1TETL

Crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCKSSQSIVHSSGNTYFEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYEWHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 TE33 FAB (LIGHT CHAIN)
publication title Crystal structure of an anticholera toxin peptide complex at 2.3 A.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 51
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL01
2XKUA 3D9AH 1CGVA 4LLWA 3O41B 4XCFH 5GRUH 3C60D 2BY1A 3AVEA 4N9GA 3L1OH 3CDGA 3QEGL 5F1NB 1RIHH 3RWJA 3VXUD 2VN4A 4AIZA 1A7QH 1TZHA 1NGZB 2Z9TA 3IDNB 3MOBH 4U05A 3OAUH 8FABB 5C0JA 2X4PA 1LD9B 5I1EL 1U8MA 4K9EC 4JFDB 4RFOH 5ADOH 5DTFB 3CZFA 1DUZB 5C0BB 1GVIA 2AJSL 1V7MH 4ZO7A 3MREA 4JQVC 3A6BH 1YEIH 5L0QB 3MOQA 4XHJC 3DUUB 1J8KA 4X8JB 5J56B 5DHVA 3RWHA 1C5BL 3OJMB 4HXBH 3EYFA 3FO1A 5CBAB 5F7EH 2OJZH 5CJQL 3DXAA 2OBGA 2MCPL 4N68A 2K1MA 2VUOA 8CGTA 4YIQA 5E4IA 5JW4Q 3F65A 4JPIA 3NZHL 2IAMA 4F33B 3O9WA 2XZCH 3TYFA 3CLEH 3UJTL 4G8GE 5GZOD 1IMHC 2ZCLH 3LEYL 5FF6B 2BVOA 1Q72H 3V8CA 4D0DA 2J12B 1RU9L 3VRLF 4PTTA 3O11A 1JF5A 2PR4L 3BW9B 3C5ZC 3QDJE 1EJOH 3BHBA 1WWAX 4LLWB 4P57B 3GRWA 1FNGA 1KC5L 4M1GH 4I3GA 3CDGB 3RWJB 4ORGA 3TFKC 3WFEH 4AIZB 4CW1A 1TZHB 1G7HA 4ZUWA 1JHKL 4Y5YC 1C7SA 4BELD 2GJJA 1FDLL 5CZKA 3Q2CA 4YEFA 1G9ML 3CZFB 1BREA 5AEAA 2GITB 1AD0A 3MREB 5JPMA 4IRJD 4LF3A 1T3FB 3LEVL 2J1KA 2VDKL 3AS3A 3ZYZA 4M5ZL 1TPXC 5SX4I 3DXAB 4M93B 1O7VA 1TJHH 5FYKL 4YIQB 3SEPA 3G08A 4LCCA 4GAJH 5HVHB 2IAMB 3O2VL 1A7RH 4YPGA 3TYFB 3MLWL 4TNWF 5HXMA 2SEBB 4PB0L 1YY9D 2AXGA 5ITFB 3VXRE 3S34L 2VE6A 1CTOA 2BVOB 4D0DB 3GMPA 4ISVA 3O11B 3K4AA 3MSPA 2B4CH 1WT5C 4ALAH 3KLHD 5L6YL 1JZ2A 1DBKL 3WE6A 2X1OA 3MGTB 3WHXA 2EIBA 4RIRA 2EDWA 5AWNL 3DHJA 1W2KT 4ORGB 4CW1B 2R15A 3C87A 5EOCJ 3TO4D 1G7HB 1BZ9A 2EKJA 4ZUWB 1H9VA 1FJ1A 5E6IB 3RTQC 1CL7I 2DQUH 2FJFB 3K8LA 2E7LC 5SV3A 1RFDL 1QFPA 3N1QC 1YA5A 2FL5B 3EDEA 3LQMA 4ONOA 2F5BL 1AD0B 1U58A 3MRCA 2VLME 5JPMB 5B38A 4LF3B 1OARH 4OD2A 2H1PH 3RJDA 5EO9A 4XP5H 4DZ8A 1A2YA 1VGEH 4Z8FL 1EO8L 4KJYA 4MQTB 4BKLA 5I1KH 3JWOH 1UC6A 3O3DA 1UXSB 5F96L 1A6WH 3G5XA 4LCCB 2WUBH 5E5UB 3FO9A 2BY3A 4YPGB 4NUJA 3GSWA 4CGTA 4I9WE 3PHSA 4KPHL 1BM3H 2AXGB 5DVLA 2VLMD 5IJKC 3FJTA 2VE6B 4OZHF 1LMKA 3QPXL 3GMPB 4ISVB 1EEUA 4YHLH 2R4RL 1P69B 4YQXL 2J7LA 4PJ8A 1AFVL 3IS0X 3WE6B 1RUQL 3WHXB 3CXDH 3ALWA 5I74B 3CXHJ 4RIRB 4HT1L 4OCMC 4JFZH 4FMKA 5DMIL 5IT2H 3EJZC 1BZ9B 2P43B 2D4DA 5DXWA 1FJ1B 4CDGC 1JZ6A 5ESVA 5C2BL 5IB1A 4JPWH 3S88H 1VHPA 2ZOLA 2I60H 3DGGA 5I8OL 3MRCB 1F4AA 2H45A 4CN6A 1INDH 3O3EA 3BKCL 2QQLH 1OGAA 4OD2B 3HNVL 1UWGL 3PDGA 4DZ8B 5LQBL 3JTSA 4OTXH 4KJYB 1FLRL 4BKLB 3BT2H 3O3DB 5FOBA 3G5XB 4APQC 4NUJB 3Q6GH 3GSWB 3RGVC 5EWIH 3V4PL 3HCVA 2YPKA 4WVRA 4HXAH 1BFVH 2L7JA 5HI5C 4JGJA 2R56L 1UZ8A 4J12A 3S37H 1AO7A 4J1UA 1FH5H 1MRDH 2PW1A 3KHQA 4Y89A 5HHVH 3VFGL 4IMKA 5ENWA 1HILB 3KGRA 4NKOA 4EVNB 4OM1H 1VFOA 2VDOL 5E24E 2EDYA 5CEZL 4JZJA 1N0LA 3IU4L 5ESVB 2UWEA 5IB1B 2W0PA 1IZKA 2ZOLB 4MA7H 3S4SB 3W11C 4PLNC 3DGGB 4K9EL 5D2LF 1MJ8L 4Y4FD 1MWAH 5CEYA 3FN9A 1OGAB 4EIZC 5JZ7C 2FEDC 3JTSB 4DVRH 3OKDA 4LLUA 4U1GB 4E5XA 5FOBB 1T1XA 2R0WL 4PLKC 3C6LD 4KROD 2X5PA 5ID0B 2VIRA 4R90L 4R4ND 5C0RH 3MJ9A 4ELMA 1MCIA 5HDBF 3BH9A 5A1AA 1JPFA 1UZ8B 2D9CA 1F5WA 1RZ7L 5HHMB 2APXA 3B9KC 2X4NA 1PG7X 1AO7B 2ZNWA 4J1UB 2PW1B 1OAZL 5ENWB 1F02I 4ZTPL 3VFSB 4NKOB 4XVSL 5F70A 4P3CH 1RUKL 3MRHB 5JPNA 1JPSL 4JHAH 3VXSA 5EBWB 1UB6B 3QQ3A 3MRBB 5D6DC 4M43H 4WI2A 3CLFL 2XT1B 2UWEB 3LCYA 4I77L 3C9NA 1HNGA 4FQIL 1XIWD 4IOIA 1XGRA 1GJIA 2HKFH 4JGUA 5CEYB 1K5NB 1M1SA 3J8F7 4V2BA 1A4JA 5CKGA 2DQTL 3MBEA 3K4DA 1CF8L 5D1XC 1X5AA 3OKDB 4LLUB 5AZEH 2YA2A 2A1WL 5JQ6L 1T1XB 3V5KA 4LVHB 3LB6C 3U7YH 2Q20A 5GSRB 4F9PC 2X2YA 4LSPL 1R3LA 3R4DA 5K59E 4ELMB 3ZE1F 3TVMD 3BH9B 3SGKC 3MUHL 2W59A 2C1OB 1WLHA 2IEPA 4R9HA 5DLMH 4P48A 4K3EL 3RU8L 1JFQL 3HFMH 2DQGL 1HQRB 3WLBA 2DQIL 5JPNB 1RZFH 3FB8B 3VXSB 2B7DT 3QQ3B 4JRXE 3M8OH 5CEZD 4LQFL 3CFCH 2JB5H 1IEHA 2R0ZL 1WCBA 2JB6A 3AY4A 1NFDF 3ILPA 1XGRB 1UH2A 3V0VA 4PJAE 4KZDH 3UTPE 3RGHA 4IJ3B 1A4JB 1S8DA 3MBEB 4KKNA 1YECL 5EU3A 3U46A 3RP1A 1OP9A 3BP7A 3QWRA 1KCLA 1CDGA 4XHJD 4YC2B 4PJGB 1KENL 3PGFL 1FGVH 2Z93A 3LD8C 3P11L 2V5MA 1AGFB 2GT9A 3V5KB 2BNQD 2OX5A 3K2UH 2Y36L 1X5YA 1QOKA 4X7EC 4P2OA 1FRGH 2O5YL 1QR1A 2IC2A 4GFTB 5MEPB 4XCNB 5JDJA 4Q6IA 4RMQA 3UTPD 1DLHA 1URLA 4R7NA 1S78C 1U8JA 4B7IA 4D0BB 1IFHL 1F4WH 3N9GH 4FXGA 4KHXL 2QSVA 5I71B 3GJEB 2VZSA 3U0WL 3WLBB 2I25N 3ARFC 3C5ZD 1OTSC 2Q87A 5DJDB 3VH8B 4ZMAT 3GO1H 2HH0L 3TFKD 2IQAA 3GI9L 4NO3A 1WCBB 4NBZB 3H9SA 3RWCA 2D7NA 1KJ2A 3ILPB 1RPQA 2LABA 2GUOA 1IILE 2OK0H 3DECA 1QFOA 1K6QH 3U46B 4FFWC 3BP7B 4BYHA 4W6WB 4N8CL 3IXTB 3O6ML 4QXTA 1CDYA 3HNTH 2Z93B 2AQ1A 15C8L 1QRKA 1EGJH 5DA4A 5L2JA 1A22B 5E08H 1NSNH 2RB8A 4P2OB 3PHQA 2WM0A 3ZKSD 1UKSA 2VLRA 5CIPH 3TH2T 5GGTH 2FBJL 4OUUA 2VDQH 4CVUA 4XXCA 4HPOL 3RI5F 3V9FA 1WUNT 1U8JB 3L3HA 1JL8A 2CIKA 4FXGB 4HWZA 4NQDD 12E8L 1J05A 3QXWA 3PWPE 3QWQB 3VA2C 2NY6B 5BVPH 3H9SB 5CUSH 3RWCB 3RTQD 1KJ2B 2GUOB 5EC2A 4ZOAA 5HPOA 4P3DA 3E8UH 