4HEPG

Complex of lactococcal phage tp901-1 with a llama vhh (vhh17) binder (nanobody)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
VQLVESGGGLVQPGGSLRLSCEASGFSFDDYAIGWFRQAPGKEREGVSYISMSDGRTYVADSVTGRFTISSDNAKNTVYLQMNSLKLEDTAVYYCAAGRFVTFGSAWSFVGGGPYGIDYWGKGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords BPP
publication title Viral infection modulation and neutralization by camelid nanobodies
pubmed doi rcsb
source organism Lactococcus phage tp901-1
total genus 32
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hepG00
4TVPL 1E4KA 1KULA 3DHMA 3BIAX 1KN4H 4JM2D 4OUUA 1NAMH 5BS0B 3SDYH 4LLDA 1S9KC 2IH3B 1Q72L 3KWWA 4EI5B 3WFEH 5JA8B 3GMMB 4FMFA 1RZKL 4POZD 2IH1A 5DFVC 3SDAC 5I1CH 2JJUA 3VGFA 3P0VH 5DRZA 4HUVA 5DHXB 2YA2A 4KMLB 2EZ0D 2Q86B 1MLBB 3MRBA 1KB5B 2OM5A 3FB5B 5CUSH 3QEHB 1G9NH 4HKJB 4H5SA 3AB0B 4ZOBA 4NQUA 5FUOH 4XNZB 4FZ8H 2C1PA 4F7TB 3OKOA 2AK1L 5D1ZD 4YXKH 3FJTA 3IAQA 2NTFB 3U7WL 3H9YA 1G7MB 2GCYB 4DK6A 3MLTA 3OKNA 2J6EA 3MNWB 4PJBF 5MP6L 3RWEB 1ZXQA 5C08B 4PJFB 3RDTA 3IDGA 4D0DA 1Y18A 2MQ3A 4S1QH 5EIQA 1V05A 1EDQA 35C8H 3P4OB 1KXTB 3OV6A 1BOYA 4D0BB 5MI0B 4RNRB 3K1KC 2B1AL 2B4CL 1I7RA 4EBQL 1U92A 1WBZA 4MNQB 4OCYL 2VITB 2VO5A 4KK8D 1TITA 5GPRA 4EDXA 4G43A 4JANA 4Q9QL 3WYRA 3MRCB 1YEEH 1JPTL 4Z7OE 4U1HB 3X3FL 3QEQB 1MFDL 4YPGA 1QEWB 3RGVB 2V7NB 1XGPA 4MD0A 4OT1L 1EHLL 2YPKA 5ETUA 1G6RB 4P4KA 3FN3A 4HEME 3UX9B 4KROB 2HLFC 3D39B 5DEZA 2BSED 5F7KC 3WFBH 4XPHH 4HSQA 4I18B 5HYJD 4R9HA 3VFNB 4EOWL 1JRHI 1ZAGA 4OGYL 4K3DL 2YZ8A 2R23A 1UT9A 2EDNA 4PYHA 1BPVA 2YRZA 5EA0L 1MHPH 4OF7A 4XP9H 5HDBF 5K9JH 4KJWD 4HIJA 1P4BL 4JRYD 1WWBX 4KV5F 4NQVA 2B20A 5JR1L 3CFBA 5F96L 5IBLC 3O4OC 5KJRH 1S9YB 4F9LA 2X9WA 3KYNA 1F42A 4JJ5A 4S1SL 3RPIB 1JGVL 1KLGB 4UV7H 4PJIA 4XVTH 2G2RB 5EZLA 1IEBB 3ZE1E 2AJVL 4POYA 2VXQH 3LH2H 4GKZB 2R1WB 3T0EA 1T0NB 1ZMYA 5FM4A 3CMGA 1V3LA 5F1IA 1P9MC 3DUUA 1UQSB 2N7AA 1J7VR 3WL9B 4YHIB 2CXGA 3UJTH 4W4OC 1ZK9A 1AKJB 1A6WH 4C55A 1A22B 1CXHA 2O5ZH 4HT1L 4JFHD 4XT1C 2VTFA 4QF1B 2ZUYA 3HLAB 3SKOB 3UAJC 4FABL 5JNYB 1EAPB 2NX5A 3EO9H 2RFXB 5F3HB 4JR9L 4OFVA 4TYUA 3G6AA 3VXRB 2BHUA 3CD4A 2VISB 4GXUM 1JZ3A 4KK5D 1F3DJ 5I1KL 2OR9L 4K23L 2BNRA 2XQYG 4PJ7F 4QNPE 3OR6B 4N0YH 1JTOA 5ID0B 2DTML 2HVJB 1HINH 4NFDA 4OZ4A 4XB8A 5FDYA 5CD3A 3MRMA 2YD2A 2Z93B 5H37G 2O5XL 4HHAA 1XIWC 1ZGLP 2NY4C 3D0VA 3MV7D 4QRSA 1Q0YH 5D1XD 4IRJC 5E08L 2BJMH 1KEGH 4PGDA 5F70A 4ODHL 3HE7D 3PDDA 2GTWA 5H8DA 4RMWA 1BIHA 3ZT6A 3L3OB 3VGEA 2QSTA 2YHGA 1FZKA 3LRHA 3MSPA 2NY0C 4QGYA 5C0CB 4NHCH 1MCIA 2GUOA 2JKXA 5DJCB 4HIHB 1A8JH 5J57B 3VFPA 1D5XA 1IKNC 1YY8B 4L8SC 1KOAA 5JXEA 5IQ7L 4XCYB 4DN4L 5AWNL 1Z9OA 5AD0A 4PGZA 2PTUA 1UACL 3NA9H 3C6LA 1A1NB 3OKDB 5E94A 3D18A 3JWDC 3D85B 4NNXA 4KHXL 3VG9C 4P4RB 1SEQH 5DFTA 3VCLA 5EC2B 3KS0J 2BNQE 3QXAA 4I0PC 3BPCA 4QLRA 4B53A 3MZTA 3SDXB 3DV4B 4P3WA 1F8TL 5B3JE 4WI7A 2VDKH 3QQ4B 4Z7UF 2A83A 4P2QD 4YDKH 3FO9A 2VNCA 5IW6A 3CZJA 3MRFA 5LGJA 1OAUL 2DI7A 2EIBA 3VFVB 3MYZA 3GSXA 1TQBB 3UPRB 1J0HA 3MRNA 3F5WA 1G7QA 4R2GB 3QHTC 4OGXH 5IB1A 2G60H 3LPWA 4TN9A 3RKDC 1NUFA 1T7YA 5GGSY 5D7IF 5JUEL 2Z31B 3QUML 4RA3A 4NOFA 3MRRA 5FKAA 2J8UA 3TFKD 4GQ9L 4QRPA 2V2WA 1QZ1A 3KPSE 1XR9A 3TA3B 3MYJB 1MEXL 2W60A 1A7RH 1UWEL 3BD5A 1U95A 4OUUB 1JUFB 2VDML 2BX5A 5C09A 1G7JB 2QLVB 2V9RA 3LKPB 4LLDB 3NFPA 1T66D 4KAQL 4PJGB 5GHWH 4H25A 2F15A 1F58H 3KWWB 2NYYD 3VI4E 1N2RA 3VXUE 4KKCD 4Y4FD 2IH1B 3LMJL 5H37H 5GRYA 3ULUE 2Y06H 2ZKHL 2R4SH 5DRZB 4HUVB 4BH7A 1XGRB 3WIFA 4DGYH 4X6BA 3MRBB 5DQJB 2YN3A 5D5ME 1AXTH 3GIZH 1K2DA 2QR0A 1A9EB 3DO3A 2X4OA 3UTPE 1DEDA 4H5SB 4UBDD 2KPNA 4QOKA 3OB8A 1B0RA 4G9FB 2ZOLA 1B0GA 2C1PB 1R5IA 1FG2A 1DTUA 3QDGA 4KJPC 4NJAH 1EERB 3OKOB 4ELMF 4OZGF 1KCUL 4MJIA 5D2NA 4PJ5E 2LU3A 2X4PB 3T4YA 2H6PB 3W9DA 4RMRA 3WFCH 3SE3C 3MMEA 3QHZL 5HDQL 3MLTB 4JO1H 4TTGA 3OKNB 1F97A 5GS0C 1BVLA 1A6UL 1I7TA 4X7SH 4XMKH 4DGVL 1XF2A 3RDTB 2DI8A 3IDGB 4IM8A 3KLHC 1QFHA 1Y18B 4IBLT 3FT2B 3S4SA 3OJDA 2PXYC 1A2YA 1BAFH 2MHAB 1INDL 2FB4H 2R0WH 4GMTH 4OBSA 1UKSA 1UH4A 3ZKND 3V8OA 4HIIA 3W2DL 3NA4A 1I7RB 4XXDA 5CJOH 1JHKL 1TXKA 1WBZB 1PDKA 1HK6A 4EDXB 4G43B 4JANB 1SYSB 1F3RB 2X4SA 2CXKA 3ARFB 4FQJL 5J06A 1CCZA 4NZDA 5DUMH 4HC1A 2PTTB 4FQPA 4GW5A 4YPGB 1RULL 4M5YH 3PHOA 3RY6A 3QPQD 4F8TA 4MD0B 2D31A 3BDYL 3L7FA 2YPKB 4R26L 1MQKH 5ETUB 2D2OA 4P4KB 5C92A 5CP3A 2VMFA 5CFHA 2VXTH 1FDLH 3CLFL 1UZ8A 5BOZG 1R0AH 1XCQA 1YNTA 2R23B 4C83A 3IDJA 3AU1A 1LEGA 2D03L 4PFEA 5C0AD 1G6VK 4KK6D 1FG9C 5JLZB 5EWIL 4NQVB 2AJXL 4LVNC 3GI8H 4LSTH 1DUZB 4ZAKA 1J8HD 1CLZH 3DVFA 4K8RL 4XCCH 5D1ZA 1WSST 4OLVL 1NCWH 3KYNB 4F58H 4TULH 4CL7A 3MCLH 5BS0E 2H2PC 2VH5H 1KJ3H 4HS8H 3O2WL 2IBGA 4PJIB 4X6CF 3UBXA 3B2UD 2GIYA 4UOW1 3RP1A 2WUCH 3MXVL 1F3DH 3QO1A 4XPAL 5A1AA 1DBBL 5T1DH 5HHXL 4WW2A 4NQCE 3TCXA 2DF3A 3QXUA 1UADC 2FHBA 4L9LB 3AREA 3H6JA 1CTOA 2APTA 2AI0H 1OTUD 3EYQC 2AXGA 2Y72A 5JIPA 4OAWB 3U9PH 4NBZB 5DDHA 1YEDA 1X5ZA 3L5WA 4MCZA 3V5HA 3G6AB 3OGOE 5C08E 5F7EH 1RJCA 2GSGB 4P9HL 3GSWA 4PJFE 2WWKT 5KVFH 2DJSA 5KG9A 3UTTB 2GT9A 5HYJA 5FA3A 3VDCA 2VZ3A 3BPLC 