1TETL

Crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCKSSQSIVHSSGNTYFEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYEWHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1 TE33 FAB (LIGHT CHAIN)
publication title Crystal structure of an anticholera toxin peptide complex at 2.3 A.
pubmed doi rcsb
total genus 51
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL01
2DTMH 3G5XB 4FQIL 2DS4A 4PGBB 4KJYB 2ZUTA 1FNHA 1G7LB 4KROB 1S7RB 1CTNA 1KGCE 1EZVX 4Y8AA 2VXQL 1NDMB 4PS4L 1CFNB 4AEIH 2FX7L 3RVVD 1T20B 1A47A 1I9EA 3MMEB 1A9BA 4X9BA 4WO4D 4XTRC 1I8KB 3VXOB 4NYLA 1MUJA 4HUVB 5EUOB 2YPLA 3GIZL 5J89A 1SMOA 1N7MH 5B38G 4XMPH 2R69H 2GY7B 2Y5TB 4QRQB 2UWEF 5MERA 5IR1B 2FBJH 1ZLSH 3KVQA 5JOFA 4OJFL 5BS0A 4UAOB 3OR7B 2HKHL 1CQKA 2Y5EA 2WUBL 3LN4A 5ILTH 1UH3A 3IDNB 1MJUH 1IEAA 1IGTA 5CSZA 3UBXA 1UADC 1UXSA 3U83A 2ZUUA 3MRGB 1IFHL 3DETD 4ONFH 4UINH 1EX0A 1FL3B 4R4ND 5C0BA 5D1QC 4AEEA 4RQQB 1T3FA 2E5EA 3BH8A 2ZCLL 1NEZA 2K7PA 2NY5H 5E5MB 3F7RA 4MCZB 2D2OA 2FX9L 2D7TL 2MHAB 3W0WD 4FQCL 1YYLL 2FJGB 3OPZL 5E7BA 4NJAL 5DJ6A 2RQ8A 1LNUA 3VI3E 3C6SB 1T22A 3ULUE 4U6VL 5TFSH 4N5UA 4YQXL 2AV7B 5J6GB 5D1XC 3VXUD 4PGEB 5C07A 4RFNB 4PJGA 4Y16A 2ADIA 2AJUL 2D7QA 1F6LL 4FFYH 4M7JL 1N2RA 5DD1L 3O6FD 3BW9B 3LKPA 4WEUD 1JPGB 4AG4L 5DD6B 1ZS8B 5JXED 1I8MB 2WP3O 2AJVH 4XWOD 1NBVH 4CMHC 5CBAA 4YHMH 2XKNA 4PRPE 1ADQA 1BX2B 3IDGB 4NQTA 2X4SA 3MRQA 3SJVE 1L9NA 3KJ4C 2A38A 3ROLB 4XPHH 3JVGA 3HLAB 5CJOH 1FNGB 5H2BB 3VRIB 3BH9A 3WKML 4OCMC 4U1MB 1JL8A 4X7FC 3WD5L 3QIUB 2P45B 1J8KA 2A6JB 5IHBA 1X4YA 1JGVL 4U6TA 4XWGH 1WZMA 1SHMA 3OG6B 4YIQA 2AK4E 1BZQK 1JWSA 1ZHNB 3Q5OA 4XVUC 5IOPB 5C7XH 1G9MH 1EMTL 1MJJA 5IK3A 1YMHA 3IDIB 3MTRA 2OMNA 1NEUA 1CDIA 1F4AA 1VACB 4HGWB 1T2QH 1A7NL 4HG4J 2XXMB 2CRIA 3AB0C 3JSSA 1W0WB 5D71L 4KZDL 3ZMRA 3C5SB 4XX1G 5H37H 1CE1L 4YHZH 1Q0XL 5JPNA 2F8XC 4FMKA 2HFFB 1PEWA 4TSAH 3OXRB 4HIEB 5ISZA 4B7LA 3L9RB 1IKFL 4Y19B 1R3HA 5BRZD 5D7KD 4FFWD 4JFEE 1WSST 4TUKH 2KKQA 1TQCB 1IAIL 3KPNB 5EZIL 2YEZA 4I0CC 1F4WL 2GHWB 4KHXL 4MXVE 4HS8L 3TVMB 3PWJB 4FXGA 4YR6B 3MRMB 4O4YL 1HH9B 2FRGP 5DQDH 2ZCKH 3UTZA 4GAGL 1KJVA 1NUGA 1YECL 3CFEA 4P5TB 1J1OH 3MV7A 3LQZA 4JG1L 4JO3H 2FATH 4YHOL 4YDLB 1U8JB 3S36X 2ICWI 4OD1L 4JHAL 4DUWA 2NX5D 3SN6N 2ZJSL 2XTJD 3O4OB 3SGJA 5IVXA 2OR7A 3ULVE 2OBGA 4HC1H 1KJ2A 2MMXA 3BESR 4NO0B 1CD1B 3F7PC 3JTTB 4PREA 2WANA 5L2JB 1VPOH 3QULB 2C4XA 1OAZH 1DFBL 4JRXD 4DZBA 4I3GA 1T4KB 3L5WB 2PF6A 1BD2B 2VDRH 3MFFB 3VXPA 1A6AB 3QXTA 2IPUK 3MREA 4NQUA 1KJ3L 2E7BA 1EAPA 3LV3A 2OK0H 1FL5A 1P53A 4IRJD 1S78D 2W9DH 3OKMB 1OARH 3CX2A 4E0RA 2X1PA 2YOCA 2IQAA 1LP9E 3HE6D 4KTEH 3TF7C 1CIDA 4K3JH 3UTTA 3O9WB 3U4AA 3HG1D 4X7CC 3DPBA 4XNQA 3LEVL 1Z3GH 2CKBL 3BD5A 4E9LA 1LK2A 1U3HD 1CR9L 2DD8H 2CIKA 3B3IA 4I3SL 4JPKL 4NGHH 1A7BA 2A9ML 5CJXA 4KI5F 2UZYB 3E8UH 3E3QC 5FM4A 2V5YA 3W9EB 4OCWH 3W2DL 4Z7VE 3L3HB 1QPPA 3TA3D 4QRPA 5I1LA 3PP4H 25C8L 4PJCB 5CP3H 5KVFH 5K9QI 1NGZA 3G6DL 3MA7B 5FYLE 3HE7D 4MDJA 1MFEL 3T2NL 1VADB 1NGYA 1D9KB 3IFNL 3QDHA 3L1OH 3I6LD 3U4BL 1S9XA 2ZOKA 3HAEG 3VFSB 2E6PA 5I18H 2VLRB 3REWA 2VLKE 4EOWH 3IDUA 2BOCB 5J7CC 4LCYA 3T2QA 3SKJL 4UI2A 1OGTB 3H9SA 3VMNA 4L4JA 1A2YA 1A4KA 4WW2F 1OF2A 4HJJH 4MWFB 2AP2A 1ED3B 1JUFB 4M93B 4TUJB 1NMBL 4GG6F 3CFDB 2GTWA 5EIIA 3SEPA 2BCKB 3I6GA 1HE7A 1YY8A 2Z31A 3HUJA 3RZCD 3K80A 4R2GC 4NCC1 3PWVB 4X6CA 4K3EH 2YD5A 4ONOA 1VGEL 4L29B 1G7MA 1LE5B 4L8BB 5EBWA 4ZS6D 2VMFA 3DRQA 1RZGB 1YYMH 2CKBB 5LGHH 1ZLVH 1R5VA 2DQCL 1U6AH 1BFOA 1U41A 4LBEB 4NN6B 4ZO9A 1GCFA 5IFAL 5B8CB 1U3YA 1WEJL 4G9FA 3JVGC 5GJTH 4A6YH 2P5EB 4OLZH 5I1GL 5E99H 3G04B 1WTGT 4ZAKD 2WINB 4WV1A 2H32B 4UBDC 4OB5L 3D85D 3EHBD 5JA9A 3WFEL 2VKXA 4LPYA 1ZHBB 3GBMH 1R3KB 3G6AB 5EA0H 5IM7B 2X41A 3BPNB 3RNKB 4EBQH 5ICZB 3QUKA 3L7EB 3REVB 1N0XH 2HWZL 5CLTA 5DJ0B 3EIFA 2A9NL 1MHCA 3P4LA 1IBGH 4I0PB 5GS1B 5C0GA 1RMFH 4PLJC 4NO3B 3G5YB 4LIQE 2VLJD 1IGYA 4FZ8H 4KQ3L 4HIXL 3BPOC 2DI8A 3BZFA 1TZHA 5E8NA 4P5MB 1FFRA 1MCOL 4GKSA 3BWAB 4M5ZL 3Q6GL 2ZSWA 4DVBB 3MV01 1I85C 1GGYA 2R0LL 3L3JB 3O2WL 2BJML 3C2AH 3OR6A 1AQKL 2WP3T 3NCBB 5DC9B 3T0EB 5JMRA 4HCRH 5D7JB 4HLZH 3RUGA 1QRNB 1VKXB 3RU8L 1GGCL 4OZ4A 3DVNA 1CF8H 1RU9L 5HGDA 1G9NC 3NCYP 5CLWA 3C9NA 2FBOJ 3V0VA 5FF6A 4GKZB 3DYMA 5EU7C 4FQIH 4R7DA 4OD2A 2GJ6A 2BSTA 3VXMD 1FH5L 1TJHL 5FYJL 3L3GA 3NFPB 1L7TH 1ZOXA 2VXQH 4PS4H 1ZGLA 3MRKA 1IKNA 4Y4KA 4ZNCD 5K59F 3QDGE 5MENB 2F54E 3LIZH 1TXKA 3MV9B 4K9EH 4ZMAT 1BLNB 4OFPA 1MIEH 1CFVL 4MX7A 3TYGL 4P2OD 4LHUB 4GAFB 1V5JA 1YJDH 2EEBA 5AAMA 1E6OL 2HFEA 5HDOA 5D9SB 3B8SA 4OJFH 5F70A 1LEKA 1OAKL 5GGRB 5C70A 4XCYA 1WWCA 3MV8A 1S9WB 4NHUB 4ZNEA 1GZPA 1IC5L 2BXYA 2IBZX 4Z7WA 1EV2E 3VGDA 4P23A 4HXBL 5DJAA 2BVPA 5F9JB 3LPWA 1F4XL 4ODSL 1R6VA 4J6RL 5H8DA 3CDFA 5C8JA 3EYFA 5A1AA 1I7RA 1ACZA 4XMLH 2VABB 5CJXC 4I5BB 3AMLA 4BYHA 2D7TH 2EDTA 3ZKNC 3QP3A 4YAQA 2BNRA 4WFHD 3T1FA 5I8EA 3OPZH 5FXCH 3NAAL 2AXJA 2IALB 2YKLL 1MI5B 1WWAX 3U0WH 2YD3A 5GGUB 1DVFA 1MCLA 3MNZB 3K1DA 3WN5A 1NGXA 2RR3A 1M7DA 4ODTH 3QNYA 3BQUA 3JV0A 3DIFB 5F21B 5AZEL 1RZJL 3MLVH 