3PWPD 1IT9H 1S9KC 3BVNA 4LVNC 5KVEL 4QXTB 1WQVT 5L2JB 3TN0C 2YK1L 2YR3A 3PHQB 2GTWA 4M9OA 1ED3B 5GXBB 4N90E 1F6AA 4F7MB 1FZJA 1Y0LB 3MRIB 4OUUB 3TT3H 1R5VA 4MJ2A 4Q2ZA 1S9YA 5F7KC 3L3HB 5HI3C 5DJZB 1YNKL 2CIKB 35C8L 4HKJB 1F4XL 3DOSA 1J05B 2FATL 2ZPKL 4KXZI 1CLZH 2X4SA 5D7LE 1HIML 4PJHB 3RKPA 1GC1L 1N5AA 4U1LA 4F7TA 4W68A 3EJZD 1CWVA 1GGIL 5CINL 1PG7W 1Q9LA 1EXUA 3G6JF 5C6TH 5EC2B 4OLVL 3PXHA 3BO8A 3TV3L 4P3DB 2AABL 4OD1H 4Z7WE 1ACYL 1X5KA 4Y1AA 2AERT 3OB0K 4AQ1B 1L0YA 4N8VA 1BBDL 3F58H 4W6XB 3IJSA 3LQZB 4LDEB 2GTWB 4GKSA 2DF3A 3KLAA 1F6AB 3H7BA 5ETUA 2UUDH 2ZG2A 3ZDYE 1P9MA 1R5VB 4M48L 2O5ZH 4Q2ZB 4UBDC 3RDTD 3FB7A 1NMAL 4XBGA 4AEFA 4YEEA 4ZS7H 1WWWX 4C56E 1Q94A 5ECJE 4YX2L 5TE4H 1DL7H 2OMBA 3BUYA 4DKDC 2X4SB 3D18A 1T21A 2HRLA 4HULB 1N5AB 1TQCB 1CLOH 4OBSA 5HY9A 3D2UA 1HHGA 4P4RA 1EXUB 5EO1B 1S7QA 5FHAH 4HJGA 4OZFA 3BO8B 1N59B 2P7TA 1TIUA 4C56D 5BV7B 1D6EA 4TULH 1MQ8A 2OXGA 1OCWH 1CD0A 4Y1AB 5JZ7D 4F9LA 1NGYB 4N8VB 2AJUL 2V2TB 3P4NA 4KRNA 1QLRA 3IJSB 3K2MC 2NZ9C 2DOCA 2V5SA 5GGSY 4MD5A 2FX9L 4P23A 4PLKD 3QQ4A 4ZXBA 2YZ1A 3IDJA 1KTLB 4UOW0 4WUKH 5ETUB 3FZUD 3SDDA 1CDJA 2DL9A 4W4NA 5FGBA 4AK1A 4JVWA 2CKBH 5J11C 1DEDA 4XBGB 5HSFA 1XFPA 1R3IL 3CZJA 2C26A 2E7HA 4TUKH 2FZ3A 2Q7YA 2DJSA 3D18B 3UTZA 2OL3A 3SKMB 4OFVA 3GBMH 2JIXD 2O61A 5HY9B 4NZUH 3D2UB 3HZVA 3DMMC 4P4RB 4AYFA 1S7QB 1ZA3A 5E4EB 4HJGB 4HV8A 4OZFB 5ACMA 1LE9A 3QIUC 2P7TB 5KSAC 4L4TE 3C5SA 1ZLWH 4G6MH 1I1FB 3Q5YA 4EN3A 1KV3A 1T6WA 1W0VA 4NJ9H 1JGLL 2X4RA 1TTGA 1MH5A 4OIIH 5EUOA 5AG8A 5LXGL 1KEMH 5D1XD 3P4NB 1QLRB 3UZEA 4CDHA 5IFAL 3MBXH 4P23B 3QQ4B 4ZXBB 3LB6D 3IDJB 43C9A 3ETBF 4L4TD 3SE3A 4RA0C 2X7LA 3BFOA 1EAJA 1GSMA 4N1EA 2NY0C 3KLSA 4Z7OE 5F9OL 2FYYA 3O4OC 4FMFA 2FGWL 2ENYA 2NY4B 2FHFA 3MA9H 2M26A 2XZAH 3O4LD 1WIOA 4YHYC 2FZ3B 2Q7YB 4UTAL 1JE6A 3UTZB 2OL3B 3CSGA 4G7YL 4G6FD 3OXSA 2ICCA 5FUCC 4JRWA 3QUYA 4QHNA 1KCSH 4J4PC 4LLAA 1CQYA 5EZOH 1LE9B 5FYKU 3FO0H 1I3GH 3C5SB 2HKHL 2OTUA 4JO1L 1W0VB 2X4RB 1MH5B 4JM2C 4JPKH 4BFEA 2KQMA 2XZZA 2P4AB 4MYWB 2XPGA 4YHNB 2NY5H 1MOEA 5B8CA 1FZKA 4UV7L 1HHKA 4EDWH 5T5FL 43C9B 4FNLH 5IROA 2XA3A 1F90L 5C0FA 2X7LB 4S10A 1I7UA 4NC2B 1GGTA 4P2YA 5CWSA 2DI7A 1ETZB 4JDTL 4W4OC 4TOYL 2FYYB 5HVFB 3MYZA 3VWJD 3L95A 1A9BA 4JFHE 5D2NB 5C0NC 1I9JH 1NCBH 2H41A 3BISA 4HD9A 3FQTA 3QUZC 5DUBB 3UC0L 4K94C 2DTSA 4FTVE 4Y19A 2CQVA 3OXSB 4MNQE 4EQ2A 3JWDC 3QUYB 5GISH 2ICWJ 2C3GA 2VDLH 4JFHD 3AREC 5AYUL 3VXUA 2VDNL 1R5WB 1YDPA 5F72S 1FGNL 2R2BA 2X1QA 2OTUB 5BRZE 1VGKA 4KK6C 3C08H 4DTGL 3MRLA 3DETC 4FFWD 4MNQD 3T0EB 2CMRL 4JZNB 2XPGB 3WUWG 3QHTC 1DQTA 3DO3A 1U92A 3QIWC 1TJGL 2ESVB 1QKZH 3IGAA 2A6JA 1I7UB 1U3ZA 2Y06H 5CWSB 3QA3A 1K8DA 5BRZD 4NFDA 5EIIA 1A5FH 1RZKL 1A9BB 3OAYK 4OCYL 4ORZC 4O51A 4RBPH 3MLUH 2DBLL 3FQTB 4RMRA 3KJ4C 2I9TB 4HK0A 1VENA 4XMKH 1TQBC 1DBBH 3LH2L 5EN2A 3RKDD 4F15C 3P2TA 3H6JA 3QPQD 4JO2L 3SHSA 3S98A 3QNZA 4XP6L 2VDRL 1CZ8H 4U1JA 1CK0L 2VXQH 1GIGL 1FC2D 4G8GA 3JWNC 4I4WB 4RAHA 1YDPB 3CFJB 2R2BB 2WBJD 1IQWL 2R29H 2HWZH 3GJFA 2A0LC 3MRLB 3V7MA 5A16A 4L3EE 3QDJA 1J11A 1J5OH 3SKJL 2VABB 5E8DL 3IDIA 4IRJA 3QUMB 1U92B 3U7WH 2HG5B 3TN0D 2V2XB 3IGAB 3QA3B 4Y5VA 4HUVA 1K8DB 4HIEA 1N3NA 4NUGH 1D9KD 1I1YA 5J6GB 2HJFA 1VERA 4WV1B 2XTLA 3RA7L 4Y16C 1QUNA 2EDXA 3WO3B 1T2QH 4L3ED 2ADFH 5J0BA 5HI3D 4DEPC 4J3VA 1MEXL 1D7FA 4KUZL 5BS0B 4QO1A 5IFHL 2EO1A 1OB1A 5DFWH 3QNZB 3IT8D 1QEWB 4U1JB 3JBG7 5D7SH 4WEBL 3MFFA 4BSVA 2XOTA 4PS4H 1UCTA 4G8GB 2QQNL 2DM7A 1SVZA 1LO2H 4GSDL 2CRYA 3VXRA 1WZMA 3GJFB 3CDCA 3W0WE 4G6KH 5A16B 1S5IH 2VC2H 1NAMA 3QDJB 2ZCKL 4JJ5A 4XHQA 3N50A 1LDPL 4YFDB 1ORSA 4IRJB 3DX9A 4PJBE 4PG2A 1Z5LA 4KHTL 5EFIA 4KJQC 5DK2A 4XPFL 2VYRE 3MROA 5IW6A 2WMPA 4OF6A 1RUAL 4Y5VB 1ORQA 4I0CC 4NQCE 4HUVB 4TTGA 4HIEB 1N3NB 3QUXC 2NXZB 1M6OA 1I1YB 4LSVL 3QDGE 2HJFB 3U83A 4PJEF 3VDAA 4AEEA 4ODHH 5KZCB 4U6YA 3ARWA 2GKIA 1N64L 4Z7UF 1KELH 3ET9F 1T7ZA 2EE3A 4LNVA 1OB1B 5SWSD 1UT9A 3SQOL 1JIBA 4NQCD 3MFFB 4WDIB 1YMMB 4HCRA 4M6ML 4BSVB 3QDGD 1JI2A 4KQ3H 1EPFA 2ZSWB 4UOW1 5EU6B 4NNXA 5KSBE 1HHHA 1YEGH 5GIRA 1MFCH 1NAKL 3CUPA 3VXRB 2MTPA 4QRQA 1HQ4A 1QPXA 1IRAY 4Z95L 3MJ7A 3DVIA 4JO4L 3BGFC 1NAMB 1T0PB 1HXYB 4WW2C 2R23B 4JJ5B 2LV4A 2WV3A 3L3GA 3DX9B 1J8HD 3ISWA 3ZSSA 5JNYB 2E7MA 5EFIB 1J1OH 3C8DA 5DK2B 1NCTA 2R4SH 5IW6B 3MROB 3JV0A 4H0IA 5ELIA 4HIJA 1DSFL 1FL6A 2XFXA 3ZKXC 1ORQB 1LEIA 4YLQT 3IFNH 2P8MB 5LCVH 1M6OB 4LEOB 1YEEH 4PRBA 5C71A 4JFYA 2VZOA 4YBLB 1B0GA 4U6YB 4KAQH 4ZPTA 2Q8AL 2VR9A 3UBXB 1FE8L 3WDHA 4NGHH 4U1MA 1QLEL 4X80L 2X4OA 4X4YA 4XPTL 2P24A 5E99H 4L9LC 3MMEA 4I48B 2M1KA 3JV4A 5ERWB 3JWDL 1H5BC 2A9NL 3HMXA 4MA8L 2Q7NA 4V1DD 4DQOL 4J3WA 3QUML 1HHHB 4LSTL 1HZHH 5GIRB 3DMMD 1CBVL 4HWEH 2QADC 3EZ8A 1DQDH 3FRUA 3QIUD 4QRQB 1HQ4B 5KSAD 3OKYA 3MJ7B 1JF6A 1VFBB 1IGTB 2V17L 3LVEA 1LO0L 2UWEF 4UNUA 4Y4FA 3MX0A 3L3GB 4HWBA 5DUPL 5CAYB 3P4LA 1DDHA 3HUJE 3RPIA 4HIJB 4KTDH 1FL6B 2OTWA 2XFXB 1TJIH 1H15B 2DTMH 3NAAL 4G43A 3C6LA 3RAJL 3LDBC 4AT6A 4M1CC 2E6JA 3ULVH 1I7ZB 4KRLB 4OT1H 1B0GB 2NY0D 4ERSH 1MNUL 1IGFH 4I8DA 2QSTA 4U1MB 4ETQA 2FHBA 2X4OB 