2BNRB 3G6DL 3ZE2F 4ZS7H 1WZ1L 3CDGA 3CCHA 4YZFF 4XCNA 5JOPD 2H2SD 4OZ4B 2PO6A 2Y07H 2SEBB 5CD3B 1QNZH 5CLWA 5J1SC 4MNQE 4WI6A 1K6QL 4HHAB 5J1AA 4QRSB 4AENA 4JRYA 1LO5A 1QO3B 1BQUA 4X83A 4M93B 3KPRA 4OTXH 3VFUB 3QEQE 4PP1C 4ZG1A 3CVHH 2GTWB 3KS0H 1T7WA 4WIQA 1FZKB 4QCIA 5LGHH 3WEXA 1H8NA 3D39E 4TVPH 5B4MD 3WSQL 2GUOB 1QOKA 2Q3AA 3QNZA 3VFPB 4CU7A 1D5XB 5KS9B 1EGJA 3UJJL 1Q72H 3FRUA 4LSQL 4P2RD 1FYTD 1FFPA 1RZKH 3SGKA 4GKSB 3C6LB 5FECA 4OF8A 5E94B 3D18B 1F11A 2W0FB 2NLJB 4NNXB 1S7WA 4RAVA 3QXDA 4QHLA 2B5IB 1BZ9A 3QXAB 3BPCB 1BX2A 2P5WD 1OSPL 3M17A 1EUTA 4PJ8D 2QSVA 2A83B 2AK1H 4JRWA 2VDPL 5IW6B 4NN6B 3MRFB 1QPXA 5LGJB 3R8QA 3W0WB 3QSKB 5IW3A 5KOVC 3GSXB 3U7WH 1U91B 3MRNB 3DXAD 3F5WB 1G7QB 4U2YA 1E6JL 1CDGA 5L2KA 5C0ND 5MP6H 3W5MA 3QH3B 3UCRA 4M1CC 5EU6D 4HFUL 3MRRB 5FKAB 1JPSL 2J8UB 3ROLA 1FE8L 4YBLC 1S3KL 1TNMA 4QRPB 2XQYK 2V2WB 4EQ3A 3M45A 4Q9RL 4BQ9A 4GRWB 1XR9B 3LB6D 2B1AH 5D1XA 3OJVC 2B4CH 4EBQH 2WQ8A 4ACPA 1I1AD 1U95B 1DQDL 4OCYH 4BH8A 4UQ3A 4PRHA 4QHMA 3QWRD 4Q9QH 4RRPG 1JPTH 2YBRB 3X3FH 3NFPB 4BSVA 1MFDH 1OARL 1PYWA 1FNAA 1UCBL 4H25B 4APQA 4PRBA 1N2RB 3DGGB 3TNNA 4OT1H 1EHLH 4LPCA 4QGTA 3WIFB 4ZUSA 4GRLD 3DMMA 4X6BB 2PUQT 3VXOA 4EOWH 4OGYH 2QR0B 1F4AA 2YC1A 4K3DH 5C9JA 4ALAL 2X4OB 4E41D 3TIDB 5E95B 1DUYB 1OGTA 1B0RB 5EA0H 1B0GB 1R5IB 1FG2B 1FFOA 4EIGB 3OQ3B 3SGDH 1J1PL 1P4BH 4MJIB 4MD5A 3T4YB 5JR1H 4UNVA 5L6YL 1G7PB 3FB6A 4E5XA 5F96H 1A1OA 3QCVL 2DWDA 5FIEA 5C0CE 1BVLB 4R3SA 1I7TB 1HWHB 4S1SH 2ARJQ 2DN7A 4P46D 2W9DL 1XF2B 1JGVH 2DLHA 2LU4A 4EN3D 3K0WA 2YXFA 1XF5B 4CADA 4DUVA 1MFEL 4FN0A 4XBPA 2AJVH 1JBJA 2R0ZL 3QNXA 5HI4D 1A4JA 5EDXA 4XXDB 5INDA 4RFNB 3CH8A 3SDXE 4BQ8A 4BFIA 2X4SB 2C3VA 5GGTL 4GW5B 2A74A 2ZWLT 3ECBA 3PHOB 1NGYB 4HT1H 2D31B 4NKDA 3P0YL 1TJIL 5IMMA 3WUWG 4N0UE 5F1OB 4FABH 4RQQA 1UM5L 2X09A 1TCMA 4N90D 4NO0D 4KRLB 4JR9H 5EBWA 3JWOL 1QSED 4Y4FA 3ULVE 1UZ8B 4OZFH 4XP4L 1XCQB 1YNTB 2AXJA 2X1OA 2QHLA 4C83B 3IDJB 3AU1B 1LEGB 5I1KH 1YYML 5DHYA 4K23H 2CUMA 1AH1A 3DYPA 4WHYH 3VMNA 4CDHA 3FAWA 4G6ML 4Q0XL 2QKIA 4Q9BA 2DTMH 2AQ2A 4ZAKB 4G8FA 5DRWA 2O5XH 2I07B 4KKBC 5C2UB 3K80A 4BSJA 5C07A 5E08H 3RWJA 4HUWB 1CICD 2BY3A 4ODHH 4X9HA 1V3JA 3NCFB 2V5TA 5DXWA 4Z18A 3LV3A 4WWKC 1ETZA 3QIWA 5JMOC 4U33A 3BMWA 1PX4A 3ZDZF 5IB4A 4G5ZL 1U42A 4BFGA 3QO1B 5HYSA 4WW2B 3SHSA 3RX5A 4KXZH 5CIPA 3NH7L 3HR6A 4HPOL 2ESVB 4G9FE 5IQ7H 1I3VA 4Q6IA 5AWNH 4DN4H 3AREB 1RK0A 1UACH 2AXGB 5CJXC 5SWZD 2ZSWA 3WLBB 1T0MA 4KHXH 4X5XA 5M7QA 1YEDB 3AY4A 4G6KL 4HUXA 2DS4A 3L5WB 2Z0BA 5DWUL 5T1LA 3F8UB 3GSWB 4KJQC 1ZEAL 1F8TH 1U3JA 1F00I 5HDOA 1EX0A 5KG9B 2X70B 5BRZD 1X6NA 2GT9B 2YMXL 5HYJB 1J05B 1NBQA 3B9DA 3QUZA 3BN3B 1OAUH 2N7BA 3CDGB 3RBGA 2CO7B 5IIEA 1Q94A 4FXLA 2X4TA 4XCNB 4J3TA 2PO6B 4X4ZA 5KSVA 1CFQA 2NY1D 1KTKE 5J1AB 4HF5L 3OL2A 4AENB 5AYUL 5JUEH 1LO5B 3QUMH 5EUOF 3SDAD 3I6GA 5E8OA 3KPRB 4HMEA 1FO0L 1EBPA 3V4UL 4GQ9H 5ITFA 2XTLA 1CXKA 5A43C 2D7QA 4XAKD 1MEXH 3HCVB 3WEXB 1S7QA 2ZUSA 3EFFA 1UWEH 4YHYC 5CGTA 2WANA 1A7NL 2VDMH 4NKIL 4JKMA 4XX1E 2WBJA 1KV3A 2W0PA 4LHUD 1FYHB 3QXVA 2C4FU 4CVWA 5TDNA 2I60L 3EOBA 2GFBA 4KAQH 5AEAA 4D8PA 1OY3B 3MUHL 5IHLB 3LMJH 2ZKHH 1HNFA 3QR2A 3WBDA 3VD4A 2F74A 1F11B 2H26A 5I17B 4MLIA 3JVGC 1S7WB 4RAVB 3QXDB 2AEQL 3NGBB 3BUTA 1Z5LA 3V6OC 1GGCL 2GY5A 2XKNA 3IRZA 1BOGA 3PL6A 4JB9L 2IAMD 4GG8A 2YWZA 2I26N 4PJIE 3X11A 5J6GB 1KCUH 3DETC 5LGKA 2X4QA 5F7FA 3R4DA 1UVQB 3T0EE 1ZHBA 4GAFB 3QHZH 4I2XA 5HDQH 5IV2A 5L2KB 1W8OA 1A6UH 3KNBA 1F3JA 4DGVH 3AUVA 5J9PA 3CFCL 1CD9B 1R5WA 4EQ2A 2NY2C 3NIDE 3ROLB 2XXMB 4LKCB 4JVUA 1INDH 2HLFD 3LIZL 5HJ3B 4ZOCA 3LHPL 2FATL 4XMPL 4ZPVA 3W2DH 3SGDI 1MI5B 5GS2H 1V7ML 3PXJA 4OGAC 4PJXF 5A3ID 5AG8A 1MCKA 3G6JF 4UQ3B 5CJQL 4PRHB 5D7JA 4QHMB 1KENL 3LKOB 5IB3B 4FQJH 4ODWA 4KUZL 4WRLA 4BSVB 3UTTE 1RULH 2NY6C 4APQB 2BNRE 3MNVA 4PRBB 3OR7A 5IBLD 3WJLA 1CDHA 3BDYH 3KPNA 3TNNB 4EIZC 4R26H 1DBJL 7CGTA 4ZUSB 3DMMB 3TVMB 1AJ7L 3VRLE 1YPZA 1FYTA 3CLFH 4UOW0 5C9JB 2YC1B 1D3CA 3TO4A 3BPNB 2FNBA 5L7XL 3FTGA 2D03H 1A14L 2DMBA 3IS0X 1CE1L 1FFOB 5SV3A 3GNML 3BP4A 5EWIH 3KPQA 4MD5B 5J1TC 2AJXH 3CLEL 3EOTL 3WNLA 4E5XB 2ID5A 2XA8L 1ZT4B 3ARBC 2DWDB 4K8RH 1A7PL 3UYRL 3X12B 2P8PA 4R3SB 4OLVH 4U1KA 1TQCB 5DJYA 5KS9E 2ICEA 4KRPC 2VXVL 3O2WH 3ZTJG 3G5YA 3STLA 3UAJD 2AV7A 2VAJA 4XBPB 1CZ8L 3O3EA 5J3HC 5D96B 3DSNA 4PGJA 1A4JB 3SDCB 3MXVH 4LPWA 4H8WL 4XPAH 2HA1A 1DBBH 5CSBA 4D3CL 4YFLI 5HHXH 5J6HA 4GKOA 3DSFL 3NCBB 2C3VB 5T3XE 4I1NB 4OCLC 5TPWL 2ICES 3EAKA 2A74B 1UH3A 2X10A 5H35A 3ECBB 2WLZA 1VFUA 3EYVA 4LDOB 2YA0A 4FFYL 3W0WE 5IMMB 1XIWD 2NY4D 5ESAA 4AMKL 3AS2A 3RBSA 4RQQB 5CZXD 2CKBL 4IRJD 4XCFL 5DVOA 4P9HH 3LY6A 4NBYB 4GRLA 5DHYB 2J8UE 4XAWL 3G6DH 2NY0D 4QRPE 2C26A 4GRWE 3BKML 3RJDA 1ZTXL 2QKIB 3VXTB 4NQED 1WC7A 2MQ0A 4LASL 1RI8A 4TRPL 5DRWB 1K6QH 2DLEA 4LFHG 5C09E 4XNMB 5GGRA 4X6DA 5C07B 4G6JL 1WLHA 4NCDA 2DDQL 2UWEA 4ZODA 4JVPA 1TTGA 2APVA 4NM4L 5CEZD 3LV3B 1EHAA 1ETZB 3QIWB 4I0PD 5DHVA 4PRDA 5EZIL 4AIXA 4PV9A 3O6LL 4TPRL 5IB4B 3DRTB 4EN3A 5CZKA 4YGVA 3WSQH 3GUTB 1FQ9C 2CKNA 2ITCA 5CIPB 4YXHL 1CD0A 4Y4KA 2VDNL 3UJJH 4MXVF 