1TETL

Crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCKSSQSIVHSSGNTYFEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYEWHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an anticholera toxin peptide complex at 2.3 A.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG1 TE33 FAB (LIGHT CHAIN)
total genus 51
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL01
4JO1H 1GJIA 2R23A 4EDXA 5CMAA 4F3FA 1A1MA 5CBEB 4CDHA 2CXKA 3QXWA 3P40A 2X4NA 2YD6A 3LRGA 2A6IB 5AG8A 1LEGB 1JP5A 2Y5EA 1MFNA 1ED3B 3RAJH 4R3SA 2QHLA 5DDHB 3LS4H 3VXMB 3MV9B 3RL1B 3ZO0A 5DUBB 4PJGB 4EJ1C 3SGKC 4PRDA 4IRSD 1A9BB 5JXAL 4LLDA 1S7WA 5KANI 3EIFA 1IFHH 4HUKB 1UKTA 1U41A 3IDJB 2OL3B 4HZLB 4ZDHB 3QXAB 3NCMA 3T0VA 5C0AB 4Q97A 3BO8A 2W59A 3V6FB 4HFWA 3V79C 3BE1L 1I3UA 3B3IB 2AXJA 3ES6A 4OSUH 1MHPH 1XGYH 3RVVC 5IM7B 2NY3C 1PSKH 4X5WB 1BM3H 3H9ZA 5KANG 3M17A 1CXLA 3DHJA 4HT1H 3IFPB 3QEHA 3WLWD 5D5ME 4XI5D 4GXVH 1EUUA 3OXRA 5DTFB 2FATH 5BVPH 3LV3A 4X6DA 2PXYD 5T1KD 2BRQA 4NN7B 3UX9B 1FZJA 1I1AB 3HC0B 4QLRA 3O4LE 4XCCL 1HSBA 1JGLL 2V2XB 4JFED 1CFQB 3CDGA 4HXBH 4ZFFA 4MA8L 2YKLL 3BEWA 4M1GL 3PQYD 4HUMB 4K23H 1P84J 3Q1SH 4XI5C 1F8TL 1T0NB 3RDTD 4RAUB 1G7IB 5JHLL 1EAJA 1AIFB 3QDJE 4ORGA 4LRNL 4WGWB 4PJ7B 3QRFM 4U1GB 1CT8A 3OXSB 2DLFH 1EXUB 1IGIH 1LEGA 1FNFA 4TULH 2EDKA 1TZIB 5JZ7C 5EIIB 2BSED 2VNCA 2MCPL 1I9JH 5MEPB 4KKCD 1NEZA 1ZMYA 4IDJL 2XWBA 4FXKA 1PG7X 2FSEB 5DS8B 4LDLB 1QUNA 5BZWB 5K9KA 3QWRA 4LLDB 4ONGL 4UT9L 1D5ZB 2NY0B 5LGHH 5DFWH 3C5SA 2QHRL 3R1GL 3REVA 3SBWC 3LOWA 5E5MA 1RY7B 4OLYH 2QSCH 1ACYL 4Z7UF 2ARJB 1YY8B 5DYOB 5C0JA 1D5MB 3BYYA 5D1QD 4BK5A 4FNLL 1U8JA 3FQWA 5IB5A 3EYQC 2W0LA 3EYVB 2D03H 4MQ7B 3BN9D 3SGDH 2BCKB 2C7UB 3FOLB 1D5XA 2X4SA 1HI6A 5JTWA 1MIMH 3BN9C 2XOTA 3DV6B 4R8WL 3TC9A 3SDCB 2BNRD 4OSUL 3QXTA 3D39E 1MJUH 3MRQB 4NQEB 4OZHE 4YXHH 3QH3B 4KTEL 3GEWB 4WFGD 5IB4B 2P5ED 2Q86A 3N1PC 1AKJA 4P5KA 4MXWL 1FO0L 1M7DA 3KPOA 3D39B 4OZHB 1LWRA 5EBGA 3IVKA 4OCYH 1HSBB 4JRXB 1J0YA 5BOZG 1I7TB 5D9SB 9CGTA 2GFBB 1KN4L 2GSIB 3BJLA 2VDOH 5I1AB 2F53A 1G7LA 4PRPE 5D72H 5DT1H 5DMIL 4BKLB 3VXSE 4J6RH 1XFPA 2B5IB 2A9NH 4JO1L 4KQ4H 2A0LC 2NPLX 2JLLA 1UWXK 5EZLA 1MQ8A 3OAYK 1L7TH 1QACA 1G9NL 1S9YA 3MV7B 2ENSA 2P5WA 5TQ2L 3NZHL 3TYGL 3N1FC 1HHHB 5DD1H 2Z35A 3KYKH 3ARGB 3MJGX 3MA7A 3MRIA 4RWHA 5EOQL 4G7VL 3RL2B 3HE7A 3MX0A 3DGCR 1UWEL 1NQBA 4MD0A 4JREC 3FFCA 4XMKH 4LKCB 1R3KB 4GKNB 4AIOA 3CFEA 1KIQB 4PTUB 2AJSH 3M8OH 4HBCH 3B5TA 3GSXB 3OZ9H 2DAVA 3O81A 4L4TA 4WNQB 2DM7A 2XYCA 5MERB 3QUMH 1DUZB 