5F96H 2G5BB 2HJLA 4LU5H 2P49B 2OXHA 3EOAB 4EQ3A 2UZIL 1DEDA 1UYWH 5CBEB 1WISA 1NANI 3MNWB 2YSSA 2KPNA 3FZUD 1JZ4A 4OQTA 4TULH 3CSBA 3RDTB 2QQKL 4XCNB 3DHJA 4NWUL 4ISVB 2VL5A 2OS7A 5SWZB 2Z4QA 5I76A 4LLYA 1WT5A 4U1NB 4MCYB 5BMFH 3JWOL 3TT3H 3WKMH 3WD5H 1SJHB 5F7FA 4YHYB 4OUUB 4G8GA 4EDXA 5E2UL 3ARYA 1N4XL 3U30C 3DV4B 1W72A 4K55A 3X14A 1UXWA 1S9YB 3EW3B 1AC6A 5HGGS 1KTDA 3O6LL 5IJKA 1QP1A 2JF1A 3OMZA 4HGMA 2IPTL 4JFFA 3GMPA 1A7NH 2P24B 4XBPA 5J1AA 1IC7L 1NQBA 4DN4L 4LARL 2DLEA 3BJLA 1CE1H 2EYRA 2DN7A 4NBYB 3DX6A 5DJXA 3LMJH 1JIBA 5HHNB 4H20L 4NC0B 3MRFA 4YFLF 1IRAY 1CL7H 3PABB 3OKEB 4MA1C 5E8DH 3F5WB 1MFAL 2XZCH 1HSBA 2NTFB 5EZIH 5FA3A 3ULUD 2RCSL 2F53B 4EXPX 1MJ7H 3MQIA 4JFHE 4PJDA 3H0TA 4HAGA 5KVEL 1HDMA 2VH5L 5I16A 3BEVA 3PP3K 3NGBC 1AFVL 1YECH 2YD7A 4V1DA 4HHAB 4JG1H 1DJSA 4ACPA 4GKOA 2GEEA 4K9EC 3QYCA 1T66D 4ODWA 2NY4C 2EDHA 1E27A 2YPVL 3UYPA 1XIWA 1DQJA 1YJDC 3QNXA 3WLWC 3L95B 1TTUA 4CW1B 4D9LL 5DQ9A 3PL6B 4WUUD 3C8KA 4PRPD 2J6EA 3ARUA 3MJ9A 4P46D 4NCDA 5MEQB 2WBJD 1DFBH 4PBVC 4PJXB 1UWXK 5EU3A 3FN3A 4PJIB 1U58A 2WM0A 1KJ3H 5EZJB 1XEDA 4R96B 4U0QB 5B38A 4HKXA 2NZIA 1ZVSB 2DLHA 1I1YA 3H9ZA 2AK4D 5D7IB 3I02A 4J8RA 4IRZH 4OTXL 2LVCA 5DLMH 3WJJC 4NZUH 4P3CL 1HHGB 1KELH 4M7LH 4NOFA 3DMMC 3JV6B 1L4IA 2DQGL 2W1NA 1FDLL 4XXDA 3FFCA 1HKLL 5DEGA 4L4VD 3IFOB 3FQXB 3O41B 1OVZA 2CK0H 2VDNH 1I9JL 3X3FL 1HEZA 3VXUB 5C6TH 1T1ZA 4XP6L 1UQSB 5EO0A 3SE3C 1J8HB 3S88H 4P9HL 1B9ZA 3BKYH 4I48A 4OGZA 3EFFA 1LO4H 3T08A 2JTDA 3VW3L 1HQ4B 4BUHA 4C83B 1REIA 5IIEA 1FSKC 2NNAA 5T33H 2IBGA 4HUWB 1DR9A 4PJFE 2PR4L 4G6JL 4J4PC 4JFED 5C09E 1CT8B 3G6DH 1I7ZA 5E6IA 2FHCA 1NMAL 3IDYC 5EORL 3SY0A 2RFXA 4LSQL 4EZMA 3OAZK 4CVUA 4AENB 4B0MM 3IJSB 3NIDE 3P30L 4YX2L 4L5FH 4M6ML 5TE4L 4JG0H 1XGUA 1YQ2A 5IW1B 5DJZA 4IDLA 1NGWA 4NRYB 5C0AE 4ZXBA 1CFSA 3O11B 2B4CH 3GMMB 3ULVD 5D72L 1CE6B 2BVTA 3B9KC 4FQHA 4YPJA 1RZFL 4LVOB 4DKFH 1A4JA 3T0XA 5KW9H 4X7SH 2NQCA 4N8PA 4K94L 3T0BA 4Z7OE 3BP6A 2CO6B 4IHOB 3TV3L 1VGEH 2V5TA 4KK8C 3HKFA 5D5MF 3QDMA 2P5WA 1R5IB 1CICC 2CGRH 1M6OB 4F7PB 4Q2ZB 1AGEB 3RWDA 5AYUH 1JFQL 1EIBA 4GW1B 4PJAF 1JYWA 5KVDL 1NUFA 2EXYC 2OM5A 3T2OA 1XMWA 4D0CB 1G6RA 4P99A 4OLVL 5CEZL 1NPUA 5I1GH 3WHE1 3JBG7 4MD5B 2UWEB 3L3IB 1JHTA 4WGWB 2C4FU 1JI1A 2ZNXA 43CAB 1E0OB 2B39A 4JQIH 5JORB 4JQVC 1XF4B 5ANMB 4HFUH 3WFEH 1J1PH 2NY7H 2AXHA 2ICCA 3HNSH 3ARGC 2HWZH 2XA3A 4OKVB 3X3GL 2A9NH 3SE9H 4L3CB 3TPUB 2XTJB 4PB0H 5J6HA 3UZQA 3N50A 5D8JH 4L3EA 1JNNH 1BEYL 2CXGA 4HIXH 5D2NA 1UKTA 3JTSA 3MOQA 5I9QB 5FYLD 1JF6A 4WENB 3VWKA 2FIRT 1NC2B 4UV4L 4NQDB 3Q6GH 3GSXB 2VQ1A 2XFXA 3PDDA 2J8OA 5IMKA 5B4MC 1YY9D 1AHWA 1OW0A 3OJMB 3ZT5A 1PZ5B 5FO9B 2NPLX 5KSAC 3QJHA 3MGOA 2ED8A 4PIRF 4ZG1A 1Q94A 3QNZA 4N8VG 4Y88A 4Y4FC 2EO1A 5IW6B 4PRIE 1U8OA 4Y2DC 4EI6A 2VAAA 3HG1B 4CJ0A 3KYOB 3Q5YA 3CFKA 1TJHH 2BSRA 4HZLA 5FYJH 1XIWC 1ETZB 4WU5B 2SEBB 1WJ3A 2OTUA 4DKDC 4BZ2L 4QXUH 2VXVH 4W6WB 3CMGA 5J3HD 3SBWA 4HH9B 5T1LD 3QZWB 5D2LE 3HMXL 3U82B 1PY9A 3WSQL 1NMCC 2NY2D 3V5HB 2B20A 2LAGB 3GSWA 3MOBH 4KKLC 3HRPA 3ZDYE 3D0LA 1WBZB 4I3RL 1ZA3B 2AW2A 5C0CB 1E6OH 1QR1B 1ZT4A 4KVCL 3EJZC 4C56A 1T21B 2VZ3A 4PR5A 2DDQL 2D9QB 1QSEB 2VDKH 1J11A 2C4FT 3GZKA 4ZSOA 1P6FA 1Q1JH 2PCPB 5F7KC 2Z91B 1O5DT 2BVQA 1Q9WA 2XZZA 4FG6D 5I1HL 3UZEA 4GRLC 2OTPA 1PLGL 1AJ7L 3TPKA 3MZTA 1UC6A 3NZ8B 5HHVH 2IAND 3FO9A 2FH6A 1ZTXL 1QTYT 4JKPH 4HLZG 2B4CC 3ZTJH 5CWSA 3GSVB 3QIBC 1YEDB 1PAMA 1NC4D 5K9KB 4MGXA 3OAYK 1KJMB 3HAEA 2RBLA 4LRIA 3OX8B 2HFGH 3LS4L 1XR9A 2ADGA 1MAMH 1CYGA 1T0MA 3N1FC 4JAMA 5E6IC 5DJCA 2AXFA 4YWGH 2OI9B 2APVA 4NFCA 3SDCA 5AZEH 1RZJH 5KANG 1U0QA 3OZ9L 1AO7A 4UILL 1JNLH 1OGAB 3IB4A 4PP2A 4LLUA 3S98A 5J56B 4PTUA 1AXIB 1CK0H 1QRKA 4GW4B 4DKEH 1FRGH 1A6TB 5DRNA 1DP0A 2NY3B 1FZKA 3D85B 1RY7B 1WWWX 4M43H 5GRUL 4EN3A 3MRHB 5CGYD 1GOFA 1JE6A 1CG9B 2AJ3B 3G6JE 4DFIA 3QQ3B 2E8ZA 4YLQT 3DARA 3TCLB 3JWOH 3QDGD 2F54D 3LAFA 3ZKXC 2XQBL 4RX4D 1P9MC 1MWAH 4HF5L 4QRRE 4X80H 4OZGA 5D7LD 2NXYC 2VLJB 1ZSDA 4GMTL 1P7QD 1H5BA 1T0NB 4Z77A 2PNDA 4ODXA 1OQOA 3TBYA 4OZFB 4LF3A 2BVOB 2VB5A 5IVXF 3V79C 3SKNA 1D5MA 5KSVB 3QJFB 3O6LH 4ERSL 4G8FA 1QHPA 2A6KA 2X4NA 1A7PL 2IPTH 1NDGA 3MRRA 3H7BA 4NRXB 2X4UA 5HHOB 4O5LL 1T1YA 3UROR 5F6IB 4WJ5A 2VDPH 1G7HB 4LARH 4PJ8D 5DURB 3ILQD 2UVFA 1VCAA 4DFHA 2Q7NA 4PGZA 1ITBB 1YNLL 3SDAD 4OAWA 1XGRB 1PFCA 4D9QE 3MYJA 4Z5RB 1TCRB 4Y5YB 2YK1H 3UXFA 1MCBA 2AEQL 4KRPC 4X6EA 1YUHB 4IRSD 4OBSA 1RZ7L 1G7IA 3QUMB 4UT9L 4TRPL 3VXQB 4GLRI 3GJFB 5FEBA 1AFVH 3RKDD 5I19L 1AGFB 2R2EA 4X5XB 4LSDA 3VGAC 1NUNB 3M8OL 2EEDA 3P0GB 1OW0C 4EVNA 3HZKA 2YPVH 5F9OL 1LEGA 5T3ZE 4GG6B 5EOTA 4JRWA 3MRDA 2FDBP 1VGKA 2BNQA 5I0ZA 1TVHA 3IF1A 3RWJB 2ATPA 1A0QH 3EAKA 4L8DA 2QJDA 3ZYIA 3VRJB 4W4OC 5L8LB 4HIIB 5DUML 1MLCB 3HZYB 4G6KL 4KJQC 2GQHA 4M1GL 2IAMA 3TBSA 5CHNB 2DBLL 1CGSL 3OKKA 32C2B 4YDJB 1K9TA 4GAJH 4S1QH 4XPTH 3JXAA 43C9A 3RKPA 4ODHH 2DQTH 3P9MB 1P4IL 1TCMA 1V7MH 3I75B 1SY6A 1TENA 2QR0B 1RUPH 2H9GA 5I1DA 2BNUB 1P84J 1T0PB 3GB7B 4HWBL 1F2XK 2DQGH 4LCIL 1FDLH 1A5FH 1ZKAA 4QCIB 5DI8B 1V3LA 4M6NL 1XCTA 3UPAA 5J9PA 