1WVZA 1S3KH 4X4YB 5DR5H 4BM7A 2MKWA 2P24B 3EO0A 3T0XA 3WO4B 3T2NL 1X5JA 3JV4B 2KQNA 2AJZA 5GJTH 4HC1A 3DUHA 4J4PD 3FRUB 4A2MA 4NHUB 5CJ5A 1BF2A 1Q0XH 2BMKA 3KS0H 4ZO6A 4YXLH 1Y6NR 4Y4FB 1DBMH 1XIWA 5L88H 5K9JH 1S7TA 1FL5A 4ZYKA 3DUSA 4TUOA 2DD8H 4DGYH 1DDHB 3WS3A 1A6VL 5DUML 1H8NA 2CDFA 5C86A 2YMXL 2OTWB 4FQ1L 2O93L 1CFBA 2JLLA 3TO2A 4I0PA 4PUBH 4G43B 1IM9B 4KROB 2EH7L 2XYCA 4G8FA 4UZGA 1ADQH 5MP6L 1S9XB 3ZHKA 1M7DA 4OQTL 5I73C 1DQLL 4N0FA 2XTJE 5FDWB 3TVMA 1QG3A 3S9DB 4HUNB 1YEDA 1UADC 3AB0C 4Q7DA 5MHSD 5C0ND 3STLB 3ULUC 4G7VH 3MRQA 4HDIB 4XPBL 1JHTA 3D25A 3JV5A 4MQSB 1NAML 2KBGA 2QQKL 5C92A 3DSNA 4UT6H 5F1KC 4PREA 4YXHH 4JGMA 3S3JA 3F6IA 3RZCD 1Z2KA 3SE9H 2VAAA 1P4IL 2AEIT 4K71C 1IAII 3ARED 2LVCA 3E3QC 5D96C 2BMKB 5CHNB 4QEGA 1XIWB 4KK6D 2XRAL 1S7TB 3PL6A 2RBLA 4ZYKB 1MPAL 1OQXA 4TUOB 3WS3B 2HLFC 3DETD 3I84A 4J3TA 4HJJL 4TSCL 2A38A 2AXFA 2CDFB 4D9QD 1EK3A 3TO2B 4I0PB 4JRXA 5FCUH 3FRPG 2QR0A 2B4CC 4NDMB 3SE4A 3TBSA 4G80A 4G8FB 1OAXH 5TQ2L 1AH1A 2DIAA 1K2DB 4HCRL 3HC3H 4R96A 4N0FB 3TVMB 5TJWK 2F8VA 4X7DC 1YEDB 3DPBA 4PJAA 4AIXA 3FFCE 3CFIC 2X4TA 1H3PH 4JVPA 5DEZA 1ZLWK 4C59B 5SWZE 4IOFC 1JHTB 1KCUH 1NGPH 3MLRH 4KRMB 3LS5H 5L7XH 3VXOA 5C6WH 2PYED 3HZYA 4U1NA 3HPLA 4PREB 1NANH 1RIUH 3QI9C 4OIAA 4KDTC 4Q9CA 4X6BA 3FFCD 3JWOC 5F1OB 2AJXL 2D7OA 3Q48A 3RWFA 4OZIA 4UIKH 2NY2D 1QHPA 5SWZD 3PL6B 1I85C 3B6SA 1P4LB 4Y0GA 1YEFH 2DQHH 5C0AD 1PG7L 2M8XA 5CBEA 1JN6A 2AXFB 3SGDH 4JRXB 1FZMA 2ADJA 2QR0B 4G80B 1MJUL 5HYEA 4RCAA 5TDOB 4HSQA 5F7YC 4Y16D 4PJAB 5B39B 2DQDH 2X4TB 2VZ1A 2XWTB 4GXUN 1JRHL 1MCPH 3U7AA 1QHOA 4HS3A 5LAXA 2YBRA 3HZYB 3PV6B 1A7OL 2E27L 2IQ9L 2E9BA 1JZ7A 4Q9QL 3HPLB 4H1LA 4DKEL 4GXVH 5D7JD 4MDJA 2DLEA 3IKCA 3O0RH 4X6BB 4Z7VB 1UYWL 1ZT4A 4MMZC 4MSWA 3RWFB 2A77L 4OZIB 5IIEA 2HAZA 5E1HB 4OGXH 1OW0A 3MCLH 3B6SB 4JFXB 4UMGA 4JR9H 3HS0A 5CBEB 3BAEL 1JN6B 4GQ9H 3PWPA 4HBCH 3B2UD 1RSFA 4KJQD 1FZMB 2ADJB 1L9MA 4AEIH 5KJRH 3MJGX 1G9NH 3HZKB 1PEZA 2VKWA 1FFPA 3V6FB 4CJ0A 1Q1JL 3NFSL 4MGXA 5TQ0L 5HDLA 2DLFL 2QEJA 1C5CH 1KB5H 2C1PA 3QUXD 1CLYL 3C2AL 5GGUA 4OB5H 5DMYA 3HNSH 3L1OL 5F6IB 3ZDXE 2F8OA 5IJKA 3VRLE 1P7HL 4YUEL 3W81A 4HS3B 4BQ6A 5JW3L 5CJ8A 1C08B 5LAXB 2NNAA 5E1AA 2P5WB 2AI0L 1NDGA 4P5TA 4H1LB 5EBLB 1YEIL 4ZUVB 5GGSA 3CH1A 4MDJB 1EZVX 4LKCA 4YH6A 1ZT4B 4MSWB 1HCFX 2ZCHL 5K9OB 4V2CB 1TNNA 1V3JA 2NY1C 2GFBA 4P9MH 1JVKA 1YMHA 4S1DC 1NDMA 3HS0B 1AHWC 4IRSA 3PWPB 1IGMH 3QJFA 1KCRL 5D7LA 4RBPK 4NP4H 3V5HA 4OM0L 1A6TA 3DWTA 2OXHA 3AS2A 5HTSA 1IC7L 2VXUH 2GYSA 4NOFA 1ZGLA 2DJ4A 1R0AH 4M1GL 1MCOH 4O02L 3VGHA 3VD3A 3VFRB 3WFEL 4Z7WA 1EX0A 4F7EB 3HG1B 3RDTA 1T03H 3VG0H 4ODSH 4PJ9A 3SKOA 3ULUL 3O2DL 1KBGH 4MMXC 4GH7B 2NNAB 5E1AB 2AV7A 4DGIH 1NDGB 4P5TB 4OZGF 1SBBA 1P7KA 2Q86A 3DVNA 3OJDB 2W9EH 3CH1B 5GGSB 2Q8BH 5J13B 1PAMA 43CAB 1VFUA 1MREL 3OL2A 1Q9KB 2HT2D 2YA0A 4FZ8H 5FIEA 2BDNH 1J18A 1I8KB 2QADD 2B20A 5I1CH 5MEQA 3BZ4A 2GFBB 3QEUB 1NQBA 3H0TA 1ONQA 4C56A 1NDMB 3QQNA 4IRSB 4NZTL 3C09C 4EOWL 3QJFB 2D7TL 4H0GA 1ZSDA 5D7LB 5TFSL 3V5HB 3D69A 2N7BA 4KI5F 2YD3A 1QA9A 3A67L 3V52H 1XF3A 3QZWA 1ZGLB 5IHLB 5D71H 1J0KA 4XWOD 1OM3H 5KVFL 4M1CD 1B4JH 3GNML 2VISA 3X3GL 4OZHE 3OXRA 3MTRA 4Z7WB 4WI5A 3WNOA 5DD6A 4O5LH 3LKSA 5IBTL 3RDTB 2J8UE 1JBJA 4PJ9B 3SKOB 2WQ8A 1F3JA 1IC5H 3NVQA 4LARL 2AV7B 1P4BL 1SJHA 1YEKL 2Q86B 2F8XC 1IJ9A 2VDPL 4KV5F 1ND0A 4LIQL 4QCIA 2ID5A 2DRUA 4JHWL 5A43C 1VGEL 2WP3O 3O8XC 5I1KL 2IG2L 5L8KB 5MEQB 3BZ4B 4UUJA 4PG9A 1MCCA 3CVIH 3EDKA 5I66A 1Q9WA 3L5XL 4IIQC 3BE1L 1CLCA 4YHKH 1JTPA 2HN7A 3VXTA 1YQVL 5DK0A 3NFPB 4MA1B 3HN3A 2JJWA 2W0KA 2BJML 3D69B 1T1WA 1I1AA 3LKNA 1NEZG 3GDBA 1QA9B 2V7NB 5D1XA 5IW3A 3T2QA 3WS6A 5EUOF 3QZWB 4K3HA 4JRYE 3BEWB 1IARB 4I3RL 1UH4A 1MIEL 3VMNA 3WNPA 4MHHG 5B3NA 1U8IB 1RZ8A 4Y5XB 1FLTX 5JHDE 2VISB 4L4TA 3WNLA 3OXRB 2HFGH 4TNVK 1F6LL 3CK0L 4OD3L 5DD6B 3WXVL 5HHNA 3SGKA 4F2MA 1BFOB 4ELKA 3FO2A 2BVUA 1F3JB 4JPWL 4DN4H 1NC4D 4YHOL 3ULUD 1A64A 1W72A 3MOAL 5GS1C 1ZMYA 4UNVA 3HR6A 2WWMD 3FB6A 4QCIB 1RZIA 4Y4KC 4M62H 5HYIA 1ZS8A 4KK9C 1BAFL 2YPVH 3QIBC 2E5EA 3HKFA 1QBMH 5D2LE 4FQJL 3FFDA 3MA7A 4HGWB 3VXTB 2DQCL 1QBLL 4M7KH 1OP3H 3SGEH 3B43A 5FV1L 1CFTA 1T1WB 3KYKL 3U0PA 1I1AB 2HLFD 2X44D 2BNUB 3TA3A 4WCYL 5H37G 5T1KD 3ROLB 5E2WL 3KPPA 1RZ8B 4W6YB 1WTLA 4TQEH 4L4TB 5JQHC 3QHFH 1KG0A 1TMCB 1Z9LA 4MB4A 1AJ7L 5DEFA 5DC0A 2GIYA 5HHNB 4F2MB 3QNXA 1U8NA 2NMSA 2ZUQC 3VWJA 4ELKB 3FO2B 3U4BL 1MVFA 1PX4A 4PPTA 2E6QA 1W72B 4DUXA 4OSUL 1JWSB 2OI9B 4KKCC 2EXYC 4NN7B 3QEGH 1WV7T 3FB6B 1RZIB 5I1LA 5IMOB 4J3XA 3UZVB 3QI9D 1ZS8B 3BWAA 4W81A 4N0YH 1ACZA 4D0CA 4NNYA 2XN9E 4RRPA 5I1EH 1CR9L 2WK2A 1CG9A 4FQXC 1CVRA 3FFDB 3MA7B 2QJDA 2AJSH 4N5ED 5DWUL 1HWHB 1EUUA 2F58L 2XKSA 3IXAA 3ARZA 3MLVL 4YDLC 3WJJC 1H3TA 1ZA6A 2BVYA 1CFTB 1C5BH 3U0PB 4FTVA 3PP3K 4NZRL 2MCPH 4MNQA 4NC0B 3TA3B 3ZYIA 4ZFOA 4MNHA 1RI8A 4FQQB 1ZWIB 2CSPA 3NZHH 3WMSA 3KPPB 3PQYB 3ARDC 3BX7C 1KG0B 1CIUA 4QXGL 3LEYH 5DEFB 2Z8VC 5BRZA 4POZC 1U8NB 1RU9H 3RUGE 3VWJB 2PR4H 4LLQA 1LEGB 5DT1L 5F7UA 1WBZA 1KC5H 2XKNA 3UJIL 5SX5H 1TXKA 1ERNA 1S9VB 4P2RE 1OOAA 