5KSAB 4P9HL 2QADD 5J13C 5IMMB 1NGQH 3VGAB 4LVNB 1AI1H 2VN7A 1QFWM 4F7EB 3TH4T 2DQUH 1I1YB 2JJTC 1PYWA 2PYED 3CX5K 3KR3L 2C7UA 1G7PB 4JVWA 5ITFB 4OT1H 5DC9B 3DSFL 4XNXH 5B8CA 3ULVH 4KK6D 1EFXD 1Z9LA 3V6BR 1ZE3C 4JFOA 1UXSB 3PGDA 4YHIB 2BNQD 4H1LA 5IKCB 5HPOA 1BVKA 3GMQA 2APFA 3PF2A 4GKOA 2VDML 5IK3B 1BBDH 4R2GC 3VFWA 1J8HA 3H3PL 1IAII 4Z7WA 2CQVA 3V52H 1EEZA 3RKDD 5LCVH 2LVEA 5GSRA 1I7TA 3S37H 1P7KB 2IH3B 3V5DB 1C1EH 3SBWA 4F33A 1YQVH 3BKYH 2HFFB 4WEBL 1C5CH 1OAXL 2GJ6B 3WJJA 1RZJH 3E6FA 4UDUA 2DIBA 3SGEI 1QQDB 2H45A 3T0EE 3L3HA 3LIZL 2HTLC 3RWEA 2C5DC 4Z95H 4NNYB 5DGRA 2UUDK 2CO7B 2W9EH 5F88A 5CEZD 4TSBL 1TJGH 4XBPB 4F9LC 4XP5H 2YPLE 4O00A 3VFTA 4G8IB 4A6YL 3X12A 3VXUD 4YUEH 5ETUA 3K2UH 3VXNB 2NY1D 3D3VE 3WSQH 1U92A 2Z31A 2ZWLT 3OAZH 3LB6C 5CIPH 1P9MC 1UH4A 3KVQA 1V3JA 4S2SA 1F11B 5ESVB 3HS0B 5I9QB 1F2XK 2NW2A 3D9AL 3VRJA 4U1KB 3D3VB 5ADPL 5T3XE 5I6XC 4M62H 3DROB 3IETB 1TZHA 4R26H 3WKNA 2HJFB 3W9EB 2XN9D 4TUOA 2EDJA 4G7YL 3QHFH 3OKDB 4ORZC 3E3QC 5T3ZE 1OCWL 1G0YR 2E6QA 4FQJL 3BUYB 3QHZL 1H3XA 3R8BB 4OFKA 2YHGA 1PJ9A 4TTGA 5IMOA 4M00A 5AWNL 2VXQH 3RVWC 5F9JB 1F4AA 1CFTB 5D7LD 2WUCH 1YQVL 3P77A 3QB7C 5B39G 4PGEB 5DD0L 3BIKA 4H20L 3PABB 4I4WA 1T1YA 3VGDA 1BZ9A 3RVTC 4FTVE 3UTSE 4HUWB 3CFCL 3UJJH 4KAQH 4M6NL 1FLRL 3GSNA 1CFVH 2B2XH 4UT7H 4QRQA 1ORSA 1YEIH 4U33A 4PP1C 5GRZA 2VLRB 4LKCA 3PWNB 3N1GC 3VDCA 4KKAC 1F3RB 2Y07H 5GRJH 2DN7A 4MMXC 1W72L 3H7BA 1JZ6A 2A77L 1QFWL 1FC2D 2Z8RA 3QQ9C 5EB9A 3BHBB 4FABL 2WBJB 1L7TL 4K9EL 2NY2C 3RIAF 5J0BA 4G6MH 4J12A 1X5YA 1YN6B 4ZO9A 3O3EB 5SWSE 5HVHC 4ZODA 4YO0B 3C8KB 5DVKA 2QTEA 4FMFA 2Z93B 5IB5B 1YECH 2QEJA 5IBLD 3O9WC 4C83B 3DECA 4OGAD 5FOBA 3HI5L 3LEVL 3FB7A 1DL7H 2NW2B 3UZQA 3GMQB 5JIKA 3SE9L 1I85A 2W0PA 1JFQL 1JF5A 2WWMC 3ROLB 3QZWB 3VA6A 1BZ7B 4G80A 4LQFH 4F37K 4Z7WB 4XP9L 4HUUB 1G7JB 2ATKA 2IGFL 5IQ9B 1ZS8B 2F19H 4BA8A 4PGZA 4XXDB 3DOSA 2KDGA 2D9CA 2BNUB 1KACB 3LSOB 4XP6H 43C9A 5DQDL 3QG7H 2VE6A 4O4YH 4RBPH 1XMWA 1BOGA 4I0KA 2BNQA 3P77B 3FMGL 4Y4FD 3TH3T 5I8KH 5IR1B 3JV4A 3MACH 4QRUA 4PJAB 4HJJL 2F53E 1OSZA 3WUWA 4PJ5A 3A0OA 2Q8AH 1U95A 5D1XD 3L9RB 1AGDB 4MJIA 4E5XB 2F74B 3HA0A 3OJMB 1DZBA 3L3KB 4Y19B 4QF1B 3IS1X 4NRXA 3S96B 1XGTB 2AI0L 4X80L 3D18A 1KIQA 2Z0BA 5DF0A 4XGZB 1IKNC 5CWSB 1I7RA 5CP7B 3OB8A 2YD4A 2ZCHH 5MEOB 4POZD 3MXWL 4JN1L 3GJFH 4N0RA 5GQBA 4GW4B 3HE7C 2D7OA 2G9HA 5F6HI 3LKQA 5JDSB 1L6XA 1J0HA 4FP8H 5FYKU 4UNVA 5D1XB 3BPCA 3AU1B 1FZOB 1PAMA 2NR6D 3ARFC 4P4RA 1ZLWH 3S4SA 4OLXL 2HLAB 1F3JA 3M1BA 4WFED 5IFJB 5F9DC 