1DQQA 4GT7A 4MB3A 6FABL 5JQ6L 2R0ZL 3HUJF 3O3AB 5BXFA 1FG2B 4XP6H 3RY5A 4X6CF 3UTPD 4RNRB 4P9MH 3ZE2F 4Q6IB 1ZA6B 5GZOD 5L9DH 3RWIB 5BV7H 4O02H 3D2UD 3QUZA 3EFDH 3GSOA 3V5KA 5DT1H 5E03A 1F58H 2BFVL 1X7QB 3T4AA 3RVVC 3C6LD 4L8CB 3PV6B 4WO4C 3OGCA 4NCC2 4UV7H 5EORH 3KPQB 3QDAA 2GAZB 4GMSH 3LKNA 1VDGA 4LSQH 3VD4A 2WWMD 5JW4Q 1G7PA 4NQSB 3RY6A 2WQRA 4XGZB 4OZIA 2ID5A 3P30H 1CXFA 2MSPA 3VXRE 4YX2H 5I17B 1Z0NA 2UY7A 1U91B 5E94A 4GRMB 2BSSB 5TE4H 1NANH 4LFHD 3LN5A 3DETC 4FXKA 3ARED 1KC5L 5J57B 5FGBC 1LD9B 4R4NC 5HYIA 1XF2A 2XWJA 3T0VA 3J7HA 4E5XA 1DBBL 3RWHB 2HJKB 5F9WB 3O4LA 1A3LL 4XVJH 1WAAA 4GS7C 2HLAB 1I1AD 3TV3H 5JW3L 4LPWA 4KWUA 1ZWIB 2HTLD 3MR9A 3WMSA 2VDMH 3QG6B 4K3GA 1NGPL 4C58B 5EC1B 4LCWA 1PYWA 4RAUB 4PJ7F 3VD3A 3QO1B 5J1TC 5KVGL 3MXWL 1DN2A 2C3VB 2APTA 2ICEA 4Y5XC 3K8KA 4I18B 4PJ9A 5E9DB 5FDYA 1A7QL 5IHUL 3TZVB 1FE8L 5ID1B 2B1HH 4K07A 1KXVC 3MGTA 5C1MB 4OUOA 1ND0B 3O6ML 4HKJB 1RHHA 2YR3A 3O6FC 1EGJA 1CXHA 1MCHA 1H5BC 1J88A 4OCXL 5EUKA 1H3PL 1VFBA 1WICA 1BVLA 5GRYA 4O51A 3VFUB 2QKIB 3O3EA 1FYTA 4JN2A 2ENSA 4U2YA 1MRDH 2DI7A 4LSVH 4XWOC 3CU1A 3DRTA 1IQWH 1C08A 1J86A 3BD4A 1YPZA 2IF7A 4AMKH 5C09D 3WE6B 5F7HA 5HYJA 3RY4A 1B88A 1JMZA 1MCSA 1UM5L 2ZSVB 3VFVB 4UV4H 3E2HC 2JB5H 1BVKB 2OQJB 3SJVB 4YZFE 1AXSA 4OCLC 4U1SA 4JFDA 5F44A 4OF8A 2APXA 3UTSA 1QACA 1MVUB 5GRZA 3ULVL 1SBBA 4NM8H 4P3DA 5A40E 2R1YA 1CGYA 1OTTC 4MQ7B 1ACYH 4HMDA 3VWJC 2I26N 7CGTA 4I4WB 5C0AD 3P4OB 4PRDA 2OP4L 4JEGB 1V3KA 4H1LH 5JIHA 1JP5A 2X09A 4M48L 3ZSSA 2IWGA 2QSVA 5ITFB 1FLTX 1PKQE 1IJ9A 2I9LA 3GIVA 1AKJA 3QDJA 1LHZA 4LLWB 2W9EL 3AAZA 4K8RL 4UQ2A 4JM2C 3AM8A 2E9IA 3QEHB 4K3DL 1H8OA 1O7VA 4X8JB 2B2XH 4S1RH 5T1MB 4MAYA 1KB5H 2AEPH 4X7EC 1QLFB 3WSQH 2GT9A 5BV7C 4Q9RL 1MSPA 3T77A 1KIQA 4LHUG 1EO8L 2RGSA 1I9RH 4LDEB 4O00A 5IFJA 1IILE 4CNIA 4HKBA 4F9PC 2KBGA 3FB7A 4KVCH 2VXSL 4QXGH 3TN0A 3F7YB 3PDOB 2DDQH 5GSVB 2W65B 1QSFE 4WW1B 1FFOB 5L2KE 1FQ9C 5BZDB 4WDIB 1GC1L 4FQXD 5I1HH 4NNYB 5EU6E 1MNUH 5CZKA 2R39A 3CLFL 3QUXC 4QHLB 1NCWL 2Q3AA 3GKZA 4X0KB 3S6CA 4WI9A 1C16A 5DDHB 3FQRA 1DQLH 1JTTA 2D7OA 2H6PA 2R4RL 5DRZB 4ZFFA 4J23A 1YNTB 4FQ1L 3EUUA 1S9VA 5ICYA 2V9RA 2IPKB 2EE9A 3S97C 5DFVD 3BVNB 1X5HA 2BOBB 1S78C 3K3QA 4TUOB 2ILLA 4HUNB 4XHJD 5EULV 3ARBA 4QY8A 3HE6C 5F8QC 2Y36L 2R0WH 5KOVC 3VA6A 3FQNB 1KEML 4BQCA 5IB3A 3T8XB 1S7UA 3TFKD 3CFJB 3OZ9H 4E41E 4UILH 5GZNC 1LP9B 3RBSA 3QIWA 1X6LA 4PRID 2ZPKH 3ZO0A 3V8CA 4OQ1A 3A67L 1U3HC 1EEYA 1A02N 4ELMF 3NA9L 4MJ4A 2P7TB 1FCGA 2JJTC 1YEIL 4L8SA 4U33A 2IG2H 3TM6A 5SX5H 4P2RB 3BWUC 4X99B 3QA3A 3RFZC 3CDYA 4H5SA 1ZEAH 1Q9LB 2EDJA 3ARDD 2XOTA 4PJDF 4Z7VB 2EZ0C 4NKOA 4L4TA 3FO0H 5CJQH 4PLKD 1FBIL 4EIZC 1FIEA 3DX7A 1HYSD 1MCWM 1QBAA 4NUJA 2D0HA 2W0FB 2A6IA 2V17L 3SOBH 2EECA 1NCAL 3PV7A 1B4JH 3BP7B 2O5XH 5JZ7D 4JKKA 4JZJA 1JN6B 2A6DA 2AQ2A 4X4YA 2ITDA 3Q5TA 2YC1A 4ZOBA 4BKLB 4LIQL 4YNYB 4C55A 3KPRE 4LCCA 1XGYL 5F88B 2VLKB 3FONA 4O5LH 2I25N 3NCCB 2ESVD 1IZJA 1KPUB 1OCWH 1BOYA 1DLHB 1QFWL 1A7OL 1MH5A 2AI0L 3QRGH 3TYFA 2DQFB 4H0GA 3KPMA 1P4BH 3RZCC 5F1KC 1SEQL 2QQNH 1PDKA 1YNLH 5ACMA 2YA1A 4NM4L 5FOBB 2I9TB 3IETB 1FVCA 3LCYA 2VDQH 1G0XA 5DMIH 4BSWA 3PF2A 2R15A 2AEQH 2I24N 3RHWK 4YC2B 4KDTC 2ATKA 1A9EA 1LVEA 2HT3C 5IF0B 4PRHA 1B6DA 3MUZ1 5L7XH 4JJHA 2PO6D 2C7UA 4NN7C 1KB9J 4UT9H 4NZDA 4TRPH 1S7XB 4N8VA 2FGWH 4UT7L 3S34H 1UB5B 1XF3A 2XTLA 4ZAKC 2FIKB 3WCYA 3C60A 2JCCF 2FLBT 2PXYA 4R4FL 3DUHA 3G5XA 3LQAH 4K7PL 4PGBA 1KYOJ 4U3HA 1Q0YH 1TNMA 4LMQI 3RZWA 4KJYA 1G7LA 1S7RA 3IJHB 1NDMA 1CFNA 5KZCB 1FN4B 2B8OT 1G1YA 3QG7H 1EEQA 1L7IL 1WITA 1MHPH 1I8KA 3VXOA 2MCPL 5SX4I 5ETUB 5EUOA 4G6KH 2XN9B 4CDHA 2A77L 3S4SB 3HNTL 2DBLH 1CGSH 2Y5TA 4QRQA 2BC4A 4QRRD 1M05A 1OM3H 4DEPC 5IR1A 4DCQA 2DL9A 1WV7T 1Y6MR 1OWWA 5E7FA 2MKLC 3IDNA 1UEMA 3DUUB 3ECBB 3MRGA 3NACL 2H1PL 3C09C 4LVHB 5I1IL 1FL3A 1WBXB 5EOCH 1R3JB 1MHHB 4J3WA 6FABH 4WTXA 4M7LT 1U8MB 1A1NB 1HZHL 4ZS7L 4UB0H 1VFUA 3TN0C 4APQD 3K4ZA 5L0QB 4MCZA 1MREH 2KZWA 2MHAA 1DBAL 2FJGA 4NC1C 3MBEB 4MXWL 4U7KA 3ULUH 5HDBF 3QXDA 4YGAB 1M4KA 2W60B 2ZUXA 1A9BB 5CFHA 2VL4A 1LO2L 2BFVH 4RMRA 1X5GA 2AV7A 5J6GA 4HT1H 1UCTA 4ZOAA 2F58L 2F19L 4PGEA 4UIMA 1YEEL 4P2OC 4NZTH 3BW9A 1M71B 3QDGB 1JPGA 2DJSA 4JDTL 1IMHC 1QG3A 5F7UA 1MIML 4PJHE 4XBEH 5DD6A 3BHBB 1ZS8A 1UXSB 1I8MA 3QFDB 2R2HB 2BRRL 4TNVK 1CTOA 2DQUL 4F15B 4OI8A 1BX2A 1QFOA 3MJ8B 1KC5H 3BH8B 4QGTA 1V3MA 1NEZB 5GGVH 3HLAA 1FNGA 5H2BA 3VRIA 1DBBH 2FECL 4U1MA 3CX5J 2A1WL 3QIUA 4WI4A 2H41A 2A6JA 3RIFK 3WDHA 1QLEL 3C08L 4LQFL 4N0UB 5IOPA 2VNCA 2B5IB 1FLRL 1NGPH 1TQBC 2EC8A 1Z2KA 4TTDC 1X5JA 3UJTL 3F6IA 4S0SD 3IDIA 3MXWH 3DVGA 4BELD 4J3TA 4JKWA 2XRAL 1A7QH 5IHUH 1F90L 1FE8H 1FV1A 1FGVH 2BVUA 4HGWA 1FC2D 4KMLB 3RVTD 4IRSB 3QI9B 3E3QE 1W0WA 5ESQB 2CMRL 4JO1L 3C5SA 2LVEA 4BQ8A 1NAKL 5GISH 2DWEB 3OXRA 1B0WA 3VXTB 4HIEA 5CBAB 1ZLVK 3L9RA 5C0BE 4Y19A 3FZUC 2BHYA 3TIDB 4JVUA 2PKDA 1INEH 3KS0J 4AT6B 3FB8B 3BH9B 3LQAC 3KPNA 4N1CA 3BRGC 4O9HH 3NFSH 2X1QA 1UM6L 3TVMA 3PWJA 4RFOL 3SCMA 1T6VN 1NBQA 2JJVA 1IVLA 4WWKD 4YR6A 3MRMA 4PBWD 5ADOH 1JF1B 1HH9A 1JWUA 