1TETL

Crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCKSSQSIVHSSGNTYFEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYEWHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an anticholera toxin peptide complex at 2.3 A.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG1 TE33 FAB (LIGHT CHAIN)
total genus 51
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL01
4GG6A 4Z76B 4GKOA 1G7MB 1QP1A 1LK3H 4D94A 5I16A 5D1QD 1CDGA 2CD0A 1KTRL 3OPZL 4MQXD 1XGTB 2H3NA 4MA3B 1JGVL 1PDKA 4L4VB 4UOW0 3RWDA 4LMQE 4MLSA 4PTTB 1Y18B 5FO8B 1G6RA 1N2RA 4M7KL 2JCCA 4XPAL 1CD9B 3UPAA 5CJXA 5DRXA 2V9QA 2APBA 3CAFA 4CMHB 1MCCA 4X8XA 4NHUB 1RUAH 4JY4A 3Q5OA 5K59F 4LPXA 3QFJB 1X9QA 5EU3A 3ZKXC 1A7PH 3MV11 3IDGB 3O41B 4NRXB 2RAMA 4G9FE 4LVNB 1WAAE 1YMMB 4OKVA 4K8RC 2BX5A 3BJLA 4LP5A 1HYSC 5BMFL 3ZO0A 3WD5L 3HS0A 4UOJA 4MJ5A 1X4XA 2FBOJ 3H3PL 3MLSL 3P73B 4XMKL 1DLHA 4LCWA 3LEVH 4PJCA 5BV7B 4GXVH 1CE1L 2OI9C 3BP7B 3MJ6A 4N0CD 3P9WB 1KELH 2IANE 2LTQB 1YNKL 4LEXL 2QLVB 3V2AR 4RWYH 5SWQA 3UXFA 4KJWC 1TVBA 1VACB 5CIPB 1S7RB 4X6CB 4PJDF 2O5YL 2XA8L 2L7UA 1VGEH 2K7QA 4N0UE 2Z9TA 4E41A 3KYAA 3ZYIA 3S36L 5GGVH 1XF4B 5DHVB 1QSFA 4J3VA 4MA7L 3BGFC 4HSQA 4HUVB 2G5BB 2YN5A 3MNWB 5DJAA 4EOWL 5JMOC 4UU9A 5F7EH 3IB4A 4QYOA 3RWIA 2HKFH 2VDPL 4NM8H 2IANB 4QCIA 3EYUH 2G60L 3LOWA 1G1CA 5CGYC 2FR4A 3B9KB 3TCXA 4BA8A 1XCTB 5HI5D 5FGRA 3T2PA 2V5SA 4M7LT 2KKQA 1MFAH 2YPLE 2WV3A 4DOHB 3OF6A 4PJHB 2PW2A 4ODSL 2HKHL 2XNAB 1X44A 1O7VA 3CCHA 4HKJB 1GGBL 1CFQA 3ZDXE 5DLMH 5DR5H 3UO1H 5HI3D 2B7DT 1J0ZA 4BQ6A 1J05B 2PO6D 3X12A 3N9GH 1UXWA 1EXUB 1P7KB 1QR4A 3O45B 2JB6A 2VLRB 4MCYA 1QO3A 4JO1H 4PLJC 4P46A 2H1PL 5GSRA 1GHFL 1CLOH 2UWEE 5F3HB 5GGQL 5B8CA 3QG6B 5EOTB 1NMCC 2EEAA 1IGCL 1PY4A 4RGNC 2NXZC 3L5HA 3ECBA 4ZOCA 2NW2A 4LU5H 4MJ2A 5EO9B 1TQCC 1B9ZA 4GW1A 1RK0A 2QHRH 2F8XC 4FZEH 4XGZB 4K23H 5D2LE 5CEZL 4EI5B 1BD2D 1J0JA 1PG7H 1TJGL 4KZDL 4P2QB 2IANA 3O0RL 2DYPA 3ARGD 1ZT1B 5C07E 1BIIA 1Q0YL 5F97E 3BHBB 4PJ8A 4PRPD 5I75C 4PS4H 5TF1H 4BM7A 4XZUA 1HH6B 5IM7B 2C3XA 4K7PY 5TDOA 4LGPB 4CJ1A 1ADQL 3KPSA 4NM4L 4MA1B 1I1FB 2FH8A 3SGEH 1HILB 3BH8B 3BPNC 2HVKB 1RUKH 2BXYA 3BH8A 4FTVE 3O6KL 2XICA 3S5LB 2O5YH 3HE6B 4OZIB 1NDMA 1FE8H 3CK0H 2HAZA 4UI2A 1B90A 2GIYA 4NNXB 3IGAA 5MEND 3HE7D 1BIIB 5CBEB 4Y5VC 1F45A 5L0QB 4LKXB 5EUOB 4LRIA 3EYVB 4LVNC 5EU4A 1F4WL 4KDVA 4H0IA 5HYJA 1UWXH 3ZDYE 3CLFL 1UEMA 4LAQL 4C59B 5HHXL 3CFBA 5EO9A 5ESAB 1A7BA 1ZGLM 4FP8L 4R4FL 2NW2B 3VJ6A 5FA4B 4RAUB 3SDCB 3MNZA 1MAJA 1Q8MA 3EFDL 2JCCB 1IBGH 1EEUA 2YD1A 3LHPL 3P30L 4YJZL 4MDJB 1LK2B 4FQ2H 1DBBH 1J0KA 3SKNB 5I30H 4GAGL 5IBLC 5DK0A 3FB7A 2V7HB 1YEDB 1U36A 5BZDA 3G5VB 4AEIL 1ZT1A 2VIRA 1S9YB 4G9FD 2W0PA 3GJEB 1EFXA 3SGJA 2FZ3B 4M61B 3VXPB 3THMH 2NX5A 5K93A 5HYSB 2XNAA 1AQDA 4XCNB 4IJ3C 2AK1H 5FUOL 1KT2B 1W0VA 4ISVA 1A6UL 4MQSB 1RUQL 4ISVB 1X7QA 4U3HA 3UJJL 4P46B 2YD8A 5HTSA 2IPUK 4Y16A 3W0WE 3WXWH 3RIAK 1UXWB 5KS9F 1MRCH 4JM2F 4KQ3H 3EJZD 1QBMH 5JW3L 5BZDB 4X4XA 2EH8H 3VFVB 3G6DL 4JFQB 5F93C 2FYYB 5AD0B 1A21A 2QR0B 4X7TB 3EAKA 1Z2KA 2ZOKA 3CFDA 4KVCH 1RZ8A 3J8F7 4PJEF 3QDJD 1TLKA 2P24A 1QR1B 1LDPL 3HFML 3X3GL 1G7HB 3TCLB 1VGKA 2R2EB 3LIZH 4I77H 4GMTH 5K9OB 2HN7A 1CTNA 2VRAA 5IFJA 5EZIH 5JHDA 4PJBE 5EUOA 4EDWL 3WXVL 1GAFL 3OR6A 2BY1A 4YHYC 4PJGA 4HV8A 2I5YH 3O6LH 5JIIA 1XF5A 1P1ZA 2R69L 1K85A 3DMMA 4RZCB 3N1GC 3LPWA 2ZKHH 3HE6A 4UILH 3G6DH 4CN6A 5E4EC 1VEPA 4YH6A 2OP4L 3MRNB 1TJHH 4BZ1L 3W5MA 1A7OL 3MBEB 3QPXH 1U93B 3VXRA 4JCLA 5FA3A 2P46B 1TJIL 3LH2L 5HGBA 5T3ZL 1C1EL 3RRQA 2R56L 3GJFK 1FRGH 4J3SA 3HMXA 4UNTA 4Y4HD 2CGRH 1WIOA 4WWID 4LSUL 4JRYB 1CICC 5DMKA 3ZKXB 3V0WL 1DQJA 5F44A 3FQNA 3KR3L 3TYGH 5DJYB 4GT7A 3SPVB 1JPTL 5H94B 2FX7L 1JN6B 5E1AA 4P2QA 3SDXA 3V52L 1P7QA 4TSBL 1IC5H 3WFHB 5DFTA 4PJFA 4S0SD 4GRMA 4JM2B 1XF1A 4Y1AA 4JY4B 1OGAB 1V05A 3QHFH 1Q1JL 3DGCR 2LTQC 2F58L 3RVVD 1EZVY 5MP6L 5HHQB 1WTGT 2B1HH 4ZAKC 1IL1A 1UB5A 1NAMH 2XTJC 4WV1B 4LSPL 1CU4H 3B9AA 2ENSA 3QUXA 1OSPL 3L6FB 1RJYA 2AJXL 5IW1B 5JW3H 1DVFC 5DK2B 1IM9A 4L4VD 1ZTXL 1BVLB 1TQBB 2X89D 3LN5B 1ONQB 1MJUL 4WW2A 4GW4A 3OGOE 1HHJB 3ARED 3MACH 3BAEL 4KJPD 2NY3D 1ZLUK 5EOCJ 1P7QD 2UZIH 3DTXB 4D0DA 2DQDH 4PJBA 4FP8H 1OGAE 4R4FH 5FEBA 1H3PL 2ITDA 1P9MA 1ZHLA 4R3SA 1H8NA 3DV6B 5KJRH 3F5WB 3CX5J 2Z8SA 5FGCB 3S6CA 5A16A 5KVFL 3HHRB 1MJUH 4PRIE 2ILLA 3BOVA 2FGWH 3QJHB 1BX2B 1DCLA 1KB9J 1NBVL 3F7PC 4AK1A 4JKPL 3WKNA 5J6HB 3Q48A 5DVNA 4QRPE 4XVJL 2R0WL 4UU9B 3QPQD 1P4BL 4HIIB 1PD6A 1SJEB 4AEIH 4HUVA 3CZFA 2ESVB 5DT1L 5IVNA 1MFDL 4F33A 3RWHB 1X5KA 1W8OA 2NW3A 2NYYC 2D7PA 2AQ2A 3AREB 3C5ZA 3E6FB 3NFNA 4WRLA 5IKCA 1QLEL 2Y5TB 2QQKH 3ARXA 5DFWH 1AFVL 1OP3H 2VZOA 3U9UB 4XHJD 2EXYC 1I7ZA 4Q6YA 1I3GH 1FNLA 3WHE1 3RX7A 4XCFH 2UYLA 3C8DA 4FFWD 4GKNA 4AENA 3MO1B 1JNLH 2FATH 5A1AA 4QOKA 5F9DC 4R6UA 2Q3ZA 4JJ5A 2NY2D 3BKJL 2LABA 3CK0L 3IJSB 1WVZA 4TPRH 4PUBL 5J11C 1T5XA 1QRNB 1ZEAL 1JNJA 1GGUA 1JFQH 1ETZB 1P4IL 2B2XL 3A6BL 2UUDK 2X4PB 1EO8L 2X2YA 4PG2C 1P7HL 2NY1D 1BEYH 4HFUL 3D3VB 2VYRE 4KV5E 3BH9B 1CYGA 1SBBA 3EDKA 5IQ7L 3ARGB 5JXED 