5MHSE 4ODBD 1JPFB 1AXSA 1ZA3A 3NFSL 2XZAL 1F5WA 1ZSDA 4X6BB 4WV1B 1UH3A 3VWJC 2HWZH 5E0QA 4HC1L 4TSAL 1LO0L 2F53D 1DLFL 2FCBA 1A0QH 1CXHA 2XZCH 5GSRB 3WFDL 5HVHB 3E0GA 1KTLA 3K8MA 2CRZA 4J4PD 5D2LE 2AXFA 4HIJB 1ORQA 1A1NB 2MPAH 3U0PB 1NAKL 5KSBA 3VMNA 4YHMH 3NZ8A 3KPSE 1FNGB 1OGAB 4U6XB 2QQLL 4F7CB 4XCCH 1DVFC 3OKKB 4P4KB 3GDBA 4AM0A 3KPRB 1KJ3L 3J8F7 2WK2A 1UEMA 3IT8D 4WO4D 3RKPA 1NBVH 3SCMA 4Z7WF 4G6KL 1IAMA 1IGML 2AEQH 1FNSH 4QXTB 1CLZL 3NPSC 3WIFA 2A1WH 3NBNA 1KB5L 3QI9D 4LOUC 4LSSL 3ARZA 3QIWC 4D9LL 2N56A 1YNLL 3MLSL 1M4KA 5KOMC 1DBMH 5TGBA 5K9QG 5E1AB 3O11B 4YBLC 3LKPB 3SGJC 4DUXA 1MUJB 4Y4HD 2OI9C 5EO0A 1J87A 4BZYA 1NC2B 1JRHH 4ZQKB 4E41E 4OQ1A 3O2VH 1JUFB 1GSMA 2M26A 1A6VL 3UZVB 1EVUA 4K7PY 1KV3A 5DSCB 5CKGA 5K59E 4CVUA 2R8SH 1EO5A 3OR7B 4X6FA 5DZNA 5DJ2B 3RDTA 1AXSB 4LP5A 2R69H 4OZFH 5EH1A 5E8NB 2J8UA 3N1QC 3QIUB 5EOQH 2C4FT 5DRZA 2NY5C 2RR3A 3T2PA 5I8CA 3C2AH 4G43B 3GI8H 1ZV5A 2CKNA 4GRWB 5D7LE 4PJDB 3V6ZA 5DRNB 3T3PF 3KLHC 4TUJB 1NEZB 2P45B 3NIFE 4K71C 4M43H 2JF1A 4PP1D 3TBWA 2PXYA 3CK0H 2BJML 4FQXA 2RCSL 4D9LH 1CE1H 1FGNH 3IDXL 3MCG1 3B9KC 4KRPD 3BH8A 4Y16C 2OMBA 3LCYA 1CXFA 2NXZB 3QDMB 2ZSWB 5DD5H 5IB1B 3NAAL 1G7HA 5B39B 1OAZH 2W0FB 4MX7A 1FV1A 2VQ1A 3UROR 3QDJD 5E5RB 1U8OA 3UTQA 2VLKD 1IEBA 3IU4L 4M5ZH 2PTVA 1HIML 1H3TA 2CR6A 4JQXA 4L8BA 3KNBA 3UXFA 4OZGF 1IM9B 3UJJL 4C83A 4JY6B 1FFOB 4KHTL 4GMSH 1U8IA 2IG2L 4LSQH 4ETQA 1JPFA 4WUUB 4LGSB 2A83B 5GS1B 4CVXA 1KUMA 3B4NA 3AFLA 5GGUB 1FL3A 1D9KB 1MCIA 4P48A 1FYTD 1U2CA 2R1XB 1P6AB 1NC2A 1HK6A 1OCWH 1A6AA 4NT6B 1HWHB 4PJEA 2E7LC 1YYLH 1UKQA 4Z7UA 4NQXA 1CDYA 1I7UB 1CLOH 3PP4H 4R0LC 3SPVA 1T4KA 4XHQA 1J0KA 3HNSL 1XIWA 2XACC 2FD6L 5C0AA 1BJMA 4NZTL 5L6YL 3AMKA 5CD5D 1H15B 3X3GH 2DMBA 3B5HA 4YHPA 1JTPA 4NM4L 5DUML 1XGPA 4WUKH 4UTBL 2PYEB 1W2KT 3VXQA 1NFIB 2FWOA 1LE5A 2QADB 5JHLH 3VRIB 4XH2A 4JDVB 4OM0H 5I19L 5JO5A 1DQQA 2FYYA 2A0LD 1MEXH 1UCTA 4OFDA 4ELMB 2M2DA 3RJQB 4MA8H 1X5GA 3GHBL 2XG4A 1LK2A 3E3QE 4OGZA 4LPWA 2EXYD 5DJ8B 4R96B 1MRCL 4M9PA 5D96C 1Y6MR 4S1QL 3IDGB 4LSVH 4Y0GA 3QDGE 3NH7H 1OF2B 3LDBB 4KMLB 1P4IH 1DQMH 3IVKB 4NQSA 25C8L 4WWKD 4LIQL 1KEMH 3MLWL 3EOTH 3WL9B 4CAGA 4UV4H 4ENED 3EO0A 4DGIL 2R2HB 1BBJB 1UACL 2UZIH 1QHOA 3BGMA 1NUDA 3SQBA 3KDMB 2GJZB 4OZIB 5E2WH 1M71A 1BM3L 4LRIC 1PEZA 5IBTH 1R3JB 4GAGL 4UBDC 5DQJA 1AO7E 3C5JB 3QCTL 4QRUB 2F19L 3ZMRA 3UTOA 1YMHA 2XKSA 2I9LB 1TNMA 4ZNCD 2J8OA 3MA7B 3MRIB 1NEUA 1CE1L 1FGNL 3QPXH 4X5XB 2YUXA 4TUJA 3L3OA 3CU7A 2OJZH 1HINH 2FGZA 4KHXH 3TGXA 2PUQT 5F7NC 4QHLB 