3PHOB 4HFWA 1JHKH 3BWAB 2R1WA 4HH8A 4D0CB 3D5OF 4NNYB 1FDLH 2ZUSA 2OZ4A 1CG9B 1FFNA 2X1PA 1NCDL 1UEYA 1G9MH 1NFDE 1UM6H 4S2SA 1RHFA 2WBJA 3IXAB 4GJTB 5E94B 4PRID 1ZA6B 3LEVH 1A3LL 4WWKC 3BEVA 5EA0L 2VDKH 5HDQL 2Y5TA 4M5ZH 4FTVB 1S9WA 3QAZB 5CJBA 5FYKH 4ZFOB 3O81A 4MNHB 4IBLT 3EYVA 3DX7A 4L3CA 5DS8A 4BFIA 5E8OA 3O2VH 4YR6A 2KZWA 1WWBX 3MLWH 3TN0A 4RA3A 4PB0H 1E4XI 1WICA 3S34H 2R69L 2AV1A 2IBZY 3BSZL 2ZUYA 4A2LA 1D9KA 4LLQB 4L3EA 1Z9MA 1WBZB 5L6YH 2XKNB 1DBKH 3FN0L 3L3DA 1LO4L 3Q0HA 5AWNH 1KCKA 1T66C 4HFWB 3IS1X 5LGKA 2ZSVA 2R1WB 2XNAA 4XPAL 1K4CA 1BFTA 1MCHA 2PXYC 2XICA 4KK8D 1RFDH 4UT7L 2D0HA 2H8PA 4YK4B 2ERJC 1FFNB 3OKMA 4GW5A 2CR6A 2F5BH 4NQXB 1AE6L 2CDEA 2WBJB 3BKML 1FFRA 2CIIB 3PDDA 3BEVB 4S1DD 2CGRL 2Y5TB 2VXTL 4Z8FH 1EO8H 4F7PA 1S9WB 5D93C 1X4YA 4XVJL 3EYVB 3DX7B 4L3CB 1T6VN 5DS8B 4BFIB 5JR1H 4FQHA 2NCMA 4YR6B 4NBYB 5I75B 4XAWL 3FOLA 4MQXC 4KPHH 4LLMB 4DUVA 4NHCL 3KS0J 5IF0B 1EFXD 1QVOA 3K7UA 3CSPA 1D9KB 3QPXH 3UP1A 1A6AB 3W0WA 1JGEA 2R4RH 1BP3B 4L3EB 1AXTL 1KGCE 2E6PA 4WGWB 4YQXH 1AFVH 3HRZA 3P4MA 1RUQH 3L3DB 4PJBA 5JXEC 2DS4A 4AM0A 4G6AC 2P46B 4HT1H 2D31A 5DMIH 4X8XA 4P99A 1MFEL 4G9FD 1ZKAA 2ZSVB 4NQCA 1K4CB 5C2BH 2H8PB 3ME0A 3QDGA 4OCLC 4GW5B 5I8OH 1Z9OA 1KGCD 3RZWA 2CDEB 4PFEA 3BKCH 3HNVH 1UWGH 3GGWB 2NZIA 5E0QA 3BD4A 1CXEA 2WBKA 4LBEA 5LQBH 5IVXF 4JANB 2CJUL 5F7WC 4F7PB 1FLRH 1XCQA 4WU5A 2WAHA 1AP2A 4JKLA 5IHUL 2HFTA 3IDYB 4LDLB 3V4PH 3FOLB 5KSBA 1V7NL 1PW3A 3MXVL 4HLJA 1AKJD 5T1LD 1QVOB 3HE6C 2R56H 2ADIB 3W0WB 4U2ZA 1JGEB 1F2QA 1U41A 2HJLA 3HRZB 3P4MB 4LLYB 3QO0A 3VFGH 7CGTA 1YN7A 5D8JL 2D31B 2VDOH 3E8UL 4PJ5D 1OWWA 5CEZH 2XWBA 3EDDA 4NIKB 3IU4H 4UILL 5FO9A 4WEUD 1DUYB 3C5JA 3QDGB 3AU1A 1CFNA 4K9EH 3VWKD 1MJ8H 1X5FA 4MJIE 1GGCL 5KSAA 4LBEB 1F3RB 4X6CF 3GSNL 3IJYA 1XCQB 3HI5L 4WU5B 3KYOA 5FA3A 4ESKA 2R0WH 3B5HA 1AP2B 5HHOE 4L8CA 4R90H 2VR5A 3HB3C 4CJ1A 2DYPB 3U48A 2A6KA 5CFHA 1RZ7H 2OM5A 1OAYL 3QFDA 1OP5K 4Q9RL 2HJLB 2J6EL 1OAZH 3NPSC 4YAQA 3QO0B 3ZYJA 3BOVA 2DMBA 4ZTPH 5B21A 4LHUA 1YN7B 4XVSH 2ICWI 3K46A 1RUKH 5HHOD 3HUJA 1BX2A 1JPSH 5JXAL 2P49B 2R2HA 1KF9B 3T0AA 3MRNA 2XWBB 2YXMA 4O2EB 2VLLA 5FO9B 3CLFH 3O6FA 4I77H 3RJQB 3RVWD 3WN5C 2YEZB 3AU1B 4Y4KD 4L8SC 4MA3A 4FQIH 1A21A 4R6UA 4L4VE 4KK9D 3RVTC 4J4PA 3MRDA 3QIBD 4PJCB 3RVUC 5KSAB 2NY3C 2MCG1 5FHBL 2DQTH 4MAYC 3IDXL 1CF8H 3IJYB 2ZOKA 1A14L 2VO5A 4ZSOB 1SJEA 5F9AC 3KYOB 5FA3B 4U0RC 5L8LB 2IBGA 1A3RL 3IF1A 4LSPH 2VLJE 4WENB 4L8CB 4WTZA 3R1GL 3SCMC 1I4FA 2UYLA 4L4VD 5A3IC 3EBAA 4EUPB 1Q8MA 4TSAL 2A6KB 4RGNC 1WAAE 2BXZA 3QFDB 3RU8H 4K3EH 5DDHA 3LKPA 1JFQH 4YAQB 2XZQL 2DQGH 4OLEA 5BXFA 4LHUB 2DQIH 3MV8D 2YKLL 5EZLA 4QLRA 2R2HB 3OKKA 3MRNB 1A9EB 4KKCD 1AGBB 2EXYD 4PGDA 1CICA 2VLLB 3O6FB 4WI9A 4JKWA 1BQHA 4LQFH 4NQUA 4FQCL 1MUJA 2R0ZH 5EOCL 1QFUL 2G5BA 4MA3B 5IR1A 1NGXA 2YZ8A 5GGVL 3MRDB 3EDFA 3FT4A 3RZCA 5MERA 4FQXD 1EFQA 4WUKL 4Y88A 3LN9A 3V0WL 5K59F 5FGCE 1LILA 3QXDA 6CGTA 4NFCA 2ZOKB 1CDCA 1DANU 1KENH 2EDFA 3PGFH 2R8SL 1CDIA 3P11H 4PRDA 2Y36H 5IW1B 1I4FB 4U1SB 3BKJL 3IFPA 1KTKE 2UYLB 1T89A 2O5YH 4NYLA 5IOPA 4F80A 3ROOA 3CFDA 1ZANL 3ARDD 4HBQA 5KSUA 3GIZH 4M5YL 4QOKD 3QRFM 1IFHH 3LKPB 5FUOL 4KHXH 3RI5K 3U0WH 2O5XL 1NCAL 3V5DA 3KWWA 2XXCB 3V6OC 5EZLB 2OSLA 3X14A 3OKKB 1SEBA 2HH0H 4PGDB 1CICB 1JNHA 3U6RA 3ARGC 2DQJH 3NACL 2VLKE 1HDMA 3KYMA 2G5BB 1G7JA 1KNOA 4KMQA 5IR1B 1NGXB 1EAPA 3FT4B 2XTJB 3RZCB 3ORJA 5DRZA 1BQLL 3FFCA 2RFXB 1FN4A 3K0WA 3BDBA 4L29A 3UTSE 4X5WA 4OCNC 5DHXB 4N8CH 5SWZA 3MV01 3O6MH 4WWKD 4A6YL 5DI8A 15C8H 4PRDB 2Y1VA 2VLKD 3DSFL 3IFPB 1G7LA 5JIKA 4PTUA 4XGZA 4BFGA 4NYLB 4EI5A 3ROOB 4LLDA 2FBJH 1L0XA 4OF5A 3P9MA 3SJVE 5KSUB 4HPOH 2LTQB 3UTSD 4ZD3L 3TBTA 2IH1A 12E8H 3F7PC 2GEEA 2A74A 2EYTA 3FL7A 5C3TA 2OSLB 2GY5A 1OP3K 3O6LL 1SEBB 4G8IB 5F6HJ 1XR8A 4QHLA 3RWDA 1JNHB 3U6RB 2UVFA 1HDMB 3SJVD 1T66D 3IDGA 1G7JB 1KNOB 4C57C 1DCLA 2NY7L 3TBYA 2C7UB 1EAPB 1WBXA 5D7JA 1F42A 4JHBA 1AR1C 4EEEA 3DTXA 3FQWB 5DRZB 4WUUE 3UPRA 1EHLL 3OX8A 3QG6A 3FFCB 4L29B 4OCRL 1F4YL 3IKKA 3TWCH 4X5WB 5I16B 2NY2B 5KVEH 5SWZB 5DI8B 1G7PA 1V5JA 2KZ1B 2YK1H 4YZFE 4KQ4L 4P3WA 1G7LB 2FHCA 2VWEC 4PTUB 2CKNA 4XGZB 4E0RA 4EI5B 4U1HA 1VSCA 2HA1A 4F37K 2F9BT 5E6ZA 4LLDB 4OFYD 3P9MB 5FB8B 1MY7A 1KLFA 2JJSC 4MQXD 5J1TC 4CU6A 3TBTB 4PYGA 1PKQB 5I9QC 1AQDB 1YNKH 2X9XA 3QUXA 3MRPB 1BHGA 4RAUA 35C8H 3S4SG 3G5VB 1F4XH 1WFUA 2YD7A 2A74B 2FATH 4XCCH 4CMHB 2EYTB 2ZPKH 4JDZA 4XX1E 1TVDA 4Z0BL 5JXED 1XR8B 1HIMH 4G6AD 4QHLB 3RWDB 3VRJB 2FR4A 1GC1H 3KPNA 2A73A 3BGAA 4GQPH 4WI6A 5DJ0A 4MAUL 3IDGB 5J6HA 1B3JA 1GGIH 5CINH 1NGQL 1WBXB 1EVUA 5D7JB 4OLVH 4RFNC 3OKOA 1NCWL 4WO4A 3DTXB 3UPRB 2AABH 3OX8B 3VFTA 1ZT7A 2YD4A 2DI9A 1ACYH 3ULVC 3BYYA 2YSSA 2FCBA 1BBDH 1AGDA 3W39A 1YY8A 1BGXL 2CLRA 4E0RB 5I8KL 2XIDA 4MCYA 3LKOA 4XAKE 5D1ZC 4U1HB 3VFPA 5J12C 3L5WA 4M48H 3MO1A 4Q6YA 5CD5C 4R97B 1NMAH 4LAQL 3HE6D 5HYQA 3RIAK 3SBWA 1D5XA 1RUPL 4YX2H 1KJ3L 5C0CB 3CX5K 5I76A 1DQQA 1LHZA 4Z7WF 2FR4B 3O3AB 4XAKD 5DJ0B 2A73B 3TH3T 3I02A 1I7TB 3A6OA 5J6HB 2Y9RT 2R1YB 2ZUTA 3OKOB 3VCLA 4WO4B 1H5BA 5C08B 4CU8A 1UXWA 