1NC2A 2BP3A 5DR5L 5DLML 4KZEH 4XB8A 2AXHA 2ZUQB 2VZVA 4KKAC 2OXHA 3RWDB 4M8QA 4NCDA 3VFGL 3NN8B 1BD2E 1BJMA 4ODUB 3TNNB 4ZNCD 1GC1L 3BO8B 2O93L 2JCCE 3BH9A 1HQRB 2VL4A 3DVGB 1NEZG 3LPFA 3VFMB 3MRPA 4I0PB 4KRPB 3FFCE 2DIBA 4JFED 2VLKD 4M4PA 5CMAA 3WLWC 3BE1H 1GGYA 2HLAB 2QHRL 2Y7QA 5FO7B 4OBSA 5F6IC 4WI4A 3SO5A 3GNML 3CLEL 1FFRA 5HYSG 5DJXB 5HVHC 5AYQA 3QT2A 3SKMA 5ANMA 4PJDA 4XP6H 4JZJA 4RISL 4PPTA 5JXAL 4PJIB 4PRAA 5JZ7D 1H3PH 3NCCB 4GKNB 5TGBB 3H9SD 1BFVL 3ILQD 4FQXD 4Z7WA 4TSAH 2XKSA 4O4YH 3U0TB 1NGPL 2LU4A 5MHSE 4K55A 4FQ1H 1JWSB 2PYEE 1S9WB 5BJTB 1IKNA 4WNQA 2JKXA 3SKJH 4OF0A 2PTTB 2FL5A 4P4KC 3LN9A 2OJEB 4F9PC 4JEGB 2UY6A 3QUYA 5AUMB 1OM3L 4MQXC 4PJDB 4F7EA 4X4ZA 4YBQD 3R4DA 5DJXA 1FN4B 1NL0L 4PJIE 5IP4A 5EU7E 5IF0A 4TUKH 2E8YA 4YDIL 3TNMB 4U6TA 3DX6B 1I9IL 1B6DA 1UM4H 3BWAB 4R4ND 4YFEA 1DL7L 4MZ3A 4U7SA 3R8QA 3HUJA 4NC1E 3IU3A 2Z92A 5CEXB 3ULUL 1I4FA 3B3IA 5KSBA 1NC4D 3U46B 4MLIA 2IGFL 2OCFD 2VC2L 1XZ0A 4G9FB 1KYOK 2H8PA 5JPNB 4TVPD 3NFSL 5DZOA 5J57B 1MCWW 4RX4A 1M6OA 3AREC 3FHAA 3QXDA 2I25N 5GIRA 4J3XA 1I8KA 3VGAB 4KMTL 4R7NA 1DBJL 4OGYL 5KSUB 3WIHH 4LCIH 1U3YA 3MLVH 2X4PA 3CNKA 3A67L 4LCCA 5DJ0B 2Q6WB 2DBJA 4LP4A 4X0KB 3T0XA 2UV3A 4Y4FD 1FYHB 2DDQH 3REWA 1WZMA 2D4FA 4NJAL 3OHXA 1M05A 1U8JA 4IM8A 5L7XH 1G9MC 4OV5B 3G5YB 4NN5B 1OPGL 4CNIB 5FB8A 5EO0A 5DA0B 1A7PL 4MXVF 5EU6D 1GJIA 2AKRA 3QQ4B 1MCIA 2DM4A 3FB8B 1Z5LA 1NGXA 12E8H 1YNTA 4AT6B 1MUJA 3DHMA 2DQCH 1MI5A 1V7NH 3WLBA 4FQXA 3RA7L 2ADGA 3KNBA 4ODHH 3CPLB 4QTHB 4EEEA 3MSPA 2CRIA 1U2HA 2QQQA 3L3JB 3MRBA 2AJ3A 1J0YA 5EORH 3AY4C 4K8RL 1FFOA 2E27H 2AK4B 5LVEA 3T09A 5D6DA 5KZCB 2IAMD 5I1LB 1U8OB 3LKRA 3OPZH 4ERSL 2IALA 4X6BA 3HAEG 3WHE0 1S7TA 5C7XH 2RIKA 3SCMC 1FNEB 3TIDB 2HFTA 32C2A 4X9FA 4X7CC 1X6LA 5GS0D 2ATKB 2R9HC 4ZO9A 3VRIB 2D7TH 4EJ1C 3DXAE 3TBTA 3HRZB 3HB3C 4BUHA 4OI8A 3M17B 4HUNB 3U9PL 5TF1L 2UWEB 5K9OA 5F6IB 4P2YA 1EEQA 2IPKB 3N85L 4FQHB 1G6RL 3UAJD 3HC4H 4J6RH 4XAWH 2OXGA 3S35X 1J1PH 4PRIB 1HEZA 2BSTA 4ODSH 2A0LD 2GEEA 1NUNB 1AXTL 2HYMA 2QQNH 4NYLA 1A1NB 4BKLB 1INQB 1DN0B 1F8TH 2NY1B 4NO0D 2VLLA 5DJZA 4MD0A 2VDNL 4DGYH 4FZ8H 2ESVE 4XNZC 4QHMB 2HFGH 2FIRT 3LKOA 3DXAB 2ORBH 5E99H 1J1OL 1JI1A 4HWEH 5HYQB 4P4RB 5MI0B 1FL3B 2VDOL 2UY7A 3LV3B 1QBML 3PWNB 3WHXA 1TETL 1VFOA 2OL3L 3VH8A 3OX8B 3DHJA 3L3HB 1XGPA 1INDL 3CH8A 1FZKA 1R3IL 2EKJA 3GMOB 4H26A 5IHBA 4FQJH 2VXQH 4JGUA 1ZA3B 3OKLA 4OT1L 4P5TA 3K8LA 2YXMA 4I3SH 2YPLA 2A2QT 1I75A 4DK6A 5DJYA 4KUZL 1T2JA 3V5KA 5JQHC 1C16A 2OSLA 3PL6C 2YS4A 4MNHA 1RZKC 4POZD 5I30L 3THML 1KCVH 5LXGH 1YY8A 3TJEH 3BW9B 4OIIL 4GMSL 4KAQH 1A1MB 5DJ2B 3WEXB 3TO4D 3SBWC 3Q3GA 3MRGA 4ZG1A 3D2UB 3D3VE 5HDOA 5IVXE 5GS3A 1T5WB 4NM4H 4LLVB 3B4NA 4ONHA 4UQ2A 4JKMA 4U1KA 3S8WA 3MACL 5D4QA 1DFBH 4RAUA 1JYXA 4WY7L 2Y36H 3DMMB 4LPVA 4P5TD 4AJ0A 4XCYA 5E8DL 3ULUE 3LD8B 4KXZH 2C26A 4OAWB 4GUPB 1OGTA 1P53A 5JHDB 5D9SA 2PR4H 5AAWA 5CD3A 1F4WH 5JW5B 1OGTB 1FE8L 3H8NA 5IIEA 2ADIA 5JORA 2H6PB 1MQKH 2A83A 4OZGB 4NCC1 2R1XA 4NN5C 4PRNA 5HPOA 5L88L 3S35H 3CMOL 4K71C 1HYRC 3NFSH 4OJFL 4I2XE 4OFDA 1AE6H 4UQ2B 4IRJD 3IFOA 5D5MF 1CDBA 2ARJQ 4LLVA 1NUGA 2FYYA 4L4VE 1CI5A 4P46D 1H3GA 4Y4FB 1PX4A 3TA3C 3FFDB 1CFNA 3EYSH 4PJ7F 4ZPTB 5DQJB 4DGYL 4YQXL 2IQAB 1A14H 1QHPA 1X5GA 2QSQA 2XWBA 2YKLH 1QACA 2G2RA 4TVPL 4HKZB 5A2JH 4UAOC 1C5BL 1SJVA 1Q9LB 1KACB 2JTDA 2DKMA 1A6TA 3HG1E 3SCMB 2ICCA 3W9DB 1FNSL 1CFTA 3K80A 2EYRB 4YWGL 2BNQD 2X4QB 5ACLA 4NC0B 5MENA 4BJLA 1CS6A 2NPLX 1L7TH 5IROC 4R0LB 2VDOH 2XXCB 2J6EL 1JPFB 1A7QL 2IPUG 5IB4B 5FYLL 3ZSTA 5KAQG 2G2RB 4NUGH 4JHWH 1LMKA 4QHMA 1J1XH 3CD4A 1YEJL 3NACL 3FTGB 1AR1C 4MYWB 3F7RA 1VADB 2GCYB 1XFPA 5F7LB 4CDGC 1WEJH 3RAJL 4DZ8A 4QOKD 2WWMD 3CDFA 3BQUC 1AO7E 4QHNB 1FSKB 3CCHB 5C08D 2EDJA 5I1JL 5MENB 2CRYA 3B2UD 5CD5C 3UBXB 3SJVB 3GZKA 3VFNB 4GAYB 1XH3A 2R2HB 4U1GB 3GBNL 1T7WA 2ZUYA 1MHPL 2YA0A 3Q1SL 3V5HA 2X4RB 3H3PH 4GW5B 5KSVB 4KQ4H 3BZ4A 3G5XA 3WJJA 3VXUA 1D9KD 1Q38A 4P0DA 5IK3A 3O9WA 1E6OL 2A74B 1VFAA 2A83B 4OZGA 2XWBB 1CTOA 4XP9L 2VISA 5ITFA 4OCYL 1M7IA 1ED3A 5I6XB 3AFLA 2GK0B 1L9MA 3NACH 4BZ2L 4QXUL 1INEH 4GKSB 4LSQH 4EOWH 1DJSA 1UT9A 5D7KE 1SYVB 4E0RB 4PBVC 4E41B 4HFUH 3QR2A 1JF1B 3PWLA 4LCWE 4U1KB 3IFOB 5I1CL 5AZ2H 3ARFB 3KPRB 4HIJB 5CLWA 1MAMH 1JUFB 5I73C 1SYVA 4NGHH 1OP3K 2VLJA 4OZFH 2Y72A 5DUPL 3AM8C 3O8XA 4GKSA 3L9RB 4P2RB 5EZOH 3QEHB 1U41A 1DUYA 2ADIB 3MCLH 3BT2H 5EH1A 2OK0L 2XN9E 4DN4H 3MV9B 5JW5A 3H0TA 4DCQA 2NXYD 3PGFL 4ZQKB 3RHWF 3V79C 3BFOA 2VZTA 4PV8B 4Q0XL 1TZIB 4JFZH 2X05A 1OAKL 5J13B 3TBYB 3HS0B 5JZ7C 1XMWA 4WFGE 1A14L 2F54E 1YMHA 1A7RL 1YMMA 5BRZD 1VFMA 1I1YB 4HH8A 3SQBA 5BW7A 4HZAA 3A67H 2X4OA 3J7HA 5IT2L 4IIQC 3E6HB 4OIIH 4PJ7E 3JWDL 3MRKB 4I8DA 1UC6A 1FZOA 4MHHG 5GSRB 4BQ8A 2NCMA 1RPQA 3GO1L 4G6FD 4Z95H 2GSGB 1EXUA 4OQTL 4NHUA 5K33A 1P84K 5LAXB 4D3CL 3K0WA 4XB7A 1VFUA 5I2IB 5IR1B 3VD4A 1LDSA 2X70B 4APQC 3IFLH 5D5ME 4L3CA 2F5BL 5F7YC 4DUXA 5DVMA 4TOYH 1OD9A 1MAML 2BNRA 1DEDA 4XC1L 1CXIA 4PJHA 4XP5H 1RJZA 3BUYB 3SOBH 1MCKA 2P7TA 2W60B 2CKNA 3U36A 1JNHB 4HQQH 1ZK9A 2CRMA 5JMRA 1XGRB 1MCLA 