1S7SA 1U91A 4FQXB 3D0LB 5GGVL 4HH9B 1PVHA 2NXZD 3U0PA 1QEWA 2VLKE 4AY0A 1HILA 1CN4A 5JQHC 3EFFA 4KRPB 3MV01 5F9OL 4QRRA 2DQHH 4NQTA 4YPGA 1MJ7H 3UO1L 5IV2A 5DC0A 4NM8L 1VCAA 4X6DB 3TZVD 4Y5YC 1S7TA 4KJQD 5IMMA 3RFZC 2P42B 5KSBE 5D2NC 2J88L 3UTQB 2C26A 3IRPX 2PR4L 4Z77A 1T20A 2EICA 5FO8A 5IVNA 1YEHL 1QFWH 3OKEB 5GRYA 5J11B 2QKIA 4YGAB 1U8HA 1ZKAA 2N4IA 4NZRH 4JKLA 4NQEA 1CTOA 4OLUL 2B39A 4Z7QF 1JCKA 4BFIA 1A64A 1WZ1L 3IS0X 1HDMB 1IGFH 4O51B 4DKDC 1FL3B 2VLJE 4JO2H 3SE3C 5DMIH 2ARWA 5ISZA 1MHHA 1M7IB 3PP3K 3PWVB 3W9EA 2A1WL 1NC2D 4KI5C 3OF6D 3V0VB 5KW9L 3WL9A 2IPTL 4U6YB 1FZKB 1ZT7B 2EYRA 1A4KB 5FUOH 3RDTB 1F13A 1TENA 3EO9L 4OI7A 4M8VA 1LQSR 2Q20A 5T1MB 3OKKA 1S78D 1L0QA 2I60L 5F1NA 4X6CF 4NN6B 5CCKH 3KPRD 4PYGA 2ZG1A 1FL6B 4DTGL 5DVOA 1PBYA 1VADB 4KI1A 2PXYB 4W6XB 4S1RH 2VZTA 3TVMC 1OGAD 2CMRL 4LCCC 3V95A 1YQ2A 1WK0A 3QQNA 1BIHA 5CJXA 5CJ5A 5JR1L 1QYGL 2FHBA 3K2UL 3MLUL 3WSQL 3IAQA 4Z7NF 1NUNB 4Z78A 4PJCE 1UGNA 1OSPL 3HRPA 5F7HA 1ES0B 3GK8H 1J0ZA 2X89D 1JZ4A 3ZE1E 4NQDA 4JGMA 3R4DA 3W5NA 2FZ3B 2VXUH 5F1IA 2GHWB 3SY0B 5CLWA 1E4KC 2BVQB 2YEZB 3I2CH 5DK0A 3RZCC 1HH6B 4Y4KA 2AK4A 5F9JA 2E8YA 1E28B 5GRVK 3X13B 4LRNH 3C09B 3EFDL 3CX5J 1R3JA 4IOIA 4LCWA 4AL8H 1MHEB 2CUIA 3JVGA 4KXZI 3QFJB 3ZHDA 4YHKL 1M7XA 2H2SC 1MFDH 4I3SH 5IW1A 3TBVA 1DLHB 5ESQB 4OLWL 1W0VA 4M1GH 4KVCH 4G9FE 3DLQR 3HCVA 3KXFB 5FCSH 1MCWM 3S36H 3SKJL 3O45B 1FDLL 5TPWL 3HNSH 1DVFA 1I9EA 3MOBH 3WHXB 4P2YA 3Q5YA 4N5UA 2I07B 3DRQA 1PEWA 1B4RA 1KXVC 2OR9H 1BHGA 3QAZC 3DXAB 4LSRH 3I02B 5J11C 5JLZA 1AR1C 3QI9A 5BVPL 1CGWA 5FKAB 1PLGH 3KYMB 2NXYB 4F2MB 3OWEA 1XR9A 5FEBA 1A6ZB 1NGQL 3QG7L 2UWEB 2VDNH 2C3XA 2VR9A 4MWFB 1XF1A 5D7IA 3OJDA 5L2KD 3PWLA 1B88A 1MELA 1NKRA 4NQCB 3O6KH 4LFHD 2QKIB 3U30C 2OR8A 2FYYB 4K3EL 3RHWF 2HKHH 4Y4FB 4DZ8B 1HIMH 2ZUXA 2R69L 3GSVB 5FUZL 3QIWD 3TJHC 3KLAB 1QLRA 2JIXB 4WW2F 2RB8A 5J6HA 3K0WA 4ELKB 3MRDB 3OPZL 1NCTA 1TETL 2XTJB 2Z4QB 2AV7B 2ILLA 3PWVA 4PGBB 3TPKA 1A6VH 4NKMB 4HX1A 3VFUA 4F7TA 1IAIH 1A3RH 3FL7A 5F3BB 3V4UH 35C8H 4LLUA 1MOEA 3H6JA 4U6VH 2X4UB 1XF2B 1X5XA 2A9NL 1KXQE 4KQ4L 2BRRH 3X11A 1KCSL 4RFNC 5CJXC 3X17A 3PWUB 3L6FB 2PXYC 4J8RA 4XX1G 3U30B 3KAAA 2EYSA 3RWEB 3NIDE 2HKFH 1ONQB 3DV4B 2J1KA 4HEME 2I26N 2XFXB 1CGSH 1WAAE 1ZHLA 1IGMH 2AEQL 2AJ3A 5H94B 3ALPA 3GBLA 3VXQB 3OR6A 4F57L 1T80A 5BV7B 3DI2B 5HGBA 1AO7A 3PL6D 1BX2A 4ZFZB 3U7YH 2W91A 4KTEH 5I15H 3BZ4A 4GW5B 2EDBA 4Q7DA 2PTTA 1NFDE 3CPLB 1NCWL 4MLSA 4OZIF 3O2WL 3I6LD 1FCGA 3P0VH 2QADC 3RVUC 4JM2B 3DVGA 4MJ6B 1S8DB 3P73B 3KYOB 