4O02L 2D7QA 1J9CT 1KJ3L 2ERJC 1QBLL 1FO0H 5D7JC 4Z7VA 3H0TA 1S5IH 4UV7H 4AJ0A 5EFIA 4ODSH 1UWEH 4K8RD 2YEZB 3QFJA 5CINH 1EXUA 4H88L 4JZNB 1QKZL 1U3HD 2ICWB 5FGCB 4DZBA 4CU6A 1D6VL 1OTUC 1VEOA 1GZQB 4XC1L 1HNGA 2VZ3A 4X9IA 5HGDA 1QHPA 1PEZA 1X6LA 4NUGL 3LEVL 3HE6C 5D8JL 5EBWA 3DX6A 2WLYA 1A47A 1LO5A 1EFXB 1NL0L 4YXHH 2BVOA 4XC3L 5EG6C 4OLWL 3FQNA 4BH7B 1F58L 5FHBH 1QYGH 2D7NA 1EV2E 3SQOL 4AT6B 1NGPH 3QUMH 4LPTA 4OCRH 5KG9B 4PB9H 4GG8B 1N2RB 3ET9F 3GSWA 5C09B 3AY4A 5E6ZA 4GG6E 1H5BB 3BEVA 3TIDA 2CDEA 4Y5YB 1SJEA 1YPZF 1A9BA 4J8RB 4PRBB 3RFZC 1MUJA 1A6ZA 3S88L 3PDOB 1I1RA 3MLUL 3AVEA 1QEWB 3MFFA 5L8LB 2CLZB 4D9LH 4LCCA 1WBZB 1JL8A 4PJAB 4OCYL 1CI5A 2QR0A 1YUHA 3AROA 4ZS7H 1JF6A 4HIXL 4L5FH 1MFBH 2JTDA 5ABDE 1U3YA 4M48H 5A2FA 1G7MA 3LPFA 2EDFA 5ACMA 2XN9E 5KN5A 1JTPA 3W39A 5C0ND 1RZ8A 4JHWL 4HJ0C 1MCOL 1SJHB 2NY2C 1OP9A 1V7NH 1UH3A 4ZFZA 4ZUUA 3M8OH 5DJ6B 3WUWG 5ID1A 2CRMA 2HRPL 25C8H 3OKYA 1C7SA 4MLSA 1D7FA 2A77L 3RWEB 5JLZA 1QSFA 5B38A 4DN4L 4QY8A 3CLFH 1PAMA 4M8VA 1DQJB 4FQQB 3ARGD 3QIUA 5C71A 3QDJE 1WIOA 2C3VB 1NSNH 2ZOLB 4YE4H 5KSBE 2BY0A 4MJ5A 4R90H 4PRPE 3WHXB 4XP1L 4JFDD 2DBLL 1PZ5A 2A6DA 2H1PH 2WM0A 4XXCA 4DCQA 4L4TE 4MSWB 2BDNL 4QOKE 1P84K 4P3CH 4N5ED 3V6BR 4WTZG 1I7RB 1NJ9B 1JGEB 1P1ZB 2BK8A 4LK4A 1DQLH 4Z0XA 1U36A 1XZ0B 4YQXL 2AK1L 4ZYKA 5KJRH 4X6EA 3R06A 1RD6A 4G6ML 4ORGA 4IOIA 1FFOB 4RIRB 1N64H 4P46A 4PGJA 5ITBL 4NWTH 4Y8AA 1CXFA 4LLWB 1LP9F 5D2LB 3WO3B 3CVIH 3SKNB 2XPGA 5C9JB 4JFOA 3MV9E 4NSKB 4F37K 2W60A 1W0VA 2BY1A 2VSCA 3LSOB 4YDKH 3BW9A 2NXZC 1AXTL 1BGXL 1KXTB 2APFA 4MQ7B 4LFHD 1S7RB 1HOCB 3HG1D 4PS4L 2ADGA 2R0ZH 3H6JA 1CDGA 5D4QA 3PHQA 4XCCH 5I73B 3O3UN 4Y19E 2VDPH 1HILA 2OXHA 4PREA 3DUSB 5DJDA 4JM2C 