3NCYS 4GLRH 4JGUA 1OQXA 4TPRH 4P5TA 1U8JA 4MAUL 4OF0A 4KKCD 4DZ8B 3VXRD 1PZUB 2CLRB 2OYPA 5C07E 4PJGE 1NCBL 5IB2B 4QOKB 1I3GL 4TSCL 1HHKA 4NO0A 1CD1A 3JTTA 2OP4H 5L2JA 2GW5A 2XKUA 5DHVH 4UT6L 3VD9A 4HMCA 4OLXH 3FTGB 4PJBE 2W91A 3FN0H 5D93C 3ZE0F 1T4KA 4WWID 4Z78B 3L5WA 1BD2A 3MFFA 1A6AA 1CIUA 3LPGA 2W9EH 4KMQA 1R3HB 1AGCB 1FZOB 1I75A 1KACB 1Z6JT 2V6HA 3P40A 4MA8L 4KROC 3FL7A 4Y5VB 3OKMA 1G0DA 2WWKO 4OGAC 1FNAA 5GS0D 4BFEA 3QZWG 4DAGH 1EDQA 1QQDB 3O9WA 4GXVH 3WIFA 2MKWA 3ULUC 2YRPA 1XR8B 3UTZB 3BSZH 1CFQA 5DA0B 5DMGC 2DLTA 2HRLA 2HMID 1NCNA 4HBQA 3MCKB 3SDDA 4UAOC 4YXHL 1T04B 4HQQL 5EOQL 3HR6A 3U79A 4OLUH 3WO4C 3W9EA 2X4PB 3DXAE 3BGAA 1FIGH 3L3HA 4ZOEA 4ZUSB 1NLBL 5FYLH 1NCWH 4PJCA 5ISZE 4WY7L 3ZDXE 3MA7A 4X6DA 2WBWB 2WBJC 1VADA 2R4RH 4NWTL 2YMXL 3V6ZB 1D9KA 1RJLB 4FQ1H 3AREB 12E8L 4OZGF 4U3XA 3BYYA 5IBLC 5CKAA 1HHHB 4E0RB 3MBXH 3HMWL 2VLRA 2EE3A 3B5HA 2BOCA 4JRYB 2FL5A 5EDXA 3KR3L 4DGVL 3VH8G 1I1AB 3UTTB 5T5NG 1WIUA 3D39B 4KDVA 4RDQG 5L88H 1UWGL 3RVUD 1BAFH 5DO2C 1ED3A 1JUFA 4TUJA 3CFDA 4S11A 3QHFH 5J13B 1X5IA 2CIKB 4MD0B 4LP5A 4YEFA 3L5XL 2EXWD 3A67H 1MY7A 3LEYL 3V4VL 5JTWA 2I07B 5C08B 1NCCL 3B5GA 3O8XD 4KUZL 3BUTA 1LE5A 5DJ2B 1YEIH 4WEBH 4PY8J 1IARB 4QRPB 5I1LB 4GQPH 3L6FB 2CKBA 2V7HB 2VE6B 4LBEA 5KTEL 4MDJB 5B8CA 4WHYH 1XH3A 3EYVB 1S9XB 2P5EA 1K5NB 4YHKL 4NUGH 5KSUA 2FEEI 3G04A 3MJ7B 3ULSB 2WINA 3FAXA 1BBDL 1OY3B 2BY1A 4OLWL 4LCYB 1PG7L 4U6HB 4J3UA 3B43A 4OZFG 4N0CC 2V17H 1ZHBA 1R3KA 5IM7A 2R1WB 4XAWH 3RNKA 5ICZA 3L7EA 3MOAL 3REVA 5L2KD 3RNQA 3QUYA 5DJ0A 5EIIB 4I0PA 3IGAB 5GS1A 1IGIL 5EU6D 4ZD3H 4JLRB 1RFDL 4GBXD 3G5YA 4NO3A 3IVKB 1Q9OB 5ENWB 1O0VA 5C0AB 4P5MA 1UACH 3BWAA 5EBWB 4DQOH 1ZK9A 2ZUQB 3DRQB 4DVBA 3DWTA 1ZVYA 1EFXD 4XNZB 1J10A 2JK5A 4GQ9H 1KXTB 2YUZA 3CFBB 3T0EA 2EIZB 5K9JH 1TQCC 3B2UD 5D7JA 4Y4HD 1QRNA 4XC3H 1VKXA 3VDBA 1F4HA 3OKDB 1QBML 2JIXB 3H9SE 1NAML 4E41D 1EJ6A 4IDJL 2BXZA 5TGBB 1BIIB 4GKZA 4JFOA 4FZEH 5JHDE 3QUKB 2RHEA 4K7PH 1MFNA 4NKQB 4M02A 4X4MA 4XPFH 1OAUL 1MHCB 3PHOA 5GPRA 3B9EA 3DOSA 2DTSA 4XTRD 5HXMA 5DVNA 3U0PB 5MENA 2CLVB 1L7IH 3OKNB 4FQXB 3HB3C 2QLVB 3MV9A 3MJGX 1BLNA 3A6BL 4YDKH 1SJEB 2DM7A 2Q8BL 3BPLB 4GFTB 3D18B 3HNTH 4LHUA 4FQPA 3T09A 2HRPL 4OZIF 2FR4B 3RP1A 4LSSL 4G9FE 4PJ7B 4OZHE 5EO9B 5D9SA 1MFDL 5GGRA 3DTXA 1E4XL 1S9WA 4NHUA 4KVNH 2YS4A 1T2JA 2WW8A 5D1QD 1A3RH 2H1PH 3CSPA 5I1IH 2MQ0A 3RA7L 3KPRD 4DGYH 2AV1B 4J2XA 1INDH 3C9NB 3MA9H 2MNUA 4ZS7H 2VZVA 4OF5A 4O2EB 1BFTA 4OD2B 5IQ7H 5JW4N 4JFPB 2VABA 3HC3L 1QFPA 1W8OA 4I5BA 2R8SL 3TBVB 1DBAH 1NUDA 3CCHA 4AYFA 3MRKB 5FO7A 4MXWH 4RMUA 3RGVD 2IALA 2VUOA 3FQUB 5D1XD 4OV6F 1MI5A 4MHHI 1NAMB 4K2UL 5BO1L 5GGUA 4RGNB 4E42A 2ZCHL 3MNZA 2DYPB 5D4QA 4MX7B 1BQLL 5J3HC 4YDIL 2F19H 1HXYB 3DIFA 1TZIA 1D9KC 2QHLA 3GSQB 2G5BA 5CILH 5FKAA 2PYED 2FYYB 1YEHH 4GAYA 3RUGE 3EOAA 1MIMH 5C92A 4MMXC 2AJXH 1ZT7A 5CBEA 3MNWA 4V2CB 2BRRH 3RDTA 4XCNA 3I84A 3BDYL 5DJAB 3GJEB 2VOTA 5DS8B 2WWKT 3SDYL 3UZVB 4XP5L 3UYOD 4FG6C 5SWZA 1QKZH 3R8BB 5C8JB 3QXUA 5M94B 4P4KD 1HWGB 3PGFL 3C5ZB 4U1NA 4MCYA 1YPZF 1BM3L 3X13B 4FHBD 1ZAGA 3D48R 1SJHA 1PJ9A 4YAQB 3GKWL 4OUUA 4DK6A 3T1FB 5GS2D 5I8EB 1RIHL 2ZUYA 3C08H 3OQ3B 4M6AA 1BFSA 1J05B 4HSQA 1JNHB 2CXKA 5MI0C 3AFLA 3DV4A 4OM0H 3MCLL 4F57L 4KQ4H 4NHCL 1EXUB 3TNMB 3MUJA 5FUCE 1OT2A 4XPGH 4X6BB 2P24A 2QBWA 1MJ8L 2XA8H 3NCJL 3ARTA 3NIFF 1ONQB 3NBNA 3BE1L 3O3UN 5HHNA 5BVPL 4KZEL 2FLRT 3PABA 3RHWF 4CDGC 2VERN 3OKEA 5I76B 4LLYB 1FNSL 3IRZA 3ZHKA 4A2LA 1UH4A 4M61A 3O3DA 4XNUH 4ZO8A 3E6FB 1KLFA 2NTFA 5C2BH 3GI9L 1MQKH 4AH2A 2F53A 1RUKH 2NXZC 5CP7B 4RFOH 4KJWD 3N1QC 3MCG1 3G6JB 2V2TA 5JHLL 1IE5A 1W72B 2E7LC 1UXWB 3LS5H 5T3ZL 2NZ9D 5DD5L 1FVDA 3RTQD 1NCBH 1KF9B 4QRRB 3KDMB 3LRGA 1EEZB 3TC9A 4CW1A 1I3GH 4DGIL 5I15H 4N90E 5LBSH 1TVBB 4YK4C 1D6VL 1XFPA 4UT6H 4RCAA 3V4PL 2BY0A 1CN4A 4GG8A 3DX6B 2V5MA 3WXWL 1OHQA 1P7KB 4ELMB 3VFNB 3EGSB 5SX4H 2DMKA 3QH3B 1F97A 5EZJA 2HVJA 4R96A 1BJMA 3RI5F 3SDAC 3ARXA 1ZVSA 5D7IA 5F7YC 3WS6A 2OLDA 1HHGA 4G8GE 3MRNB 3H0TB 4WU7A 3P77B 2ARJQ 1KLUB 3V5DB 5F3BB 5HHQB 3JV6A 2KZ1B 2ZOLB 3KYMB 4GSDH 3V9FA 1DZBA 2A73B 3ZDZE 3IFOA 3FQXA 1UFUA 3O41A 4WHDA 4YEEA 4BFIB 3VXUA 3RKDC 5DZNA 4YHLL 1R24B 1UQSA 4YXHH 2VC2H 1DQJB 4JFFE 1J8HA 2X40A 3LB6D 2L7UA 5DQ9B 4JY6B 1WIOA 1HQ4A 5F7DA 4C83A 3MLXL 5C0BD 4O58L 2OCFD 4JY5L 2VO5A 4HUWA 5JXEA 3RAJL 2N4IA 1CT8A 3QPXH 5EIVA 2YMXH 5DXWA 2VZOA 1U8QA 2Y9RT 4HKXB 5FUOL 5T5FL 5EWIH 4AENA 5E08H 3I02B 4LVNB 2R56L 1DN0B 1W0VB 1ES0B 3K7UA 2H2SC 3Q2CA 4X4XB 2ED7A 3HPLB 1Z9SA 4HUXB 1EO5A 5C07D 3SGKA 4Y16D 1QBBA 4NRYA 4XXDB 3FFCB 3K74B 3O11A 3GMMA 1QUNA 4Z76A 1CE6A 5HHXL 2VQUA 4Z7UE 2JCCB 1BQHG 5DUPL 1XGQB 3L5XH 2DKUA 4HUKB 3LEYH 1FO0L 1VEMA 4I48B 5C0FB 5J4MA 4AEHH 3J8F7 4IHOA 1JHKH 1C1EL 3P0YL 4XZUB 5FHBL 3C87A 5AZ2L 1AD0A 4YFLI 3MLZH 5GZOC 3H42L 1M6OA 1U93B 4F7PA 1C12B 4Q2ZA 1AGEA 1IGCH 1AXTL 4GW1A 2NY1C 4IMLA 4LEXH 4D0CA 2R2BA 5JR1L 5FUZH 3ZE1E 5J8OA 2FJFA 3C6LC 4MD5A 2UWEA 5J06A 3ISWA 2DIBA 3L3IA 3MLYL 4YHYC 43CAA 5JORA 1XF4A 2YZ1A 1A8JH 5DJZB 4HPYH 5D1ZB 5BJTB 3MOAH 1S5IL 4EUPG 4OKVA 