5E8EA 5KAQF 4G3YL 2M8XA 2P5WE 1SVZA 3MLXL 5HDLA 1I9EA 4HWNA 4IMKA 4HPYH 2UUDH 3BAEH 3U0PB 1WIUA 4ZDHB 3RZCC 3BYYA 3F7YA 4PS4L 4GFTB 1H5BC 1KJ2L 4Y19E 2DL2A 3E2HC 1SBSH 3QDHA 5DJ8B 4R96B 4F7EB 4FQPA 3M1BB 5EBWA 5JHLL 2VERN 4OZFA 1NBYB 5J89A 5ANME 2YPLD 3WYRA 3TJEL 2PXYC 4X6CA 5TE4L 4YGVB 3IKCA 2XT1B 3OKDB 4M43L 3WDHA 1FLRH 5FXCH 2J8UB 3FFDA 3B2VL 4YXKH 3PQYB 1U6AL 4Z78B 3K8KA 3JWOH 4RBPK 3BRGC 1FVCB 4S1RH 3QQ9C 4NWUH 3NIGE 1FFOB 2EXYD 3UROR 3BPCB 1RU9L 3ES6B 2DLHA 2JJVA 4GXUN 5EIIB 1MREH 1QYGL 4Z7VB 1ITCA 3HR5B 1R5IB 4HUMB 4KHXH 2YXFA 3TLRA 3U0WL 2ADGB 5IVXB 4XH2A 4U49A 3GNMH 1GPOH 2A0LC 2ZCHH 5CHNB 2W9DH 1T66D 4JDVA 1UKSA 4NHCH 1NFDE 4D0BB 3PL6B 5HGGS 4OZIE 3NCYS 5KBNC 3BWUC 2GTZB 3F7VA 4F7PA 1IKNC 4BH7B 2EDTA 4X6BB 1M71A 4AH2A 1KIQB 1IEHA 5IBLD 1AR2A 4ONHB 3DECA 1FGVL 5E8PB 4GAJH 3QEQE 1NLBH 5BOZG 2VDPH 4LGSB 4OQ1A 1NFDA 2EH7H 5F7HA 5I1JH 5TE7L 1LGVA 3EYSL 3KPQB 3EJYD 5JQ6H 3MQIA 3CX5K 1M6OB 2DQGH 4WW1B 4MQTB 1NFDB 3L7FB 5DJDB 1KB9K 3PHQA 3MXVL 4MD4A 4HS8H 2XTJD 3QHZL 4AEHL 4NFDA 1LDPH 1KIQA 2NY6B 3EFFA 5E5MB 3WS3A 3OKLB 4Q97A 2WP3T 4UNVA 1ZS8A 2VZSA 1NFIB 1QOKA 4AQ1B 1ZXQA 2R0LL 1AGBA 4KK6D 3TPUB 4Q74A 3S96B 1D9KB 1G9MH 1S7VB 3LEVL 3TH4T 2DQTL 4U3XA 2O5ZH 1FN4A 1I8KB 3QXDB 1JI2A 3PDDA 4HGWA 5D7IA 1WITA 4GBXA 1U8IB 1U2CA 3X11B 1JGLH 3RWFB 1PG7W 4K3JH 2X6MA 1DDHB 4Z7UB 1T83C 2CKBH 5DJZB 3FMGH 3VI4F 1KG0B 5FHBH 2FHBA 1FVCA 1B88A 2AQ3A 1CZ8L 2H32A 2AEWA 1HDMA 1UH3A 3NCYP 2XZZA 4LSSH 1KTDB 3BWAA 4LSPH 4B53A 3WIHA 3VDBA 4Q6IA 1CLCA 4K7FA 1KCUH 2AW2A 3TBVA 5FYKE 2V2XA 5BRZE 5BVPL 2OTWA 4ZUWB 4OZFB 1AO7B 5C8JA 5KVFH 1MRDL 3QIUB 2F74B 3C6LC 3UTQB 2BJMH 3V7AE 4XH2B 3HC3H 5IOPB 3PDOB 3UTQA 2FJFA 1E4XI 3OAUL 1I3RA 2EE9A 3KXFA 1IC5L 2P5WD 2EC9T 3RZCB 1F58L 4YXHH 4ZTOH 1EGJL 4HDIA 1H5BB 4KPHL 2WMPA 5C9KA 1J8HA 5GJTL 2WWMC 1KTDA 1AKJD 4Z78A 3LS4L 4DKFH 2Y23A 1U8OA 5MEQA 2BVOB 4RISH 4JO3H 4WY7H 1RJYB 3BMWA 2VXTH 3TH3T 4LOUC 3KJ4B 2FX9H 4HWBH 5F7KC 1M7DA 4PREB 1OT2A 4YLQT 4QTHA 4NRZA 4JFDD 4WHTA 2F58H 2YMXH 2IAND 2IMMA 5HSFA 3TO4A 1VKXA 1MHCB 4JO4L 5FHAH 5F8QC 2RCSL 4WUKH 4KVNH 5GJSH 1TZHA 5DD3H 4UIMA 3CVHA 1OGAD 3L5XL 5DRZA 1CD1A 4U2ZA 4HUKB 2I5YL 3O6LL 4G80B 4XBPA 3L3OA 3T04D 1BBDL 4OM1H 4FMKA 2X09A 5IEHA 2VAAA 5I1DB 3U4BH 5DRNB 3T2QA 3FT3A 3VW3L 5JLZA 3W9EA 1N59B 4WTZA 5BZWA 4WW1A 3ZT6A 4OLXL 1MCEA 4Y89A 4R7NB 3I50L 4LCUA 1X6NA 2X1WL 4R4BA 1HINH 4H1LB 5FO9A 2CGRL 3UCRA 4L1HA 4LF3B 1I7ZB 1KB5H 1GL4B 5KSAD 3STZA 3P3YA 1S9VB 4YO0B 1VB9A 1ZAGA 4MAUL 2JB5L 1A3RH 3NFPB 4EDXB 4EUPG 2Z92B 1UQSA 4HG4J 5CEXA 2X9WA 4LLYA 5E0QA 5MERB 4AL8H 2A9MH 1HKFA 4GRWF 2ESVA 5GGTA 1T4KA 1QLRB 4PYGA 3ZSSA 1S9KC 4M62H 4KROB 3QUKA 3WUWG 3F58H 2Z31A 4LCYA 3LQAL 1D5BA 4PJXF 3VXMA 3Q6GL 1DUYB 3AUVA 3TCLA 1CCZA 1JWMB 4XX1E 2Z91A 3O8XB 3QIBB 3NZHL 4CMHC 1TCRA 2QKIB 2VQ1B 4M43H 2H26B 1OW0A 1T89C 5ENWB 4Y19B 4K94C 1XH3B 2R2HA 4JG0H 3UYRL 1SY6H 2A6JA 3VFVA 3EBAA 2D2OA 2W92A 4N9OB 2FWOA 4WFFD 5BCAA 3HZMB 43CAB 5JW4Q 1WISA 1QKZH 5GGSB 4UB0L 4C56D 4TPRL 3F12B 4RBPH 3ARFD 3JTTA 2N7AA 5C3LD 2O61A 1ED3B 3MREB 3NABL 4LARL 3MMEB 4ZFFA 3QJHA 2YUWA 2YPKA 3MXWH 4WV1A 2OI9B 5D7JC 4R96A 4H8WH 4AM0A 5ADOH 2AK1L 4M6ML 1ZHLB 1MREL 4JFFE 5L6YH 3ETBF 3T0BA 5E56A 1QBBA 5FKAA 2CXKA 1CFSA 2NX5B 2X4QA 1ZVHA 3RIAF 4ZODA 1BQHG 4WW2B 4YHZH 1XGYL 3CDCA 3B9KD 3BO8A 4RSVA 1QLEH 4HMDA 4QHUA 3DUSA 3BVNB 3VXSA 5EZLB 3FQRB 4R9HA 4W70A 3G6JF 3NCJL 1AY1L 1F3RB 3NPZB 3RY6A 1VEMA 2GW5A 3TH2T 4ZPTA 5JDJA 1QQDB 3AY4A 4WDIA 3VFSA 3WD5H 3ARGA 1A6PA 5BO1H 3ARPA 4LHUD 1RIUL 2J6EA 2NY5H 3JTSB 1EH9A 4OCRH 1EVTC 4L3AA 3MRKA 3QZWG 3TO2B 1QRNA 2SEBA 1JN6A 2YUVA 4LSRH 1DLFL 3EYQD 3O2VL 1A0QH 1EAJA 1OP5K 5HHXH 3RVXD 4YDJB 5F6HI 4LSTL 1MLCB 3RVXC 1U3HC 1RZ7L 4XBEL 3QXTA 1WBYA 1EGJH 3TBYA 5F21B 5IV2A 4ELMA 1I9IH 2HN7B 3C8HA 4XPTL 2EZ0C 3H0TB 2WLZA 1TTUA 4PLJD 4D9RE 2FEDC 1WC7B 1AGCB 2FHCA 4Z0BH 3L9RA 4P2RA 1RUMH 2R0ZH 3TN0B 1NL0H 3DRQB 5DD5H 4NQXB 2V17H 5KVGL 4FNLH 3QWRD 4X7SL 4AMKL 3P4MA 1F42A 1MH5B 2ZNXA 4X7TA 2IQ9L 1S7QB 3VFGH 1ZLWH 1HSAB 3MJ9H 3U7WH 4XP9H 4HPOH 3FO0L 2VOTA 1KULA 1N3NB 1YA5A 4LASL 2KUTA 5C0IB 4TSBH 4CMMB 1QTYT 2XI9A 4S1SH 3OKMB 4KTEL 4KQ4L 4Y5VA 1NLBL 4Y4KA 4OIBA 4QRQA 4R4NC 5IFJB 3D0LA 5DD1H 4KKCD 3T8XB 4RFEB 4UT9L 5ITFB 2XRAL 4HIXL 2W91A 3QYCA 1VFAB 3V6FB 4FQCH 3MV8B 1RZKL 4ODWB 4MA1C 5HYEA 2VH5H 4NKOA 3W11D 3C5SB 4Z7QE 3PP3H 4IRSA 4EIZC 1MFCH 5GGQH 1J0HA 4GAYA 2FATL 5AZ2L 1EAPA 3UBXA 3HN3A 4LK4A 1RAMA 1YEFH 2MPAH 2PNDA 3W2DH 2DLEA 4FFZL 5HHVL 2AJYL 3QEUA 3S36H 4Q2ZB 5KW9L 3DMMD 4PRPE 2I07B 4ELKB 1Q9KA 1MY7A 4X5XB 1ORSB 1WZ1L 2JJWA 5T1LD 3X3FH 4O51B 3GSQB 4KWUA 1JZ5A 3HG1B 1ZGLA 3VXRD 1UB5B 5JA9A 3BZFB 1N26A 4NBXB 1FFPB 1INQA 2D9QB 3C8KB 4LIQE 4M1GH 4NDMB 3T2NL 1KEML 1KJMA 3ABZA 3LKQA 4M6AA 1RIHL 1S9XB 3MLWL 4QCIB 1TPXC 1PAMA 3V5DA 4RIRB 3ULVH 3PWNA 4PJEE 4P2RE 3MRJA 4QRQB 1IEBB 5IVZA 5CZKA 5J9PB 4XXCA 1RFDL 1RMFL 1Q0XH 8FABA 5EOCH 4E5XA 4ZO8A 4UV7L 3LCYA 1MY5A 3H42H 1I7RA 4TUOA 4O2EB 1MNUH 5E9DB 4MSWA 1TMCB 2FIKB 1YMME 32C2B 3AC0A 5GZOD 1TENA 7FABH 2FLBT 3CLFH 1MH5A 2XQYK 2XQBH 3CVIH 