5E2TL 4JFZL 5GXBB 2W0KA 2H45A 1P5VA 2GAZA 4S10A 3V5KA 4G6AC 1IRAY 3REWA 2JJWA 5EZOH 4P23A 5JUEL 3HZMB 3DX8A 1V8HA 4WRLA 5IMKB 1ZGLA 5H35A 4Q2ZA 3FN0L 4LNRA 35C8L 1AH1A 2BNRD 5KVGH 2JE8A 3CLEH 3V0VB 4WO4A 2HJKA 1FZJB 1ACYH 2V7HA 1QP1A 1SYVA 1I3GH 2ENYA 1WBXB 1CLOH 2BC4B 3PQYD 4ONGH 2VN4A 1HHHA 1JZ7A 3QG7L 3R8BB 4HPYL 4Y4KA 5E6IB 5HGHB 3RZWA 3A6OA 3T0VA 5HD8D 3MV8D 3QISA 1M6OA 4XMPH 1GGCL 1WAAE 1ZKAA 2F54A 1EH9A 4U4BA 3X3GH 3BPLC 1T1XA 4KAQH 1QRNB 1MHPL 2P5WA 4JANB 3IFOA 1OAXH 1KEMH 1BIHA 4OCSH 3IVKA 1U8NB 4R2GD 3VDBA 1GCFA 1YMME 2GCYA 4KTEL 4F57H 1MIMH 3T2PA 4LLYA 5CD5C 4YHNB 2W9EH 5HVGB 1FNSH 4GKZA 2AI0L 4H5SB 1KPRB 3MBEC 4FQHB 5H37H 2B2XL 3QI9D 3JUZA 3RX7A 5B3JE 1BF2A 1A4KB 4L3EA 3LD8C 2GITB 1KEGL 3P77B 3P0GB 4JO1H 3ZO0A 2LFGA 3RWIB 5D72H 1AD9A 1VCAA 3QIWC 2ZG1A 4L4VD 3VGGA 3ECBA 1TZIA 3MOAH 3L3IA 4MD4B 2FL5B 4U05A 4CKVX 3V4PH 5LGHH 1EDQA 3QCTH 4KY1H 4BZ1L 5DHYA 1QSZA 1MSPA 2BNQB 4G5ZH 5T5FL 4IS6A 3CSGA 2COQA 3CFKB 4L8DB 3X12A 5J06A 1M4KA 3JWOL 5HJ3A 4S1RL 4JDTH 1TDQA 3ULUD 3HNVH 3VGHA 1L7IH 2WAHA 4GFTB 4EJ1C 4WWKA 5D71L 3U46B 2LU4A 1C8PA 4PJ9B 1JGUH 3HKFA 4UT9H 4P2RD 1PKQB 4GRWF 5GRJH 2M2DA 4GAGH 5IW6A 3NA9H 3T1FB 4NQTA 3VXSB 3N1MC 1F3DH 4XCYA 3O2VH 1NFDB 1I85C 1H5BC 2GQHA 2WLZA 3MXVH 3QNZB 4ZD3L 5DYOA 3P11L 5TE7L 5ALCL 4MMZC 4Y5YC 3K2UH 3MRRB 5HY9A 3D85D 3M17B 5DJ0B 1RUKH 1TMCB 3X14B 4QHKJ 2XV6B 4XPTL 3SE4C 2ZWLT 5E2VH 2DMCA 4KQ3H 5J1SC 3SJVE 7FABL 2BFVL 5C2BL 2HYMA 4PJHF 3KPMB 2R2HB 3KPLB 3D39B 4O00A 5C7XH 2QQLH 2C3WA 3RY4A 1FL6B 1T89C 2AJUH 3UTSE 4BH8B 4H26A 5TQ0L 1T6VN 4P4KD 3VWJB 4GRLB 1TENA 1DBJL 4I3SH 1YNKH 4KWUA 1UKQA 4HWBA 4ODVH 5HHOE 1QTYT 3QDHA 4PJFF 3QWOB 5GGUA 4KC3B 3VXRA 4S2SB 1X5GA 3CH1B 4GH7B 1LO3H 1NLDH 