4NBYB 1OPGH 1DQTA 3I9GL 1F45A 5FAAA 1J0IA 2VDNL 3MOAL 2ADGA 2VMFA 4AEEA 4XPAH 4HS3A 3BVNB 2Z93A 5ENWA 3BEWB 5SWSB 3RWJB 3I6GA 2GJJA 4NFCA 4G6FB 1W8OA 1L6ZA 1VHPA 4ZUSA 1NBVL 5C0CD 2XZAH 4LCYA 3ZZ1A 3KPMA 2A9MH 4RFOH 3PDDA 4PJXE 4U1SB 5TPWH 2JB5H 4MNGA 1RZGB 2R0LL 4MQTB 5FDWB 5T5FL 4FXLA 1IQWL 3AC0A 1NUGA 4Z76B 2VXTL 3ET9F 5ISZB 1RJLB 1ZLSL 1FORH 4Y1AA 4HX1B 3VFUB 3OHXA 3U82B 4Z7QE 1FIGL 1C5BL 4JRYA 2F58L 3V0VA 1JZ8A 3MRJA 3FQRB 1OW0C 2DIJA 5GS1C 1OVZA 1QEWB 1RZKH 2LABA 3PWUA 3C60C 3VH8A 4Z8FL 3PHOA 3RUGB 3T77B 3TO4A 1YN6A 3VMOA 4JFHD 4W4OA 4DQOH 1E6OH 2NY1B 4HK0A 3PWPE 3L7FB 3ARGA 1A7RH 4RFOL 2PTUA 3FQXA 1ITBB 4KKLC 3ILQD 4L3ED 3MV7E 4Y19A 3BAEL 4HAFA 1WJ3A 3TV3H 5IB2A 4NDMA 3IDNB 2X70A 3N9GH 1YN7A 4GXVL 4M1CC 1FPTH 1J8KA 3D25A 4RISH 3GSOB 1U3HD 4YDVB 4L4VD 4M1CD 5BRZE 3G9VA 2HMIC 4MNQA 2Y25A 4MQXC 4QNPE 5CBEA 3AM8A 3RIFF 2EDRA 1T89C 4LLQA 5D7SL 1OPGL 4I0PC 4GKZB 3OAZK 2RQ8A 2CDGA 2D4FA 3QNXA 4LAQL 4MSWB 1T83C 3MREA 1G1YA 5DD6A 5C09A 4OLVL 5GJSL 5B4MD 4P3DA 4ODXB 3K1DA 3QO0A 1A14L 1UWGL 1HNGA 1Y6KR 2J3SA 4NQDE 4OCWH 5HDQH 4HKXB 3WHE1 1H3GA 4HK3N 3FKUS 3WNPA 3GIZH 2FIKB 4KFZC 4GAFB 1IZKA 4YHYC 4PB0L 2PO6A 2UVFA 2LVCA 5I2IA 1UEYA 4NUGL 4HIIA 3GSRA 1DFBH 5JXED 3WD5H 4EDWH 4NQVA 2JIXD 5TH2A 4LVHB 1INEL 4L4VA 1U3HA 2G60L 1Z5LA 1UZ8A 2JTDA 4X7DC 5GISH 1WT5A 3FO9A 1K4CA 1WUNT 3U6RB 3MGOB 2FEDD 4KJWC 3NZ8B 3TYGH 1CZ8L 4FFZL 4G6JH 4LAJH 3WJJC 4FFVC 4KJWD 2PKDA 5E00A 5FKAA 2Y1VA 4QTHB 5BVJB 1T2QH 2YZ1A 3WIIL 4HK0B 4L3EA 4Z0BL 5C0JB 5E6IA 4M5YL 1BVLA 4X9HA 4NGHL 4XCYA 3ARGD 5DEZA 2B1AH 4F7MA 3BW9B 4ZSOE 5F9OH 3ULSA 3UTTA 4IRJC 3WIFB 4YDIH 4D8PA 1T66C 3T1FB 2Y5TA 3DXAD 2ZOLB 1T7ZA 2Y4SA 3D25B 2AAVA 4JVUA 4TOYH 3GSQB 1C16B 5L0QB 2WLZA 3K80A 3TCLA 3MLXH 2R1XA 3HCVB 4LLYB 1ZT1A 2GW5A 1OWRM 1SJEB 2AXGA 3ZYOA 2ITCA 4LDEB 4HBQA 3G5VA 4OCXH 1IQDA 5GRWA 3EDDA 2HG5A 4JQVC 2NY2B 3KHQA 5D7SH 4JJ5B 5C0CA 2ZOKA 3BQUB 5BS0D 2JK5A 1N6UA 1T04B 4PJIA 4NC1E 4KV5E 1INDL 3EOTL 1AC0A 1P7HL 1HYRC 3SKJH 4NNYA 5E8NA 3TBYB 5L7XH 4LSTH 2EDHA 4YDLB 4JFZL 4PRBB 4KVCL 4QCIA 4RIRB 25C8H 4WW2C 4MAYA 2AS5M 4Y5VA 2FBJL 1A7PL 2EE6A 3O0RH 1UENA 4ODWB 2P8MA 4AL8L 3QIUC 4UI2A 2FO4A 1ZA6A 4JB9H 4QTIL 2COQA 2P5WE 1R3KA 4GKNA 1S7SB 1U91B 1CD1A 2YPKA 4PJ9A 3O4LB 1IGIL 1LE9A 3TBTA 3IFOB 3MLPA 5MENA 2NY0D 3JUZA 4QRSA 4R96A 1Q94A 2X2YA 2OQJA 1N26A 2ERJC 3GKWH 5LQBL 3BRFA 5E1AA 1PD6A 3PL6A 3CFJA 3U0TA 1WF5A 1UWGH 3R0NA 1TZHB 3PJSA 4GKZA 5T3ZH 5EOTB 3HZVA 3U9PL 4ONFH 3D6GA 5EA0L 3X3GL 4LL9A 3QDME 3O8XA 4KK5D 5DXWA 3NIGE 3LEXB 