4QOKE 4LSQH 3GMRB 1LE9A 3MRQA 3CFEA 4Z5RA 1J8KA 3Q3GA 3KJ6L 3QDGE 5F71A 1PEWA 2FR4A 3ARDC 1RK0B 2DKSA 4IRSA 5CBEB 4MJIE 2ZSWB 4JM4L 2IPKB 3RKDD 1I4FA 4X5XB 4NCC2 5SWQB 3RZCA 2NXYB 3TT1L 5T1LB 1OSPH 4C54A 2WUBL 5I15L 5IR1B 3MA7B 4NO0A 3TJEL 1NUNB 3ULUL 2VDPH 1T2QL 3QUZB 1QSEA 3U4EA 1BQHA 3T2QA 4XBEL 2M1KA 1EXUB 1HEZA 5IIEB 2X4TB 1QSZA 5CZVL 1E6JH 4PTUA 4ZMAT 3BYTA 1CFQB 1JIBA 4UMGA 4FOMA 2Y1VA 2YXMA 1UJ3A 5HVHB 4HFUH 3BEWA 3I6GB 1IKFL 5E8OB 1CD8A 1JPSH 5I9QC 3ZDYE 3EGSA 1OHQA 5IM7A 1FE8H 4JKLA 2FJHA 5ITFB 1S3KH 1DANT 2DQEL 3JV4A 4Z7OF 4Q9RH 1MUJA 3FQTA 3W9EB 1S7QB 3EFFB 2FDBP 1DQDH 5D1QC 4KJPD 1FH5L 2WBJB 3OXSA 2XXCB 5TDNB 1NAMB 3EOBB 2R0LL 1OARH 1UCBH 4LVOC 5EIIB 5LAXA 1JTTA 4D8PB 3ARYA 4X4XA 5GS0D 3E2HB 2X89D 4L4TD 3UDWA 5ESVA 2H26B 3KLHD 5HHQA 3BIBX 5FO8A 2FGZA 9CGTA 1Z5LB 2PXYD 5D70L 3ZE0E 4AIOA 3TC9A 4ALAH 3PQYA 2XKNB 4PG9A 5SWZA 2HN7A 5GGUA 4KQ4L 4M9PA 2BXYA 3PL6B 3CAFA 4GG8B 2YUWA 2J12B 4LHJB 2Z9TA 3PF2A 1MCRA 3X11B 1J1PH 2YD4A 2P44B 2X4QB 5ACZA 3AAZA 1NUDA 5L6YH 2OMBA 4ERSL 1R3LA 4I2XB 1UZ6E 3QCVH 3ZE1F 1NCTA 4PLKC 5IV2B 4JRXA 5IF0B 3KNBB 3RVUD 1F3JB 2W9DH 5J9PB 1BGXL 2ESVE 4RAUB 1R5WB 3GB7A 3BZ4A 5D9SB 1A6AA 1MFEH 4WDIA 1MVUA 2AJZA 3I3DA 3P9MA 2Q7YB 1X4XA 2R0ZH 3NBNA 3SDAA 4DOHB 4P23A 4ZPVB 2Z8VC 1ZVHA 3T09A 3FKUS 2MCPL 3JTTA 2PYFA 4MNGA 3O2VL 3E6HA 5D7JB 1PD6A 1NBYA 3QBTB 1F4WL 4P5TD 1O0VA 4OF0A 5GGTH 1Z6JT 1EEYA 5HYJE 4JZJC 3DX7B 1T22A 3OR7B 1EH9A 1DBML 1V3KA 3KPNB 3P0YH 1TJIH 3OAUL 3FZUC 4UDTB 2VKWA 1UM5H 2H2PD 4O2FA 5F9WB 5IHBA 1KB5L 1YPZB 3JWOH 2QEJA 4XP4H 4QT5B 4JRYE 3TO4B 3VXMA 3D9AL 3FTGB 1YYMH 3D2UA 3KPRE 3HMXA 2WSKA 3J8F7 1I85C 3KPQB 5E9DA 1XF3A 4G6MH 1U2CA 4CNIA 4Q0XH 1MAML 3SGJC 3GJEA 4Y5VC 2FLBT 2Y7QA 3BP5A 3RFZC 2P8PB 4PGEA 4U1KB 4MDJA 4DEPC 5DJYB 4M7KL 3ISWA 5IHZA 2ICEB 4ZFFA 5FB8A 1FL6A 5GSRA 3G5YB 3STLB 3F7RA 3GJFK 2V9QA 4LEOA 4YHPA 5C70A 1C7SA 3BJLA 3V6FA 4U7MA 5I1IL 4N5EC 2R1YA 5HVWA 5HHMB 4G5ZH 1WZLA 3E3QC 3PGFL 5T1KD 4KI5C 5F1NA 1U8QB 3VD3A 3NH7H 2DLFL 2MKLC 4HPOH 3U1SL 5F6IC 2D0GA 1FFQA 3ALWA 1EFQA 4LCUA 2C3WA 3IAGC 1NFDA 1CGTA 5H35B 1QSVA 1JL8A 2CIIA 3RY4A 5B3JF 5C9KA 3CXDL 5ESAB 1GOFA 4B0MM 8FABA 4G6KH 1SMAA 5L2KE 1AD0A 5DWUH 1V8HA 4F80A 5IKCB 1ZEAH 4CKVX 1ZSDA 2YMXH 3LZFL 3QB7C 4RBPK 2DIAA 1OP9A 2A6DA 1X4YA 2VR9A 1JWUA 1VENA 1WC7B 2F53D 4LF3A 1C12A 1TMCB 4K07A 3LSOA 3V6ZA 2P47B 4PRHE 4FQLL 4HF5H 4KTDH 5I1GL 3S7GA 5AYUH 1U93A 5GGRB 4X6DB 4HJGB 3IFOA 5GGVY 4PRID 4Q6YA 1FO0H 2UWEB 3V4UH 4W4OA 3ZKXC 1Y0LA 2IBZX 4PRDB 2XTJC 4PV9B 1IEAA 1EEZA 1A7NH 3BHBA 3DIFA 4YGVB 3QWOA 4ISVA 4NKIH 4Z7UA 2ITCB 3SPVA 5BV7B 4Y4KB 2I60H 5I30L 2A9NL 3MRQB 3CFEB 4Z5RB 3Q3GB 3M8OL 3TBVA 5BCAA 4IRSB 1JZ2A 3FMGL 4HFWB 1P6AB 3EIFA 2ZCLL 4M1CD 1I4FB 5D7IA 4Y5XC 2AEQH 3PP4L 1HN1A 3RZCB 1CD1A 3L95A 1GGCH 2VZTA 3BRGC 1QYGL 4FP8L 1A7BA 3M1BA 1XIWA 1N0XL 5J89A 4JB9H 3CSYA 4OCNC 1J1XL 3GSRA 1NGWA 4X8JA 1IZKA 1WGOA 3B6SA 1YEFL 1AI1L 2VABA 3FL7A 3U4EB 5ID1B 2QSCL 3PE9A 2QQKL 3WHE1 4KUCD 1MCNA 4MAYD 2ZUUA 1NAKL 4PTUB 5I66A 3BRFA 3O3AB 1KC5L 1F2XK 1JGUL 1G9ML 1BJ1J 3DO7A 3CFCH 1UJ3B 1QG3A 3BEWB 2VLJB 1MF2L 3PXHA 3KR3L 4U0QB 5HGBB 1IKNA 3P4LA 5IM7B 1SYVA 2FJHB 3LIZH 4L8SA 1II4E 4NOBA 3LHPH 2FATH 1MUJB 4XMPH 1YUHB 3MRLA 4JY6B 4OZIA 2VDQL 1V7MH 4YDVA 3SY0A 3QDJD 5CJQH 3SKUD 1KENH 1HHJA 5KAQF 2CR6A 4I0PA 3OXSB 1U8IB 4OZGA 4DW2L 4ELMA 4KUZH 3SKMA 4DWHA 2OTUA 3C5ZC 5LAXB 5D7LD 3BUYA 3L1OL 2H9GA 2KH2B 2E7CA 2YA1A 4LPXA 4MQXD 3W11C 1DBJH 3H9HB 1AJ7H 1W72A 1AHWC 5FO8B 2Y36L 5IMOB 1U6AL 5IWLC 3TN0C 3PQYB 3VFRB 4PG9B 1QLRB 2HN7B 5F3BB 5C07E 5L7XH 3U48A 1W0YT 1HXYB 1A14H 4OIAA 1CE1H 1ZHKA 3GNMH 4WO4C 5ACZB 3AAZB 3CLEH 3EOTH 3QCTL 5DMKA 1R3LB 4M62L 2XI9A 4IOSD 3C5JA 2XA8H 5JIIA 2RQ8A 5J7CC 1A7PH 4JRXB 3UYRH 3ULVL 4LBEA 2IJ0C 3KXFB 3RX8A 3MV9A 2VXVH 4ZS6C 3GB7B 4CBPA 1P5VA 1A6AB 3OPZL 1CZ8H 1KEML 4WDIB 5C6WH 2AJZB 3MTRA 3HG1A 4ZO8A 3P9MB 3SDAB 1U3HC 4P23B 1H9VA 4H8WH 2AP2A 4UIMA 3RWCA 3JTTB 2PYFB 4MNGB 4C4KO 4D3CH 3DSFH 3E6HB 1NBYB 5GIRA 3BDBA 5TPWH 2YK1L 3B3IA 3U30B 1UGNA 4FFYH 2I9LA 4AMKH 2QSQA 4KKBD 2CKBH 4O2FB 5EBLA 4XCFH 1B4JL 3SE3A 4X6CA 3VXMB 4L4TA 4WWKD 1N6QL 3MJGX 1NH6A 1FC1A 5ABDE 3D2UB 1JPGA 1J5OL 5IMKA 3BO8B 4HGWA 4OFIA 3VXSA 1BJ8A 3BKMH 1G0YR 5E9DB 2VN7A 1XF3B 4CNIB 4N8VA 1ZTXH 5E5MB 1PVHA 1DFBL 1TIUA 2J6EL 5LBSL 4TRPH 4A2LA 5E6ZA 2Y7QB 4RRPA 4I9WD 4PGEB 4Z8FL 4JPKL 3FT3A 1CGSL 8CGTA 1S78D 4G6JH 3B9AA 4JZNA 5IHZB 4ZFFB 2DDQH 1FL6B 5GSRB 4NM4H 4LEOB 4WU7A 4YHPB 3GGWA 2R1YB 1GOHA 5EZIH 3OKEA 3T0DA 3O6LH 5HVGB 4KJQD 2LU7A 4CMMA 5KAQG 4GAGL 2Q8AL 4AK1A 1WFOA 4PJ7B 5F9DC 2VDNH 2XKSA 4WUKL 3GBNL 2YUXA 3KJ6H 4LCUB 1NFDB 3QAZB 4JM4H 1R3JA 3ARQA 5L2JB 3S6CA 2ZJSL 3MJ8A 8FABB 4I2XE 4M8VA 3OKLB 1AD0B 5TE6L 2MSPA 3TT1H 5C3TA 1G7LA 4YR6A 3ARGC 3OAYH 4R96A 3SDDC 5DJXA 4XCEA 2WUBH 1F5WA 1FZOA 5I15H 4NIKB 1J10A 3TJEH 4IDJL 3ULUH 1T2QH 3HE6C 5C1MB 4XBEH 2A6DB 1BREA 5IESL 1JWUB 2ILLA 4HS6A 3O3BA 5CZVH 3HC0B 4LF3B 3LSOB 3H42L 4Z95L 4OQTA 3OGCA 3GHBL 1FVCA 1KJVA 1EEUA 3IFOB 4X9BA 4ZFZA 5CS7A 2FL5B 3BT2L 2DQEH 1KF9B 3CVHB 4HWZA 4LSSL 3GMNA 1T83C 3E0GA 1D9KC 3X14B 