2W59A 3P4MA 2CUIA 1VKXB 1HH9A 1IGMH 3MLYL 4G8GA 1MI5E 3KYMA 4NGHL 3ZL4H 2BOCB 3NABL 1BEYL 3H3PH 4PTTA 1I8MB 3UDWA 5LBSH 5K9JH 1BQLH 3N50A 2OTWA 3G6AA 3WXVH 1T7VA 4L29A 2R56L 1G6RH 2FX9H 4HH8A 3JTTB 4LLDB 1F6AB 2X9YA 3VFNA 4CW1A 2UVEA 4EOWL 3O8XA 1S7UB 1ZT7A 3HI6L 5IUSA 1FV1A 4OZGE 1S9XA 3TPKA 4KHXH 3DYMA 1OT2A 2R69H 3ZKQD 2HVJA 2JB5L 4KUCD 4BJLA 2IJ0C 2QSCL 5FKAA 3O45B 5BMFL 1A8JH 1OWRM 1MJ7H 1P2CA 4UNVA 3UTZA 5I1AA 1A6PA 1DUZA 3FO0H 1QO3B 3RGVB 5EU6A 3VJ6A 5I8KH 2NY5L 5DEGB 1RK1A 2HLFC 3G5XA 5IVZA 3LN5B 4R7NA 2DQIL 4HF5H 4XBEL 1DVFB 5EZLB 1CYGA 1XGRB 3D5OF 2Z8VC 2CH8A 5EWIL 3LIZH 3L7FA 2AJYH 3PGFL 2PTTA 4YHZH 1MCDA 2PW1A 3GMRB 3T2NL 5C8JA 3U7YH 3CAFA 2BMKA 3FRUA 1ZLSH 1CGTA 1MFDH 3ZHDA 4E41B 5D70L 1RZIB 5I73C 3HS0B 1OQOA 3MRJB 5SWQB 1FZOA 1CN4A 2CK0L 2ZCHH 2UV3A 1CGYA 3BKML 4FFVC 5C0CE 3VA2C 2PETA 1OGAB 3SDCB 4JCMA 1WCBA 3IRPX 4DK3A 4P2CG 4K3HA 5I1KL 3TA3A 4TTGA 1FGNL 3MA7B 1Q8MA 3UTOA 4LASL 5EU3A 1I8IB 1OGTB 1T2XA 4P2OB 3SGDI 3ROLA 4HZLA 4Z7WA 5A1AA 4NFCA 1JGVL 3FQRB 1FVDA 3DVGA 1QSEA 2HVKB 3JVGA 5H37G 2X7LB 4HGWA 5C6PB 2VKWA 2AXFB 4AK1A 1NBZB 3PGDB 2EDYA 3NIFE 3LQMA 1IM9A 1E4XI 2B1HH 5IB1A 2VABA 5FGCE 3U0PA 5E6IC 5EBGA 1WJ3A 4WCYH 4LVOB 3IFPA 1Z2KA 4LCWD 3RPKA 4F15B 3FQWB 4JKMA 4NDMB 4OLYH 2VLRE 4JFEE 4CVZB 5HYJA 2FJGB 4LSSL 3UPRA 1X4YA 4APQA 3GSNB 3X17A 3I6GB 3UYRH 4NQDD 4IM8A 4OLEA 1I9IH 3KYAA 2DWEB 3WIHA 5C09E 3ZT6A 5I18L 5KS9B 1VADA 1CR9H 2DLGA 3O4LB 1AO7B 1WFUA 4POZC 4MJID 4F7PB 5IM7B 5E1AB 2KUTA 2RCSH 3BKJH 5FEBA 3VD4A 4NT6A 4XP5H 4KPHH 5GGRA 4LSPL 4ODBD 4F3FA 1NC4D 2P45B 3F8UB 1FNEA 1UG9A 3BHBA 1CFTB 4WW1B 3W2DL 3PABB 2NY6B 2DKUA 1GGBH 4JB9H 1N4XH 1UYWL 4PJAE 3RZCB 1AY1L 3IFNL 2ZUVA 1B0RB 1XGTA 5H94B 3CFEB 