1Z3GH 4WW2B 5DURB 2R9HD 5D1ZA 4EN3A 3EYSL 3P9MA 4MD5A 2VABB 1CD8A 4KZDL 2JCCA 5C0EB 2VDMH 4HQQL 3IFNH 4RMSA 5FXCH 2EKSB 1AP2B 5A3IC 1LDSA 2MJWA 5FYJU 1HZHL 4J3TA 4X7SL 3FRPG 1NMCC 4JHAH 4YC2B 4PJDF 1CXEA 2ZNWA 3ME0A 1JNLH 4AQ1B 1VKXB 1Q9LA 1KG0B 2HN7B 1G6RH 5F72S 4HT1L 4K7FA 5FA3B 1FL5B 3T08A 4MD0B 1YNKH 4OBSA 5T1KB 2EIDA 4QEGA 1Z5LB 3D0VB 3C8DA 3HAEB 4WI4A 3L5WB 1QRKA 5EO1B 1WBXB 3O4LD 4ZYKA 5CJ8A 1KT2B 3QNYA 5FF6A 4YHOL 3VW3L 3SDXF 4UIKL 2YA2A 3ES6B 4NN5C 4IM8A 3E2HB 1AE6L 4AH2B 3L9RA 2ED7A 4MJ5B 1F90L 3QUYA 3D1MC 3FONB 1IEBB 5D1QA 5EFIA 3WFCH 3LQAH 3DRTB 4NZDA 2ICWI 3V6OE 3QFDB 5E8DH 1DQLL 1IM9A 3DSNA 4EQ2A 2XKNB 5I74C 1T1WA 4U1IB 4IS6B 3RQ3A 3WKML 4WTWA 2R56H 3H3BC 1B3JA 5L9DH 3QWRD 4M43L 1MVUB 2XA3A 1E4WL 3MRKA 3ARFA 5BMFH 4JPKH 2C1OA 1SVZA 4HWZB 3ZT7A 4Y2DB 4MGXA 3G6DH 3MV8E 3QUZD 3NN8A 3FFDB 4C54A 4EUPA 3QNXB 4DAGH 2YBRA 4RDQG 4ZFFB 1G1CA 3BDBA 2Q7YA 4GRMA 4F9PA 1VESA 3MOAH 4U6YA 1I8MA 1T1ZA 4ZPVB 5JORA 5L2KE 4J7RA 1T04A 4PJIB 5DHYB 3GI9L 5M95B 5GGRY 1X44A 2MQ3A 4RWYL 1U8NB 3VRLF 3T8XB 4PV9B 1RIVH 4Z7UE 1NBYB 2A6JA 1HHJB 4O2FB 4PJFA 3HFMH 5DHXB 4K7PX 3NZHH 3QCTH 2B7DT 1G9NH 1H3VA 5EOCH 4Y2DD 3ULVE 3X12B 1RHHB 4ODTH 1ZHBB 3LS5H 1OGTA 3K4AA 1CDJA 1LP9F 5T1KA 2ICEB 3IFPA 5C0BD 1FN4B 1E0OB 2AQ2A 2WBJC 1GXEA 4CMHB 4LIQH 1WISA 5AYUH 3TA3D 4N8VA 4DEPB 5E9DA 1BFVH 1P4IL 4OLEA 4ONGH 3HUJB 2GIYA 4E42A 1QFOA 4GG8B 5DHVB 4XPHL 3F6IA 4HG4J 2VZSA 4W68A 5DJYA 2H26A 2Q76B 5DRWA 1P7QB 5DUPL 2CLVA 5C08A 1OL0A 4R4NC 4YHML 5SWZD 1DANT 1MCCA 3RIAK 5IFJA 2WINA 1TTGA 2E7HA 3C60B 1FHGA 4KPHL 2H2PD 3LH2L 2D03L 4CUCA 4MD4B 1JWMB 5ANMA 4O58L 2R23B 5IW1B 5CMAB 4EDXB 1MUJA 3A6CH 2BHZA 5DVLA 4ZUWA 4YNYA 2CLRA 3KJ4B 4APQD 4ERSH 1UB5A 2YD5A 5I2IB 3O6KL 3RNKB 2HWZL 5C8JA 3LDBC 4XC1H 2D7QA 3QYCA 1MFAH 4FQIL 4FRWA 1ADQL 3OG4B 4BH8B 2EZ0C 3LKRA 3U2SB 1KFAL 5SV4A 2GUOB 3ARDB 4UNUA 3ZE0E 1P1ZB 4ODSL 2AEPL 3BO8B 5JA9A 3TBYA 3DMMA 1KCVH 3DIFA 5DURD 2QJDA 3HRZB 3OKNB 2CMRH 3GMNB 4R2GD 1UCBL 4Y5VB 1VPOL 3BDXA 4K07A 5IT2H 4APQC 4G8EA 2G5RA 2X10A 1MCFA 2VR5A 3TZVA 2IG2H 1FFRA 1XGRB 2C3VA 1SYVA 1LVEA 1FNAA 3RWGA 3BXNB 1RIHH 5IHBA 3BQUC 4QRPD 5I1KL 4BFIB 2B4CC 1GHFH 4FQXC 5FUOL 3EFDH 1C12B 3QXUA 2BOBA 2V9RA 3BKJL 1IFHL 5FGCB 2NY5L 3MJ6A 5KVFH 1Z0MA 3ARBC 1IC1A 4U0QB 1KIRA 4I8DA 4PREB 1I1AC 1HEZB 3CDGB 4PJGA 1J1OH 1GGBL 3F7PC 5E94B 3QIUD 3RWJA 3DUSB 4JCLA 5DQDH 5GPRA 4HKZA 2VKWA 5C0CB 3DGGA 3IJHB 2XN9E 4H8WH 4XNUL 4JY4B 1AIFA 4J8RB 4JJHA 2NY2D 1I75A 1N2RB 2C4FU 1WWAX 4NHCL 4PRIE 4V1DE 3QFJA 2VDLL 3RWCA 1DE4A 