4YPJA 3LKNA 4Z78A 4XPGL 4NDMA 1ZV5A 3BHBB 1YPZE 3S35X 4EVNA 3QWOB 1CK0L 1FYTE 4ISVB 4Z7UB 1P53A 1FH5H 3FO0L 2A77L 3RHWF 3DETD 2R0LH 3WNNA 4XNUL 2CRYA 2XZCL 3OBAA 5EZOL 2P8LA 2UY6A 4JO2L 4PB0L 1SJEB 4RIRB 5F44A 1BJ1H 5EULV 2BNUA 2A0LC 5D7IB 5C0BD 2DQCL 1WEJL 4F15C 5D70H 2NY2D 3L95B 4D0CA 3FAXA 4MHHG 1P4IL 4NKQB 4KQ4H 4ODBD 1XIWB 2NY4B 2VJXA 3GSRB 1NGWB 4X8JB 3WIHA 4LOUC 4NWTL 2C4XA 3BWAA 3MRDB 1VFMA 2VABB 4OGAD 4ZNEA 2AJ3A 4V1DB 3NPZB 1CF8L 3RNKB 4DCQA 3RX7A 4ERSH 3L3KA 4XP6L 3TNMA 5D6DC 5HHME 5ESQB 1JV5A 5I66B 3Q6FA 2NY6D 4L9DA 2XN9D 3LRGA 3DO7B 1BGXH 1WCQA 5GS1C 4J3WA 1EEQA 4AY0A 3FFCD 5CEXB 5EG6C 3C87A 1SYVB 4XP5L 4L8SB 1T3FA 2VLKA 12E8L 3SKNA 3OF6D 1I7ZB 4KKAC 4OZIB 4K8RC 4PRIA 1OLLA 2MCPH 3PWLA 5T33L 3SY0B 1UB5A 1JNJA 3VFTA 3O2VH 1CFBA 4JFEA 1HHJB 1I1FA 5F88A 5GGSA 1F4WH 4Y0GA 4ELMB 4OZGB 4OI8A 2EC9T 3G04A 4W6YB 3SKMB 1BWMA 5F9JA 1TPXB 3MBEC 3ULVF 4M7LT 4G8EA 3BUYB 1LDPH 3QFJA 1DBMH 5IHUL 2CIKA 2H9GB 3OAUH 4L5FL 3MLPA 4YH6A 3PWNA 2RJMA 3B4NA 43C9B 1KB5H 1W72B 2AJUL 4LAQL 4TNWF 5T3XL 4Y88A 3NFSL 2F8OA 3UZEA 1GPOL 5CBAA 5J3HD 3D9AH 4X6DE 4B41A 4CW1A 2G5BA 1WUNT 2CDFA 2UWEE 1ZHKB 4Y4HD 4K3HA 2LABA 2ZSVB 5CLTA 3BZFA 2FSEA 4OBRA 1MAMH 5DMKB 1MELA 3T4AA 3C5JB 1RZGA 4FXGA 4LBEB 5E4EC 4P9HC 4Z77B 1PKQA 2PW2A 4M7KH 1QSFA 4M03A 3LRSA 3MV9B 5I74B 1HDMA 2LTQB 5IROA 2EE2A 3OTTA 1S5IL 3QIBC 3MV11 3L3HB 2YN5A 3MRHA 3HG1B 5I1IH 1B0WA 5B22A 1M6OA 4UIMB 3RWCB 3PGFH 3BZEA 5L9DL 1VEOA 5FGBC 1QR1A 4JFQB 1N0LA 2ZUQB 2DLFH 3U1SH 1AQKL 2JJWA 1LNUA 3B3IB 4N90E 5F9OL 3QDJA 2IPTL 1HZHL 2GK2A 4XNQA 5HHOA 2I9LB 3CXDH 4O51A 1YJDC 3GSUA 4ZPTA 5EBLB 5D7LA 5JHDD 4LARL 3SBWA 1ND0A 4X6CB 1E6OL 5BXFA 2V17L 4ODSL 1EVTC 2VLJE 3LZFH 3D87B 1XT5A 1JPGB 4TOYL 2I27N 2GJZA 1OAYL 5GS3A 4HGWB 3CH1A 3VXSB 2R2HA 3QIUB 2OL3A 1YN7A 3U46A 4EI6B 1VERA 3V7AG 2XWTA 3FCTA 5DRXA 1UYWL 4OD1L 4FQLH 5I1GH 4LGRB 5MHSD 3ARDD 4JZNB 4O02L 5IK3A 4RWHA 5IJVA 1MHCA 4L4VD 1SVCP 5KBNC 1I3UA 3B8YA 3DVGA 4IJ3C 2FECL 4HUKB 4WU7B 3FN9A 3GGWB 2VLRD 4G8GA 1ONQA 4IIQC 2YRLA 4Q74A 3D48R 4AYFA 3OKEB 2A9MH 4U1GB 3H9SD 1M1SA 3SN6N 4CMMB 4Q58C 1T1WA 4U3XA 4Y89A 4GOSA 4GFTB 3PQYE 5SWZE 3WHE0 1VA9A 1BD2D 4ZD3L 4HC1L 4XNXL 5I30H 2A9NH 1EA9C 4CVXB 2I25N 3M8OH 2XV6B 2ENSA 5IB5A 4ZO9A 3LEVL 3OAYK 3VWJD 3WXWL 4GBXC 3FMGH 1N8ZB 1R3JB 3P4NA 2ZCLH 3I6KA 4PJIF 3IYLW 4JO4L 5BZWA 3GSNA 3MJ8B 5CAYB 1T21A 3WD5L 5JORB 3KPPA 3PP4H 1A9BA 4JRXE 5TF0A 5IBTL 3TYGL 1ZHNA 2FEEL 1G7LB 4L1DA 4FP8H 2AK4B 3KXFE 4YR6B 4BKLA 1N0XH 4U6TA 4R96B 5DJXB 5JW5A 1J1XH 2EC8A 2F9BT 4M3JA 1T5XA 4XCEB 4LLYA 2EXWD 3KYKL 2V9TA 4RZCB 5EO0A 1PG7L 1YY9C 1YEFH 1H15A 1AI1H 1RIHL 4HLZG 4N9OB 4OI9A 5D1QD 4LRIC 3L6FA 1QRKA 2QSCH 2QQKH 3ALXA 1QFWL 3NIDF 4WWKA 1XFPA 3GSQA 4TSBL 3QI9C 3O3BB 4X98A 1NAKH 3BESR 3H9ZA 4AL8L 4MNGE 4NRZA 4X5LA 3DV6A 1KC5H 3FQNA 1ZLVH 1JGUH 1G9MH 1UWXH 3MRPB 5EU4A 5ISZB 3OGCB 4KRMB 4JKKA 1WWAX 1F6LL 1JGDA 1MF2H 4KV5E 3KR3H 5FYLE 4ZFZB 5DUBA 4X7EC 3WUWB 4HWZB 1GC1C 4FQXC 3NCCB 2EDXA 3LKNB 3VGHA 2VDQH 3QWQB 1QLEL 4EVNB 4MA1B 2R4RL 3I6LE 4R8WL 3VXME 4DW2H 2BXZA 2XICA 4LRNL 2HT2D 5C7XL 5J12B 5JZ7C 2P8LB 4D9RD 2BHYA 1X5XA 3L1OH 4PLKD 3MRJA 4EZMA 2BNUB 1QRNB 5E9DE 1A6TA 2DAVA 3DX6A 1AR2A 4M1DL 2Y36H 1M7IB 4D0CB 1U6AH 5FUCC 4PJDF 3ARRA 3RWDA 5J0BA 3HNVL 5DQ9A 3D3VD 4HGKC 4WFFD 2AJ3B 1WK0A 3QCTH 4M62H 3L3KB 4Y2DC 3TNMB 5DA4A 1IARB 2WIMA 3ULVH 3Q6FB 1V5JA 1P69B 3QUYC 3VMOA 2YRPA 1JYWA 3WS6C 2JIXD 3BSZL 1AGDB 1EZVY 2YD8A 1NGZA 5E2UL 1MJ7L 1NFDE 3OPZH 1KEMH 5D72L 1T3FB 4OV6F 2VLKB 1MVFA 3SKNB 4HS3A 2AW2A 5TFSL 4PRIB 3PWLB 1UB5B 3VFTB 4JFEB 4ZOEA 1I1FB 5F88B 4HLZH 5GGSB 1EGJL 2OTPA 3V6OA 4NRXB 2YK1H 4X4YA 1BP3B 3G04B 5HDLA 2PYEA 5F9JB 4PRPA 1N5AA 2XACC 2JCCF 4G8EB 3QFJB 1CQYA 2EIDA 1N26A 4CVZA 2CIKB 3CDCA 3T65B 2J8UF 2AABL 2EDFA 3PWNB 1B4JH 5DD6A 4K71B 4XMLL 4KKLC 4NFCA 4X7FC 4CJ0A 2BVPA 2DTSA 4N9GB 5CBAB 5ICZA 4LGSB 1N6QH 1VSCA 4N5ED 4Y16D 2D9QB 4L3EA 1CQKA 3CJJA 4JM2C 4W4NA 1J5OH 2DIJA 1NEUA 5DTFA 3PWPB 4KI5D 4UTBL 2EYRA 5CJ5A 1DFBH 1L0QA 2J6EH 2ZCHL 5LBSH 1RZGB 4FXGB 4JQXC 4Z8FH 4FHBD 4JPKH 4Z7UE 4UUJA 1CGSH 1R3HA 3LKSA 2PW2B 4JFFD 1QSFB 2OQJA 2EZ0C 3MO1A 5FYJU 3LRSB 2BVQB 3WDJA 1HDMB 2AJSL 3DPBA 4TVPD 2OI9B 4F7EA 4PY7A 1NCAL 3MRHB 2ZNWA 1U2HA 5DMJB 2OCFD 1NMBL 4JQVC 1M6OB 1S8DA 4AQOA 5ANMA 5D7IE 3K2UL 2BC4A 4GAGH 4HK3J 2Q8AH 3BZEB 1CFTA 1QR1B 4C56B 2EDOA 1W0VA 5IBUG 3KPLA 1IGIL 1INQA 3GJFB 3OF6A 3U7AA 4OLZL 4WUKH 3GBNH 1R3KB 3NABL 2DYPD 3QDJB 1EJOH 1D6VL 1CIUA 2A6IA 2D7PA 3PP3H 5HHOB 4O51B 1HQ4A 2ZJSH 3GSUB 1RIVL 3SJVB 1IGCL 2VZ1A 4ZPTB 5CEYB 3N9GL 5D7LB 5D7KE 5TE6H 3MV8B 3ARBA 4OD3L 4UAOB 1OAKL 3RIFF 1B4RA 1X5FA 2XTJD 4KK8C 1JN6B 4IDJH 3C5SA 4ZTPL 4OFYA 3FQUB 3MXWL 3KLAA 4DFIA 3ESVF 3CH1B 1T1ZB 2R2HB 1A0QL 4PGBA 5IESH 2OL3B 1YN7B 3U46B 2RBLA 4OZIE 5D93B 4JM2F 5F89A 2XWTB 5DRXB 4DN3L 3ARSA 3H42H 5GJSL 3DTXA 1EV2E 1TETL 5CEZE 4Z95H 2NW3B 3GHBH 4G7VL 3HAEG 3ZTNL 4ELME 4OZGE 3K81A 1I8MB 5ENWA 5IK3B 4LSRL 5IJVB 3BT2H 1T1XA 3QDMD 2BVEA 4OFPA 4LSSH 2VUYA 4G8GB 1ZHLA 1IM3A 3EBAA 4XPGH 5E1HB 1T89C 1BWWA 1T1WB 1HWGB 1CK0H 3FO0H 2A77H 4FFVC 1AO7D 