1N8ZB 2YHGA 3DRQB 1VFAB 2DLFH 5AD0B 5DMGC 3E8UL 4EI6A 4X6FB 1HDMA 1BQSA 2K3TA 3BZ4A 3U48A 4R26H 1SY6H 1MH5B 5J56B 2VDKH 4HK3N 3V6OA 4JFFB 3WS3A 4AIOA 2ICWI 4EKXA 4FFWD 1WZLA 1MRDH 2J8UB 4P9HL 2X4QB 3PP4H 5DQ9B 4PJ9C 3ULVD 3HE7B 4WV1A 2LU7A 5INCB 2JCCF 1RZ7L 2FEEI 1X9QA 4UAOB 1G0YR 2CDFB 1EFQA 3DETD 4U1IA 3HLAA 1NUNB 1J1XH 3NCEB 4JHBA 1NEUA 4EUPA 4ZO6A 3SDAD 1T6WA 2H26B 1YPZA 2VXQH 1X4ZA 1UH2A 3VXMB 5EBMB 1RUPL 4YNYA 4XCEA 1W0WA 2X4PA 1JNHB 1A7PL 5F88B 1FL5A 4JG1L 3MJ8A 5DD5H 3MRFB 4JG0H 2IH1A 2HN7B 2ITDA 3LMJH 3U9PL 1NEZA 5IQ7H 3BGAA 5ESAA 4RFNB 3NACL 4NO0D 5FA3B 2VIRA 1T5XB 1QLRA 3T4AB 4ODTL 2UZXB 5D2LE 3V4VH 4U6XA 1VGKB 2QQKH 4PBWD 3VWJC 2BSTB 4GRLC 4JRYD 2BCKA 2OI9B 2X89D 1XIWD 4M5ZH 5T1KA 2VDRL 1C16B 4XWOC 2WNGA 2HWZH 2D7OA 2NY0D 3AFLA 4MA3A 5HDOA 3MRQA 5JW4R 3AU1B 3WD5H 3VWKB 1E4WL 4KMLB 1XGYL 1UCTA 1DLHB 1D5BA 1IC7L 4LLUA 3E1F1 4V2BA 2X1PA 5I1GH 4NKMB 3X13A 4OCXL 4PYHA 3HZVA 4RGND 2MCPL 4PJXF 1MLBA 1J18A 4R4FH 5M95B 4JY4A 3GIVA 4RGOH 4OZ4A 2G2RB 4LCUA 2DQJH 1ERNA 4KKCD 3S37L 5CUSL 3UJJH 2XWTB 5IFHH 4U1JA 4D94A 4OIAA 4LPVA 5FYJE 3I6LE 2I60L 4ZQKB 4JQVC 2WINB 3MRNA 4Y2DB 4Q97A 4UNUA 3BWAA 3W82A 4G8FB 1PDKA 1MCPL 2HLAB 4YHOL 2AVGA 3KR3H 3RU8L 4LLMB 1CFQB 2JF1A 1DBAL 1QFWM 3HZKB 4Q9QL 5DEFB 3N1FC 2DIJA 2PR4L 2VUOA 1E6OL 2DQFA 4PJ8A 3TBVB 2OL3B 2C26A 5E4IA 3RGVC 3BPCB 4B7IA 1I1AD 3L95A 3P2TA 1LP9A 3SHSA 3FB8A 2R29H 1F11A 4JO4L 1S7XB 4NQCD 4JRXA 1F45A 1FN4B 5EN2B 4LRNH 3OJMB 1DVFC 2W0FB 3VFOA 3BT2L 1QPPA 2HH0L 1QRNE 3IU3A 3IYLW 4LRIA 1WCQA 4POYA 1JHTB 1T03L 1JPGB 2IF7A 5E9DD 3V6FA 1DSFL 2CXGA 5HYEA 5JO5A 1CBVH 3RVXC 3MRGB 3TBSA 4J6RL 3ZLQC 2N7AA 5E0QA 4QXWA 4MNGB 4QRSB 1EBAA 2QL1A 5ANMB 4XNUH 2KZWA 1KXQE 3S36H 1J8KA 4AEHH 