4D9QD 1VERA 1KLUB 1XGYL 3MO1A 5ACLA 1RURH 2JCCE 4LSUH 1RIVL 4WWKA 4JY5H 3OHXB 4YWGH 5CZKA 4P2OA 3WO4B 1T3FA 3G5YA 3H42H 4Y4HB 3MBEA 3O9WD 3QEUB 3NFNA 5HHMD 1H0DA 4L8DA 4JM2D 2R8SL 1A3LH 1CD1B 4CMHC 4U1GC 1XH3B 2G5BA 1MPAH 4P2QE 3C5SB 1OAUL 3MZTA 5FUCC 3QI9B 3WUWG 1UVQA 3VU2A 1HKLL 5C6TH 1V7NL 4NO0D 5GGVH 4WO4B 1FAIL 3HHRB 5JIIA 4ZS6D 1BFVL 1H3PL 5EZJA 3VMPA 3VXNA 4AG4H 1YNLH 1HXYB 1PW3A 5IOPB 3S4SB 5SWSA 2X41A 5JHDD 1KB5H 3LKOA 5T1LA 3BXNA 4ZO8A 1JZ2A 3FQUA 1DSFH 1RQ5A 5TF0A 5J8OA 5LKNA 2OTUA 5F7EL 4C56A 5TGBB 5SWQA 4OD3H 1WZ1H 2FJGA 1DSFL 1FNLA 5EWIL 1DN2A 2VB5A 3MRKB 5D5MA 2BVEA 3SDXE 4IBLT 3IETA 4FA8A 3EO1A 1WZKA 4WHYH 1I4FA 5DO2D 4GMTH 2CKBH 3HUJF 1U3YA 2BOCB 1BAFL 3T0WA 3V5DA 5C8JB 3S88L 2AJXH 3BD4A 5I1JL 4MNHA 1Q1JL 1UJTA 1ZT4A 2BK8A 4S1DC 1AGEA 4RA3A 3NGBB 1LEIA 3N50A 3NCJH 4FS0A 4Z5RB 4MDJB 4ODHL 4NM8H 2B8OT 3MUJA 2IJ0C 3PP3H 3SO3B 1KBGL 1BFSA 3RZCB 5JHDB 1KCRH 2HJKB 5SX5H 1YDPB 2BMKA 1R0AL 4XBPA 4LVOB 4GG6B 3E6HA 5L2KB 3RTQC 2IBZY 1QLFB 1QSFE 2Q8BL 3GSUA 1OGTB 3D9AH 3H9HB 4RMWA 2NXYD 4MA7L 3K2MC 3GMLB 4IMKC 1BP3B 2XV6B 4L4VB 1RURL 1JNNH 1YMMA 4MJIE 2FD6H 3LQAL 3S97C 4OCNC 4M6OH 4WTZG 3O9WB 4U1MB 1F4WH 3LKSB 3MRDA 2H9GA 3MBEC 8CGTA 2R2BB 1AQDA 4E42B 3TT1L 5EBWA 3D39A 4OZHA 4Y2DA 3TIEB 3TJEH 2BVOA 2A6DA 3MXWH 4UV4L 4XVTL 1PDKA 5BQ7B 5GGQH 1DBBH 2HFGL 3SDAA 1BIIA 4L3CB 1WFNA 5I1IH 2XY2A 3UJIL 4BKLA 5F6HJ 4YXLH 4IRZH 1MJJB 1TZGH 5I71C 4KUZH 1P4LA 1EAPA 4XWGH 3BRGC 4YXLL 2FBJH 3HNVL 3Q5OA 4GMSL 5D2LB 5A3ID 1ZEAH 3V52L 2ZUYA 4PJFB 4LHJB 4XVJL 4MVBD 4HJJH 3RPIB 5E2VH 5L7XL 1TTFA 3MXVL 3V6ZB 2NX5A 1RFDH 1H0DB 4L8DB 1A9BA 3TT1H 1I9RL 4LOUD 1OAZL 4NM4H 2PTTB 3SPVB 1RIUL 4IIQC 5IV2B 5IR1A 1I8LA 5B39A 3INUL 4FQHB 5BVJA 1X4YA 4LCCB 3SCMD 3CJJA 3KYAA 2ITDB 3QUYD 1NFDA 2XPGA 3UBXA 2HTKC 1T20B 1HXYA 1WFUA 5IOPA 4L8BB 1SJHB 4FG6D 4I18C 2Z8SA 4BJLA 4L9LC 1A2YB 4NDMB 3JWDH 5J56B 2IAMC 4WENB 1FRGH 5ESVA 2ZOLA 1WWCA 1PKQE 4NGHH 4JB9L 4ODVH 5IF0A 5C0ND 1KJVA 5TJWK 4H5SA 5D1ZC 4EN3C 1ZOXA 3WUZA 4HXAL 5FA4B 1JGVL 5HD8C 4V2BA 2PN5A 3HC0A 1FG2B 4JFDB 4G6ML 4RZCA 4KMTH 5EOCJ 2BY0A 2GTWB 4LVOC 3P30L 3QUZC 4TVPL 1W72H 2V2WA 4PJCB 2IBZX 3SOBL 1TJIL 5FGCE 4PJ8D 3DGGB 3IJHA 1IJ9A 1NJ9A 5D70L 1JI1A 4YHZH 1KGCE 1XF5A 4PJGE 1FG9C 5KJRH 1CICC 3MCLH 3T4AA 4M6NH 4L5FH 4PD4J 1JVKA 4YBQD 2OXHA 1MCEA 5CSBA 1XGPB 4HMDA 1CICD 1LK3H 5C2BL 2XN9B 3SKOA 4KK5C 2EDEA 3D2UD 4P2CG 3CFKA 3X3FH 4HJGA 3BZFB 3ARWA 2VLRA 1H3PH 2J8UE 1KJ3H 3JWDC 1UXWA 4G3YL 5DMKA 4P2RA 5EUKA 5C6TL 2VAJA 3ECBB 3VFOA 5GJSH 3WJLA 1CFBA 