1ZXQA 5ID1B 1S7RA 1DQML 3ZDYF 4OCXL 2MQCA 5ICYA 2YSSB 1C1EL 4GG6F 2AJUH 1AGDB 3W39B 1YY8B 2ADFL 4NQSA 2CLRB 3AMLA 4P0DA 2IJ0C 3HR5B 3E2HB 1PLGL 2FX9H 3LKOB 3VFPB 3AMKA 2W1NA 5E70A 3L5WB 4N9OB 1F97A 3MO1B 2IH3A 3HB3D 4PJEE 5HYQB 4RGMB 5DMJB 1R3IH 1D5XB 2XWJB 4XPGL 4Z7UE 5KAQG 1KJ2H 4X4ZA 5I76B 3ZT7A 1DQQB 2FB4L 1J1PL 3RX7A 2OR7A 1ZLVH 1E27A 2ED8A 5F9WB 5B3JF 4E9LA 2PF6A 4OKVA 3KPQA 1ZLUH 3DHMA 3I02B 3E0GA 3HA0A 1CQKA 4KRPB 1X3DA 4LMQE 5CZXC 4LAJH 1U8OA 2LFGA 1C8PA 3VCLB 1Q9OA 1OAKL 3I50L 1UZ6E 4OZHA 5HVGB 3RVTD 1S7RB 1RULL 3T77A 4BZYA 2QADB 3WXWL 5ICYB 1JGLH 2J8UA 3RVUD 2VUYA 2NY3D 2NW3A 4MAYD 1HKLL 5LXGH 5GGQL 3UDWC 1JWMA 5IFAH 1E4KC 4PGCA 3VH8G 3CX5J 3SCMD 1PSKL 2LAAA 2IH3B 3VW3L 5F9OH 4CRPA 5A3ID 1KOAA 1U6AL 3CC5A 5EG6C 3S6CA 4HQQL 5E5MA 2X70A 2FGWH 5IP4A 2AJYL 3WLWD 3SOBL 1KXQE 4OCSL 5F7DA 1U2CA 1E27B 4NZDA 4UTAH 1CFVL 1FNLA 1E28A 4OKVB 3KPQB 4G7YH 3K80A 4CADB 1UH3A 1NC4A 4XVTL 2EIZB 3HC0A 1T0MA 3GHBL 4JRYA 4ZFFA 3STBA 1U8OB 1HI6A 3OR6A 3WIFA 5JHDA 4IMLA 4LNRA 1QFWL 1BVZA 4OZHB 1FVCA 2GSIA 2HKHH 3S7GA 3T77B 4JO1H 1INQA 2J8UB 4YFLI 5IBLC 2NW3B 4Z7OF 1YEEL 3DARA 4GLRH 4Z77A 1VKXA 4NWUH 4RWYL 1BIHA 1EV2E 3HMWL 4AZ8A 4PGCB 4UV7H 3TJHC 5GRVK 4X5LA 1B90A 1F90H 2YD9A 3NABL 4JDTH 3EYUL 1M4KA 25C8L 3W82A 4TOYH 3CMOL 5E5MB 2X70B 5D2LA 5DA0B 3ZKMC 3KJ6L 5I1IL 1KYOJ 5F7DB 4X0KA 3P0YL 2AEPL 3IETA 1ZV5A 4P5KA 4NNPL 3UC0H 4S1RL 1J0IA 2FEEI 4MWFA 2APVA 2C4XA 4OV6F 2W38A 4PV9A 5IWLA 4XH2B 3MV9E 1T0MB 5EDXA 2J88L 4JRYB 1RAMA 1CT8A 4ZFFB 3QDHA 3ARGD 4WU7A 1YYML 2CO7B 3BPLB 3QCTL 4FHBD 5AYUH 4OGZA 3WIFB 2VDNH 5JHDB 4IMLB 4LNRB 1FGNH 4ZS6C 3SO3B 1FVCB 2GSIB 5KN5B 4WI3A 5FUZL 3R06A 1K9TA 1G9NC 4DTGH 5BJTA 2ARWA 2Z8RA 1AXSB 4Z77B 2HYMA 2IGFH 1VKXB 2CMRH 2H9GA 2HJKA 3IAPA 5E9DE 4I1NB 2OP4L 1TJGH 3BDYL 3HHRB 3EYOA 2ICWA 5C1MB 5DR5L 1UVQA 2DMKA 1FSKC 5I17A 3MNZB 5E2VL 3VGAC 1CS6A 5JMOC 2XN9A 1RZKH 4F57L 4OCYH 5D2LB 3KXFD 5FM4A 4U1IA 3RWEA 5DO2D 2DKSA 2DBLH 1GOGA 1MHHA 3IETB 5E9DD 4R7DA 1C5DA 2JJUA 4P46C 3SDXF 2R0LL 4MWFB 3LH2H 5DMGC 4PV9B 4JO2H 1MI5B 4XP6H 2VDRH 3ULSA 1CT8B 1CK0H 2C5DC 5GRYA 3TC9A 1GIGH 4WU7B 4J7RA 1IQWH 2DWEA 2LU7A 1AR1D 5BJTB 3RUGA 3BIAX 5IB5A 4KKLC 1YYLL 1N2RA 3D85D 3SKJH 2HJKB 5DSCB 5E8DH 1S7WB 4HIXL 4QRTA 3V7AG 4M8VA 4P2RA 3EYOB 1YZZA 2ICWB 4LCYA 1UVQB 5TGBA 3BQUD 3T3MF 4PJFE 2XN9B 4R2GB 3EHBC 3RA7H 5D7KE 3NN8B 1NFDA 4U1IB 3RWEB 4Y2DC 4H26A 1KTRL 2AK4E 2AVGA 1MEXH 3B8YA 4R7DB 1C5DB 3EJJX 4KUZH 4P4KA 4L3AA 4XWGL 4M6AA 4HFUL 5IFHH 4MLSA 1T83A 4YDVA 1J0JA 2BRQA 4M7LL 3VXQB 3ULVE 3ULSB 4N8VG 4WEBH 1QSFD 2YXFA 3W5MA 1MWAA 2VTFA 2QQNH 3VGFA 2NX5E 4J8RB 4GRLC 3MRMA 2DWEB 4GSDH 4ONGL 4RNRB 4I0KA 2AK4D 5I6XB 2E8ZA 2J4WL 5IB5B 3RUGB 4MD4B 3BRGC 3BPNB 2ZCKH 5JA8B 1LDPH 2BOBA 3PWLB 3U30B 3ULVD 3HC3L 4C55A 2CLVA 4KHTH 2ICEA 1FZOA 2FJGA 1MIML 1QSZA 4P2RB 5DD5L 2XQYG 4XPFH 3QEQE 3RHWK 3W2DL 3T2OA 1AHWA 4LCYB 1F8TL 1RUAH 4PJXE 5L2KE 5TGBB 2C9AA 4NRXA 5D1ZD 1VADB 4LSVH 1L4IA 3S36X 1NFDB 1XAUA 5CD5D 1N64H 4OZFG 4QGTA 1PEWA 5K9QI 1SMOA 2GJZA 5MI0C 1MFBL 2P47B 4PLOB 5C0DB 1EFXA 4P4KB 1DR9A 3OTTA 4KY1L 1CI5A 2QKIA 4JFPA 4RMWA 1SY6L 4NKMA 5CGTA 4M3KB 2PO6C 3SQOH 4QWWD 4LMQI 4UAOC 5L2KD 1I9IL 3RFZC 1NGWA 1XEDA 3X3FL 3JUYA 4M6MH 1WJ3A 5FV2A 4PJBF 4ZTOL 1MWAB 4O2FA 2AGJL 2CRZA 3MRMB 1NAKH 1FC1A 3WEXA 2IANE 4Z95H 4JO4H 4H88L 4P49A 4LFHG 5CJOL 5CGMA 4IDJL 2BOBB 2CLVB 2MKLC 3VA6A 2ICEB 1FZOB 2FJGB 5IG7A 2JCCF 5FAAA 1U3HA 1AHWB 1P1ZB 1DSFH 4F8QA 3I6GB 2B5IC 4Q9BA 1RVFL 4NRXB 4Q97A 5INCB 2IAND 1Z6JT 3I75A 4ZG1A 1VA9A 2Q8AH 5IBUB 5IGXH 1HH9A 3WFDL 3EJYC 1FE8H 4GUPA 4OGYL 5FKPA 5T1LA 5KSBF 1QRNE 1EFXB 1QLEH 2I9LA 4X80H 1VPOL 2QKIB 4JFPB 4NKMB 4XPTH 2P1YA 4JPVL 1PQZA 2I27N 3FHQA 3ESVF 5J3HD 1UJ3C 3JWDH 5JORA 2A9NH 3OKNB 4MA8H 4DQOH 4Y4HB 4FA8A 3QUMH 4LSTH 2GJ6D 1CBVH 3LKQA 1NMCB 5CZXD 1J9CT 1QRND 3WEXB 2EDQA 2V17H 1LO0H 3VWKA 5JLZA 5DUPH 5HDOA 4IIQA 4KJWC 5IG7B 1NUDA 1Q0YL 1U3HB 1UB5A 3DURA 2BHZA 3LN5A 2ZNXA 4JEGB 3T09A 2B1HL 3NAAH 3RAJH 4KKAC 5J7CC 3I75B 5T3ZL 1MNUH 4CL7A 1GOFA 4PGEA 3IJHA 4QNPE 1HH9B 5FKPB 5T1LB 4MJIA 1MCFA 4D9LL 1ZVSA 5EU4A 1P6FA 4HIHB 2BNRD 4M1DL 3T2NH 1A7NH 3GKZA 4OZGE 3GSUA 3WL9B 2RIKA 5HHOA 1LO5A 3X11A 4JHZA 5DGQA 5EU5A 3LKQB 3HUJF 3NA9L 3J7HA 2EDRA 1MHEA 1S5HA 3HE7B 5GS1A 4QRSA 4K3DL 5IVZB 3TJEL 2EE9A 2R0KL 4YGAB 1K8IB 3GK8L 5DD3L 4Y4KA 5FEBA 5DMKA 5CLTA 3VWKB 5JLZB 1EGJA 1INEL 2Z35A 2AS5M 2YPLE 5IBLD 3QIBA 4IIQB 4C4KO 1KEGL 1A6VH 5DUMH 1K3IA 3DURB 1UB5B 5CIPA 2YMXH 4FQ1H 5GGTA 1XMWA 3L7EA 2DJUA 1T03L 4D3CL 3VG0L 3TJHD 2EH7H 3H3BC 3VD5A 5MP6H 4JM2F 5SWQA 2W07A 4YBQD 3G6JB 4U7MA 4PGEB 1JNJA 3IJHB 4OQTH 4L4VA 1BEYL 4MJIB 2YPLD 3HC4L 3ZKMD 1KIQA 1ZVSB 5EU4B 4X98A 4XPBH 4GRMA 3D87B 5I1CL 1G9MC 1NAMH 2QQKH 3UTQA 1IAKA 4GAGL 1KXTB 2X89D 1MCWW 3GSUB 3B5GA 2VLJA 1LO5B 3X11B 5HYFA 2X41A 4M7ZB 3TCXA 5HHXL 4Z5RB 3DX6A 4YGVB 1MHEB 1S5HB 1P4IH 5D72L 4Y4KB 5DMKB 4ZS6D 1WAAA 2DLGA 2XRAH 5D71L 5FKAA 2Z35B 5C9JA 1JZ3A 1MPAH 1RJLA 4FQXA 3N85L 4K7PY 4HH9B 3EDJA 4HJJH 4QRRE 4TSCH 5I1DB 4H0HB 5DFTA 3L7EB 2B1AL 4E42A 1IEAA 1ZLVK 5T1DL 1ZLSL 