4PLJD 3TT1L 4W70A 3SE4A 4L3CA 1OLZA 3TPUA 3NN8B 1IGIH 4UU9B 5F7MC 5AG9A 3O6KL 5IB5A 4LPUA 4KI1A 5ISZD 5HGHB 4XP9L 5EUOF 5C0RL 5FB8B 2O61A 4NQDA 1FVEB 3GSXA 1HIML 4JRXA 1ZANH 3N0PB 3UO1L 5DMYA 3BKCL 3SHSA 2E6QA 5LXGL 1PZ5A 5FO9A 2DQDL 5DMKA 4OIIH 2AXGA 5IROC 3VMOA 4QEGA 4IRJA 3O2DA 5GGTH 1FO0B 3MV7D 1FGNL 4X5LA 5IW6A 1QBMH 5C0DB 1TDQA 4BK5A 4DVRL 2OXGA 4TTGA 3PP3H 2C1OB 3D3VB 4IDJH 1MLBA 3HG1A 3KYOA 4H88L 1I3RA 3QXAB 3QEQE 1DQDH 4YBHA 1N64L 1ETZA 4WU5A 2SEBA 2OR8A 4WI5A 2F15A 2VZTA 5J6HB 3PL6C 4EI5B 2K7QA 2YD1A 1D5BB 1X6NA 1MCJA 4HH9A 2WIIA 3JTSB 4XNMA 2EDXA 2F5AH 3QZWA 3QDME 2AABH 5FOJA 1N8ZA 3S4SG 3V5HA 2DLFH 2VQ1B 2FX8L 1ZHKB 1WBZA 4JFQB 1ZA3A 4UNUA 1EEUA 3EKCA 1QR1A 3HE7A 3P2TA 4LSSH 1T21A 4OT1L 3CXHK 2HYMA 5HHPB 1QSEA 1SBSH 3QNZB 2PCPA 1HCVA 4NKIH 2Z91A 1J0JA 4D2NA 1I7TA 1VFOA 2X4OB 1FPTL 4HW6A 4XX1E 2OSLB 2KQNA 1MRCL 1LO5B 2DM3A 3QQ4B 4MB5A 3WO3B 1GOHA 3ZKND 2NMSA 5AWNH 2BMKB 3L3OB 3GSVA 1YEDA 3QFJB 1KJMA 1TETL 1A14L 3CJJA 4MDIB 1N0LA 4S1SL 3O8XB 4MJ6B 4K2UH 5IP4A 4P3WA 4PJ5B 4LCUB 4U1GC 1EVUA 1BQLH 3GSWB 3EDJA 4XP1L 5CEXB 1KN2L 1H0DB 3D0LB 2A0LD 3U6RA 3S3JA 4C56B 4M00A 1OGAA 4Y1AE 2HVKB 5F93C 3TEUA 2EICA 3D25B 3ZYOA 3H9SD 2Y06L 2DQHL 4ZSOB 5TE7H 3LZFL 4GW4A 1CU4L 5JHDD 3HMXA 2UZXB 3D85A 4IM8A 3SGKC 2YD9A 3UTQB 3ZLQC 3MRHA 3SDXA 2IPUG 1CG9A 2Z31D 1P1ZB 3QQ3A 3BIBX 4MJIE 1QSFB 3TCLA 4W4NA 4LVOC 4U1IA 1OAXH 2V9TA 5B22A 3I50H 3GKWH 4LGPB 1UH2A 1T5XB 5GGQH 4BZ1H 1RIHH 2VLJA 3STBA 1XF5B 1W0YT 4OF7A 1MCQA 1QFUH 4NBZB 4G9FD 3MCLH 4UIKL 3WFCH 5A2KH 4HJGB 4OZFA 1PD6A 1TTFA 5DJCB 4Q74A 4QRSB 2AXFB 3ALXA 3CFCH 1N3NB 4XHJC 4QXWA 3UBXI 3ZTNL 4CVXB 2X9WA 4ELKB 1WUNT 3FMGL 5HHOA 3NZHL 5I73C 4LDLB 2R1XB 1CWVA 1CXKA 3KAAA 2AGJH 3S35L 4L9LB 3BE1H 1P4LB 4X7TB 4KZEH 4OSUL 4LPXA 2OL3H 1FNSH 4N0YH 4Z5RA 1TCRA 2FSEB 4Y5YA 4NFDA 4P2QB 3VI4E 3WIHH 1C7TA 4G3YH 5L6YL 1V05A 2HG5B 4QNPE 5GIRB 4OZGB 3R1GL 1JYNA 1YEKH 3GSNH 3ARDC 3VXQA 2I5YL 3KPLB 3U7WH 4HV8A 2NY4D 1AGFA 4X5XA 1HXMB 2F8OA 2CSPA 4LF3B 4LPVA 4ZTOL 3R0NA 4NO5B 3SKNB 2D4DA 2A6KB 3EOYG 2X4NB 3OF6A 4WNQB 3MRRB 3H6JA 4M1CD 2R29H 2CUMA 1D6VH 5I1JH 4WJ5B 5D7SH 3M17B 3RWJA 4JHWL 5F7EH 4X6DF 2GJ6D 5D1QB 3VRJA 1F3RB 5D70L 4OAWB 1MCIA 3HZYA 4AQOA 2IGFL 3HI5L 3DYPA 1IAMA 5FGCE 2F5BH 2MQCA 32C2A 4YDJA 4Y4KD 3GHBH 3DI2B 3P9MA 4OGYL 4X6EB 3S3SA 3BMVA 3DMMD 2QR0A 3GJFH 1IM9B 2BNUA 1G7IB 4FN0A 3MRJB 2ZUVA 4OCYH 5IHZB 3GB7A 3NTCL 4QHNB 2PO6C 5DI8A 4QCIA 1MPAH 5D1XB 1KCKA 1CLYL 3BP5B 2DTML 3BFOA 3MV8D 1QHOA 3O3AA 1FG2A 4C59B 4C4KO 4Z7QE 4RNRA 1H8NA 4GW5B 4OF6A 5FYKU 4Q6IA 5ICXA 4KV5F 3T4YB 2P8MB 4OM1L 3UDWC 5JLZA 3MLXH 4YO0B 3AY4C 4CMHB 4LFHG 3ARRA 3IAPA 3IXAB 3FRPG 3T04D 5DEFA 1X7QA 3PV6A 2IAMB 1N7ML 4XMPL 5F1SA 2LTQB 5E6YA 2GAZA 5FUOH 4DW2L 5GQBA 4R0LC 1S7WB 4NQSA 4JO4L 4XGZA 2R56H 2H9GB 5I17A 3OAYH 1DVFD 3AVEA 1BGXH 2QV2A 5ILTL 1U91A 1MJUL 4GRMA 2BSSA 2X4RB 4ZFZB 4ALAH 3BQUD 4ONFL 4UINL 5EFIB 3B9KD 1WCQA 3M1BB 2VITA 3W11C 3CXDH 3RL2B 3LKSB 5HHXH 2P8PB 4N90D 5EPMB 3P9LA 1LD9A 4WUKH 5DUPH 4HULB 4N1HB 2AJZA 4KK8D 2HJKA 1FZJB 1FNEB 2X10A 5BRZE 1CICD 3OAUH 1HQRB 1YEJH 4APQC 4LPTA 1C1EH 4HWBA 5GS0H 3P0YH 1ZWIA 3X12A 1YMME 4OCNC 4OGXH 1A6WL 3V6BR 1D5ZB 3QG6A 5EC1A 4RAUA 1AXTH 5TFSL 3QO1A 5BW7C 1KULA 3AGVA 3CMOL 2C3VA 3PHQB 3MRIA 2CRZA 1CBVH 1MCCA 4G8GD 4X83A 3TZVA 1ZE3C 4FFYL 4J3SA 5ID1A 3MLYH 6CGTA 1CDGA 1T2XA 4U1KB 3U46A 5E94B 2CR6A 4HKJA 1CLOL 1UZ6E 2VSDA 4M62H 4AM0B 2AJVL 1HYRC 3VFUA 1BBJB 2QKIA 1R0AH 4YHML 3KJ6L 4JFFD 1S5IH 2OZ4H 3TT1H 1UGNA 3U4EA 3TESA 2XWJB 5CJOL 3O6KH 1OAQL 1N26A 4KU1A 2BZDA 1J12A 4Z9KB 3LQMA 4KI5C 5ALCH 3WE6A 5C0RH 4XWGL 2ZSVA 4PRPA 3MR9B 5B4MD 3VFVA 5I8KH 5C7XL 4F7EB 1QA9B 1BVKA 1WBYB 4HS3B 1G7JB 1JCKA 3SJVA 3LRHA 4R26H 1X4XA 5EU5B 3K1KC 1T6WA 3BYTA 1MVUA 2DQEH 5JOPE 1E4KC 3O3BB 1T2QL 4I4WA 4JR9H 3P4OA 4J3OC 1FGNH 4CVZB 4C57C 2ENYA 2D03H 4YHZL 4KTDL 4O51B 4N8CH 1SYVB 1XIWD 4TSAL 3F58L 3KXFE 1XGPB 4H88H 5F7NC 1H3VA 5DMJB 4LLWA 4WW2C 3IDJB 1N64H 3QEHA 4TUKL 2D31A 4MMZC 1WAAE 2DI9A 4F7CB 5T1MA 4TNWK 4OFYD 3EZ8A 1QLFA 1GOGA 3D69B 5DQDL 2ZCKL 2FX8H 1J1OL 2P46B 3O81A 4JO3L 4WWKC 5DD0H 4GRWE 5E2TH 4TVPE 5INCB 1G9EA 4OT1H 3PDOA 5GSVA 2W65A 4GRLD 1FFOA 4WW1A 3AS0A 3PQYE 3OKLB 5BZDA 4WDIA 1FPTH 4PFEA 4PD4K 4NNYA 4Q9QL 2ADFL 1RJZB 1VPOL 3W5NA 5MHSE 1OAZL 4X0KA 1MRCH 2JJUA 1FYTE 5DDHA 2VDRL 3QIBD 3GK8H 5DRZA 3R4DA 1YNTA 4R2GB 2IPKA 5JW4R 2AAVA 4KY1H 1T7ZA 2W9DL 1OARL 3IKCB 1DDHB 3BVNA 1G9NL 5HYJE 3N1PC 4KTEL 3PXJA 4S1SH 2BOBA 5E6ID 4K3JL 5J12B 3SKOA 4TUOA 5IWLC 4DN3H 5GS0C 1KN2H 1Z3GL 3FQNA 3GMOA 1DBJH 4JFDE 4U3CA 2E3VA 3T8XA 3CFJA 4YJZL 2DD8L 5GHWH 2FCBA 1X3DA 3ZYZA 1LP9A 1MRFL 1BQHA 1XF1A 2EDLA 3LZFH 3FKUS 3VFPB 1JWMB 2P7TA 2IQ9H 5AG8A 4XNXH 3STLB 5IHLB 5DHYB 3NH7H 4NQXB 2R23B 4P2RA 4KTYA 4PV8B 4X99A 3EO9L 1NFIB 2JJSA 3L1OL 4RWYH 4NQEB 3DXAB 5F9WC 3QDMD 2P5WD 4Z7VA 5L8JB 2IFFH 1IGFL 4CN1A 1RUQH 5I18L 1FNLA 3VG9C 1IGMH 3ARFC 1KCRH 5D6DC 4C4KT 3UJIH 4PG2A 3S9DB 1II4E 2W0FA 3G9AB 4F8QA 4I77L 2ARJA 1F11B 4HJJL 1JN6A 4I18C 5HHME 5ESVB 4YNYA 1QSZA 4EUPA 5KG9B 3TZVC 5F88A 4LASH 1DLFL 