5T3ZE 4CMHB 5FA4A 3HZYA 2EO1A 5A2IH 4XNUH 5EZOH 2XZCH 4JG0L 1WBXA 1IGTA 4JO2H 4PB0H 3P4NB 5KANG 3I6KB 1PFCA 1FL5A 4QXTA 5BZWB 3GSNB 1LO0L 4QYOA 1I1RA 5EUOB 2DQCH 1WEJH 1XEDA 1A9BB 3FHAA 1ZHNB 3RHWK 1P4IH 3BGAA 4BKLB 1KELH 1LE5A 1UZ6F 5JW5B 4LLYB 3MV9E 3DWTA 5EO0B 4NWTH 1H15B 3FQRA 5JHDA 1UWXK 3A6OA 2EEDA 3HG1E 1CF8H 1QFPA 3NN8A 4WWKB 5DK2A 5FYKU 1M05A 4XP6H 1C5DA 1FJ1A 2Y25A 5BOPA 3KYOA 4NRZB 4QRTA 3C5ZD 3FQNB 3MOAL 5EU4B 4NT6A 3VDAA 4I77L 1HNGA 2A6KB 4RFEA 4XP5H 3B9VA 2J5LB 2E27L 5EZJA 4KK5C 12E8H 3ARDA 3TN0D 3IU4L 3RJQB 4WI5A 3O8XA 5T33H 3BKCL 4FRWA 2VAAB 2AXHA 4X6CE 3BZDA 2APWA 5B8CC 4Q97A 1P7HL 2FX7L 5DJ6A 4BM7A 4KY1L 1IGJA 5IHUH 3S4SG 3MRJB 3VXSE 4CJ1A 4L5FH 1X7QA 5EUKA 1QBAA 1A6TB 1N6UA 1F90L 3DX6B 1XGQB 5CHNA 2AJUH 1J0KA 3N1QC 5FF6A 4HDIA 4ZS6D 4J4PC 4LCCC 3N85L 3O9WC 5T3XH 3NFSH 1GPOH 1NDMA 3RWDB 3GKWL 1DJSA 1U3HD 5GRJL 5DQ9B 5K9QI 2GHWB 3HRPA 1KTDA 4DAGL 1WZMA 3I75A 1RAMA 1OSZA 4XC3L 4TNWK 2ZCKL 3O6FA 5JO5A 5DD0L 1NC4A 3I02B 1X5GA 5DURB 3ZE2E 2J8OA 4WY7L 2GY7B 4KVNL 4YZFE 1NGZB 1S5IH 3PGDA 5DVNA 4GRWH 2EIEA 2QADC 4JGMA 1CWVA 5I2IB 4FTVD 1J86A 1RZIA 4UILL 5IEHA 1FFRA 1GSMA 1R24A 3BEVA 3EOYG 1MJJA 2NR6C 5L9DH 4JREC 3I3EA 3O81A 1KJMB 4HMCA 3O6ML 3DBXA 1AQKH 3U0PB 1FFNA 1RK1A 4YHNA 4DZBA 1NPUA 1EFXA 4X4YB 3GMPA 3B5TA 2PYEB 4PRPB 5F9OH 1N5AB 2IPTH 3CMOL 1HZHH 3UTSA 2UZYB 4F37F 4PLNC 3UBXG 5GZND 2PCPA 3AXLA 5DD6B 4LARH 4AIZA 3EYFA 2BVPB 1E6OH 2BY0A 3S8WA 2V17H 2FYYA 4ODSH 2EDKA 1KLFA 1FVDA 4L3EB 3TWCL 4TOYH 5SWSD 5DTFB 1OAYH 4WNQA 1NKRA 2XWJA 2EYRB 3U4BL 2Q76A 2D3VA 1UYWH 2VLMD 4KK9C 3LD8C 4OD1H 3EDDA 3TBYB 4UUJB 3PV6A 4QO1A 1RUAL 2FX8L 1HCVA 2FHFA 3LKSB 4MJ5A 2MMXA 4O02H 2OQJB 3MO1B 5LG1A 5MEND 4WUUB 3DARA 3ULUC 4Q9CA 1RY7B 2XZAL 5DUPL 5I8EB 3AM8C 4F7EB 4LL9A 4UU9A 2PTVA 3BX7C 4JZJA 3F62A 1T0PB 4UBDC 1PG7W 1ITCA 2JIXA 1LO2L 1S8DB 5ANMB 3GSOA 3P9LA 4O2CA 4A6YA 3BPOB 3PP3K 1K4DA 1W0VB 1HILB 2Q8BL 2VDLL 4ZD3H 3TZVC 1INQB 3HE6D 5FYJE 4HC1H 4XNXH 1CDUA 1NQBA 3E6FB 1QACA 3EKCA 2A6IB 3LEVH 3O4LD 4ZNEE 3WXWH 2VDRL 1HQ4B 1I85A 5CP3H 4UTAL 3BP6A 4PP2A 3WD5H 5CSZB 1UH2A 3SGJA 4U49A 3TYGH 5IBTH 4OSUL 4Y5VA 3ARBB 4O5LL 2FO4B 2I24N 3KYKH 3HUJA 1HKFA 4ZUWB 1PG7H 1SEBA 1TENA 4KI1A 2X5PA 1RIHH 4JQIL 4KRPB 2KBGA 3MLYL 5EN2B 1CFVL 3PG2A 3SQOL 2VLKE 1QFWH 1TVBA 4X9GA 4TSBH 4NBXB 4PRIE 4AL8H 3QPQC 5EFIA 3DTXB 4JFEE 1UJTA 1ROWA 4G7YL 3K2MC 4LNRA 5ENWB 1T1XB 3QFJE 1KG0B 3QISA 1FN4B 2NZ9C 2CMRL 5F7YC 4JFFA 1YN6A 3IKKA 1IM3B 1Q9LA 4P2YA 4KK6C 1QLEH 4QEGA 3FO1A 3QYCA 1KTRL 3UPAA 4LOUD 3WKNA 2R4RH 1HHIB 4R8WH 4LRNH 4CU6A 5C7XH 5HBBA 4GKNA 1WBXB 2EDDA 1IGTB 2JF1A 4OV5A 3PWPE 2QV2A 3WDHA 1MLCA 4Z76A 3QUXB 1FL5B 4QXTB 4X6EA 4QYOB 4M1DH 3RTQD 4WENB 1DSFL 4X9IA 5FDWA 2NPLX 1OAXL 1IM9D 1PKQE 1F02I 4EI5C 1QSFE 5GXBB 4OCWL 3ALPA 1IAIL 2ICWA 3HNVH 3D1MC 3IDIA 2HKFL 4X5WA 4DGIL 4K8RD 4ONFL 5JHDB 4PJ9D 3DURA 4RISL 3NN8B 1M05B 1BVKA 1C5DB 1FJ1B 1B88A 1A4KA 3RGHA 3KYOB 4QRTB 3AB0C 3NCYS 3WKML 2E8ZA 3MBED 3U36B 2WP3T 2DICA 2WM0A 4OQ1A 2EDQA 3BSZH 1FHGA 5E2UH 5FM5M 1MJ7H 3QDJE 1X5HA 5D72H 5HHOE 5EZJB 4G6FD 5FYKE 1KFAL 2R29L 1IGYA 3HPLA 5KSAA 5TFSH 1XF4B 3SJVE 2ORBL 1LK3L 3O8XB 3L9RA 4BSWA 4HEPG 5D7LE 2CLVA 3MV8E 3WHXA 4Y5XA 5BV7L 2CQVA 3JUZA 1EGJH 4JFDD 4LLMA 4YLQT 3B9KB 1KGCD 3VXQA 1KIQA 3ZDZE 2HFGL 1IGJB 3TCLA 1AO7A 3JV0A 2DM4A 1X7QB 2R9HC 1S7TA 5DR5L 1GZQA 1RJLA 2AABH 2AXFA 2CUIA 4HDIB 3DRQA 2CRMA 3TBSA 4DKDC 5D7SL 1CG9A 3QIBD 4B7IA 1T4KA 3MCKA 5CP7A 5B4MC 32C2A 4U0RB 2VR5A 5TJWK 3WE6A 4G8GE 1PY4A 4KROC 5K9KA 4UTBH 1DLHA 4WU5A 3I75B 4V2BA 1YMHA 1OSZB 2ZCHH 5I8KL 5K9OA 2F54D 4ZFOA 3VD5A 3MBXL 1WAAA 3O6FB 1T20A 1NC4B 3F7YA 1JHLL 3LS5L 1G7IA 1KBGL 1OVZA 1RFDL 1PX3A 3QJHB 3V6BR 4QTHA 2AJSH 2ERJB 4GW1A 1Q38A 4R4NC 3S88L 3PGDB 5DJ8B 1NCAH 1JNLL 5JDJA 1FZJB 3BVNB 3MLVL 4PJ8C 2WW8A 1NFKA 1FAKT 1NMBH 5FGCB 5IEHB 3K2UH 1R24B 3BEVB 1OM3H 1S7RB 2OJEA 2WAHA 1IGIH 4Z7QE 2BCKB 3RL2B 3DBXB 5IWLA 4OLZH 1P7QA 3RL1A 3TN0A 1FFNB 1RK1B 4YHNB 1EFXB 1UXSA 3GMPB 3NABH 3UTSB 2CUHA 1U58A 3VGBA 4N0FB 2VOTA 4WO4A 1RIVH 1IGCH 2FECI 3N9GH 3AXLB 4XPTL 2CKBB 2IAND 3SOBL 4PV8A 4QRRA 3DJ9A 1JF1A 5HYSG 4OD3H 4RGNB 1OAKH 4UB0L 3B43A 1XGTB 2FBOJ 1J18A 4K3EL 2XOTA 5ALBL 2XG4A 3MXWH 4QY8A 3GI9L 1NCBL 2ADJA 3BQUB 4WNQB 1A0QH 3PGCA 1VGKA 4KJYA 2XWJB 2Q76B 1WZKA 1HOCA 4DN3H 1YZZA 2AEWA 1LMKA 1PZUB 5GJSH 1TETH 2ZPKL 4G7VH 2UY7A 3EDJA 3ZTNH 3RIFK 3VW3L 4PJHA 5DRNA 1MCOL 1YPZF 4LSRH 4LVEA 4CUCA 4QWWC 3Q5YA 1UB6B 4HKXA 4UU9B 1RMFL 4JZJB 1KB9K 3IDXL 5AZ2L 5MEQA 3GSOB 3P9LB 4O2CB 3WMSA 4P2CG 1G9MC 3D5OF 3BFOA 3IGAA 1QFWI 1YY9D 2FJFA 2VSCA 4LHQB 1K4DB 4NRYB 4R90L 4HGMA 5JA9A 4XH2B 1Q8MA 4FTVA 3V9FA 5FYLL 4LFHD 4JG0H 1JFQL 3GRWL 5F97E 3ZDXF 3QI9D 5I19L 4NNYB 4P46C 3OB0H 3L3GA 1MQKL 2VWEC 2FGWL 1TVDA 1LO0H 5LCVL 4Y5VB 5HI4C 4Y8DC 5FGSA 5IMLB 4GXVL 4FQXD 3ZO0A 2Y23A 2E8YA 5DF0A 1SEBB 3L3JB 1S9WA 2MJWA 4WGVB 5B3NA 5E6IA 3WN5B 5ADOL 3KJ4B 5CINL 4AEEA 2JB6A 1TVBB 4QHKJ 5BQ7A 3S34L 5EFIB 3VD7A 3QNYA 5JZ7D 3MOAH 1YNKL 4I77H 4OKDA 3V6OE 2OS7A 2DLGA 4HCRA 5F6IB 2PYEE 4E0RA 4PRPE 1T7ZA 2VXUL 1TQBC 2JK5A 2E27H 4R2GC 1EK3A 