4PRBB 3L5IA 3MRHB 2FH6A 2H2SC 3V9FA 1F58H 5DMYA 4NQXA 4K9EC 4XVTL 5KS9E 3B9DA 4LRNH 3VFRB 5I76B 4JPWL 4MJIB 2XG4A 3O3BB 4Q7DA 4D2NA 4G8FA 1E0OB 5EU5A 3KPSB 1ZLSH 2I24N 4JPIB 1UJ3C 5FIEA 4RX4D 5GISH 4XNMB 5BS0E 4RQQA 5SX4I 4OLZH 2CMRH 5HGDA 4FXGA 3DNKA 3RIFF 2Z4QA 4R8WH 3MLZL 3QDJB 1MI5B 1PY9A 2Z8VC 3MFFA 1FVDA 5IT2H 3BDYL 5D2LB 4OSUL 5DMGD 3IDGA 5HY9A 2W9LA 5EO0B 3QB7C 1UZ8B 1I8MA 2NXZB 2P5WA 2WZPD 2AJZB 2DQFB 4HLJA 3BI9X 1JGLL 3VFRA 5ID1B 4JM4H 3CSYB 2HG5A 4MJIE 2IAMA 3DX8B 3ECBB 2GY5A 4WENB 2YWZA 3GSNL 4PRHE 5ICXB 4X0KA 1A6AA 4URTB 2E9IA 4LSRL 3HZYA 2OL3A 4JFQA 5IM7A 1QO3B 1YUHB 3R0MA 5BVJB 1C8PA 1EHLH 1FNGA 3NGBC 1X4ZA 4WEMB 3AS0A 4L8SC 5B38A 1C1EH 1RUPL 4CN1A 3ZDYF 3ILPB 4GG6F 4M5ZH 1IMHC 4UQ3A 4LQ1A 3LB6C 4TOYL 3HC3L 1XF2A 2R23A 4XAKE 4JPVH 2GFBB 4OF5A 5CJOL 4KROC 5TPWH 5CILL 4G42B 3WN5B 3L3KB 2APTA 3W39A 1YEIL 4OLUL 3HUJB 2VLRE 3ET9F 3DVNB 1N6VA 2XPGA 4C56E 4QRRB 4FFWC 2X1XR 5DUMH 1PLGL 5KZCD 3GSQA 5SX4H 1FO0B 1P2CB 4GLRH 4PB9H 1R3JB 3IS1X 4J3WA 4QEGA 1S3KH 2L7JA 3NA9L 1CFQB 2VLJD 3HC4L 4J6RL 1HCVA 2PYED 1GGTA 4XC3H 5JPNA 5JOFB 5IQ9B 4PTUA 4O58H 3MNZB 3RBSA 1MHHA 4WNQB 2YSSA 3DROB 4KGLA 2ARJB 3QBTB 1D6EB 1PEZA 3RGVD 1I8LA 3ZL4H 3IU3B 4PJCF 2ERJC 1N5YL 3MCKB 3QP3A 3TGXA 4LLMA 4HK0B 1CLZH 2VXQL 5HYJB 3RVTD 4KH2A 5TQ0L 2NZIA 3RVTC 4ZAKB 1I9JL 5GRZA 3UC0H 1N8ZB 1BVZA 4ZS7L 4OI9A 2CLRA 1BJ1J 3TZVD 2ICEB 1WIPA 5GS0L 1F6LL 3N1FC 2AXGB 5ANMB 2MCG1 1Q9OB 5TJWK 3UBXI 2FGZA 3QWQB 5KN5B 1DVFB 5DHVA 2XFXA 5DYOB 1JZ7A 1NDMB 4IEFB 2BSSB 2E6JA 1ZMYA 3SE9L 4ZXBD 5E2TL 1DBML 3STZB 2FDBP 1S3KL 4BYHA 4X9IA 4QXGH 2HT4D 1NCTA 1IAKA 5D7JA 1F6FB 3V6OC 2VLMD 3D85B 3MRRA 4P46C 4ZTPL 1UM6L 2P8MB 3OKNB 2N56A 3OZ9H 4HMCA 5FV1L 1KOAA 1Y6MR 3RAJH 2EIZB 1FC1A 3KDMB 4U0RC 1NCAL 2NZ9C 3DUSB 3KYKL 4NRYB 5KSBF 5I1DA 2EDWA 4JFPA 1H3XA 4RMVA 3IDXL 4YDJA 1MUJB 4RDQG 4UT6L 3O4OB 4EVNB 5KTEH 3QUYC 1KLUB 2W65A 3K3QA 4NQUA 2D0GA 4KPHH 5CCKL 4YIQB 5DGQA 4UIMB 4JPKH 2UZXB 1T2XA 1OARL 4X6DA 1SJXA 5D93B 3RX8A 5I1KH 1PZ5A 2KQNA 1E4JA 4Z9KB 1ZVSB 1BAFH 3TN0C 5CFHA 1GIGH 4LNVA 3GFUA 1IAIH 4G6KL 3M07A 4MNQD 1IQWL 3BD3A 1HIML 1FNHA 3OSKA 3TV3H 5E2WH 4NKDA 3ZYOA 2GJJA 4RMRA 3HNSH 3P9LB 2R1YB 4WI7A 4JY6B 2AV1B 3EYFB 2FWOB 1MCPL 3IT8D 1G7QB 3SDAB 4S0TD 3TWCL 4X4ME 4N8VA 4LLDB 4HDIB 3O4LB 3H9ZA 2FHFA 4YHIA 4HXBL 4XBGA 1PSKH 4F33B 1X5ZA 1AI1L 4OUUB 3RVWC 2DQJH 2F74A 2M1KA 2FX8H 1Z9OA 5JPMB 4ZFFB 5DEGB 4AENB 3DIFA 3INUH 4LCYB 3PABA 1UG9A 4YHML 5DEGA 5T3XL 2A6KB 3MNWA 2ZOLB 3OKKB 3MCKA 3SGJC 1NGWB 1KSRA 1BQLL 1FAKT 3HPLB 5GGRB 1T7YA 5F9WC 4B7IA 1KG0A 4PJBB 3OB0H 4Q9BA 2NY7H 4JM2C 2FECL 4Y19A 1FCGA 5E8DH 3D3VD 1CDHA 3FONA 4M7ZB 4R7DA 4APQD 4LF3A 3PJSA 2DM7A 4LPWA 1KENL 1OAYH 4Y4HA 5ERWB 3QEQA 3DSFL 5DK2A 1NMAL 1UVQB 1R3HA 5HYIA 1B0RA 3BN9C 4NQTA 3MUJA 4NZRH 5CBAA 2F8OA 4YXLH 1WCBA 4QGYA 3LSOB 4PGJA 5E8NA 4QXTB 1MIML 5AG8A 3D39A 5KVDL 5IW3A 3MLRL 3R06A 4J8RB 5J3HC 4R8WL 4XPHL 3UPRB 5ICYB 3A0OA 2AK4E 1A3QA 4R3SB 5I66A 1L4IA 4ZTPH 4OB5H 4Y0GA 2YHGA 2YPVL 4Q9CA 3GBLA 4OGZA 3VWKA 2NXYC 4OCLC 3MV9E 4YIQA 4PYHA 3L3DB 4ZD3H 3QDJE 5E1AB 2X9XA 1E6JH 3QUMB 1FJ1B 3C5ZC 5B3JF 1I1AA 3QDGD 5DMJB 4NKIH 5TQ0H 4OCWL 2V5MA 4N68A 4PREA 4HJGB 2BVEA 4U7KA 2ZSVA 4OZHE 5FDWA 1UWEL 4OD3H 4C57C 2XZCH 5F1IB 1CGXA 4U1IB 3T0EA 5HHQA 1EJ6A 2H3NB 4MA3A 5H8DA 4DVRH 3SN6N 1G7MA 5I16B 1FL6A 1UA6H 4N1HB 4Z7VE 3TZVC 3SE3A 1FAIL 1JNLL 1RSFA 4X9HA 4KK6C 4MNQA 1N4XL 4HMEA 1RIHH 1PGRB 3O6FA 3HTLX 4HJJL 4CUCA 3SPVA 4K9EH 1SJHA 2VNCA 3UTPE 3QI9D 4EN3C 2YD5A 3V4PH 4WHTB 2DAVA 1YY9D 4WEUD 3IJHB 4G8EB 3D39B 3HNVH 4Z7VA 3NAAL 5E6IC 3SKOA 3LSOA 4PB9L 1AD0A 5D93C 5CGYD 4DKDC 2XZCL 2HJFB 1MEXH 4RAHA 1H15A 3RVUD 3MLTB 2P5ED 1UACL 1IAKB 3RHWK 5DT1H 4I4WA 3TP4A 3S3PA 4QRRE 1FHGA 3ULVC 1OSZA 5GZND 4ZO6A 5HHVH 4GG6E 4HCRH 1K4DB 4L8SB 5D7LD 3U9UA 4PRBA 4AG4H 5I1GL 1IQDA 3MGTB 4HD9A 5AD0A 2EECA 1NDGA 4ENED 1IKFH 3NFNB 3NCBB 4PP2B 1IEAB 1D5ZA 1BQLH 4NUJB 1IEBA 4R97C 1MQ8A 1X5LA 3VXME 4PJEA 1NSNH 2YK1H 2FSEB 4Y7MA 1KXVC 1YEKL 1ZS8B 5DFVC 3CUPB 3MRLB 2BOCB 4XWOC 4I0PC 1QFUL 1U8HA 3BPNB 4JHAL 1JNHA 1MCHA 1OSPH 4L8CB 1OPGH 3CFCH 1RJZB 3BUYA 3HNSL 1ND0B 1FFPA 1F4YL 3CJJA 3NZ8B 2BNRB 1M1SA 1YEIH 4KI1A 1T0MB 3HE6C 2B1HL 2Y1VA 3QNZA 1JE6A 3LN5A 4JY6A 1OM3H 1MCPH 1K6QL 1QVOB 3QIWD 3D0VA 4HG4K 4YHNB 4OLEA 1HHKA 1U8NB 5DVLA 2WBJA 3SKJL 4L9LC 1AQKL 5FGBC 1IKFL 4WI3A 4M7KH 3TEUA 3K4DA 1J18A 4LLUA 3UZQA 3V6OA 4JFFB 1OCWL 1MIEH 1JPST 2VLME 4GAFB 3C60C 5F9JA 3I6LE 1ZLSL 4M5YH 2IAMB 3DX8A 2K7PA 1TETH 1F3DJ 5IB1B 2IGFH 2VC2H 4XTRC 2DJSA 4Y2DC 1D6VL 3PHQB 1R0AL 3NABH 1ZSDA 1QSFE 3WFHA 4UTBL 2MHAB 4JDVB 5FCSH 3NPSC 4GSDH 1UWGH 4I13B 2VUOA 1OAQL 2XIDA 3QZWB 5HD8D 1BOGB 1YUHA 4IRJC 4ZOAA 3OKNA 3D69A 4NQEB 1SEQL 4F2MA 1KCVL 1U0QA 1TNNA 3PUCA 2OK0H 2CK2A 3VJ6B 5E70A 4G6KH 4FTVA 4U6XA 2NY0B 4H8WC 3RKDC 4YZFE 1JV5B 3DGGB 2AJZA 3WXVH 1PVHA 3S4SG 1KEMH 1JPGB 1X4YA 3OKDA 3REVB 4P2CG 3H9SA 3IDYC 1AHWC 1HH6A 3QIWB 3BZDA 1EGJA 1NGYA 3MV8D 4D9QD 3RJDA 4WI5A 2X41A 4HS6A 1HNGA 4NKIL 4UDUB 5ICZB 3CDYA 1WSST 3LRHA 3MROB 4Z7QF 4BFIB 1JK8B 1GH7A 2VSCA 