3X17A 5TQ2H 5EPMA 4HCRH 3ZKNC 5T3ZD 4L4VB 4QT5A 3PJSA 1NUNB 1KIQB 3ARDA 3S97C 3FMGL 2J3SA 4QRRD 4H5SB 4X98B 5FM5O 3BD5A 3UO1L 1QSVA 4GRMB 4P46D 3TZVC 4MS8C 3UTQB 1C16A 3UTOA 1IAKB 3L5JA 5DMGD 2PYFA 2APFA 5CSZA 2VLJB 1T20A 2FECI 4PD4J 1T5XA 2QLVB 4JAMA 2Z8WC 1XH3A 2AJXH 1FORL 2ZUUA 4ZO9A 3KDMA 5FKAB 5ICZA 1PKOA 5C9JB 1RJLB 1CTNA 4KKBC 1ZHKA 1FPTL 1PG7H 4NKIL 4WY7L 5HGBA 5I18H 4E42B 1IEAB 3CNKA 4WWKA 3S5LA 1T4KA 1KIUA 1MJUH 2VLKA 5IK3A 3QP3A 5EPMB 1WEJL 2APTA 4OLWL 5DFVC 5L0QC 4QT5B 3PJSB 5F88B 5C07E 4OF0A 3SE8H 2BY2A 5FGCB 3ARPA 4Y2DD 3UTSA 5IMKB 3L5HA 4Z7NF 4E41E 4U6HA 1JRHH 2ZG3A 4JO3L 4NQEB 2PYFB 2IQ9H 2E27H 3P4OA 4LVOB 3FQUB 5CSZB 4BUHA 1FVEA 4Q9QH 2HTKD 4DKEH 3CGTA 1T5XB 4JAMB 4NQVA 3PWNB 5CGYC 1WCQA 1XH3B 3DO7A 5C07D 1UYWH 3GSOA 3UYPA 3SJVA 2A77H 4I2XB 4GRLD 1ITBB 4XTRC 5ALCL 3KDMB 2HTLC 4L8BB 5ICZB 5TDPA 3ECBA 3ES6A 3UBXG 3BAEH 3EW3B 5FO8A 5HGBB 3WJLA 5T5NF 4DGVL 3ILQC 1YC7A 5F21B 3DI2B 3S5LB 1H3VA 1T4KB 2CKBA 2VLKB 1Q1JH 3NFSH 5TQ0H 2DLFH 5IK3B 3P9LA 5EORL 1BIIA 5ALBH 1CLYH 3C2AH 4XC3L 5IV2A 1HHJA 3RNKA 4WUUA 3UTSB 4M93C 4YUEH 4N0YL 1HSAB 2Q6WA 5JW3H 3P4OB 2AI0H 1FVEB 4LGRB 3VGBA 5JXEA 4KMTL 1J0ZA 3QFJE 5FO7A 3GSOB 2ZCHH 3RVVC 2XQYK 3ZHDA 2WANA 3S35X 3GI8L 5TDPB 1NANI 3ECBB 3ES6B 5GRWA 4PIRF 3WUWA 1VEMA 2WWKO 1UFUA 4G42B 5E8EA 5FO8B 2E9WA 1G6RL 1KCRH 3ARBB 3OB0H 4OM0H 3ZDXF 5E6IC 2AXHA 3QFJD 5HYJE 4Z6AT 1QO3A 2CKBB 2E7BA 1IC7H 4KJPD 2PNDA 3P9LB 1TZGL 4QHKJ 3C2SA 1HHJB 3SGDI 2YD2A 4N9GB 4O02H 4LQ1A 4NJAL 4WUUB 1F58H 5IB3A 4GXUM 4PP2A 4WFEE 4XCEA 3EJYD 3RIFK 4RMSA 1X5IA 3MR9A 3GBNL 3HE6A 5A2JH 5C0JB 1YJDL 2X4PB 3O2DH 2Q6WB 3ULUH 2DMCA 1U8MB 5HYJD 4JN2A 4LCCC 4WFHD 1RURL 1UM6L 5E2UL 3UAJC 4X6DE 2FH6A 5DHVB 4ZUTA 3RWHB 4FQ2L 5FO7B 1MREH 1OAUL 3EYFB 3GMOA 3FO1B 4MLIA 4WFED 4OF3A 2J5LB 4WHDA 1B0WA 3QT2A 4JPIB 4PV8A 3O9WB 3LKRA 5I74C 4LOUD 1J1XL 4Z0XA 4NZTH 4DN3L 5TF1L 4EOWH 2D7TH 5TFSH 4ZOEA 1L0QA 2EDDA 4D9RE 2I26N 3N1GC 4KJWD 1JGUL 1J10A 3K8MA 4PTTB 1QO3B 3A67H 4P59L 3BHBB 3U79A 1FNGB 3B9DA 4WWID 4ODVL 3WYRA 4KKAD 1NC2D 5GRZA 3M07A 5KVFH 1KUMA 3GNMH 2ADGA 3X3GH 5IQ7H 5IB3B 1JMXA 4YWGL 4XVUC 4XCEB 5IBTH 4F8TA 4OLUL 3MR9B 1CYGA 1MVUA 4D9RD 1PY9A 1U3YA 2OR9L 4JFFE 4X9GA 4JN2B 1EERB 1QACA 4LARH 4NWTL 4KTYA 4ZDHA 1P4BH 4OGAD 1YEKH 4MD0A 3VRIA 4W70A 2VDPH 2XG5A 1I8MA 4LRNL 4RQQA 4K8RC 4LIQH 4JHWH 3BGMA 3F62A 1M05A 3PP4L 5J57B 2IG2H 2F74A 4PJEA 4JFFD 5JR1L 3G08B 3L5XH 4PV8B 3BE1H 3I85A 3OMZA 4Z7UA 1RIVL 1YQVH 4Z0XB 4BFBD 1D5MA 1IVLA 2IMNA 2BJMH 2XXMB 5IVXE 1E4WL 5HGHA 4MAYA 1AQKL 2OS7A 2J8UF 4GBXD 2X05A 5GGRY 4JB9L 4I3RH 4ZODA 1MIEH 2JTDA 4XNQA 5D5MF 2X40A 5DRNA 3TIEA 2ADGB 4H1LH 3SDAC 4D8PA 3CK0H 3T8XA 4OD3H 4OBRA 3WIHL 3WXVH 4U1GC 1IL1A 4JKMA 5FYKE 4YHOH 4ZDHB 4CVXA 3FQRA 1U58B 3MOAH 5B38B 2OR8A 1I8MB 3FKUS 1KXVC 4X4ME 5EO9B 3BGMB 2UVEA 2YD8A 1A2YB 2VXSL 4LEXL 1V3LA 3DROA 2FNBA 3EO9L 1M05B 1BAFH 4PJEB 3ULUF 4B53A 2BSSA 4FQJH 5FYKD 3FO9B 3OZ9L 4Z7UB 3SDCA 2FO1A 4N0UE 4RMUA 1NBYA 2DQCH 1QBLH 3CFEA 1TZIA 1D5MB 3DVFA 5B39G 4X6CE 1EBAA 4HIIA 2IPKA 5HGHB 2FJHA 3KYKH 5TE6L 5F7HA 4M4RA 4OCWL 1IAMA 2YC1A 3G6AA 4WCYH 3CSBA 4PJ8B 4YHIA 4XNQB 5GRVL 5KS9F 2DWDA 5E2WH 5HVWA 3TIEB 2BVTA 4F58L 4D8PB 3L9RA 2RGSA 1GHFL 1DQJA 1GAFL 3ZKND 5JIPA 3T8XB 1AJ7H 1MSPA 5F6HI 3U4BH 4AEHL 4LVHC 4LCUA 4R3SA 1JZ8A 3FQRB 5IMMA 2FLBT 3TZVD 3O3EB 3GSXA 4OSUH 4MS8D 5ICXA 4EJ1C 1OTUC 3DYMA 1JP5A 3BUTA 3VD9A 3DROB 4KK5C 3THML 4LASL 2RR3A 3BN3B 5F97E 4WFGD 3X13A 1QBAA 4M4PA 1CR9H 3H9HA 2BSSB 3ARGA 3BESR 3WSQL 1N4XL 3GRWL 3SDCB 1NBYB 1UWEL 5DWUH 3CFEB 1TZIB 3HCVB 2F58H 4NO2A 2YPKB 2ZP0T 5C0BE 1EVTC 5TH2A 5M94B 5ISZE 4PP1C 3JUZA 1Y18A 3MLVH 1RZGA 4X5XA 5EUKA 4HIIB 3T3PE 2IPKB 4R4BA 5LG1A 4KKBD 3H9ZA 4LSUL 2PUQT 2YC1B 4DKAA 4NZRH 3WFBL 1VEPA 2NXYB 3MV9A 4YHIB 3GJFK 1FO0A 2DWDB 4JFDD 4H1LG 4UINL 3L9RB 4OFIA 5I0ZA 4IJ3C 5C0BD 1KT2A 3MBEC 3QHZL 3DX8A 5DFVD 4DOHE 4QXGH 5ISZD 1GC1C 4YC2C 3UYRL 4JZJB 3OAYH 4K55A 2UZIL 1CFSA 5DT1H 4R3SB 1HEZA 3B3IA 5IMMB 5E9DA 3UJIH 1JTTA 2H6PA 3GSXB 5ICXB 9CGTA 4XBEL 2DDQL 3LZFL 4YXKL 3QWOA 1DVFD 4JG0L 1CXIA 3X13B 4E5XB 5BQ7A 5CGYD 5I71C 1NCDH 4U3XA 3KPOA 2BX5A 2VIRB 4NO2B 5TH2B 4XTRD 2HTLD 4X5XB 1A3LH 5EA0H 5CEZE 1JPFB 4U0QB 5HDQH 4HMEA 4WNQA 4OI7A 2X4NB 3QUKA 3BZFA 3QH3A 3RUGF 3MV9B 2YD6A 3ILQD 4BSWA 3AY4C 1FO0B 1SM3L 5C3LD 1WWCA 4Y7MA 2DBJA 3GBLA 4LSQL 1KT2B 2R69H 1G0DA 3BQUA 3BSZH 2VXVL 1B0RA 3C9NB 2BNQE 1GGYA 1HEZB 3B3IB 4IOIB 3FN0H 4P2OC 3LPGA 2H6PB 5E9DB 5F44A 1QLFA 3W9DA 4GRWH 4MXVE 1LO4H 1G9EA 3H42L 2EDNA 2GK0A 2Q1EA 4K8RL 3QWOB 1JHLH 1CXKA 3CH8A 4XPAH 3D3VE 1RHHA 4PJFA 5C0GA 3X12A 4UT7H 2JKXA 4BK4A 2GK2A 2NYYC 3RVVD 4QTIL 1R3LB 1BMGA 1U8KA 2K9UA 3ALXA 1AE6H 5J4MA 2PETA 1RQ5A 2AK4A 3BKMH 2NY6C 3GEWB 5DRWA 2CGRH 2VXTH 3VXME 1KB9K 5DEGA 3GIZL 3QUKB 4XVJH 3BZFB 3FRPA 3QH3B 4ZPVA 4FOMA 4UNTA 4RX4D 3F7YA 4BSWB 3D3VD 5E6ID 3MFGB 4XAWH 4BQ9A 3WIIL 2NX5A 4AH2A 4MXWL 4ODBD 4NHCH 3BQUB 1PFCA 3BD3A 5D1ZA 3VFOA 5LJYH 2DQJL 2VB5A 3L3JA 3L6FA 3VXMD 4LSSL 1AXTH 5BVJA 3T0WA 1C7TA 2JB6B 2W60A 3LRGA 3W9DB 2GK0B 3V0VB 3CVHA 5CZVL 3B4NA 