3KPSB 2RGSA 1HWGB 1RIUH 4TN9A 1CGSL 3SDCC 1MCJA 3L3KA 5F8QC 3FO2B 3O3BB 4NIKB 2JLLA 3GBNL 1R24B 5CEYA 3TN0B 3D18B 2D2OA 5GHWL 4LSRL 4TOYL 4P2OC 5GISL 3RVVC 5JIKA 1KJ2B 1P7KA 3M1BA 4PJIB 2MTPA 3S36X 3QUYD 4AL8H 1T3FA 5MEND 2XA3A 2BNQE 4IOFC 5JW3H 3IJSA 3CVHA 5E5UB 2EDLA 2DM3A 5FF6A 5GJSH 4FQJL 3DO7A 4OD3H 4ONHB 1KELH 4RBPK 3IETB 4M7JH 5AZ2L 2JIXD 4MD0B 4LVOC 5EC1A 1P4BH 1UA6L 3MSPA 4K9EH 1Q0XL 4R0LB 3QRFM 3QO1B 1ED3B 5DMJB 1SYSB 4F15C 5FYKU 4M6ML 4DVRL 3O3EA 3IDXL 2MOVA 1PKQE 1XCQB 5TGBA 5ICYA 5CZKA 1PY9A 5FFLA 1HEZB 2BVQB 3QDAA 4CADA 5DURD 2N56A 3HB3D 1Y6KR 4OFIA 4OFVA 2Y36H 3BP5B 3H7BA 3VXSE 3QULA 4U6TA 5CCKH 2VC2H 1NFDE 2KKQA 3F5WB 2VLKB 2X41A 4Y16D 2YPLA 1WISA 2NX5B 3EGSA 3TH2T 4ALAH 1NMAH 1BZ7A 4YHLL 4JGMA 4YR6A 5C6WH 1YQ2A 4X98B 3TH3T 2P8MB 5DK0B 5C1MB 5TH2A 5DO2C 3U36A 1NBYA 4BSVB 5B21A 2J8HA 4LP5A 3QHZH 3VD5A 2NY6C 4BELD 2YSSA 4G6KL 2A2QT 5JZ7D 3QXUA 3RZCC 1EAPB 5A16B 1A14H 3ZKND 2FJHB 2DI8A 3A6BH 2AJ3B 5L9DL 3GM8A 4J4PC 5TE6H 5JNYA 3CFJB 3ARBB 3U4EA 4M3KB 3QO0B 5KVEH 1WC7A 2WBJB 2H2SC 3TJEL 4M62L 5D93B 2E7BA 2UUDK 5T1LA 4XBGB 3SGDH 3DGGB 4HT1L 4ZFOA 1X5FA 4NWUH 1TNMA 3VXPB 3HE7C 3VGBA 1MJ8L 3T09A 1LGVA 1SEQL 4Y2OA 3L3DA 3OSKA 4UAOC 1G7LB 1FG2A 3QEHB 5F6HI 3B6SB 1E4XH 1BZ9B 3LRSA 4A2MA 2DJSA 5C9KA 5ENWA 2YKLL 4UT6H 4MAYA 1P9MA 2LVCA 4U6HB 2DMKA 2CRYA 3EYQD 4LLVA 4QLRA 4HULB 3EO1A 1ZWIA 1FORL 3RTQA 4CDGC 1DFBH 4U1MB 1NGXA 1OB1B 3VE0A 5KOMC 4F9LC 3QEQA 3QSKB 3DIFA 4QRQA 4PJHA 5C0AB 3STBA 1G9NL 2QQQA 2HT2C 3U7WL 1QR1A 1T80A 2EXWD 1EZVY 4NQEB 4V1DA 4RFNC 1DBBH 1EGJL 2CKNA 1I9RH 2V5TA 2X5PA 5KVFL 1TTFA 5IFJA 5C0JA 3VFSB 4L8CA 2OI9C 3WJJA 3S3JA 1A6AB 4OI7A 3GHBL 1ZHNA 4OGAD 4YUEL 3V0WL 1JHLH 3VI4F 3LKNA 3VWKC 1YA5A 