4DN3L 4MD5B 5DXWA 5GRJL 1NC4B 4EN3B 1FRGL 4EUPB 4FABL 3SDDB 2VZ1A 4DTGH 3JTSA 2Y9RT 1MJ7L 3TPKA 3FQUA 3QIUD 2F9BT 1ZANL 4JKLA 5E08H 3MRHA 4KQ3L 1MFCL 2DKUA 1CFVH 2ARJA 2YD2A 3K4AA 4FMFA 5DZLA 2DLGA 4D0CA 2RBLA 3IDJB 3QO1A 4U1NA 4H88L 5GQBA 5F3HA 2J12B 3OXRA 1H8SA 4FFYL 1BWWA 4O9HL 3QJFB 1JPSH 5HHOA 2OTUA 3X13B 2QQLH 1P2CA 4NJ9H 1B6UA 5DC0A 3HI1B 1OHQA 3WS6C 3GSWB 1NCUA 3G04B 1TFHA 3EYOA 4L9DA 2NY2C 4GW1B 3CC5A 4K2UL 4R90L 4TULH 1U3HD 3TIEB 5K9JL 1LP9A 2VSDA 1ES0B 1WWCA 3GKWL 3PDGA 2GK2A 1JZ4A 4P3CH 4AM0B 5FYJU 1MJ8H 1MVFA 4MJ6A 4LAJH 2FR4B 4U33A 1XR8A 4F58L 4JFOA 2VLRA 4MCYB 2PR4L 4QYOB 1MCRA 4O51A 5SWSD 43C9B 2VN4A 4DJMA 1RZKH 1ORSA 3WFCH 2X70A 1U8LA 5DO2D 3SO3C 1WLHA 2OTUB 2RJMA 4M7ZC 1KN2L 1L6XA 1U58B 2EE2A 3NIDE 4JFXB 5IMLB 5DD1L 1JRHI 3SKNA 3MUHL 2JIXA 1EBAA 4PR5A 4RMQA 5INCB 1A4KB 3IDJA 2CIKA 1F02I 2A9NH 1AKJA 2UZYB 4J1UA 1AD9A 1RZFL 2VQ1A 1HQ4A 1N5AB 4L9LB 2W07A 1A4JB 4R0LC 3CSYA 1HOCB 2X4UA 3U48A 4Z7WF 5SWQB 4J23A 3R0NA 3AVEA 3ARSA 5TF0A 5HDQL 3DO7A 1ZVYA 1Q72L 3UTPD 4KVNL 1MFEL 5FHAL 2VDLH 4Q9QH 2H41A 4Z0BL 4UDUA 3SDDD 4JHBA 4OGYH 5B22A 2NX5E 4JFHE 3DVIA 5C0BE 1NEZA 1KEGH 1N6QH 4G6AC 1KJVB 1HXYA 1AD9B 3V52H 2HFEA 2FX7H 4J1UB 4NQDA 3VXRE 1A4KA 1B3JA 3S5LA 1FC2D 1S9VA 5FCUH 1GZQB 4YR6A 5F7WC 5L2KE 4HC1H 3WEXA 1HHIB 5C0RH 2DTMH 5L6YL 4OLWL 3NIFE 4FG6C 3I6LD 3UTZA 3TF7C 43C9A 4LL9A 3Q5TA 1PG7L 2K1MA 3UBXG 5I1EL 3ZYZA 1HH9A 3TZVB 4O2EA 3PWPD 2PXYD 4NQDE 5GZOC 5BO1L 4MNGB 4E5XB 4LU5L 1F8TL 4FQLH 1QFPA 3OQ3B 1TTFA 1HK6A 1A6VH 2NTFB 4YEEA 3CFKB 2ZNWA 3QDMD 5EBGA 3O3AB 5GRUH 3EYOB 1T66C 4J3UA 1IC4L 3NZHH 2H45A 1BWMA 1FFNB 4PJXE 3MX0A 5D70L 4ZFOL 2EO1A 1EERB 1KB5A 2QQLL 3PXHA 4CN4A 3W9DA 3KHOA 1RZJL 4PJAF 3LQAH 4FN0A 3KYOB 4RA0C 5KSAB 3QG6A 4KZEL 4NRZB 1OTTD 5IQ7H 1BECA 3ZE1E 4F57L 4PTTA 4OFIA 3LKSB 3P0VH 1N7MH 1FZJB 4KVCL 3X3FL 4B41A 5J12B 1IGIL 3QXAB 1JPFA 1P69B 4LLAA 3EKCA 5IUSA 3SDYL 5C07B 4WHCA 5D1ZD 5D7IE 3LKNB 4JQXC 4FQHA 3FQTA 3IDMA 3MBEC 2ZCLL 3DO3A 3WNLA 1IM3B 2W9EH 3M17A 1Z9MA 1A6TB 1OAXH 4BSWA 3QIBA 5FM8A 2WBWB 3B9KA 3IJYA 1KCLA 1IT9L 3BN3B 4NZUL 5IWLA 4WGWB 3JTTB 2O61B 3PNWA 4GRLA 4Y4KB 2IQ9H 4EBQH 4OZHA 4N0FB 4NOBA 3DBXB 2ICWJ 4I5BB 2XKNA 1T3FA 5EUOE 5JOEA 4U3CA 4Q9QL 4NQVA 1BEYL 1YPZE 4PP1D 4QF1A 5I1AA 2D7QA 1X5FA 1EO8H 3D2UA 5HYJE 3PV6B 1JHKL 3I02B 1QUNA 5H2BB 4FXKB 1A1MA 4X9GA 1WBXA 4TN9A 2MKLC 4OGAC 1FFQA 1E4XH 2YA1A 3K2UL 1WV7T 3IVKA 1CL7L 1AD0B 4UT7H 1HXMA 3SJVE 1T20A 1A0QL 3GSOB 2DTML 4NN7C 3FT3B 5E8OB 5IV2B 1WBYB 1MWAH 5IG7A 2CDFB 4NSKB 3KYNA 4XCYB 3ZTJG 4Q6IC 1JYWA 2ZUXA 5JDSA 1FO0L 4KKLD 2R2CA 4OLWH 3F6IA 1YYLL 3BRDA 4D9RD 2OLDA 5IEKB 4YE4L 2NY7L 1CD1B 4L4TD 3RWEA 2VE6A 1QPPA 3Q3GB 4Y19D 2YEZB 3QI9A 1CU4L 1FL6B 1A1OA 4X8JA 2IBGA 4NP4L 3SQOH 3WFBL 4AMKH 3CIQA 3KPQA 4LEXH 3MOAL 3RGHA 3RTQA 5HDQH 1N2RB 3SJVD 2CLVB 5CJ8A 3MJ8B 2E7HA 5A2FA 3MLVL 1H3VA 1NJ9A 3T3PE 1BFSA 1VERA 1A7NH 4GH7B 5CJ5A 1M4KA 1X5HA 4PRHA 1A7RH 3EGSA 3IXAA 4JPWH 4HC1A 2IBZY 4EI5D 4HXBH 3LHPH 2J5LC 2GI7A 3QFJE 5SV4A 4ZSOE 4J7RA 3VXOB 3VXQA 4W4OA 4G8IA 1UXSB 1NCNA 3T1FA 3VFTB 4QTIH 2XACC 4RMWA 3H42L 1ZLVK 1J86A 2YD6A 2DI7A 3CSGA 3P4NA 3OV6A 4UDTB 1BVKB 4IOIA 2QSTA 3FN0L 3WIIL 1FYTE 2VWEC 1DANU 2WQ8A 3HPJA 4N90D 1D3CA 1LP9F 1QEWB 3FRUA 3MREA 4M6OH 1CGSH 1UKQA 2ZCLH 1WCBB 3BPCA 5J13C 1R24A 3P9MA 4YC2C 4JO2H 5EIVA 1S9WA 3ROOB 3ZE0E 2WIMA 4DN3H 2HRPL 4X5WA 4PJFF 2WWKT 4WFFE 3RFZC 4I4WB 2OBGA 2W59A 4R7DB 3B6SB 4F9LA 1YEEH 4O2CA 1H15B 5CCKH 4JJHA 1LD9A 4LFHG 2CDEA 3HNVL 2IFFL 1JTOA 4G8EA 2EDDA 3ARGC 4EN3D 5D72L 5FK9A 3P77B 4ZFZB 4XP4L 2NY5C 3G08B 4JR9L 4FFYH 5FUCC 4GAJL 2DD8H 2X1OA 1G0YR 5D70H 2A1WH 3ZKSD 1P4IH 2B2XH 3A6BH 3DV4B 5CP3H 3VXQB 3VXOA 1LE9A 1Y0LA 4ZUTA 2GQHA 3GIZL 3SDCD 2ICWB 4RGND 2VKWA 4XHQA 4PJ5E 4XVSL 1AHWA 2HA1A 5FUZH 3BD5A 3SDYH 3U36B 1A3LL 1SEBB 3QCUH 4NFCA 1FIGL 4ODUA 5JHDD 3NN8A 1CXKA 3OXSB 4PJAB 3TYFA 5I8CA 4AG4L 3FB5B 3FZUC 4UTAL 1SYSB 5F8RC 3VD9A 1XGUB 4N0UA 2CIIA 2DWEA 2QBWA 1EHXA 1IGJA 5J1AB 1ZHNB 2JK5B 1BJ1H 4A6YA 2B5IB 5J1AA 1KPVB 3RPKA 2DWEB 2FD6L 4M9OA 5DTFB 1A8JH 1AO7D 2NR6D 3RBGA 5EG6C 3T0AA 1AFVH 4OLVH 1XCQA 4X6EB 3NBNA 5E8PA 5I19H 3G5YA 2EO9A 4V1DA 4DUVA 4H20L 2IADB 4PD4K 2HLFD 3SGKA 4AH2B 4X4MA 2BNUA 3C2AH 3OTTA 3TBSB 4QRSA 5L2KD 4I18A 1IGMH 2C3WA 2IH3B 4U1SB 3VGBA 2OQJB 4P23C 3L7FA 5DJDA 1JWUA 3QUZC 5CZXD 2N7BA 4YQXH 1SVCP 3VFUB 3Q2CA 4KUCD 5CHNA 5CUSL 2MCPH 3W81A 2N4IA 3HMXH 1KBGL 3P30H 5KVMC 3C60A 1DE4A 5CP7B 4PG9B 1QBAA 1IGJB 2AI0L 2QHLA 4UBDC 3HZVB 5FGCE 1AJ7L 5SV3A 5EIIA 5IGXL 1RURH 3LS5H 4PY8J 4QF1B 5I1AB 3ULUD 5SWSB 3QISA 2DI8A 4BQCA 4LVHC 3D85A 3MRRB 2PTUA 1WUNT 4JRWA 3MA7A 3MTRA 4PLNC 1MIEL 1VGEL 3C09B 1TVHB 2VWEE 2X7LA 3DARA 1MCOL 4L5FH 2LAGB 4K3HA 5CJOH 1A6UH 5FUOH 2GITA 2AVGA 1NLDL 3UTTD 3K74B 1Q72H 3BRFA 3QULA 4JFEB 4IOIB 5IVXA 4HXAH 4JFEA 3VXUB 1MVUB 3WUWB 2LU7A 4XPGH 5J1SC 2X4NA 5KSAC 2I27N 5IVOA 5LGJA 1MWAB 2FO4B 4R2GB 2FCBA 3T4AB 3MPCA 3BXNB 1ADQH 1CGVA 3MRMA 3GSUA 2X7LB 4QHNA 5ESVB 1TVHA 4X4YA 3P40A 3FO1B 1DBAL 3HE7A 3U4EB 1F2QA 2EIBA 1SMOA 1P6FA 5LXGL 3BZEB 1EIBA 4I3GA 3X11A 