2VLKA 4MXQC 3FMGH 1JGLH 3NZHH 5HGBB 3CVHH 1KPUA 4NC1E 3OKOB 1DLHA 4K3EL 2XV6B 4CL7A 3S35H 4JHZA 1V7NL 5FOBA 2I9TA 3IETA 4KRPD 5LGHL 3UAJC 1U6AL 2ZKHH 4DKAA 5D7IF 3ELAT 5DFTA 2E27H 5L6YH 4NQVB 2XQYK 3IXTB 5IF0A 5I74C 5GJTL 4A6YL 4JVPA 3TO4C 1IQDB 3Q3GB 5C0JB 4PY8I 1S7XA 2VXTH 1UB5A 1DE4B 2FIKA 1LMKA 4Y1AD 3GBML 3LD8C 4G80A 5EA0L 3P4NA 2W59A 4EBQL 1LDSA 1TNNA 1T7WA 2ITDB 3SGDI 1PG7X 3V4UH 4H0HB 1TTGA 1NFDF 1IBGL 4OCRL 4QRUA 3IJHA 1RMFL 1FN4A 1CD9B 2VXUH 4WI2A 1RZKH 5GS2H 2PTTB 1GPOL 1T83A 4MJID 4UTAL 3KPMB 4JGJA 4WFHE 5ETUA 4ONHB 1FVCB 1U95B 3S4SA 1EFQA 4WFGE 3C2AL 1MFCH 1VEPA 3D87B 3SQBA 4OGYH 4ORZC 1TVDA 3EO1B 3MPCA 1TJIL 4Z95H 4HCRL 5E4EB 4OI9A 2QL1A 3DUUA 1W8NA 4L4TE 3ECBA 5JIPA 4X98B 3NTCH 3QAZC 3EBAA 5DK3A 1HHJB 3Q6FB 4G8EB 1WBXA 3VRLE 3A6OA 1MHHA 3C60B 1PX3A 4XCEB 1JK8B 3TJEL 2PXYB 5EBGA 1K8IB 1QD0A 1U8MA 1A1NA 4WGVB 1U36A 4A6YB 5KS9E 1MOEA 1L7TL 5HYQB 1C5CH 4OM1H 3MBEA 1SJVA 4IJ3C 4OBRA 2W60A 2J3SA 3FCTB 3LIZL 4MD4B 4K9EL 1MIEL 3UC0H 2BC4B 1M05B 1YJDL 2EH7H 4DCQB 1JZ3A 4DUVA 4DW2H 2X4TB 4PRHE 3U2SB 5K9OB 1GAFH 5GJSH 4Z7NE 4JO4H 1M71A 4K23H 5I1KH 5I30L 3QDGA 4H26B 2F54A 5F9DC 1UCBL 2A74B 3CPLB 4C54A 4RMVA 3BHBA 2X2YA 2X7LA 3Q1SH 1CVRA 4PJEF 2GKIA 4LSPL 3QFDA 2DJ4A 2R2HA 1P7QA 5HPMB 1FJ1B 3MJ8A 4FTVB 4XMLL 3RX7A 3R06B 1IT9H 5KSBF 1E28B 4EN3D 4X7DC 4NJ9H 3UX9B 1EK3A 3UPRA 4LAJH 5B3JF 3QXDB 4N0UA 4AL8H 3DO7B 3VGFA 1A6WH 3OB0H 1WVZA 4MA1B 3U0WL 3RPIA 1K85A 4HWZB 3CMOH 3RGVC 4QYOB 4P2CG 4ODTL 4UIMB 4KHTH 2FO4B 3MLVL 3NABH 5F96L 2IEPA 4NZRH 3LOWA 3WUWB 4LU5L 4IRSA 1QZ1A 2NR6C 3QI9A 2CUHA 5ESQA 1UYWL 1A1OB 3W9DB 4XCFL 3NGBB 1CLOH 4PG2C 4TN9A 1H3UA 4TULL 4MHHG 1HINH 2DWEA 4XCCH 3HI6H 2ITCB 2YRZA 3VXTA 4WUUE 3KJ6H 4U4BA 3TIDA 5ID0B 1YZZA 2IADB 5E2WL 2HTKC 2G9HB 5A16A 1YDPA 4AT6A 5BMFL 3TT3L 3U9PH 3FB8A 1OAQH 4P4KC 4RGMC 5B39G 3BD3A 5ECJE 4IIQC 7FABL 1QBLH 2EDDA 1JF1A 1FFPB 4HX1B 3LH2H 1RZKC 4TSBH 1GXEA 4KJPC 2QQLH 3DVGB 1JYVA 2JB6A 3BT2L 4DZ8A 1OTTD 2CLRA 3EYUH 3ARWA 3VWJD 1JHLL 5IB2A 4IBLT 4L4VE 3FB5B 1A6ZB 3IJYA 1FV1B 4QOKA 4MA7L 5E00B 3S37X 5C9JB 3DMMB 4G7VL 5E8OB 8CGTA 1D3CA 1RJYA 1ADQH 3FTGA 4NOBA 2HH0L 4HS6B 3WFBH 3EYOB 4Z78A 5E95B 4KTDH 3LMJL 1CLCA 3F58H 4JM2D 1T89C 3ZKSD 1CL7L 3MUHL 4MNQE 2B0SH 5E8DL 1AGCA 2AKRB 1KFAL 2R9HC 1FZOA 2BNQD 2XZCL 4Y5VA 1YMMD 5IEKB 3OB8A 4U49A 3O0RH 1FSKB 1NCTA 1MJ7L 4IMKA 1QQDA 5T5NF 3DBXB 1WC7B 3SCMB 1JWUB 4RDQF 1UJTA 1XR8A 5B3NA 4KJWC 4KH2A 2LABA 3QWQB 1KIRB 3LDBC 3HFMH 5TDPB 3UJJH 3MCKA 1BHGA 1L6ZA 5I1AB 1T04A 3RVXC 4JQXA 2NZ9C 3QUXD 3RTQC 4KRMB 1HHKB 2X4PA 3SDXF 4Q9QH 5KOMC 2ADFH 3H8NA 4LVHC 4ZUSA 3LN9A 3VFGH 1K4DB 4CBPA 3NIGF 1WF5A 3ES6B 4N0RA 4F7TB 3FRPA 3EO0A 5HD8D 3V6ZA 1RJLA 5ALBL 3VXSE 3AREA 1MF2H 4LOUC 1HHHA 4IRZL 5DLML 2FEDC 3MBEC 1G9NH 4JRYA 4NZUL 1I1AA 5SWSB 1KELL 4M7LL 4MSWB 1Q8MA 3UYRL 1X5ZA 3WIFB 3D39A 3OV6A 1FG9C 1H3XA 5GZND 1CFQB 5JOPD 3EOBB 2CK0L 2VDNL 4MD0A 2EYSB 1DUZA 5IBTL 5C6TL 1KJ2H 3RIAK 4OFDA 3S36L 3SDDB 4CN4A 1MRFH 3S88L 3O45B 3BKYL 2I07A 5C08A 1VESA 3SKMA 3SKUD 4CKVX 1LO4L 4MNHB 3KXFD 3U7YH 1NGQL 2EDKA 4NQCB 3LB6C 5DJ2A 5F1NA 5T33L 3T3ME 3ARGB 4K3HA 4F15C 3L6FA 1ZV5A 2NYYC 4F37K 2V7HA 2VE6A 4X6DB 3EO9H 3IDMB 3MYZA 1F45A 2EZ0D 1MCPH 3EYVA 4RAHA 1K5NA 1CGXA 2AK1L 3MJ7A 5HPOA 1RURH 3ULSA 1IGFH 4NFBA 4LCWD 4L5FL 2FL5B 5C09A 3W81A 2VLME 4TVPD 3KGRA 2B5IC 4U6HA 4XXCA 4JG0L 4I77H 2R1WA 5HI5D 5CZVH 1BWWA 2B4CL 3PQYD 5KSAB 4M7ZC 4Y16C 4FFVD 1JGEB 1DLFH 1EH9A 3IGAA 4DKFL 4JLRA 5TDOA 2GJZB 5KW9L 4Y4FB 5MHSD 3IVKA 2VISB 3LKQB 4X7SL 1QFHA 2R4SH 1Q9OA 1FYTD 2M8XA 4Y2DB 5ENWA 5C0AA 1V7NH 4FMFA 3T3PF 2YPKA 3GRWL 3MO1B 5EBMB 2CGRL 4PJCE 2HT3D 4Z7UB 5IMLB 5AYUL 4EJ1C 4ZUUA 2Z35B 1IEBB 1P2CA 3CFBA 4LSRL 1XH3B 2EIZA 5HYJD 1P6AB 3DURB 2CUIA 5KSUB 1BFVH 15C8H 5C0ND 2NY0D 3BP4B 1NMCB 1S7QB 3OKDA 3QPQD 2JIXA 4JFDD 4JQIL 5CMAB 4HFUL 1J1PL 1UM4H 2YD6A 4S1DC 2NY7L 5TGBA 1BIIA 4BM7A 3HNSL 1AR1D 3KPSE 5CGMA 3RNQB 3QUYB 5IB1A 5I71C 5FYKE 1UJ3A 3SE9L 2EKSB 2IANE 3LVEA 1NLDH 4PB0L 4OCRH 5TF1H 4TNWF 5D8JL 5FM8A 3HCVB 3KPOA 4GRLB 1JNNL 1JRHI 3U0PA 2CLVA 1AKJD 1GPOH 3QDJD 2WK2A 3OKNA 4UTAH 2AJYL 2FNBA 4FQXA 5SWQB 1I1CA 1SJEA 2X9XA 2C3GA 4CJ1A 3NMEA 4LKCB 4W6XB 3D18A 3CNKA 3GMRB 3QXWA 3GGWB 2JK5B 3QIBB 2FR4A 5DJDB 4PJ7A 4MAYD 5EO9A 3D1MC 2P5EE 1TJIH 2V7NA 3X17A 2WIMA 1ZGLM 4IMKC 2QSCL 5DJ8B 3ETBF 2I60L 5HHMD 4LSUL 3TN0D 2AV1A 2VSCA 3TJEH 3RX5A 4JFOB 1ORSB 5LWYH 3QQ9C 1R5WB 4O2EA 3ZSTA 4JFPA 4MS8D 3SGJC 4RFEB 3PHOB 3ZL4H 3TBVA 2EDNA 3MLRH 4QXUL 2VDLH 2WNGA 4PRIA 1Z9LA 2VXVL 5CGTA 3FQUA 5EIQA 3VXNB 3ARQA 1QVOA 3P11H 1NAMA 2DYPA 5D7LE 3QEQB 4ZTPH 3FRUB 3MOBL 3DHMA 4YUEH 1Y0LB 3OXSB 4KXZI 1HXYA 3QSKB 5F97E 3Q0HA 1AI1H 3GSQA 3HA0A 4Z6AT 5I8CB 2FYYA 3KNBB 1OSZB 5I30H 3VI3F 4OCSH 3ULUF 2NXYB 3DGGB 3DTXB 1QRNE 2VDKL 3ILPB 1UCBH 1Q1JL 3ARBD 5JDSA 1A6UL 2ICES 4LSPH 4U6YB 1IM3B 2Z8RA 4Q0XH 3GJEA 5DS8A 1UZ8A 5HHVL 3QIWD 3C5ZA 4NKDB 1P5UA 2C1PB 5J13C 4X4ME 2VWEC 3F8UB 1RUAH 2O5ZH 3X13A 3PIQB 2OJEB 3CXHJ 4JKPL 3LY6A 4Z0BH 1KPRB 2J8UE 3CCHB 3KYKH 1AGBB 2HFTA 4U6XB 5FO7B 4TTDD 2K1MA 1HNFA 3GSUA 