1I1YA 4G9DA 1YN6B 3IU4H 3OHXA 4BQ6A 4MNHA 5C86A 4LMQE 3MFFB 1NGQL 2Z31C 3BKCH 3C6SA 3FO1B 5CIPH 3N06B 4ETQA 5E8NA 4K94C 1A6ZB 3BD4A 3R06B 5ACLA 3ARGA 3IXAA 4L3EE 3SDDA 3FONB 4GKNB 4Y2DD 2FX7H 4LCWA 2HFFA 2GAZB 4KY1H 3BN9C 4RSVA 4OV5B 2IMMA 1MLCB 4Z76B 3QUYD 3HE6A 1CICC 2UWEF 3UXFA 1F90H 3OKMB 1CS6A 4X6EB 5E1AB 5FDWB 4D9QE 3N85H 3CSPA 5E0QA 4YNYA 2MPAL 3T3MF 1JYNA 2P1YA 3GKWH 4NQDD 3JTSA 2AERT 4M6NL 5GRJH 2ICWB 3MUGA 4J3SA 3U2SA 3IJHA 4J3XA 1TTFA 1MAKA 1EBAA 4DAGH 5C0EA 3ZKXB 1BJMA 3HC3L 4Y1AD 1D9KA 1N59A 1BVKB 4XC3H 5ANME 4PJCF 4IS6B 2XTJB 1A4KB 3E1F1 2Y07L 1J11A 5TGBA 2ZCKH 2FJGA 4RMQA 5DD0H 1RQ5A 5H2BB 3O11A 1NUGA 4WY7H 3ZHKA 1WIUA 4KVNH 2QQNL 2WIIA 3SE8L 4XGZA 4ODXA 4KKLD 2OP4L 3HPLB 1IGYB 5KSAB 4PREA 3L9RB 3ZT5A 4D9LL 4BSWB 1J0YA 2BERA 3O6MH 5KSBA 1NCDL 4LLMB 3DI2B 4M61A 4YXLL 3BKJL 3VXQB 1KIQB 2NY1C 3H3KA 3CMOH 1VACA 4HJ0C 1TJHL 2APFA 1S7TB 5IT2L 1GZQB 3PHQA 2AXFB 4D2NA 3NCEB 1K9TA 5INCB 2XT1B 4M7JH 5D6DA 4MXVE 3ARFC 3DRQB 5IUSA 4NQCB 3F58L 1GOGA 1T4KB 3TWCH 5GS1A 32C2B 1K8IA 3P2TA 2DQTL 3WE6B 2G5RA 4P4KC 3U0TA 4F37K 2BMKA 2KQNA 5DI8A 5K9KB 1DLHB 4WU5B 2A6JA 2AQ3A 1YMHB 4P2OB 3U4BH 5K9OB 4ZFOB 2PNDA 1YMMA 4RGMC 1RUAH 2FX8H 4BUHA 1G7IB 5I1LB 1LO3L 1XGUB 3VFGL 4GW1B 5DUPH 2XZAH 5KN5A 1WCBB 4WFED 1QKZL 2IAMC 4L8CA 5E2WL 1LO2H 2IQ9L 3LVEA 2WINA 1T2XA 2MOVA 2GW5A 2ZNXA 2GK0A 5CEZL 1EHNA 1C1EL 1SMOA 2OJEB 1H3TA 3EZ8A 2Q8BH 2VDLH 4J2XA 5IGXL 4KVCL 3RL1B 1P7QB 1A5FL 3TN0B 1HHGA 1UXSB 3LS4L 3TPUB 4NKOA 4C59B 1A3RL 1C7TA 5JHDE 4M9OA 1U58B 3KDMA 3C60D 2VDRH 2XQBL 3MJ9A 2Z92A 4Z9KB 3W81A 4UTAH 2E7BA 4WO4B 3P73A 3VRJB 1W72L 2HFEA 4HLJA 4R7NB 3O0RL 2XY1A 2ZUTA 1SQ2N 1KXVC 1MCWM 4OSUH 4PV8B 4QRRB 5T3ZL 4GS7B 5HGDA 1NEZA 2BFVL 4O5LH 4L9LC 1JF1B 1QVOA 3GIVA 1ACZA 3BRDA 5A3IC 4P3CL 3VGAC 2D4DA 1FCCA 5IW1B 4JQIH 3HN3A 4Y19A 1ORQA 1B3JA 3MLYH 4QY8B 1CFVH 4TUJB 3SQOH 5JQ6L 3PGCB 1I8LA 1VGKB 5FOJA 4FFVD 2YD3A 1I9JL 3TESA 2I9TB 2EDHA 4K2UL 3G5VA 1KJ2A 5GISL 4PJHB 4G7YH 3ARVA 1NC2D 5C2BL 1S7SB 4NC1E 4BZ1L 4L4JA 3ZSSA 1UWGL 1N7MH 2CMRH 2N4IA 3JXAA 3U6RA 1UG9A 3QG6B 4ORGA 1BQHG 3Q0HA 3RI5K 4PS4L 3RY5A 4G80A 2FJFB 3IGAB 2YS4A 3OB0K 1T6VN 2OZ4A 3SCMC 2UUDH 4NUJA 1MCPL 5MEOB 1Y6NR 3R1GL 1Z0NA 3NIFE 4B50A 3AFLA 1I8KA 1YQVL 1QFWM 3FRPA 1DSFH 1DQJB 5EBGA 1DVFA 1OAXH 5JPNA 2BSSA 4L8DA 2XA3A 4LPTA 1ZT1A 1L6ZA 4OCWH 1D6EA 1FNGA 1IAIH 1S9WB 3PNWA 4JY4A 4DGIH 2HKFH 5TQ2L 2W1NA 4ONFH 2IANA 5E6IB 2EKJA 4RISH 2COQA 1QLFA 4ESKA 5DZOA 2B5IC 2BOCA 1NFDF 2VL5A 1RZ8A 5FGCE 3NOIA 1GAFL 4JGJA 3WKMH 1CT8A 3QNYB 4M8QA 1BZ7A 3HA0A 5F8RC 5CZXC 3WO3B 1OD7A 3FQWA 3S37L 4KMTL 4NN6C 5AAWA 4E0RB 1IBGL 4YHML 1IC5L 3UTSE 5I71B 2JK5B 1U9KA 4HUNB 1I1YB 4G9DB 4J4PD 1KFAH 2R29H 3O9WD 4ORZC 1CGYA 2EDJA 4PJDA 1EO8L 2ORBH 4GBXA 1LK3H 3OHXB 1CGXA 5DD3L 3C6SB 3VG0L 2YD5A 2VC2L 5BV7H 2CJUL 5B38A 1RUQL 4ETQB 2WK2A 4RGNE 5E8NB 1FIEA 1IEHA 5KZCD 3ARGB 3IXAB 4UZGA 3SDDB 1CXEA 4LCWB 2HFFB 2HFGH 2OR8A 5F6HJ 3L3DA 3AGVA 5DR5H 4LRIA 1AGCA 4PJAA 1OGAD 1U0QA 3VI3E 3HAEA 4WFFE 5D7SH 1KCSL 2XG5A 2QADD 5JXAH 3JTSB 4NZTL 2YPLD 4LCIL 1NBVL 1OQXA 15C8L 2BNQD 3MUGB 1LP9A 3T08A 3U2SB 1PW3A 4MCYA 2NR6D 3MRGA 4N0UB 5C0EB 5I8KH 1D9KB 1N59B 4ZYKB 4LHUG 5TGBB 3MBXH 2FJGB 3O6KL 4LIQE 2MFNA 4OQTL 3O3UN 2H41A 1JHLH 3VGDA 2JCCA 3LS5H 4NN7B 3B2VL 1KBGH 1RFDH 4U6XB 5JHLL 2ZG1A 4KWUA 3JSSA 4LSUL 5LKNA 4GJTB 3S88H 5B39G 2JJTC 1ED3A 1JNLH 3BE1L 4XGZB 2N1KA 3MLVH 4ODXB 1QBBA 4LLAA 4WJ5A 3F7VA 3JWNC 3LN4A 4Z0XA 3KPSD 1EUUA 1VKXA 4F15B 4YK4B 2AQ1A 5KSBB 2EECA 2D7NA 4M61B 3HUJE 4TNVF 3R0MA 1CL7L 4H0GA 5JOFA 2DQUL 1MOEA 1VACB 4KK9D 4LSPL 3IFPA 3U9UA 3PHQB 3WNPA 4RFNC 4GRMA 4XPTH 4JDZA 4Y2DA 3UP1A 3SOBH 3ULUD 4WHTA 3E3QE 1EPFA 3KGRA 5FYJL 4KI5E 4OZIF 4UB0H 3QUYA 3WIHL 4UINL 4BFBD 1CGWA 3RY6C 2CDEA 4K3EH 4N0RA 4F33A 4JN2A 5ALBH 5GS1B 4XBGA 3BOVA 4J23A 3GI9H 3IVKA 1NCBH 1HYRC 3GMQA 3U0TB 1DR9A 4JFFE 3GBLA 2A6JB 3TZVD 5F9AC 3VXPA 1Z3GL 1GHFL 1YMMB 1K3ZA 2ZPKH 4PJ5D 2OK0L 3GO1L 3VW3H 4OGZA 1MCOH 2VQTA 1GGTA 4Y1AA 4D0DB 1JWMA 1JZ4A 5DJ0A 3S5LG 1M7DA 1RMFH 5C0DA 4L29A 4ZAKC 3IDXH 4F57L 5AZ2H 4WW1A 4QRUA 5FV1L 3BWUC 2WINB 3QQ9C 3WV0A 2P5EA 2VYRE 5L8JB 1U92B 2GK0B 1S7VA 4FQHA 1HCFX 4P9ML 2D4FA 1C5CL 4R90H 2JB5L 1F4HA 1LDSA 3NMEA 2HMID 4MQ7A 5FYLH 1HHGB 1FORL 3P30L 3DGCR 1JFQH 3GRWH 2P7TA 5I19H 3RVUC 2ZUWA 4JM2A 1XGPB 2Z92B 3WIIL 1WFTA 4F9PC 2FGWH 1KIRA 3Q5TA 4WW2C 1FSKB 2HFEB 5GQBA 5GZOC 5LCVH 1F13A 2XTJE 1WWWX 4LAJH 5HGDB 4AT6A 1N64L 5E4EB 1QVOB 2EE6A 3P3YA 4PB9L 3AREC 4GXVH 2NZ9D 4MD4A 3CPLA 3U4AA 4Y19B 1ORQB 2F58L 3OKYA 5ADOH 4HIJB 4JCLA 4P5TC 4QHKI 5CINH 3S34H 3CFBB 4K7PY 1PEZA 4JQVA 3GZKA 4K9EC 1YNKH 3MRIA 3G5VB 1KJ2B 4JJ5B 1SBSL 1AGFA 3SE9L 3CGTA 2PETA 4IMKC 1YC8A 2VXUH 2UUDK 5EZLB 5BS0D 2OTWA 3V0AC 1VEMA 1AO7E 2Z8WC 2HJFA 1IAII 3T0EB 4ORGB 1MCQA 5F1IB 4EI5D 3DUUB 2VKXA 1NGQH 2J2ZA 4ZUUA 2FWOA 4NUJB 5AAMA 1A64A 3RNQA 4B7LA 3QUKA 4HBQA 4Y5YA 2RHEA 1MRFL 2HT4C 5FYKL 1I8KB 5BJTA 5I1AA 3FOLA 5EU7C 5F7MC 1IE5A 5KVGL 2NX5B 2HTKC 4Z7WA 1DVFB 2DQFA 3NTCL 5JPNB 1WAAE 2BSSB 4J3OC 4L8DB 4JKPL 3PIQA 2MPAH 5I1EL 4F7PA 1ZT1B 3C8KA 4M6NH 5J13B 