5IHZB 3FRUB 1QRNE 4LPCA 5DDHA 1G9NL 5D7KD 1KLGA 4RRPA 5F96H 1EJOL 5BOPA 3AS1A 3O6FD 4UB0H 1DE4B 2AAVA 4DAGH 4XWOD 1CR9L 3OAUH 5JA8B 3VXSD 4X6DB 5DO2C 4OCNC 4KY1L 3S96A 4K71B 3T1FB 2YBRA 4OZ4A 4LNRA 2XYCA 5AZEL 5I1KL 1HN1A 3MXVH 1DQDH 2BHUA 3UJIH 5F3BA 4WU7B 3IRPX 2NTFA 2WSKA 4NZJA 4RCAA 3ZKND 1LQSR 3HZKB 3TNNA 3MLUL 4OCWH 2BFVH 3RUGB 3TA3B 4ZPVB 3ZTNH 1JYNA 5I8EA 4HS8L 4Y5XA 2R23B 2NNAB 1HH9B 2BNQB 3TZVA 4YBLB 4EI6A 3QH3B 3QDGA 5FKPB 1XT5A 2G75A 1B0GA 1D5IH 2ATPA 3UTZB 5K9QI 4GBXD 3GSXB 3BQUD 3ULVD 5AWNL 4JFZL 2X42A 5D7JB 5E03A 1FNGB 3ZDZF 1T21A 2DIJA 3I75A 2MTPA 4HJ0C 2C1OB 4OFKA 3ARDC 3CXDL 3VRJA 4Z5RA 3I3BA 1I1YA 4LPYA 1I1AC 1T0NA 1SM3L 2Q8BL 4NHCL 1NEZB 2HG5B 4PY8I 1FAIH 1GGCL 2D31A 5C6PB 2UVEA 3U6RB 4HV8B 3S88L 3T2OA 3ZTNL 5IIEB 4KHXL 3U0WH 4IMLA 2BOBB 4S10A 2F53A 3KLAB 5GRJH 4ZAKA 3MFFB 4BK5A 4IRZH 3W0WA 1N64H 3DO7B 1UCTA 2YD7A 3KYMA 4N1CA 5E7BA 4BSWB 1KFAH 5HGDB 1Q9WB 4Y5YC 5SWZE 4QWWC 4ZFOB 2ZUUA 3UC0L 1D6EA 2ZOKB 3CFDB 5FYJE 1RZIB 2WUCL 3FQTB 4FZ8L 2CIKB 3T4YB 4O5LH 3V4UL 3VE0B 2ED8A 3OR7A 4U1GC 3WNKA 3V95A 5I76A 4FXLA 1YNLH 3W82A 1IGFL 3D18B 4OZHB 1BREA 5F7NC 1NUFA 5GRVL 1L7IL 1JGDA 4KI5E 2GCYA 3FL7A 2VAJA 2DN7A 1EUTA 2K3TA 4ONGL 4XPHH 1SEQH 1PSKL 4Y16B 4JM2D 1K8DA 4NQCD 1DBAH 1LO2H 1VPOL 1J12A 1BVKA 4JR9H 3B5TA 4DFIA 2W9DL 5SWZB 4OCSH 4KK5D 5GS1A 1VCAA 3EOBA 5E5RB 1D7FA 4YHLH 4HIHB 5BW7C 5K9QG 1V5JA 3QUZD 4TQEH 1BFTA 3ARFC 3G04A 3UJJH 1OF2B 1XF2B 3CFKA 2HWZL 2ITCA 5HI3C 5I73B 3O9WD 3IAGC 2F19H 3LD8C 3GRWL 4LPTA 1RUQH 4KK8D 1JYVA 2ZUVA 2NY4C 1C7TA 2XWTA 3PG2A 2E27L 5JIPA 5LCVL 4TTGA 4GXUM 1K8DB 1MCJA 1OARH 2OL3B 2AXJA 3WNMA 1G7IB 1S7WA 3CFJB 3ZT5A 4MD0B 3FN0H 1RI8A 3BJ91 3WIIH 5KSAA 1JIBA 4LSTH 4JM4L 3LEXA 2EDYA 1RHFA 2E9WA 2J1KA 3MBEA 1FFNA 3P0YL 3VXRB 1GZQA 3UYOD 3VE0A 3G6JE 3MRFB 1TCMA 1W72H 5EU4B 2R4RH 1S78D 4OKDA 3CFEA 3BPOB 3TV3L 1J8HD 1V3MA 1XGQA 3PGFH 1S8DB 4P2OD 1WWAX 1XF5B 3CU7A 1IVLA 3BT2L 4I9WD 3ISWA 5GRVK 5DMKB 5JORB 1IFHL 4QXGL 2BERA 4KC3B 5FOBB 5DFVD 5JW4M 3BDXA 5D7LE 1N6UA 4LLWA 5CSZB 3ARDA 1VGKB 3LKPA 4LHUG 4ORGA 1LE5B 2D31B 2P24B 1JHTB 1QR1A 2I26N 1TITA 4PJXA 1RZ8B 3MRNA 4FQXC 2J7LA 4POZC 1O0VA 3PQYE 1T3FB 1TZGH 3HAEA 3U30C 4Z95L 4I5BA 2AI0H 3ULUH 3DBXA 3C5JA 4OBRA 2Q1EA 3I2CH 5DJ2A 3H7BA 2R1XB 3UTSA 5EB9A 4PJGB 1CG9A 1Z3GH 1U8LB 4LSQL 3GMPA 4MWFB 2R39A 3ARDB 3LKPB 3SE8L 5D8JH 4LLWB 4TRPL 1A3LH 4MMZC 1WICA 4MAYC 3PIQB 4X83A 5GGTH 1S7XA 1F11B 3RL2B 4P23B 3JVGA 4OFYA 3IF1A 4U6HB 1IGTA 1AGEA 5ILTH 1RJLA 3QO0A 4M1GL 4ONGH 3EIFA 3RNQB 3T2NH 1XGQB 2Y07L 1YY9C 3WUZA 2IEPA 5KSVA 1JHKH 4LEOB 2XG5A 3PQYD 3TVMB 1BLNA 2HFFA 5KVDH 5B8CB 2E7BA 5HPMB 3BZFA 3RPIA 3C2AL 3VXUE 3HG1A 1I9RH 2K9UA 3GJEA 2PCPA 5GGRY 4NQEE 3VWJD 5KS9A 3HE6D 4MJ4A 3HRPA 1S7WB 3CFJA 4LFHD 5F7DA 2ESVD 3IKKA 4MQ7A 5J6GA 3MBXL 4Z7OE 3B43A 4MNHB 1L7TL 1EAPB 1OAZH 1N64L 3VXSB 2BK8A 1JRHL 2F5AH 2GAZA 5FA4A 4OFYD 2W9EL 3FQWA 2C4FU 3MRLA 2VR4A 3FFCB 1FGNL 1U8PB 2NLJB 5B3NA 5FGSA 5HHME 4ODHL 2EE3A 5HYSA 1JVKA 4XVSH 5FUZL 3Q1SH 1ZT4A 4RFEA 3SGDI 2YKLL 2DD8L 1A5FL 3WDJA 4YFDB 4GQ9L 4ZFGL 3BKCH 4QRPD 1R5WB 1D5ZB 3KPPA 5DI8B 1MHEB 2E7LC 3QAZB 2D0FA 5DWUL 5ACMA 2NY3C 3DRTB 1NDGB 3VXSE 5LG1A 3KXFE 1OQOA 5I8OH 2JJUA 5FDYA 2ZCKL 3JXAA 3LDBC 4Y2DA 1OP9A 5GGSA 2CUHA 5T1KB 5FM5M 1ZHBA 4JAMA 1XR9A 4Y4FA 4ETQB 2IALB 2R0KH 1AIFB 1E28B 4F2MB 3A6OA 4NCC2 1ZEAH 5DJCB 3S5LG 3S4SB 2HRLA 4HF5L 3QXVA 2QKIA 3T65B 4FHBD 4JCMA 5HVFB 3WO3B 2Q7YA 1BF2A 4HBCH 4M5ZL 5LWYH 2HWZH 4NNPH 3GMMB 3H9SB 2Z31B 1YYLH 4L4JA 3JWDH 1JPGA 1EHLL 4LDOB 3B9VA 7FABL 3QFJA 3UTTB 3DJ9A 4YBLC 4Y88A 2DQIH 5IROA 3LRSA 3RTQC 3C6SB 1KCKA 1KF9B 4CL7A 4ONFL 1MRFL 1AGDB 1G6RB 3H7LA 3LY6A 4NOFA 1T1XA 3MV8E 5DHYA 4D9QE 4LLUB 1DUZB 1EEZA 3MRGB 1BGXH 5D1ZC 4FQXB 2ZZUT 3QIUC 2JK5A 5GIRB 3NH7L 1I1AB 1UKTA 3V8OA 5D7SL 1T1WB 3D5OF 2GT9B 4C55A 3S97C 1FBIH 4CNIA 3BGFB 1I4FB 1MPAL 3B3IB 5D71H 5KSBB 4U6YA 5CGMA 3MV7B 2OMNA 4O4YL 2BNUB 1WCQA 3NVQA 1QSZA 4G8GE 4U7MA 4DOHE 5J7CC 1IC7H 3CUPA 5ISZB 4ZUTB 2A9NL 4IHOB 1V8HA 4JZOA 1OAUH 4LSDA 3K2UH 2IPTH 1DFBL 3BN9D 35C8L 1RFDH 1U8MA 3UDWC 1P5UA 1H3TA 3X12B 4F7MB 1BFVH 4J4PA 2AJSL 1A2YB 4ZFZA 2Q8AH 4UV7H 4XP6L 1XF4A 1J1OH 1SYSA 4S1QH 2KL6A 4IS6B 4YNYB 4H1LG 2EC8A 3IXTB 2FL5B 4L8DB 2PTTA 4D0CB 1FVEA 1KTLB 3CVHL 3BGAA 2VDNH 4QY8B 4X80L 5L9DH 1JGUH 1HWHB 4KMLB 3NCMA 2NY4D 1TCRB 3EJZC 1JWSA 5ESVA 3AGVA 2CK0L 3WJLA 3BXNA 1KCRH 3RJQB 4FQQB 1MWAA 2FO4A 4LVOC 4XP4H 5E2TH 4KV5F 5C0AA 4WHDA 1OB1A 3Q5YA 1PLGH 3F58L 4P57B 4NPYA 3NGBB 4PJCB 4LCWB 5F9AC 3P73A 3VI3E 4G6ML 4K07A 3TYGL 4JQXA 1QBLL 3Q6GH 4WCYH 4HS6B 4X7EC 2CDGB 5EOQH 4NZUH 1F13A 3ULUC 2PO6A 2R0ZL 2HLAA 1J9CT 4KTDL 5CMAB 5C0FB 4O2CB 1I8IB 1HHHA 4K8RH 4W81A 4FG6D 1U42A 1UYWL 1BF8A 3LZFL 1FNSH 3BKYL 5I17B 4FTVB 3GBMH 3LKRB 3OAZK 1FIGH 2HP4A 2QJDA 4YGAB 2JE8A 7CGTA 1DDHA 4Z7UA 4M8QB 3NIGF 3L5WA 2OJZH 3HUJF 1DLHB 3VWJB 5D7IF 1CBVH 5D7IB 4XCEB 5TDPA 3EDJA 4MJ5B 2BRRH 1RZJH 2C3VB 3WLBB 3ARVA 5CP7A 3RL1B 2VXUL 2DQHH 1XAUA 3P2TA 5ISZD 3GMRA 3WJLC 4QRRD 3C9NB 2AS5M 2Y7QB 3WFDL 2AP2A 4G80A 5K9KA 4GG6B 4RGOL 4YPGB 3BIKB 