1LEIB 5HYEA 2HFGL 3ESVF 3MRBB 4WFGD 3MV9E 1J05A 1JNHA 1MAML 4BSJA 5C0IB 2VQTA 4E42B 3P73B 3HPJB 3MLUH 1U8KB 2V2XB 4MQSB 4KRPB 3WFHB 5I1EL 1EXUA 4YWGL 1TZIB 3TNMA 5CUSH 4L4TD 3FB6B 5FKAB 4FQLH 4X6BA 4UZGA 5C6PB 2W07A 1JNLL 2AEWA 4G5ZL 5HDQL 3LHPL 3PWPB 4GAYB 2A0LC 1G6VK 1KTRL 5HJ3B 1ZT7B 4XCFH 1CK0L 1ONQA 4DKEL 1FRGL 4XB8A 2H26B 4M43L 3VGAB 1UA6L 1Z5LB 4PGDB 5F72S 3DO3A 1F13A 2XICA 5E2WH 4Q97A 4M4RA 3E6HA 3E6FA 4KC3B 2Z31C 3CDGA 4HDIB 4X9GA 3EOTH 1MWAL 2IC2A 1Y6KR 4X80L 4ETYA 4JFZH 5CP7A 7FABH 1PGRB 2NY6B 5IVZA 4KRLB 3G6JA 3H7LA 2ZUQC 2EE2A 4PRHD 3BAEH 3BT2H 1S8DB 3MRLA 1A21A 4MXVF 1JHLH 4QRRA 3KDMA 3SGDH 1EEZA 3VFTB 4MA7H 1X5AA 4G7YL 4OQTH 4N1EA 1KN4H 1TVBA 1CZ8H 4G7VH 4WV1C 2VDPL 3UTPE 3I3DA 3WJLA 2HH0H 2O5YL 2QADC 3MGAA 5E5RB 3T65B 3H9HB 3K4AA 4NN5C 1P7KA 4ELMA 3VFNA 3ULVF 1TLKA 3EGSA 4KROD 3WXVH 3LRSB 1FFQA 3QH3A 5TQ0L 1KFAH 2XWTB 4OGAD 2YK1L 1DBMH 4M61B 1JPTH 3O3DB 5I0DA 1PY4A 2NCMA 4AH2B 3QCTH 5DMGD 5TQ2L 3MRNA 4RGOH 3BO8B 3P77A 1KLUA 3V5DA 5F3BA 5HHQA 2W0KA 2MFNA 2ZOLA 3KYMA 2V2TB 4WO4B 5EZLB 3JWDH 2A73A 3DROB 5IG7B 1VEOA 2J1KA 4ZUWB 2XZQH 1LP9F 4NKMB 4BFIA 1BECA 5CIPH 4M8QB 1FVDB 1R24A 1T1WB 1PEZA 1MWAB 4JY6A 4B7IA 1NBZB 3LSOB 3ARSA 4LMQE 3HHRB 2X44D 3HNVH 4GG8B 3I6KB 4PRBB 3S37H 4M1CC 1A0QL 2P4AB 3PWUB 1J0KA 3C2SA 5IBLD 4RRPG 5CSGA 5DRXB 2VDOL 5ALBH 2HVJB 4GAJL 4S1QL 4XPTL 4Z7VF 4ODHL 2W92A 2DQTL 4GS7B 1V7ML 3KHQA 3PHSA 4P48A 3VFMB 4ZUTB 1DN0A 1W0VA 1ES0A 2ERJC 1RUPL 1IKNC 4Y4KC 2F53E 3N9GH 4ZDHB 4OLYH 5HVGB 3W0WB 4BZYA 5H37G 4QTIH 4X4XA 3HPLA 5DO2D 4WU7B 4HUXA 3UYRH 1XCQB 4HH8A 4RGNC 5FGCB 1A5FL 1UVQB 4Y5XB 3PWNB 3DX8B 4D8PA 1RZ8B 4N68A 2JCCA 5FUCC 5IBTH 3S36H 1XGQA 1EHLH 3NOIA 4P9ML 3MJ9H 1K2DA 3O6FB 5C0FA 5L9DL 5BV7L 4O02L 1NFDB 5F7DB 1NGQH 4XZUA 2EDRA 3EFDL 3TIEB 4MNQD 5DT1L 3A0OA 1F58L 4P23C 4PJXE 1U93A 4S2SB 1C12A 4PJIE 4N5EC 2BDNL 4HK0B 3C5ZC 2PW1B 3GO1H 1U8QB 4UV7L 4HIJB 1NKOA 3GMQB 4GMSL 2AK1H 4M1DL 4N0CD 2YBRB 4LP4A 3E2HB 1N59B 5I2IB 2DBJA 4P4RB 3V7AG 3V6OA 5KJRL 1DVFC 5D1ZA 5H94B 3WN5C 5BJTA 4EXKA 4Z76B 3BQUC 1Q9KB 3VXRA 2WBKA 4U7MA 3NN8A 4UU9A 4MLSA 4K7PY 3GBLA 2X9YA 4UOW0 3UP1A 3OGOE 4XVJL 5HGHA 5B39A 4QT5A 4KMTH 2ZUSA 4H8WC 4Y19D 5FB8A 3GRWH 1AD0B 2UYLA 3VXSD 2VDML 1FVEA 2WUCH 4CMMB 2Z9TA 4IMLB 3CC5A 2L0DA 4JM2B 1WT5C 2R2BB 3EDFA 3VU2A 4LAQH 4LSRH 5BRZB 2NW2B 4Z0XB 2FJFB 3OKYA 1IC1A 1ORQB 2XI9A 2DKSA 1FO0A 1YMMB 3HR5B 2B1HL 5BV7B 3WNPA 4P5TD 5C3TA 4KAQH 3BGFB 5C0DA 3GUTB 2C1OA 3D3VA 4PJEB 4JN1H 1MRDL 3QXAA 5IVOA 4LSVL 3JWDC 5IJKC 1J0ZA 3DSFH 4NO0D 3JV4B 2NX5B 1OSPH 1IQWL 3AS2A 2XYCA 3HS0A 2CRYA 3HB3D 2H3NB 5IB5B 3PJSB 4EI5A 4F58H 5E8EA 1D5BA 4I2XE 1BD2D 3QUXB 3QXVA 4R90L 4AMKL 4M5YH 5KSBB 2AJYH 5TH2B 2O61B 1G6RH 1H9VA 1YN7A 2JB5L 4JVWA 4JRXB 3L7FB 3OJ2C 1ZHKA 1X5YA 4JFQA 1OP3K 5DMKB 5HHPA 2AXGB 3O9WD 2VLMD 2R0KH 4NM8L 2I27N 5AD0B 4UTBL 2UWEE 4B5EA 5LGJA 1WFTA 4IRJB 5ELIA 1ACYL 2NW3B 2QSCH 2X4OA 3BKMH 4KK9D 5ANME 3HE6B 4HLJA 2I60H 4QHMB 4LSUH 2OSLA 1U8PB 3TH4T 2OJZL 4PY7B 1I9IH 1LO5A 1MLBB 3QQ4A 2QTEA 1I3RB 3IU3A 1JV5B 4F2MB 4PGCB 4B41A 2BMKA 3L3OA 1U3HB 5HI4C 1QLRB 3GJFK 1H3GA 1CGVA 3QFJA 1Z9OA 2B2XL 1ZT1B 1B0GB 4MDIA 4S1RL 2CD0A 1MCDA 2WIIB 1KB5L 3O8XA 4XNMB 4MJ6A 1WLHA 2AEPL 1D9KD 4NNXB 3TCXA 1N8ZB 4PJ5A 4LCUA 1I9RL 3TA3B 5CEXA 1H0DA 2MCG1 1LQSR 3HE7B 2ORBH 5FECB 2XXCB 2HVKA 4QXGL 3ZT7A 1FL6B 3D25A 3FHQA 1ZXQA 3GMNB 5HVFB 2J5LC 5BZWB 1A6UH 3BXNB 1I7TB 3EJYD 3KPSD 4XC1H 5BQ7B 1IZKA 1MNUL 3UTQA 5F8RC 5EU4B 2ESVE 1PX4A 5FYKD 3U9UB 4WVRA 1FCCA 3RJQB 1P1ZA 4OIAA 1DQLL 1QSFA 3RWCB 5L2KA 3PQYB 3OSKA 4YBLC 1MQ8A 2EDQA 4CGTA 2A83B 1T5XA 3K8MA 4GBXA 3RZCB 1CDYA 1H3TA 1KCSH 1XF5A 4H1LB 3VH8B 2CLZB 1CLZH 4HJGA 2P5ED 2R0WL 4QRSA 5I1EH 3QWRD 5C0CE 3U6RB 1N3NA 5EO1B 4CVXA 5HVWA 3WUWG 2J7LA 4NN7B 4ELKA 4QRTB 4G5ZH 5HDQH 3LHPH 2BVYA 2ZPKL 2EO9A 2O26U 2R1XA 1I4FB 4Y4HA 4YGVB 2CDFB 4ZAKB 4W68A 3QT2A 4MQTB 1KB5B 4L9LA 5D6CB 3V6OC 1P4LA 5HGAB 1UA6H 4X7TA 1TPXB 1JJUA 4JREB 4X5WA 4ZPTB 4ZXBC 3SDXB 2VRAA 4I0PD 2IG2L 4E41A 1MHEA 2FSEA 1B3JA 2X4QB 4P2QA 2NXZD 3HAEH 4U1IB 1ZEAL 1LK3H 3R8QA 3BDBA 2HG5A 5GIRA 3FO0L 5CJQL 3KPLA 4X9HA 1W2KT 3CIQA 4CN6A 2X6MA 2FD6H 4HIHA 5KANI 2CJUH 3SOBL 1IGJB 1B4JL 5C9KA 2O5XL 1HXMA 5D7JD 1QRND 4NO5A 2BHZA 1OGAE 4WNQA 1AP2B 4G7YH 3GSRB 1PG7W 1FORH 1AD9A 3KLSA 3C09B 1OCWL 4NZJA 4RBPK 3M17A 1JRHH 3QRGL 2O5YH 5D1QA 1P4BL 2QQNL 1C5DB 2GITB 1VFAB 4JDVB 3E1F1 5TQ0H 2VDQL 5DMIL 4M7KH 3OWEA 5IMOA 4XPBH 2XT1B 3GFUA 4WRLA 4JPWH 3VXMB 3WKNA 2HKFH 5L7XL 3MV9D 1IM9A 2GIYA 4DWHA 4R6UA 2AS5M 3MRJA 5CINL 5D2NC 5IHZA 5TQ2H 2Q8AL 4LHUD 5I66B 1KCVH 4QHNA 1BOGB 2FGWL 3S34L 3VWKC 4QHKJ 4HJ0D 4HV8B 5D1XA 3QCUH 1DUYB 4YBQC 1R3IL 5HBBA 4W6YB 1OAYH 2BY2A 3NCEB 4JY4B 3BP5A 3F12A 2Y4SA 4MNGE 1B90A 4P2OB 1AHWC 3LQAL 5IFHH 1RVFH 1Q0YL 3FOMA 4GW5A 5HHOE 3T4YA 2P8MA 4CU8A 4LKXB 4KI5E 4YO0A 3WDIA 3DUSA 3MNVB 2XKSA 5DJYA 3QG7L 1P69B 3BIKB 2K3TA 3IXAA 4F9LA 1MHPL 1PSKH 5MEOB 1A6VH 2J8HA 4V2BA 1HK6A 1INQA 2BK8A 2VDOH 3O2VH 1OM3L 4KXZH 2J12B 3C5JB 2H2SD 2NTSP 1S7WA 4PJFF 5ADPL 1HKFA 1AY1L 1MI5D 2DL2A 2QEJA 5ACZB 1TQBB 