3QEQA 1S8DB 3UAJD 1MFEH 3IRPX 5EU3B 4XXCC 4NRZA 4PJXA 5L2KA 5FYJL 5K93A 1WFOA 4NQDE 2X42A 5I1AA 2GT9B 3TCLA 2IWGA 1U8KB 2EDHA 1QR1B 3DRQA 4EBQL 5DRWB 3FT3A 4Q6IB 1DLHB 2CJUH 4R7NB 1ITCA 5DEGB 3BMVA 4F7CA 4ZPVB 2B2XL 3RBSA 3F7YB 5LGHL 1ADQA 1OSPL 5IHUH 4TN9A 3DV4A 2NX5B 1V7NH 2YRZA 3MXVH 4HK3N 4XP9H 2BHUA 4MX7A 4NM4L 1GZQA 4ZAKA 5D1ZB 3S8WA 3L3IA 3VFOB 2IANA 3L3JB 2IQAB 1QFWM 3L6FB 3TEUA 5AUMA 4JCLA 3DLQR 4NO3B 5BVJB 5JHLL 5HYSA 4PRAA 4HAFA 4U6VL 3MYJA 5EOQL 3VG9B 3UJJH 5D8JH 4NM8L 3CVHB 3MJ9L 2LE9A 5J1SC 3QEQB 2K7PA 3TWCL 5CKAA 4NRZB 4PJ7F 4UILH 5I1AB 1C12A 4K8RD 5JIHA 3TCLB 1KB9J 1B88A 1ROWA 3RQ3A 2BVEA 3BWUC 1OPGL 1GGCH 4PBVC 4GRWF 3DRQB 2VLRB 4JKKA 1QRNA 1DANT 1D3CA 3G6DL 3GSNH 1KTDA 1TQCC 1MHPL 3HI5H 4F7CB 3SGJC 2EH8L 4HWZB 3LSOA 4JY5L 1AXIB 1FBIL 3DV4B 4XCCL 3JXAA 1UEMA 5BV7C 2COQA 4KH2A 4MX7B 2D7PA 1GZQB 1RMFL 4ZAKB 5KW9H 1OGAD 5D70L 3SDAD 1BQSA 1OAYH 2IANB 2BHYA 1U36A 5DVOA 4JKPL 4Q9RH 1AO7E 5HYSB 2J6EH 4PRAB 1QD0A 2OZ4H 2ZJSL 3MYJB 2X10A 2QHLA 4TVPL 2FD6L 4DWHA 5JXAH 1P9MC 3Q6FA 3TYGL 4NCC1 3BVNB 1I3UA 2ARJQ 1C12B 2BSRA 1KULA 1OD9A 1SEQL 3V4VL 3QJHA 1AO7D 1FNHA 3ARYA 4UV4L 3S36L 1QRNB 4APQD 1I3RA 5FHBH 1FZJB 3RGVD 3IDXH 1KTDB 1A14H 2HFFA 1YQ2A 1S9YB 2R2CA 2Z8SA 2BCKA 3F7QA 1RZKC 4I13B 5AD0A 4GG6E 2J2ZA 3E6FA 5HI5D 1WZKA 4ODUA 2VNCA 1A3RH 3NCMA 5E4EC 2Z31A 4JDVA 3VGGA 4OZGA 3R1GH 4WTWA 1L7TL 4TSAH 3CDFA 5JW4M 5CCKH 4R0LA 1W0WA 1U8QA 4U1LB 4F7TB 3VXPA 1F13A 3H8NA 2XZQH 1Q9LB 1XF2A 2YPLA 4ZOCA 4P23C 4ZXBC 3PUCA 3W11D 2YKLH 4Z9KB 3Q6FB 5B3JE 3CMGA 4ONFL 4HUUA 5FGBC 1OTUD 1BVKA 5H94A 2BSRB 3FQNA 4FQCH 2FEDD 2CRMA 5EOCH 1QFUH 3F5WA 3QXTA 4KK5D 2NY4C 5GGVH 4GKSB 4NC1C 2Z91A 4XNMA 4KVNL 3GKWL 3KLAB 3H7BB 2KDGA 1I3RB 2X4UA 3V0WH 5DGRA 4BZ1L 1R6VA 3F8UB 5IJVA 2FECL 4PP1D 1Q38A 5E03A 2BCKB 5AD0B 2R8SH 3VXSD 3GMNA 4PJGE 3E6FB 3FB7B 1WAAF 3TPKA 4ODUB 2P42B 2WW8A 2Z31B 4JDVB 1HINL 1K4DA 1KB5A 3UTTE 4OZGB 5HPMA 3B9KD 4DZBA 1Q94B 1KJ2L 3BKJH 1MFNA 2APWA 3BUYB 3CVHL 5I2IA 1QQDA 1ZANH 4R0LB 1KCVL 1L6XA 1T21B 3MC0A 1U8QB 1BFSA 4M5YH 3VXPB 3C6SA 3MBED 3LN4A 4XCYA 1IEBA 5FUOH 1HHGB 3NGBC 1XF2B 4Q0XL 2YPLB 2O5XH 1Z3GL 5GS2H 3K8KA 1NCAH 3UTTD 4HS8L 3BPOB 4MVBC 4UOJA 4QRRA 3SE3C 5DVKA 1D6EB 5GS0H 4HUUB 1BVKB 2VQ1A 3NACH 3FQNB 1IZJA 5F89A 1XGTA 5IQ9A 3BIBX 5D2NC 3O4LE 3GUTA 2AAVA 4MD5B 4XNMB 3ARVA 1OL0A 1XT5A 1BQLH 2X4UB 3SDDB 5GSVA 5IJVB 3NBNA 3GMNB 3QUYC 4HX1A 4A6YH 3UYOD 1K4DB 1KB5B 5HPMB 4JCMA 4DZBB 4IOSD 3DSFH 2H3NA 4JREB 2HRPL 1TTFA 5I19L 5I2IB 1NFKA 4HLZH 2BRRL 1J7VR 3U1SL 4FFVC 2O61B 5D4QA 4ZD3H 3LN4B 1IEBB 4BUGA 3T0EC 3HZVB 1ZA3B 4HV8B 4XP4L 1CXHA 4Y2DA 4BSJA 3SO5A 3IYLW 3D48R 5I15H 3O6LH 4EN3B 5CD3A 5J9PA 2MNUA 3KPSE 2VQ1B 3PXJA 5CS7A 2WP3T 5EUOB 1BJMA 1TVBA 1XGTB 5EZJA 4NWUL 4YFLF 2NY7H 3H9SE 3GUTB 3NZ8A 4I18A 3EGSA 1EHLH 5C07A 5GSVB 4OCRH 4EUPH 1F4YH 4QGYA 3T4AA 1XGYL 1TCRA 4HKXA 4E41A 2Y4SA 3OGCA 2PN5A 3I6LE 3LS4L 2NY6D 5FYLL 3KPSD 4HX1B 1MHCA 1EA9C 1JPTL 1KPUA 4RMVA 4U7KA 3CPLA 1S78D 2H3NB 4KQ4H 5DC9B 3EFFA 3H9SD 4K7PL 5BV7L 3ARFD 3TPUA 1EH9A 1OTSD 4I3SL 3MNWA 4DK3A 4P2QE 4QHNB 3I6LD 3C60A 1QFHA 1FP5A 2BFVL 3SDXE 3FQXA 5KVMC 4Z0BH 5CD3B 4M6OL 5J9PB 1N0XL 4P5MA 1JI1A 4N1CA 4PJHE 5HGDA 5DQJA 1JNNL 2VQTA 4MAUH 1VFMA 4WV1C 3NIFE 1XGUA 2IGFL 1NBZA 5EZJB 5MENE 4G9DA 1HYSC 4U49A 5EH1A 1NGQH 1IC4L 3BRDA 4P2QD 3NZ8B 5B8CB 3JVGA 1DBAL 4I18B 1FZKB 1NCWH 4XB7A 4YZFF 2JELL 1HHKB 1F45A 3LIZL 1RK0A 1TLKA 5C0FB 5J89A 1I7RA 1TCRB 4HKXB 4E41B 3OGCB 3QXUA 2BP3A 1I8LA 4XC1L 3L95B 1KPUB 3ZSTA 3CPLB 4J3SA 1BGXH 5GJSL 3CFBA 3EFFB 3F6LA 5MEND 3BP5A 5I8KH 2FO4A 5AZ2L 4HLZG 3RPKA 3QFJA 5DJCA 3TPUB 3T3ME 4Y19B 4ZUSA 4LAQH 5CSBA 4IRJC 1M7XA 3C60B 3MPCA 1D5IL 1RUPH 3V7AE 1KJ3H 1S7VA 3VXUB 5I8CA 1DE4A 3FQXB 5T3XL 2QBWA 4Y5VC 1VGKB 4P5MB 3VI3E 2NXZC 5HYJA 1XGUB 3KHOA 1LP9F 4G9DB 1G0XA 1YY9C 1CL7L 5GGRA 3FAWA 1OHQA 4O58L 2DN7A 1NMBL 1RK0B 4EUPG 2A83A 1DQMH 2A6JB 1I7RB 2OL3L 2YUZA 4OCXH 1S7SA 3KLHC 1C1EH 3DVGA 5EIIB 2D7QA 4HF5L 1A6ZA 1E6OL 1EEYA 3ZE2F 4O51B 3QCUL 3BP5B 4LHUG 4X6DA 1PLGH 2FO4B 4NBXB 1P53A 3F7VA 4MJ4A 4LKXA 4HK0B 1CU4H 4YHZL 1EUTA 3QR2A 5DJCB 3UCRA 3K4ZA 5EN2B 4ZUSB 3ZL4L 1KSRA 1IE5A 4J6RL 4Y1AD 1NC2A 4G5ZL 4PG2C 1UACL 3NCCB 4XPGH 1JV5A 4RGOL 4ZFZA 3ZLQC 1S7VB 2FB4H 3TO4A 5I8CB 1J1PH 3EOBA 1DE4B 1B6DA 3NPZB 1Z9SA 1XGQA 5JOPD 2IMMA 3IDIB 5GGRB 5INDA 4WTZG 3MUGA 1OAKH 3I50H 3N1FC 1WSST 3MCG1 5SWSE 5F7LB 1MY5A 4JFEE 1RULH 1S7SB 3WXWH 1UJTA 3DVGB 4JFFA 4PBWD 1HKLH 1A6ZB 2RCSL 5GGQH 2YOCA 1FAIL 1R5IA 1EEYB 4UBDD 3D2UD 5KANI 2JCCE 3LQAL 4LKXB 4WHTA 3D39E 3OPZL 2DKMA 1PSKH 4G8EA 4GBXA 4JFED 3VW3H 3ZZ1A 3IU3A 1J8HE 3TT1L 1U6AH 1MCSA 4K2UL 4HQQH 4MCZA 4FZEL 5DVNA 5BZWA 2AJYH 4UQ2A 4ZFZB 3SOBH 4OCSH 3TO4B 1MCDA 5F8QC 3S35L 4JZOA 4NC1E 1UZ6F 1CFVH 1FIGL 2WINA 4P23D 5IVXA 3D39D 5DK3A 1XGQB 2IALA 1T1YA 4JQXC 4XVTH 1NLDL 3GHBH 3PG2A 1ORSB 5INDB 4LFHD 3GZKA 1Z5LB 3MUGB 3T1WA 3GM8A 5BO1L 2W0FA 1NBVL 4XNXL 4JY6A 1QFWH 2NY4D 4NQTA 2OTPA 1CDBA 2NZ9D 2D9QB 4TPRH 2L7UA 4YDJA 3WDIA 3WO4C 4JFFB 3ARUA 3PV7A 4EXKA 4V1DE 4BZ2L 4RWYH 1R5IB 5D9SA 3HMWH 4K3JH 5IGXL 