1FNGB 3F6LA 1YEJL 3PNWB 1YNLL 3Q1SL 3QXTA 5C08D 2DMCA 2OL3L 2ADFL 1QLFB 4HUMB 4TUKL 5J8OA 3GDBA 3HC3H 3KG5A 2VL5B 1RZ8B 1NDGA 2M26A 4U7KA 3PJSA 3SGEH 3MRMB 5IBUB 3TV3L 2FO1A 1NLBL 1T89A 1BZ7B 5JW3L 1GRWA 3D0VB 3FQWB 4FFZL 4YC2B 2R9HD 4NN5B 4MNQD 1U8NA 2G75A 2QQNH 4PGDB 3SE8H 1NMCB 1V3MA 2VIRA 5JW4Q 3RVXD 4IHOA 2OP4H 2DD8L 4P3DA 3QEQD 4PJDB 4GBXB 2VZOA 1KYOJ 2PKDA 4D9LH 1AR1D 3RGVD 4QRRE 5DEFA 3BMVA 1NCDH 4KROD 3D39D 4YXLH 3BKJH 4JAMA 4QXWA 4OLWL 5I18L 1DDHA 1J0ZA 3E8UL 1RZJC 4OF5A 5AD0B 1UM4L 1TJHH 1CDIA 3L3DB 1JPST 5IT2H 3GSNL 2NY3B 2ATPA 5EBMA 4XZUA 4NPYA 4PJAB 3VCLB 5KSUA 3HAEB 3VH8G 4R4ND 3F58H 1XGYL 1VCAA 4PJHE 4APQC 2HTLD 2EEBA 1ORSA 3IFNL 3ILPA 2DQTH 4NJ9L 3FO9B 4MCYB 3TVMC 2LFGA 3MRGB 3AS0A 1XH3A 3VWKC 5A2JH 2X05A 5FKPA 1CFNA 3BPNC 5IB1B 5IVXA 4L3CA 2JCCB 4OCSL 2PW1A 4KZDL 2ED7A 1QQDA 5CMAA 1LO3H 1ZLUH 3VFGH 1WTLA 2C7UA 4P5KA 7FABL 3EO0A 3VRIA 1KXQE 5B8CA 4WFHD 3C08L 5E2VL 3MV7A 1QKZH 2KDGA 3F7VB 1R6VA 5E2WH 5FOBA 2IQ9H 3LN5A 2W60B 1PKOA 1OD9A 4X7TA 3S9DB 3BGMA 1AKJD 3MLRL 2D9CA 1QFOA 3HE7A 4N8VG 1C1EH 5CEZH 1PG7X 3T1WA 1VKXB 4J4PA 4LCCA 5IGXH 4KVCH 2OXHA 5C09B 4MAYC 1A5FH 4U2ZA 1PLGL 1YQ2A 1PGRB 3LS4H 5D96C 25C8L 2A38A 1A3RH 5GRXG 3VXRD 5I75B 3SDCC 5JOFB 4FZEL 2XQBH 2D7MA 3U9UB 1JTPA 4BH7B 1W72H 1IL1A 4GRMB 3B5GA 3O0RH 2GI7A 4JDZB 4NO3A 3KLDA 4QWWD 1T5WA 5T3ZH 1K2DB 2BFVH 3T2PA 1XCTA 3QUYB 3TYFA 4OIIL 4QOKB 4BFEA 2CDEB 3EDKA 4P3CH 4F33B 2WNGA 2ZOLB 1OGAA 4XBGB 3ZMRA 3QDGB 2CSPA 4Z7NE 3IVKB 3HR5A 3GMQB 5JQ6H 5D2NB 2VRAA 1MFAL 3W9DB 1I9JH 1RURL 3ARXA 2YPLA 1LVEA 5DQDL 3MMEB 2BK8A 4R4FL 3VXPB 4P2QA 4MQXC 4K2UH 3H3PL 4NZUL 4CN6A 5GISH 3K4AA 3N1FC 4TSAL 4Y1AB 1JWMB 5C2BH 5DJ0B 1MWAA 3S4SB 1M7DB 3OJDB 5C0CD 1IMHC 4LCWE 4BZ1H 1A2YB 6CGTA 5C0DB 1UWGH 4L29B 3V7AE 4WW1B 4HIIB 3ME0A 4LU5L 4QRUB 2KZWA 2P5EB 4PS4H 4FQHB 1S7VB 3T77A 3VJ6A 5IJKC 4HAGA 1MCPH 5L0QC 3D85D 4MQ7B 4OIBA 3R1GH 2P7TB 3WFZA 5ERWA 3V4PL 4OZHA 4JM2B 1INEL 4U6YA 1NMAL 3L7FB 4KUCF 1YQVH 4YHLL 1KIRB 1HHHA 2WQRA 3K3QA 1MCJA 4S2SA 4AT6B 2VZSA 1ZGLA 4R2GD 3V5KA 4MD4B 3CPLB 3HPJA 5TQ2H 2PF6A 3ULVD 1LQSR 1ZLSL 2Z31D 4WEUD 3U82B 2W07A 5FK9A 4GT7A 4H1LA 5EO1A 2FIRT 1GAFH 2FEDD 1MHHA 3MOQA 1DEEA 4ZUVA 5D1ZB 3TA3D 4DQOL 3SO3C 1JNHA 3MRIB 3TH2T 4F7MA 3BN9D 5KSBE 4OM0L 1AGFB 2YEZA 3S37H 4KMTH 1U3ZA 3QUZC 1ZANL 1IBGH 4YHMH 1IC5H 3VFWA 2Z4QA 3UBXB 5CD5C 3CU1A 2HJFB 3H8NA 1EO8H 4Z7VF 4JG1L 2C3XA 5DD3H 3QZWG 3F12A 3VG0H 2GQHA 2VC2H 1F45A 2CJUH 2NY5C 4ZUUB 4OD2A 1RUQH 2FWOB 3SGEI 3QUKB 2QJDA 1IAIM 3TH3T 4FFWC 4Y5YB 5F6HI 4HX1A 1S78C 1YECL 4XRCA 5BJTB 5I1AB 1CDJA 2E9BA 3FOLB 1PQZA 4Q2ZA 4G9FD 4TTDD 2BSTA 4PR5A 4P49A 4PGCA 5DDHB 3WO4B 5E8PA 2DQFB 4GG6A 5JIHA 1YMME 4MCZB 3TEUA 3V5HB 1KCSH 1U8KA 3LKQA 4NZTH 4LCIH 5D6CA 4F7PB 1NBVH 3C8KB 15C8H 3E2HC 2PR4L 1AGBA 5FA3B 4P0DA 4NZJA 3G08A 1ADQA 5MERA 1DLFH 3RDTD 1L7IL 4NC0B 1OOAA 3TJHD 3CCHB 1BIIA 1OTTC 4FMKA 1IC4L 1NDGB 2M2DA 2VUOA 3PJSB 4KH2A 5C0AA 5HGAA 4QXUL 1T7VA 3O6KH 3PL6C 4OQTH 1G9NC 2HT3C 4KTDL 3B2VH 4JRYB 4CRPA 5JHLH 4HJ0D 4LSUH 1U8NB 2G75B 4XI5C 2YD9A 4FQIL 1J8HA 4Z7QF 3BE1H 2ED8A 1A47A 3ARFD 4U1IA 4IHOB 2O5YL 1IGFL 4P3DB 1EIBA 3HI5L 4QCIB 1E27A 4U1MA 2YWYA 4XHQA 1FGVL 1U8HA 2FBJL 4PYGA 2IBZY 2DRUA 4Q7DA 5DEFB 4P4KD 3QHFL 3QNZB 3FRUB 5I73B 3K46A 3CFDA 3CFKA 1DDHB 1CL7H 4X9FA 4Y19E 2W92A 2DQUH 4YBHA 1FFPB 4JPIA 4LSPH 5FECB 2ATPB 5EBMB 1MLBA 5D7JC 4HIEA 1QBLL 4QHLB 1IAOA 5KSUB 3THML 1BZ9B 4FS0A 3C9NA 4XVSL 3QEHA 1BX2B 5FYJH 5C71A 3M17B 3WIHH 4UINH 1X5KA 5I1HL 1ORSB 3INUL 3ILPB 3BW9A 5FFLA 4JFYA 4AJ0A 3C09B 1ZLUK 5IVOA 1G7MA 2GCYA 3TO2A 2UVEA 5FKPB 1CFNB 1Z3GH 3MNWA 3TO4C 1GHFH 4KQ3L 5IQ9A 5IVXB 4YHOL 3LQMA 1GGUA 1OL0A 3GO1H 4P99A 2DIBA 2OK0H 2YSSA 5A2LH 1KIUA 4JVWA 1J1OL 1FZMA 2PW1B 3ZYIA 5CMAB 1QQDB 4O2EA 2C7UB 4P5KB 1MRDL 3EO0B 3VRIB 4K3JL 5B8CB 1IFHL 3MV7B 4OCRL 4F57H 5D1XB 5FOBB 3LN5B 1EO7A 4X7TB 3HE7B 2NX5E 4P9MH 4BH8B 1C5CH 3QXWA 2JB5H 4KPHL 1DN2A 1WISA 3CK0L 3VXNA 1FORH 3S3JA 3P30H 1QEWA 4WEMB 1PYWB 5J56B 2IANE 1FVEA 1P4LA 5E7FA 1LEKA 5TE4L 3WIIH 1G6RA 1VDGA 3UTTD 4JFXA 3PDGA 2V6HA 1IL1B 3VFNA 2BNRD 4NO3B 3HKFA 3VXOB 4P2RA 3MGOA 1N64H 5CGMA 5E5UB 4PB9H 1XCTB 3TYFB 1OGTB 1QPPA 1OGAB 3L5IA 4LK4A 3QULA 4K7PX 4QRQA 4QHUA 4LEXL 4M43L 2F58H 2P5WA 1LD9A 4PJ8A 1F4XL 3SCMD 4PJDE 1S9YA 3FB6B 5C6PB 1ZWIA 1A1OB 4P2QB 4KDWA 4RMTA 2L4OA 3OG4B 4XWOC 1SBSH 3RUGF 1MREL 2UVFA 3SE9H 2B0SL 4AZ8A 1L0YA 3DXAA 1MWAB 4WVRA 2G2RA 4CADB 1UKTA 4Y7MA 3HMWL 4YIQA 5EU6A 4TSCL 5E8DL 3QNXB 1AXSA 5JXED 4AG4L 1UQSA 1PAMA 4HK3N 4Y4HC 5CWSA 3C8DA 4PJAE 3WLWD 5FAAA 5INDB 5AYQA 4R0LA 3T77B 2ZZUT 3UEZA 3GJFH 4YGAB 3T2NL 4BFIB 4OF6A 1OAZL 3N1MC 3RRQA 3VGGA 2Q20A 1WICA 1I1AA 5ERWB 1LP9E 5DS8A 4OZHB 1MRFH 2RR3A 4JCMA 4BK5A 5FYKH 2X44D 3RWIA 5FCUL 3QWRA 4NKDB 4U6YB 5T3XD 4QF1A 3JUYA 1VEPA 1HHHB 5ILTL 3ULSA 5F3HA 5KVGH 1MH5A 5BV7C 3NTCH 1F6AA 2X6MA 4I0KA 3VXRA 3W0WD 4S2SB 4JKPH 4Y4FB 5EBWB 2JCCE 1H3VA 3LD8B 5I1EH 1OWRM 1U8PA 1ZGLB 4WTXA 1BECA 3V5KB 1AGEA 3LDBB 3HPJB 3Q1SH 1YEJH 1YNLH 4ZDHA 4KXZI 3OR6A 5D71H 4UDUA 2OL3H 2ADFH 3NZHL 4TUKH 5ID0A 1AD9A 1H3PL 4E41A 3RZCC 