3SBWC 2X4RA 4ZFZA 5GGSB 1VA9A 2VN4A 5EFIA 1WFOA 2X89D 3M1BA 5EOCL 3NIDF 3RL2A 3LKSA 1ZLUK 2P8PA 5EPMA 1KXQE 1H8SA 4FQQB 4UB0L 2ZWLT 1PKOA 1LILA 4GG6E 1KCUH 4YHPB 1FZJA 1FNEA 1MREL 5ICXB 3RDTD 3RQ3A 1HQRA 3PGCA 2Q86B 1SJXA 5JLZB 3ULUL 2NY1D 1URLA 2C3XA 1SVZA 4N0FB 1D5ZA 1BVZA 2JELL 5C0EA 5DEFB 3TNNB 2Q3ZA 2BDNH 1ULVA 4HWNA 4FP8L 4HT1L 4Z7OF 3PHQA 1DSFL 1SY6H 1WZ1H 1U9KA 2AERT 4NZTL 4U1KA 4M1DH 3GM0A 3QB7C 3RVWC 4LSTH 4XBEL 4M3JA 4LRIC 1EUUA 4EDWH 4AM0A 5KJRH 4PG9A 4AIZA 3QEUB 2KDGA 1BBJA 2VITB 1IAII 2HN7A 3PG2A 3SDCC 2XNAB 3CVIL 3P9LB 4RIRB 5FA4B 2Q20A 3KG5A 5GGVL 3WLBB 4MB4A 4PYHA 2AJZB 1JBJA 1LO3H 4X6FB 3MC0A 1S7TB 1N5YL 5D93B 3X12B 4IS6B 4EN3C 4G6AC 4R4BA 4F7EA 1QA9A 1WBYA 4HS3A 1O7SA 1G7JA 5EU5A 2RB8A 4O2FB 2YD2A 3MRIB 2F53D 5FDWB 5F89B 1AC0A 5FV2A 1FGVL 1AE6L 2DQIH 3B5TA 4JKLA 3O3BA 2Q87A 3GHEH 3BPCB 5ACLA 5LCVH 3U46B 4EIGB 4CVZA 4AIXA 1X5FA 2YRLA 5E0QA 3VFOB 1GHFL 4JZOB 5GISL 1SYVA 3HI1B 1XGPA 1OP5H 1GZQB 4HBCL 3PL6D 3IDJA 3U4EB 3VJ6B 1INEL 2FJHB 3WO4B 2K9UA 1EJOH 1XAUA 3N1MC 4O9HL 2YZ8A 3NFSL 4F7CA 2D3VA 4R90H 2E9BA 1E6JH 4R7NA 3PNWA 1GGIL 4WUUB 5ADOL 4UQ3B 4PRPB 3D69A 4GRWH 4TVPH 5K59E 5CAYB 4P46B 3MX0A 2WBJB 5JUEL 4TPRL 3W39B 5FHAH 1RUML 1NFKA 5INCA 4DTGH 4JPIA 5E9DE 3NCMA 3HZVB 4KUCF 2E7HA 5D2LF 3CSYB 4U2ZA 4GXUN 4UTBH 3VG0L 3OKLA 1EGJH 3IFLL 1U8IB 2AK4B 3ZDYF 3C8DA 3BRFA 4RISH 2PTVA 1RJZA 1I8LA 4OLXL 3FN0L 4OD3H 3THML 2Y72A 3NVQA 1F3JB 1CDJA 5DA4A 2OJZH 4MVBC 1J8HD 4XBGB 4L4VB 2J88L 2Z93B 5C86A 4RRPA 4ENED 2D31B 4PTTB 1Y18B 4PJBA 3IKCA 1DDHA 4P57B 5ITBH 5HI3C 1TITA 1B0RB 4DAGL 1KT2A 1UWEH 4F9LC 3NPSC 4GXVL 4MNQB 3CUPB 3L5IA 3BSZL 4ODBD 3VFRB 4JFEB 2IAMC 1EPFA 4N9GB 2LTQC 5DZLA 3PUCA 4YPGB 2PTUA 4XPAH 2JLLA 3FJTA 2YA2A 4KK6D 4OLUL 5FK9A 1RK0B 3VFPA 1JWMA 1T1XB 4BH8B 4IOIB 1FAIH 1FIGL 3STLA 4YDVB 4LPCA 4BH7B 5DHYA 5FYLL 4NQXA 2R23A 1EHXA 4U1JB 4PV8A 2EIBA 3TBTA 1NFIA 5F6HJ 4BQ6A 1PVHA 4NQEA 5HD8C 1MAJA 3DXAA 4XI5C 3BKJH 2JE8A 3R0MA 3G6JF 3MBXL 1F3DH 5LJYH 3QUZC 4HC1A 1VB9A 3SE8H 4WHTA 5KN5B 5DUBB 5DHVB 3SKOB 5IQ9A 2Z8WC 1I85A 5I1CH 3VXSB 5L88L 1F11A 1BAFL 3GMOB 3PXHA 4X4ZA 4W81A 4Q58C 1HSAB 1CGWA 2OR9H 5ESVA 3QHFL 4LNRA 5KG9A 3MRPB 1NCDL 3RY6C 1BQHB 5HGBA 4RAVB 2E7CA 3VD7A 3OKOA 1PQZA 3GBNH 3GNML 5TPWH 4M3KB 4PLNC 3OB0K 1F4YL 1U42A 3FT2B 2Q6WA 4OKDA 4WEBL 2BX5A 4IOFD 1CXIA 2ADJA 3FT4B 3BZDA 3IXTA 4NQVA 4KK5C 3WL9B 3TH3T 1ZHLB 4HXAH 1IQDA 1NC2D 3Q3GA 4NQDD 4NUGL 5C0JA 3BZEA 4LRNH 4D3CH 4U0RC 5D96B 1DE4A 1JZ6A 2MPAL 4RWHA 1FAKT 5CP3A 5K9QG 2ARJB 5FYKL 4XAWL 1K8DB 5IGXH 4L1HA 4PJ9C 3ZTJG 3N85L 4YE4H 4HWEL 4EUPB 3VGEA 2NY5C 5HI5C 2DQJL 4Y89A 4ZD3L 5AUMA 4FFVC 4MJ5B 2ZG3A 2PTTA 3EDEA 2C3WA 1QSVA 4DJMA 5I6XC 2D4FA 1U92B 1UACL 1HI6B 4UMGA 5T3XE 4ONHA 4DQOL 1J9CT 5CEZD 1U95A 4P2RE 5DR5H 5BCAA 2FB4L 2QHRL 3D6GA 4GQ9L 1A7RH 3EO1A 5K9JL 4R97C 5IB4B 4XC3L 5CINH 1GL4B 1VERA 2PYEE 4X98A 2Q8AH 2YXMA 1HHJA 4D0BA 3Q6FA 4G8EA 5C0CD 5C0NC 1NL0H 1R3IH 2KL6A 2NY0C 5T1LB 4U1LB 4WTWA 2NY2B 4XCEA 1JK8A 1QSED 4G80B 1K8IA 3QPQC 3P4NB 4FZEL 4KKAC 3WS3B 5IT2H 4XPFL 5ERWB 5JO5A 2V5RA 4PGJA 1AR1C 4URTB 4UDUB 4A6YA 1K3IA 4U1HB 4QRUB 2X05A 5HYQA 4GKNA 4XMKH 1QR4A 1GIGL 1J18A 1I8LC 3FCTA 4MD4A 4ONGL 1G9MC 3KPSB 5JHDA 5CCKL 3I9GH 4YDKL 4RMSA 4RA3A 2IANB 1A1MB 3SQOL 2X4TA 1KB9K 3U2SA 5K9OA 3AM8C 5ADPH 1AY1H 1P5VA 4H26A 1OB1B 3B9DA 4JFYB 1OTSD 2A74A 3CPLA 2P1YA 1NC4B 3BX7C 4FNLL 4KVNL 4MAYC 4L9DA 3QHTC 3W11D 5MI0B 5J12C 4P5KB 4ZQKB 3BN3B 1A3RL 3FOLB 2DAVA 2G60H 5HPMA 1KYOK 4PBXA 1OGAD 4DGYL 4OZHA 1INDL 1FJ1A 3MA9L 1DL7H 5FCUH 2HJFB 1EERB 5IQ7L 5MP6H 4FTVA 3FO1B 2RIKA 2D0FA 3FN9A 3R06A 2NY3D 1D5XA 4HCRA 5KBNC 1E28A 1RAMA 1IAOB 2HP4A 4MS8C 3LEXB 3DO7A 1X4ZA 3I3EA 3WV0A 2JELH 4M4PA 2AJSH 1RULH 5I8OH 1QEWB 5SV4A 4HWZA 4YH6A 2XN9E 1DCLA 4FP8H 3VD5A 5D5ME 4QYOA 3MLSH 1DSFH 3VDAA 5LQBL 2FO4A 4PJAE 5CILL 2NXZB 4LLQB 5DD3L 4I1NB 1YEHL 4O2CA 2F54B 3WUWA 5H35A 2AJXL 5HVHB 1A1OA 2X7LB 2CPCA 3W9DA 5D7LB 3MODH 1VSCA 2ITCA 3ARBC 1P7QB 3WDJA 5HHOD 5ID0A 3M45A 1QKZL 2IADA 3QEGH 3WNNA 3CVIH 1K6QH 3EYQC 2G9HA 1KUMA 3K2UL 4KI5D 4RZCA 4YK4B 5DURD 3QIWC 4Q6YA 1KEGH 1DEEB 4R3SB 4Z8FH 1N5YH 1QYGH 3UPRB 4HWUA 1UKSA 5DK0B 4FQ2H 1FFPA 4PJ8B 5A3ID 4HX1A 4QWWD 4L8SC 5F7WC 3RPIB 2YPLE 4OM0L 1K4CB 3SDAB 2HLFC 4KQ4L 5FAAA 3WJJA 2J8UB 3ZKMD 4D94A 2FX7H 4BA8A 3FB5A 1A6ZA 4XPGL 5BS0E 1AE6H 4YZFF 4NSKB 3INUL 5E00A 5C9JA 3DMMA 2XA8L 5E8OA 5F3HB 4MQXD 1GHFH 3GIZH 4RMTA 3ZYJA 4KKBC 4HS6A 5EN2B 3EYOA 2GK0A 3OF6D 4JZJC 2AKRA 2HKHH 4FFZL 4HBCH 3SE3A 3CX5K 2WUBH 5I75B 1F5WA 4LCCC 5A16B 4JB9L 1UB6B 1YDPB 4I13B 4XNUL 1F42A 4JM4L 2CIIB 5C2BL 5IEKA 2ZZUT 1IFHH 1MQKL 5A2FA 3WEXA 1RUKL 4J4PA 3QQNA 1GGIH 1WC7A 3DBXA 4N0UE 3H9YA 4JPVL 4P2YA 5JUEH 1KG0B 2ZCLH 1RUMH 5GRVK 1KIRA 5TDPA 3TP4A 1CDHA 2FX9H 2JB6B 3LS5L 4FQCH 1YYLH 4L3AA 4R9HA 5JIIA 4PUBL 5I1AA 1IL1B 3IJYB 3VG0H 3RL1B 2E8YA 4NJAH 4ETQB 5E4EC 3IFLH 5I15L 5LBSL 3MUY1 4U6VH 1SMAA 3I3BA 4YQXH 4LQ1A 5E4IA 4UOW1 1RJYB 2L4OA 1K4DA 3THMH 3G5ZA 3PE9A 3ES6A 4F7TA 3C60C 3B9KA 2AJUH 2PXYC 1I3UA 4M7JH 5DD1H 2J88H 3MROB 3K4DA 4AG4H 1CS6A 1T7XA