5H35A 3DNKA 2X1XR 1TDQA 4AMKL 4X4MA 1CGYA 4R8WL 1I8IA 3D1MC 3NABH 4G8EB 4GBXB 1MCLA 3EYUH 3PF2A 25C8H 3GMLA 3IU3B 4Y4FC 3BP4A 3EO1A 3CMOH 4MCZB 1EBPA 1L6ZA 5BZWB 5FM5M 3KG5A 3KJ6H 5I1IH 4UQ2B 4N0UA 5D2NE 4NNXB 4DUWA 2NR6C 3P0YH 2AEPH 4JZOB 1G7IA 3CUPB 4NNPH 1MLCA 4X6CA 4S1RH 4FG6C 5IVXB 3CIQA 1IM3A 4UTBH 1T1YB 3PIQA 2EKSA 2XY2A 2J88H 3TZVA 1UA6L 4YDKL 2YWZA 1YYMH 3LPWA 3QCTH 2YS4A 2W0FB 4JY6B 1V3MA 4IHOA 5FUZH 1ZT1A 3TNMA 2IADA 3EOYG 1LEIB 4YDJB 4PJIE 3TESA 2CUHA 4P2CG 4PRBB 4JFYB 5DZNA 5FUCE 5D9SB 3T0EE 4ZPTB 3D0LA 4C58B 2OP4H 2MPAL 5H35B 3QUYD 2H32A 3G9VA 3BDYH 1W8OA 1IGCL 2ESVE 1I8IB 3PP3H 4O4YL 4U6TA 1WZLA 3ARSA 4BQBA 2W92A 2A6DA 3GMLB 1A02N 3MMEB 1XIWC 5E2VH 3EO1B 1A7NL 4Z7QF 3TP4A 4F57H 5FYJU 4FQLL 1DLFL 4N0UB 1DUZA 1EIBA 1O5DT 5C0BA 3T0ED 5ISZA 2ORBL 1G7IB 2ITDA 1MLCB 4X6CB 3TGXA 3BPCA 4X8JA 3RVXC 4I0PC 5IVNA 2R0LH 1NH6A 2ESVD 1IM3B 2EKSB 3KR3L 4JM2D 1P2CA 3TVMC 2EECA 2Y5EA 5MHSE 1PZ5A 2L4OA 3NFNA 1EHNA 3RPIB 4YNYA 5LBSL 1LO3L 4M7JL 4IHOB 1ZT1B 3TNMB 1DVFA 3WHE0 1DFBH 2IADB 3C6LB 1NKOA 1YYLH 3EKCA 4AT6B 4X6FA 3BW9A 1VESA 3D0LB 4HIXH 4P57A 2W9DL 2H32B 3LV3A 2VH5L 4QHKI 3ALPA 4ETQB 1B6UA 2XA8H 2DIBA 4FP8L 4GLRI 3QUZD 2A6DB 3NIDE 3EO0B 3RRQA 3HI6L 1UM5L 5DHYA 3PL6C 1IGJA 2B39A 2AJZB 2WUCL 4D9QE 2GITA 5ISZB 3UX9B 2ITDB 2FX7L 1T3FA 3BPCB 1JYVA 4XWGH 1ZHLA 4HFUH 3LOWA 5BS0E 3SE4C 2VL5A 1A0QL 1N7ML 4M7LH 3RY6C 4WIQA 2VDML 1V3KA 2BY0A 1FYTE 1FL5B 1P2CB 3VXNA 4M9PA 3DUSB 1PZ5B 3NFNB 3P0VL 4YNYB 4NN6B 4NN5B 1HYSD 2SEBA 4JQVA 4ONGH 3VU2A 2K3TA 4DOHB 1DVFB 5ITFA 3QIWD 2ZUWA 1F2XK 2J4WH 2F5AL 4N0RA 5BS0D 2PYEE 2BNQA 4PJFF 4X6FB 4EZMA 4KVCL 2XQBL 1M7DB 2A6IA 2MHAA 3QULA 5JMRA 3MGTA 3LV3B 1FYTD 1MIMH 5DD5H 1MF2L 1CGSL 3W2DH 4G8GD 2EO9A 1F8TH 3STZA 4RISL 3MRQB 2N1KA 4RX4A 3D25B 3D3VA 4FFYL 4XNZB 5E6IA 5DHYB 2FJFA 1T1ZA 3ULVF 5C0AE 3CXHK 3V4UL 1IGJB 3C5ZA 2FL5A 3QDJD 4LRIC 4NCDA 1MFBH 4KGJA 1NLBL 4LSRL 4TRPL 4GS7C 2VAAB 4KY1H 2X4QA 1ZHLB 4Z7NE 1SY6H 4L5FL 4K23L 2VL5B 3VXMA 4XMLL 1X5LA 4Y5YA 1I9IH 3X3FH 1UXSA 3IDUA 2A0LD 2DLTA 3VXNB 2NXZD 1YMME 4D94A 4ZTOH 4PB9L 1CD9B 5F6IC 5EU6E 2AGJH 5KZCD 1UGNA 1XZ0A 4DKFL 1FNFA 3BMWA 1R3HA 5I18L 1I9EA 4JN1L 4PJXF 1DZBA 3TBSB 2BSTA 4H88H 2BNQB 4RDQF 5CJOH 4WJ5A 3B2VL 4IDJH 2A6IB 2MHAB 3CX2A 3H3PL 3QULB 4R96B 3HMXL 3AS1A 1YMMD 1X7QA 1XF5A 3SE8L 5EU6D 1JYWA 3SQBA 1RVFH 3STZB 3VXRD 3D3VB 4NQDA 1KIRA 1OW0C 1T1ZB 5C0IA 3B8SA 5DD1L 3C5ZB 3VXOB 5LGJA 4HWBL 1WT5A 2ZKHL 4MXQC 4U1NB 3Q1SL 3WFDH 1I3VA 4OGYH 2EC9U 2JF1A 1VPOH 1F4HA 2X4QB 3VXMB 4UIMA 5DZLA 4JPVH 4NKDA 4Y5YB 4OKDA 3RTQA 2E7LA 5GPRA 4CBPA 1PGRB 1AD9A 1RZJC 4GW4A 5KVDL 1XZ0B 2EDTA 1R3HB 4DAGL 1ZE3C 5EULV 2JJTC 1VFAA 2BSTB 3VFMA 1TPXB 4WJ5B 3FONA 2YWYA 4P5TC 5ALBL 1EMTL 1HILA 2VZUA 3VI4F 3B9EA 1X7QB 1Q0YH 4HC1L 4EVNA 6FABH 5J13C 4P9HL 1XF5B 3QDME 1N26A 3SY0A 4I9WD 1G1CA 3BYTA 2B1HH 1UCBL 4NQDB 1KIRB 1BZ7A 5C0IB 5T3ZH 4PR5A 1KFAL 5LGJB 2YBRB 5CILL 2Z92A 3S4SA 3MRGA 4IRSC 3IKCB 3SDAA 4D9LH 1OP5H 4EDXA 1CFQA 4UIMB 3QDMD 5IIEB 4CNIA 4NKDB 1AI1L 1UM4L 4M1DH 1HYRC 3H9YA 3RTQB 5ACLA 1MFDL 5LWYL 5ID0A 1AD9B 4AQOA 4GW4B 3JSSA 3NA9H 2GW5A 3RDTC 1NKRA 4K3DH 5FXCH 2R0KH 3TJEH 4PJ9C 3VD7A 3GK8H 4YHML 1VFAB 5DD3H 3VFMB 1FFPB 3MLTA 3FONB 1RJYA 2G9HA 2KUTA 4UI2A 2C1PB 1INEH 1P84K 1GRWA 5GGUB 1KEGH 2EYSA 2VR4A 4APQA 4LGPB 3VFSA 4QNPF 3WFZA 3RGVA 1F58L 3MRHA 3SY0B 3EFDL 4N8PA 5EBWA 1UB6A 4D3CH 3MRBA 1BZ7B 4DFHA 4PR5B 1ZHBA 4L1DA 2Z92B 1MJ7L 2VZVA 3MRGB 3O6KL 1BEYH 1E6JL 4MA1C 3HC4H 1K5NA 4LKCB 4U4BA 3SDAB 4EDXB 1CFQB 5TPWL 2NR6D 4CNIB 4GG6A 4FG6D 4K3GA 1T5WA 1YMHB 1IM9D 4GAGH 3KYAA 5GSRA 4NO0D 4Y5XC 1AY1L 3FZUC 3IFLL 5HHXH 3E6HA 5D72H 1A6TB 1KACB 2C1OA 2VAJA 1T2JA 2Q3AA 3MLTB 1RJYB 5H37H 2G9HB 5F7NC 5IEHA 3UMTA 4MJ6A 1KLUA 4O9HH 5EC1A 2EYSB 3N85H 1HQRA 3BJLA 4APQB 7FABL 3RGVB 5IQ7L 1SHMA 2AEQL 2B1AH 3FB8A 2CXKA 4ODWA 1A7PL 1ZEAL 5T1DH 4MNGE 1ZLSH 5A2LH 1JWUA 1ZHBB 3B9KA 4UB0L 3WD5L 5D5ME 5F3HA 4H20L 3DI3B 1P7KB 2AEWA 3DVNB 4QF1A 1WIUA 1FYHB 3WHE1 3MV7E 1VEOA 2MWCA 1QSEE 2XI9A 4WI8A 3FMGH 1I1AC 2JIXA 3I3DA 5ILTL 3UO1H 4QRUA 3WS6C 4GG6B 5D6DA 4PJGA 2IFFH 3RVXD 1T5WB 4I0PD 4XI5C 1RJZA 4GKOA 3H0TB 1AGFA 1OVZA 1ONQB 4NT6A 3UTTA 4C56B 1HK6A 1P84J 2DLIA 1ZSDB 1R3JA 3E6HB 4B0MM 5MEPA 4XCNA 4OLYH 3MV7D 1QSED 3MRJA 1FORH 3MLZL 2PTTA 3BI9X 3ULUE 2P8LA 1XF3B 1MCJA 4HS6A 2V5TA 2HMIC 4D0BA 5IEHB 1CGUA 4MJ6B 1KLUB 1X5HA 3H7LA 2OI9C 5EC1B 3GJEA 1N6QL 1FPTH 4NN7C 4F9PA 1HN1A 4NKIH 4WY7H 5DJXA 5DJDA 3VH8A 3LKSB 4ODWB 3B9AA 3E3QE 1JWUB 2K7QA 3B9KB 5KS9E 1WEJH 4OLWH 3O4LA 1SJHB 5F3HB 4QF1B 2NW2A 2YUXA 3PL6D 1ND0B 4YDIL 1HE7A 4WI7A 4FFZL 2JIXB 1JZ4A 5FGRA 3TA3C 3OAZH 3G5YA 4QRUB 4KGLA 3B9VA 1JZ5A 4JRXD 2AJVL 3IXTA 4JO3H 4UUJB 4PG9B 2V9RA 3PWVA 5I66B 1RJZB 1Q9WB 1FNAA 3CCHA 2ZUVA 4NT6B 3UTTB 2HN7B 5DK0B 2EZ0C 1LEKA 3IFOA 1R3JB 1RZJL 1EHXA 5GZNC 3LKNB 3MRJB 4Z7VE 3VWJC 2CUIA 4K7FA 2PTTB 5D1XB 1CGTA 4OZIE 2P8LB 5F1IA 5H2BA 5ALCH 4HS6B 2D2OA 5DC4B 1OF2A 4U3HA 1LGVA 1CCZA 5IBUG 2KKQA 5JO5A 1LK2A 4XRCA 5DJXB 4LIQE 2IFGA 2D03L 2G5RA 1IGYA 4DGVH 2G60L 3KPSA 1JCKA 3UBXI 5EORH 3O2WL