3MGOA 1CFBA 2IFFH 3MRIA 4U05A 1UJ3A 1U8KA 4PJAE 2A9ML 1GZPB 1A22B 1MFEH 2YC1A 4ZUUB 2R4SH 2IADA 1YEEL 4QHKJ 2NMSA 2D0HA 1MQKL 4MD4B 2VDML 4XCEA 4KJQC 1NMBL 5TDPB 5CSBA 5FV2A 5A40E 4HWBL 3T77A 1BZ9B 1FV1B 3L5WB 3DYOA 1Q94A 3BD4A 4KJYA 4WWKD 3PWPA 1U8NA 3I84A 2DWDB 1MAKA 3QEQB 5I17A 4UV4H 1EJOH 3GSVB 4OGXL 4F37F 2KPNA 3RVUC 3PV6A 3WXWL 1HHHB 3MJ9A 1I8IA 4PJ8C 2NY5L 1ND0A 1EHNA 4QT5B 1GC1C 3CMGA 4I2XA 5F71A 3KS0H 1BD2B 2NW3B 3FKUS 5C0BA 4CDHA 2FJFB 3UPRA 3B9KC 1CL7I 1XIWA 2QQKL 3FN3A 1NAML 2XTLA 1RY7B 3KPTA 3QIUA 5HJ3A 2VXVH 5CJQL 5LGHH 2WIIA 4QNPF 5E8NB 5JHDE 3TNMA 1WGOA 4WHYH 1N8ZA 5I1GH 4WI6A 4XPGL 1U95B 5SWSE 1BIHA 1FL5B 4LLMB 2IJ0C 4FXKA 3VXNA 1MELA 3PJSB 3QUYB 5AUMA 3S3SA 4GAGH 2ZCKH 2P5EA 2ZG1A 3LN4B 2P5EB 1U8IA 5HHMD 1NGWA 15C8H 2AEPH 1FDLL 3EOTH 3PWVB 3PABB 1R6VA 1S7UA 4CRPA 5E6IB 1ZTXH 2F15A 3IJYB 4QO1A 1DQTA 1DSFL 3MV01 3PXJA 1W72A 1OOAA 3OB8A 3F7YB 2W38A 2R0LH 4XBGB 5F6HJ 4XMLH 3GJFB 1QKZL 4QT5A 3F8UB 3LH2H 2O5XH 1MJ8L 2GSIA 3GI9H 4PJFB 3BE1L 1Q1JH 1UJTA 4NKQB 4BSVA 2MKWA 1HQRA 1IZJA 1QFOA 1S9YA 3P9LA 3QXAA 4XNYH 2Q3AA 4RGOH 4UUJB 1FH5L 4W68A 3UJTL 5HVGB 1J8KA 2PYFA 3L3GB 3IAPA 5IFHL 4XPFL 1BZ9A 4LQFL 3S98A 2BSRB 4TSAL 2VABA 5T1LA 4M8VA 5DRWA 5TFSH 3KYOA 3CH1B 1KIPA 4WI9A 1VDGA 3ORJA 1H0DB 1I8LC 5F1NA 4X8JB 5JXEC 2HT3D 4C58B 4CW1B 1LEGA 3RDTB 5D1QC 3HFMH 4UTAH 1CICB 1WWBX 3UZEA 4WUUB 2CH8A 5CZXC 3GI9L 2HFEB 3BIBX 3BKYH 1KCSL 3I6GA 1UYWH 1WFTA 4U1HA 4PUBH 1UWGL 3EHBD 3V6BR 4KUCF 3FQNB 1LO4H 4I1NB 3RA7H 4KTDH 1WEJL 4NSKA 1L0XA 5EPMA 1ORQA 5D7LA 1DZBA 3RI5F 5F88B 1MCQA 4FQCL 4ZQKA 3WLWD 4BQBA 4JZJC 1UFUA 5KANG 5JO5A 1UVQA 1H3UA 1I3UA 5E9DE 3UEZA 4HX1B 5EIQA 3PQYA 2WINB 4XP1H 1I9RL 2XV6B 5T3XH 4QKXB 4HIJA 2NXYB 5GJSL 3V4VH 2YSSB 1A7NL 2BSSA 3LMJH 4G8GD 1YJDL 1P4BH 3PWLB 4PTUB 1CXFA 2XKNB 3ELAT 4O02H 4MS8C 3V0VA 4MAYA 2XFXB 2ADJB 4OTXH 3VGHA 3MNVA 4KMTH 5DD3L 4HFWB 4DEPB 4X7DC 2E6QA 4RGMC 3BESR 2P48B 5FECA 4IRJB 4G3YH 5D6CA 1SBSL 1FNFA 1NBZB 4JFYB 1U8PA 1UADC 2A6IB 3NA4A 4OUUA 1LO0L 4LBEB 3DV6A 1HE7A 4L9LA 2BDNL 4PLKD 1WFOA 3V5HB 1IGYB 4RMTA 4YBHA 5E2WL 3QCVL 1EBPA 1MWAL 4L3EE 1R3KA 5BS0A 5GHWH 2D3VA 5HGAB 1I1AD 4OV6F 4U1MA 4WFGD 5LCVH 3SDAA 4ODTH 4M5YL 1BAFL 4WU5B 4CADA 4PRDA 1DBKL 4DZ8B 2Z35A 2MWCA 4KDWA 1T83A 1VADA 3QUXB 3FTGA 2IFGA 2E5EA 4O02L 1EEZB 1IAII 4JANA 3O11A 2R0KL 3DETD 4G6AD 3QXWA 1OY3B 1T22B 2VO5A 2NYYD 2X4OB 1QFUH 5IB4A 3EDDA 3MOAH 4LDEB 5EBMB 5IBUG 3IAQA 2L4OA 3SQOL 1MCNA 1ITBB 3FOLB 5GRYA 1A9EB 3IF1B 4U6HA 2LE9A 4WO4A 2B39A 2YRZA 1CZ8H 1FZMA 3IDIA 3MV9A 1FVDB 1RUAL 4PJGE 2HJLB 4LKXA 4X99B 5E4EB 1CXLA 3QDJA 1CG9B 4M6MH 1FGVH 3Q6FB 1QFWL 2V9TA 4N0YH 5SX5H 2DMKA 3S37X 1A6ZB 1A9BB 4HKBA 3ARFA 2BNRE 2VL5A 1AGDA 4NQCE 5ICXA 5EDXA 2E6PA 2PYEA 4PJXB 1EV2E 1J11A 3O2WH 5T1KA 3I85A 5GPRA 4D8PA 4OLXH 4NQEA 1PYWB 3JV6B 4E42B 5IESH 1DR9A 1JK8A 1QG3A 4MNQE 5C07D 1AXIB 1HI6A 1FH5H 4YPJA 5D7LB 4PRNB 4ODVH 3ARRA 5IMMB 5MEOB 3S36X 5CSGA 5D9SB 1ZLUH 2NTSP 4JVUA 4TNVK 3REVA 1ZSDB 2YA2A 3SJVA 1FLTX 3LQAC 1G7HA 1IT9H 1AIFA 4MJIA 1JV5A 3DGGA 3FOLA 5FGBA 5SWZD 3B83A 2XTJE 1XR9B 1KJ2B 3K7UA 2PYEB 3MOQA 3GK8L 2YMXL 3KJ6L 4HT1L 4MDIB 4JFFA 3O6MH 4MSWB 3NPSB 2R15A 1MRCL 1BOGA 1G7PA 4J4PD 4KMQA 1C7SA 35C8H 2X1QA 4PJDE 4S1QL 2P8LA 1OAZL 4DK3A 3BSZL 4NFBA 4HUWB 1NUDA 4P4KB 1CDUA 1QBLH 3D2UD 1CQKA 4OZHF 2Q20A 1CGUA 3NZ8A 4N0CC 4WEBH 1F97A 4C4KO 3O2DL 4UNUA 3O3DB 4XP5L 3TVMA 4JB9H 1A9EA 5C7XL 4GMTL 3E8UH 5JOPE 3FQWB 2RR3A 3ZL4L 1RK1A 4ODWA 1LHZA 1MIMH 3JBG7 2J8HA 3K1DA 1P4LB 4HAGA 4X9BA 4MXVE 3I9GH 1U3JA 4JANB 1ZGLB 5DJ6A 4YXLL 5FECB 3T8XA 2P1YA 1E27A 2QSCH 4A2LA 2IBBA 1X5IA 4HUWA 2ARWA 4MWFA 2FX9L 1J0IA 5E6ZA 3FT4B 2CXGA 1F6AB 2P8LB 4P99A 4JFDA 2HVJA 5ID0A 2EC9U 4NM8L 1QSFB 5F1KC 3QEUB 3BYTA 3QNZB 5C71A 3RUGE 4WO4D 4WTXA 4WO4C 5HGAA 1HSAA 1BLNB 1UM5L 3UDWA 4YAQA 5CGTA 5L88H 3TN0D 3HI5L 5D1ZA 5HHMB 1V3KA 1KJ2A 5I15H 5I1HH 3VXNB 1J5OH 2BSTB 2BOCA 2HT4C 5EN2B 1I8MB 3RY6C 5HDBE 1CF8L 1DQDL 2VDQL 3IU4H 4EN3A 5HY9B 2J88H 3IRZA 3MRCB 4RFOL 5D2LA 5DHVH 3D87B 4WI8A 5MEOA 1JMXA 3FCTB 3RVWD 1NMBH 1CR9H 3MROA 5HJ3B 5HVWA 3IJHA 4OQTH 4BFEA 4CVXA 4LRNL 1KCUL 4P3CL 4QGTA 4FQIH 1FORH 1NANH 1IEAA 1N3NA 3QHFL 4OLYL 3SY0A 3RUGF 2RFXB 3HE7C 3IFLL 4LSSL 1MRDH 4JPIA 1PYWA 5T5FH 3SDAC 4EQ3A 1MF2L 4GKZB 4IOFD 3DXAD 3DX9B 2GJ6E 4K3JL 1T2QL 2OZ4L 5TE6L 3TN0A 3KHQA 1MFNA 1C12A 3FZUD 4E41D 5HGHB 3D69B 4ZSOA 1T80A 3RU8H 2AJ3B 5T5FL 4O9HH 3W9EB 4Y2DD 1IAIL 4KAQL 3WNNA 5DUPH 3O0RH 1F3JA 1OAKH 3VA6A 1NCBH 1IGML 3H9SE 4ZPVA 1A64A 5EPMB 3T0VA 1U9KA 1DBMH 5TH2B 3ROLA 1TJIH 3HI6L 1VA9A 4N9GB 2DRUA 2FJHB 5ABDE 5F9WB 4U1LB 5EU3B 4H26B 4UILL 5FB8B 4LNRB 5EBLA 4NNYA 1KFAL 4OV5A 1OTUC 4M7LL 3JV4A 3BSZH 3QUMH 4PV9A 4BK4A 3S7GA 2P8PB 3O6KH 1AP2B 2ORBL 3QNYA 5DRXB 2AEQL 5BXFA 1NFKA 2OS7A 3LKOB 1OWWA 4UT6H 5IHZA 5KSUA 5CD5D 2EYSB 2FB4L 5DHXB 3MODH 4KRPD 4H1LH 3RWCA 3SDCC 1QVOA 2W1NA 2E9BA 4Q2ZA 1K3ZA 5IMKA 5EA0L 4XC3L 3UO1L 4DEPC 1EA9C 3FONB 1L7IH 1XZ0B 2A1WL 5D2NC 2AGJH 3U46A 2YD4A 1A5FH 3GJFA 3U9PH 1I1RA 3O8XD 4V2CB 1W72B 4K23L 4X5LA 2V2TB 4QRUA 3BUTA 3V6FA 