5FK9B 3TF7C 4N5UA 5EO1B 5HSFA 2HLAA 1MHHB 2AJYL 4QRPD 5DC4B 3TV3H 3TPKA 4G8FB 1NLBH 5JW3H 1JNHB 4RBPH 4F7MB 4FFZH 1EHXA 1CLOL 2YEZB 2APBA 3RWJB 4FXKA 1FIGL 5SX5H 3VFWB 2Z4QB 4Y2OA 1AQDA 1J9CT 2DD8H 4P46A 4F7CA 2F5BL 2EO9A 4S10A 2JE8A 1IILE 4LIQL 2GEEA 1KSRA 3F12B 5HYSB 1UJ3C 3IETA 4NQSA 1YY8A 4FG6C 4N1HB 5FM8A 3T0BA 1H8SA 4OLWH 5I18H 4Q6IB 5JPMA 3CNKA 3E8UH 4HX1B 2R15A 4PJCA 1UM4H 1A1NA 4XRCB 5D2NE 3GSNH 4Q2ZB 1KYOK 2K9UA 3FN0L 1T0MB 1DZBA 5FO7A 2ZG2A 4MZ3A 4PGCB 3V8CA 4PBVC 4HUXB 5E8PB 4GG6B 4ODVL 3SDXA 3ZTJH 3IDMA 1U8KB 2H8PA 3LKQB 3ET9F 1XGYH 3V79C 1HH6A 4DVBA 5IFHL 4Y1AE 1FC2D 4YAQA 1FGNH 3WDIA 3IFNH 1AGBB 3LPFA 4W68A 4NJ9H 3G08B 4QTIL 1YC7A 4WHCA 3GMLA 4O9HL 1Q94B 1TNNA 2P5EE 4O58L 3TBWA 5C0AB 5HGAB 3VWJC 2E3VA 5KSVB 3NAAL 2LVEA 4OCSH 3X3GL 4KZDH 4WV1C 2FCBA 3LAFA 3SE4A 4NYLA 7FABH 5E00A 1J8HB 1Y6KR 3C08H 4N0CD 5E2VH 1K3IA 3NPSB 1CTNA 3ARZA 2EXWC 4YDIL 3OJMB 3WCYA 1A1MA 1JYXA 1E27B 4U1MB 1CICA 3MLRH 4HV8A 4YBQD 1JUFA 1C5BL 3TGXA 1U8HB 2GJ6D 1G7JA 3LKPA 1SHMA 5DD1L 1PLGH 4W6WB 4PBWD 4PJGA 2J4WL 2GFBB 4RX4D 25C8H 3CFDB 3CFKB 5TDPA 4MSWA 4P23C 1L4IA 4JPIB 4FZEH 1JNNL 1YA5A 3V4VL 4GO6B 1X5LA 2R2BA 1XGRA 2F74B 1S7XA 5EU3A 5DQJA 1CGVA 3BGFC 4HWEL 1I3GL 4HIEB 1IAOB 1A9EA 2EKSA 3C9NB 1HKLL 1G1CA 4CN4A 1BOGB 4ZAKD 3U30C 4G9FA 4OIIH 4HG4K 2V5MA 3BW9B 3QQ9D 4JFYB 2X4PA 2H6PA 2HT2C 2EDBA 5SV4A 1MFAH 3G5ZA 1RURH 4U1JA 3TO2B 1ZHBB 5DQDH 4JFPA 4R4FH 5BRZA 3S3PA 4EKXA 5IQ9B 5KVMC 3H3PH 5HHPA 2KL6A 4NZUH 1I1CA 2YSSB 4WFEE 2J3SA 1FZMB 4CU8A 4TSAH 4OUOA 3PWUA 1B6UA 1VB9A 4O2EB 3FT2A 1BFOA 1DANU 4I8DA 2H1PL 2MHAA 5E8EA 4X0KA 2M8XA 3G9AB 5GZOD 1IC1A 2ESVD 3AROA 4LU5H 3RVWD 3W5NA 3STBA 3ARED 3NIFF 2DM3A 2BVUA 4Z7WE 3LEYL 3RZWA 2L0DA 4NWUL 1BVZA 1SYSA 3ARFA 3BKYL 5F7HA 1KTLA 3L5XL 3WFHA 3TIEA 1SM3L 3VXNB 4ODWB 5JTWA 2PTTA 1JMXA 3BXNA 1MY7A 4M48L 4BQBA 3HNSL 3V4PH 3MNVB 1FVEB 1P4LB 1LDPL 1INEH 2DWEA 1NMAH 1LEKB 4LHUA 4YHLH 4JFXB 4WCYL 2EDEA 3ZKSD 1OW0C 3UMTA 2Q3ZA 2P49B 2E9IA 4P2RB 3MGOB 5DO2C 1FYTB 3QRGL 2DI9A 3QAZC 3S35L 5B39A 5I0ZA 2PO6D 3NZ8A 4U1NA 2BVTA 4HH9A 3QULB 2DL9A 3NACL 5JLZA 4QRQB 1IGML 4QHUB 1ZLSH 3BP4B 2P5WB 1LD9B 3OAZH 4PJ8B 1DUZA 3LOWA 1MCBA 3KPRD 2IAMA 1EVUA 4HH8A 4ZFOL 1ZWIB 4DQOH 1FAIL 1HSBA 3MUY1 4XVJL 4OM0H 1G7HA 2HT4D 4J6RL 1ZANH 1FRGL 3DXAB 4ENED 1QD0A 2AV7B 2DJUA 4L8BA 3O3EB 2HTKD 2MNUA 4C58B 4Y16C 4YIQB 5EU6B 3K74B 1NCNA 1AXSB 1MPAL 5E70A 3I85A 3EJZC 5CWSB 2HRLA 4JG1H 2GSIA 3N1GC 4R0LB 4MMXC 5J6HB 5JQHC 3IS1X 4IOFC 1CXLA 2X42A 4OLEA 4JFHE 1E0OB 3VI3F 4L9LA 5FM5O 3MR9A 1I1AB 4DJMA 5I8CA 5DS8B 1RUKL 4OLYL 1KPVA 3RWIB 1YECH 3EYVB 4OAWA 2E6PA 3HTLX 4DFHA 3FHQA 2Y6SC 1QUNA 3ULSB 2RB8A 1MH5B 3HFML 5JW4M 1F6AB 1E28A 5IVXE 2GSGA 3KPOA 1RUPL 1CYGA 3QCUL 3S5LA 1WFNA 1U8PB 2X4NA 1AGEB 3UTTA 1TJGL 5HD8D 5L2KD 4GRLB 4KKNA 2PR4H 4ZDHB 5BZDA 1RZKC 1P5UA 1D5MA 1KT2A 4UDUB 1L7IH 3MV7E 4EXKA 1AD9B 4E41B 1NKOA 3ZZ1A 2GYSA 2HLAB 2SEBA 1IC4H 1CE6A 5SX5K 4QXUH 1K5NA 1P9MA 3DVIA 1E4JA 1QO3A 4NP4L 1MI5D 3SCMA 3VFUA 1JPFA 3MGAA 5DK3A 3M07A 1KPUA 1O7VA 3VFOA 3ZLQC 4FXKB 4FQIH 4M6ML 4PRHD 4HW6A 4ONGL 5GJTL 4J7RA 3P11L 1AQDB 2O5YH 1VGEL 3HUJF 1IGFH 4P46B 5E99L 5DHVB 3WUZA 4F7CB 1RZ7L 3HI5H 3OKKA 2BP3A 2A9ML 4APQD 1H3XA 1TDQA 4EN3B 1FGVH 2FBJH 3IETB 3WNOA 4NQSB 4FQ1L 5KS9A 3QHFH 3DMMD 3TVMD 1LE9B 1OGAE 5JPMB 3VWKD 4KI5F 4GKSA 4PJCB 2FR4B 3GM0A 1KCKA 2W0FA 2NLJA 2B4CC 3TBTA 2YPLE 5DGRA 3FO2A 5FO7B 3F6IA 1XR8A 1QBLH 4P2QE 1MCFA 3THMH 1I75A 4XVSH 3IDMB 1HE7A 2H8PB 1TPXC 1HH6B 2VERN 4DVBB 2NTSP 1T04A 5LWYL 4YAQB 2E9JA 5I1HH 3INUH 3OMZA 4IRJA 2ZG3A 3GHEL 4YJZL 4NO0B 3B5HA 1SY6A 1RSFA 4EUPA 3W0WA 4MA7L 3REVA 1QSEB 3ZHDA 1BQHB 3GMLB 4DZ8A 1U91A 1IJ9A 1HEZB 3MLSL 3TBWB 5DMGC 5KOMC 4KQ3H 1TZGL 3QH3A 4HJJL 1XZ0A 3HZKA 4YHOH 1H5BC 1J1OH 3SDCD 2WMPA 4HCRL 4H0HB 5CGYC 4NYLB 4NQEA 1MRDH 5E00B 4K3JH 2F19L 4YDLB 3EGSB 4HKZA 4OZHE 4UT6L 1IFHH 2HKHL 3JV4B 4WGWB 4OCRH 3A67L 2MWCA 2ICWJ 5HPOA 3FQTB 3PWVA 1A1MB 3STZA 1CICB 4HV8B 2IF7A 3ILQC 5I74C 4KPHH 2LTQC 2YBRA 3CK0H 5GGVL 1L6XA 3L7EA 2EDTA 4CVUA 4JN1L 3UC0L 3OSKA 1URLA 2KZ1B 3DGGA 3PDOA 5TDPB 1OQOA 4MSWB 3H0TA 4X4XB 1A6VL 1HSAA 5TE4H 1L7TL 2R2BB 1NLDL 1S7XB 4G6AC 5ESVB 5EU3B 5JDSA 2ZUQC 1J0JA 3O3DA 1VFAA 3HI1A 4IDLA 5HHQB 4OLUL 4LLQA 1CFSA 5C8JA 2EKSB 2CH8A 1WV7T 3VE0A 3TIDA 5SWZB 1L0XA 1DUYA 5GGUB 1IC7L 4QHNA 1O5DT 2BY1A 4JJHA 3T1FA 1CN4A 4LEXH 4M43H 3WXVL 2JJTA 5C07D 2YPVL 5E24E 3G5ZB 1F4XH 1G7PA 4U1JB 1MNUL 1WVZA 4JFPB 5BRZB 5DD5L 3QIWD 5HHPB 4LMQI 1TLKA 1MREH 2JELL 2C9AA 2B0SH 3PWUB 1BFOB 1XF5A 1PSKL 3BZ4B 5E8EB 3QIUC 4X0KB 2NY1B 1MVUB 1EJ6A 3HMWH 2CK0L 4W70A 4TSCH 4JY5H 5E8DH 2WWKO 3VH8A 4AG4H 5HYIA 3GEWB 5BO1L 4GG6E 4U05A 1SJXA 3T2NH 1KTLB 3WFHB 3TIEB 2P8MA 1OAZH 3BXNB 1BBDL 1WAAF 1EEYB 2NXYD 1NANH 5T1LD 1NGYA 1T22B 2DWEB 2GJ6A 3RIAF 4U1GC 5FCUH 2UV3A 5AG9A 4LHUB 1JYVA 5EU5A 2CPCA 5ILTH 3N0PB 4RX4A 5C0AE 5IEKA 3MROA 3P77A 3QUZD 1LGVA 5HXMA 5F1KC 1SVZA 3OAZK 2X89A 4RGMB 5B39B 5CD5D 1A3QA 3NZ8B 4U1NB 2HAZA 4HH9B 1J8HE 2BHZA 2PXYA 3B9EA 3NZHH 1H3PH 1MIML 5ECJE 2IAMB 3GJEB 2QQQA 1CGUA 2AJYH 1FNLA 2I07A 3BP5B 4FFWD