4JN2B 4G7VH 1ZEAL 4XPBL 1NC2D 4E41E 3OKLB 3T0EA 3QQ9C 1M7DB 5IIEA 3O6KH 1EHXA 1IJ9A 4HX1B 5B4MC 1JFQL 5GIRB 3TT1L 1P7QB 1DEEB 3ALXA 1I9EA 3IXAB 1KTDB 4KVNH 2V9TA 1LO2L 4QYOA 4S11A 3SPVB 1YYMH 1A3RL 1KIRB 4OUOA 1OGAE 2E7HA 5IJKA 1I4FB 4DUVA 1JMXA 1F6FB 3HMXA 1AKJA 4Y2DC 5CJOH 3G5YA 3GKWL 3HC0A 1ADQL 4LAJH 4I5BA 3SGKA 4P4RA 3ILPA 4NQVA 2V2XA 4BA8A 1KTKE 3PNWB 1V3JA 1CD8A 1KIQA 4ONFL 3TYFB 4KHTL 5BVJB 4KRLB 5KAQG 4HUVA 5DUPH 1FNFA 1M1SA 5FA4A 4FZEL 4X6CF 3QDJD 2J6EL 5ADOH 5H2BA 3STLA 1WZ1L 2KDGA 4PRIB 1DQML 3NCCB 3TVMB 4XX1E 4HXAL 3PV6A 4RMUA 2GI7A 1TJGL 1DN0B 4Z76B 4HC1H 1CWVA 3FRPA 1ACZA 3TFKC 4PGBA 3S34L 5JPNA 1IMHC 4TUJB 1T2JA 1GIGH 2XTJD 2ZCLH 3D1MC 4RX4A 3RWGB 3HNTH 5SV4A 5ILTL 5E8OB 3V79C 3SCMA 1U91A 3S4SA 5KS9E 4OB5H 1DDHA 3O4LE 5C0DB 1AO7E 3V2AR 4WFHE 1KB9K 1K6QL 3MNWA 1CGWA 4LCYA 3OGCA 3UEZA 1AI1H 4M4RA 4P49A 1KFAL 3S7GA 4OZHB 4ZFFB 1MCNA 3P30L 4XT1C 4EBQL 3QEUB 1INQA 1DQQB 1AC0A 5MHSE 1J0KA 4W6YB 4WHYH 3GSVA 3ULUF 1MVFA 4QEGA 3TN0C 1MVUA 4NM4H 3L6FA 4JO2L 4JY6A 5TDNB 3WFCL 3VXUB 4A6YL 3N1QC 1MAML 4DAGH 4ZAKB 2FYYB 2N7BA 5IMMA 5DVMA 1V3LA 1Q9LB 2PCPB 5DMKB 2F53E 3LH2H 3VFWB 1WGOA 5MP6H 2CXKA 1OT1A 4PRAA 2E6JA 4JFFE 3UO1H 4EVNA 1KLUA 4R0LC 3OAUH 3QUXD 15C8H 1B0WA 3G5VB 2J8UE 1CLYH 2NW2B 3W0WD 4Z78A 3PWUA 1RJCA 3ARXA 5BS0B 3OXSA 4XTRC 1CE1H 5K59F 4KDTA 3Q3GB 5D7JD 3OGOE 2C4FT 5DFWH 1B0GA 2ILLA 1HHJA 3GJFK 1CFVL 4QHLB 1Q72L 5F9AC 4IRJC 3EOTL 3EOBB 1E6JH 2KL6A 3SE9L 5HHXL 5I1EH 5BO1L 1EEZB 1XR9A 2QV2A 2X42A 5SWZA 1OTUD 3JV4B 4HGMA 1MCBA 3VXME 4YXLL 1ZLUK 2P24A 1D6EB 4UTAH 1XGPB 3VFPB 2CPCA 4E5XB 5E6YA 1AE6H 4MJ2A 4WUUB 4JJ5B 1R3LA 3UJTH 2YZ8A 1UCBH 2F5AL 1ULVA 1U8HA 1HYSD 2EC8A 1IILE 4OAWB 3B9KA 3KG5A 3OKOA 3H9HA 4KJQD