4KKLC 3TBTB 4JHWL 4OF3A 5DQDL 2YD9A 4V1DD 1KN4H 5T3XD 2ATKA 2BRQA 4KJPC 3RWIB 1A7QH 5J06A 2BHYA 5IF0B 2V5RA 3L5JA 2F54D 2P42B 1LO5A 4PY7A 4P9ML 2J4WL 3T0DA 5DURB 4HGMA 1J88A 5KOVC 1FPTL 2H32B 3DWTA 4MA7H 2HFGL 1AR1D 3NFPA 4EDXA 3S88H 1T03L 1S7QA 1RZIA 5ENWA 4DAGL 4Z8FL 1GOHA 1K2DA 4TUJB 3PWUA 1U6AH 2R1YA 4ALAL 5ECJE 4KDTA 4PG9A 4P59L 1A2YA 3O2VH 4NKDB 4DUWA 1YNTB 4KJYB 4AT6A 1D5BB 3GO1H 1O5DT 1TQCB 2BOBA 4HWBA 5JLZB 2NNAA 4NWTL 3SDAD 4MZ2A 2WW8A 1BZ7A 1T2QH 3CFCL 4EI5C 2V2WB 4DQOL 3L7EA 1QLFB 3CXHK 3BIAX 3RU8L 3E3QE 3ARBD 3I6KB 1EUUA 3VU2A 5E5MA 1KC5L 3FB6B 1UQSB 4M03A 4QHKI 4JQVC 4I2XB 4NT6B 4G6FB 4MNQB 2J2ZA 4JE4B 2BFVL 4YPGA 1ZHKA 1S5HB 4F7TB 4OZ4B 1LEGB 3RDTA 3KPMA 1TZHB 1W0WB 3EYFA 4YHOH 5F1NB 4HBCL 4JFFD 2G9HB 2GTWB 3AB0C 3C6LA 3GSXA 4RDQF 2J88L 4MXQD 3RZWA 3ZKMD 4EXPX 2M26A 3IDNA 3ZE2E 1FV1A 5DDHB 1M7DB 1CGSL 1PKQA 2P8MA 1ZVSA 2A77L 4UBDD 5IESL 4L8BA 4RFOH 1XIWC 2DQCL 3W5NA 3L3OB 4RAVB 3KPMB 1MNUL 3BIKA 1CFSB 5C09A 4DZBA 4F7TA 2P49B 5T1MA 2XA3A 1FG2B 4HWEL 5BS0D 4DQOH 4B7LA 4PGCB 1T5XB 4EVNA 5TE6H 4L4TA 1A6WH 3U1SL 3GMMA 3UTSD 3ZKQD 1VKXB 1I3RB 2MCPL 1O7SA 2XZQL 5ICYA 1OQXA 3G08A 5IOPA 4M48L 2X89A 4NRYA 1MF2H 5T1KD 3I9GL 3VGEA 3VWJA 2FECI 4J3OC 5GS2D 3HCVA 5E6IA 2QSCL 5I9QC 3BP5A 3EO1A 4Q6IB 4KKCC 1DEEA 3FN9A 1MLBB 5ACZB 4O2FB 4PFEA 2HTLC 1JF6A 2A73A 3F6LA 1IGFH 4O2FA 2VLKE 2C1PB 1HCFX 1AXSA 2MSPA 2EDLA 3LN4A 2DMBA 5C2UB 4P9MH 2Y5TA 4M3KB 4NKMA 5JOFA 2P44B 1J5OL 2H26A 3T0WA 5GGRA 3C5ZB 5DYOA 4Z7UE 3KXFB 1ZGLP 3BEVA 4XXDA 2AEQH 4HGWB 1QSVA 2MOVA 2WBJD 2FLRT 3RNKA 2Q86B 1S78C 3ULVL 5D2NB 5L8LB 4QXUH 3GDBA 4BH8A 5FO7A 3GK8H 3TBVB 1UB6A 3KWWA 5ETUA 2XPGB 4AY0A 5C6TH 4HK0A 1QLRA 4YWGH 1IZKA 3ZT7A 4WUUD 4RAVA 1HINL 5ADPH 3TBSA 4TNWF 2P5EE 4DFHA 1GGCH 3RWJB 2X4SB 4PJBF 1OP5H 4ZFGH 2Z93A 1U91A 3ESUF 4D0DB 1A02N 3C87A 3L3IB 4GRLC 4JZNA 4RWHA 4MVBC 3TVMD 4B5EA 3AU1A 1T1WA 5D72H 5IWLC 2VQUA 5FO9B 3IDYB 4JG1H 3QIWC 4XNYL 1U8QA 1NGQL 4Y1AE 5L7XL 4FFZH 1S5IH 3D3VA 3GKZA 2B0SL 5C0EB 1YDPB 3TPUA 1DUZA 4MXWH 3ULSA 3FB5A 2VE6B 3O2WL 2OQJA 5ISZA 4P49A 4OD2B 3ARBC 2ZG3A 5AZEH 4JRXE 2F54B 2AJYH 4XRCB 3SDDC 4JJ5B 2KZWA 2Y06H 3GI8L 3RNQA 5ITBH 2DQFA 1IGTB 4JM2A 2CDFA 1CDYA 1XCQB 2LVEA 4X6EA 3CVHB 4F3FB 3PIQA 3O4LD 2UYLB 1UGNA 2BMKB 3RGVA 4HEME 5B4MC 1CF8H 1I3VA 1KPVA 3TO4B 4M48H 2XZAH 4YEFA 3WV0A 1UENA 5E4IA 5H2BA 3B8SA 1LEIB 2Y36L 5IMOB 2DM3A 4X6CE 5C0GA 4PJAA 4ZTOL 1ODAA 4IMKC 4XCFL 1U92B 1YJDC 1V3JA 4G8FB 4TRPH 4QXWA 5EU5B 3MRQA 4NO5A 2XXMB 4HZLA 3FOMA 3AREA 3E6FA 4E0RA 3EJYC 4HPOL 3RWHA 4X5WB 1G0XA 5J1TC 3CZFB 1ZHBB 4JAMB 4PJ9D 2VDLL 4ORGB 4X98B 4KKBD 3DLQR 4M93B 4QNPE 3DX9A 5E2UL 1K3IA 5C0FA 1Y0LB 5IFAL 1FORL 4X7SH 3DV4A 2BY2A 4GKZA 2PO6B 4OIAA 4TTDC 3PE9A 5DEFB 2HRPH 3FAWA 4HGKC 3I3EA 4OJFH 1KNOB 3BKJH 3D9AL 5EBWB 4JPVL 2AABL 3GMLB 3P77A 2YWYA 3GRWH 3T65A 3F5WA 3P0GB 1NBVH 2JJTA 4PJHE 3ZLQC 5DJCA 2ITDB 4NPYB 3DETC 1H3WM 1ZT4B 5IBTL 3VFNA 4FQQA 3KPRD 2R1WB 3QA3A 5HVHB 3O3BA 2DB8A 3ZE2F 1HHJA 3D39E 3D85D 5CINH 4HC1L 1BVLA 2ED9A 4M4RA 4Y2DB 4YAQB 4QY8A 5ALCL 2PXYB 1VESA 1BBJA 4OCRL 1R24B 1CDIA 3MGAA 1YQ2A 4LSVH 1FP5A 3MBED 5F9OL 1UM4L 1YYMH 1I7RB 3D6GA 4OI7A 1IL1B 3T1WA 1NKRA 4S1DD 5ID0B 1BQUA 5DJ8A 4WIQA 3C08H 4RFNC 3OGCA 3WIFB 4M3JA 3WDIA 2PCPB 1YN7B 5DQ9A 3VCLB 3QNXB 2YD3A 2BVTA 4R0LA 1T04B 5DJ6B 2YEZA 2EDHA 3QI9B 4NQCB 4ZDHA 4YUEH 3GM8A 4DGIL 3ZTJH 3N85H 4WFHD 4CVWA 2VMFA 3E6HA 4ZUVA 1RK1B 4QRTA 5DVKA 3EFFB 2GAZB 3HUJE 3QO0B 1BM3L 3M45A 4LVEA 3SE4A 3QUZA 4NBZB 4G9DB 2ZUTA 2DQDL 3O3DA 3S9DB 5MEPB 3DUUA 3VXPA 3R1GH 1R3IH 2E7LA 1FO0H 3GMQA 2R56H 1GCFA 3CDGB 4WFED 2CJUL 2CSPA 4X5XA 2AJVL 1NGZA 1AJ7H 5B38B 3K1KC 5C0IA 3MUZ1 2OJZL 1TJHL 5CAYB 3KYKH 2UWEF 1G9ML 1YZZA 1WQVT 4EIGB 1YEHL 4R2GC 4YK4B 3HZYB 1KBGH 3GIVB 3UPCA 3DYPA 5E00A 1R5VB 3VI3F 3UYPA 2CKBB 4N0FA 2VITB 1Q9WA 5DUBA 1EMTL 3UTTA 4Q9RL 1U3HA 2GTZA 1QYGH 4G7VL 4TVPE 2VXSH 1CWVA 4O5LL 4GO6B 2H1PH 3AROA 5C0CD 4IRSD 1RIVH 4XNUL 2NY6C 5IMMA 2VISB 1JTTA 5INDA 1IJ9A 5F7UA 1WBXB 3WNPA 1X5XA 1IC4H 3VXTB 2I9LA 1HI6B 3N1PC 4N90E 1DQQA 1J10A 4X80H 3EOAB 1BQHB 2O5XL 4X6FB 1JZ8A 4M7LH 2VDRH 3EW3B 3TO2A 4APQB 1RUML 3TO4C 5A2IH 1LP9E 4XCCL 2BVUA 5FFLA 3V6ZA 2Q7NA 4LCIL 1F4XH 1X5YA 5E94A 1WF5A 4CJ0A 3MLYL 4UIKL 1NGZB 4HS3A 1JHLH 3IS0X 1IE5A 4TSCH 2FIKA 3CXDH 3JVGC 3P11L 3QFDB 5C09E 4YDLC 3DUUB 4E9LA 3ZHKA 1P4LA 2XRAH 3M1BA 3RUGA 3TA3A 3P0VL 3HR6A 5DS8B 5IVZB 3JWOC 2IPTL 2WQRA 2X4RA 4GW5A 4QRTB 4XPFH 5B4MD 3IDMB 3O3EA 1S9XA 1AQDB 3WNOA 3ZHDA 3FO9A 3IFPA 5T5NF 4OM1L 5IB2B 5E8EB 2FZ3A 4M61A 3DOSA 1KV3A 3OAYH 1HKLL 4C4KT 1JGUL 4KRMB 3A6CH 4G5ZL 2VLKA 5FYKU 2BSED 3OAZH 5GISL 3STLA 3ARDD 1LK2A 3CSPA 2APXA 1MRFH 4WGVB 4KRNA 3PP3K 3W11C 4KTYA 1FNAA 1DBJH 2KBGA 4XP1L 5FHBL 1OL0A 1KJ2H 5I15L 3UTTE 3D18A 4PRPB 1JPTH 3FQUB 2GSGA 1HEZB 3L95A 1T0PB 4YR6B 3QCTH 2PW2B 4W6WB 2X4NB 1C5DA 3UP1A 4BFIA 4ZFOA 3KLDA 5C0ND 1XCTA 1RJLB 3QI9C 5DS8A 5C1MB 3GGWB 3CLEH 4MNGA 4KI5C 3IFNH 5LQBH 3MMEA 5EUKB 2F53B 4OZIA 3TIDA 4HCRL 4HEPG 1JGDB 1JGVH 2QL1A 4TUKL 4POYA 5DJAB 4JLRA 3H7BB 1RUKL 5I74B 3UTSB 1PKQE 1HHIA