2DF3A 1WAAF 3QHFL 3BWAA 1N6QL 1OB1B 4KK9C 5C0BB 5CP3A 3MRRA 2ZSVA 4FZ8L 3GBMH 5AUMB 3G04A 1BVLB 3UBXB 1IM3B 5D1XA 1K3IA 3BPNB 3WMSA 1AHWA 3V5HB 1SHMA 4X9IA 1AFVH 2XA8L 1XR8B 4MNQE 5LGHL 3O2DL 4QKXB 3G9AB 1INQA 4HKZB 1BD2E 3JZ7A 1E4JA 4AQOA 1AP2A 2MCG1 5C0GB 5D4QA 3WDIA 1SM3L 2F54A 2GJ6D 4NUGH 4OFPA 4OFIA 3GGWA 3WFEL 4XVUD 2VDRH 3F7YA 1RJZA 4PB0H 1UJ3C 5DLMH 1MFEL 2NTFB 2HT3D 3OAUH 4RRPA 5F3HB 5CD3A 2A38A 4GG6F 5DMGD 3U4EA 3ZDXF 2EIZB 3K8KA 2DTSA 3EKCA 3C5ZB 5C92A 3IKCA 2VERN 2WV3A 5I1HH 1AD9B 5IFAH 2OP4L 2X4OB 3S4SG 5IESL 2I24N 4DOHB 5IB3A 3KPQB 4YFDB 1NANH 1NCAL 4UIMA 5TE4H 2BNQB 4L9LB 4F15C 5DJZA 1VFAB 4I5BA 3UJTL 5KZCD 1FE8L 5IWLC 2AJYH 1RZ7H 4TSCH 5D1QC 4BFGA 4PBWD 4LLWA 5C0AE 1JN6B 3ULUL 1NANI 2C4XA 5I30L 3QEQE 5GS0L 1CL7L 1EEUA 4YHYB 5A2IH 4JO4H 2G75B 1A0QL 3GMLA 5IQ7H 3QJHA 3BZ4B 4GW5A 1D5IL 1K6QL 1HHGA 4PJHF 5EU3A 4NP4H 2QV2A 2XKUA 2P24B 4N0CD 2NZIA 4OT1L 3HI1B 2X4RB 5DEFB 3VWKC 1TVBA 2ZSWA 4KRNA 3ARFB 3HE6A 5D5MB 2EE2A 2WBKA 3ILPA 4LFHG 1AGBB 5FYKE 2YZ8A 3KGRA 2PO6D 3VFVA 1AHWB 3DYOA 3V5HA 1JUFA 2FZ3A 4Z7OF 2HA1A 1MH5B 4QWWD 1G7LB 3V7AG 1A4JA 1D9KD 1QPPA 1FJ1B 2IANA 5IESH 5I66B 3MV7D 5A16B 1HH6A 4Y4KB 1DBAH 2VO5A 3BP7B 3QXAA 1MY5A 2DRUA 4KVNL 3P9WB 5BOPA 5KSUB 3MJ7A 3QCVL 5KN5B 5L2JA 4NWUH 3WN5C 4C59B 4D9QE 4PJAA 1KTDB 2R2CA 3AXLB 1P5VA 4JRXD 3KLSA 3Q3GA 1HHIA 1R6VA 3B9EA 2DS4A 4X4XA 3RX7A 4L8SB 3W0WD 4YX2H 3RX5A 3H9HA 4ZFZA 4NQXB 2GQHA 2YRZA 2R0ZL 1UT9A 5KSBB 1GGIL 1GPOL 1UADC 3DARA 4OF8A 2DI7A 4MCZB 2UV3A 4GKSB 4YHZL 3A67H 5FIEA 3W81A 1NBQA 2ICWJ 4L8CB 2DQJH 4ZAKC 1G9MC 3C9NA 5D70H 1XR9B 2AVGA 3QRGL 3O6FB 1KC5H 1MLBA 3TYFB 5EBWB 3TIEA 4AH2A 4KJQC 2EDWA 1MY7A 5AD0B 3O6FD 2P46B 5CAYB 4XPTL 3PGFL 2G75A 5D1ZB 4EN3B 2RGSA 4U4BA 3QXVA 1HOCA 1YN7B 3RU8L 4ZUTB 1NCBH 1MCSA 1HQRA 1AY1L 2Q86B 5HHOE 1QBML 4H88L 5J6HB 3F12B 4QGTA 2IF7A 1WLHA 3QUXA 4IMLA 3VD3A 1TZIA 1AGBA 2Z8WC 4JPWL 2V5SA 2GY7B 1IGJB 1TVHA 3MRJB 2APXA 1GGIH 3BUYA 5CJQL 2GJ6A 1A1NA 3UEZA 5FYKD 3O6ML 5IG7B 4U1NA 3ARDA 1KENH 3IFLL 4FQCH 3RWHA 1U8NA 3HC4L 1CZ8H 2VSDA 4FFZH 1BZ9B 4G6JL 1MWAB 4G8FB 5FO7B 1QFUH 4U31A 1JV5A 1DQLH 4MAUH 3ZLQC 4JFEB 2PYEA 3OPZH 4WWKB 2V7HB 3H9SB 4HXAH 4O2EA 5JW4Q 5IROA 2OX5A 3UTPE 2VLLA 3S98A 2ED9A 2F5BH 4C4KO 2NZ9D 1AD0B 1J5OL 1SBSH 3RI5K 1MVFA 1RJYB 1JGEB 3QXDA 4WCYL 3EDJA 3LIZH 2BY2A 1OARH 4OQTL 1A8JH 2B20A 1S9VB 2OTWB 4P2RD 5CZVL 2D7NA 2GT9A 1A7QL 4JHBA 3MODH 2X1PA 4KV5F 4QXUL 3FT2B 4OGYH 1OQXA 1Y6NR 5EIVA 1S5IH 3IF1B 1GIGH 2R0WH 3SDAC 4OFYA 1AHWC 5EN2A 1WC7B 3AS1A 4OLVH 1RZJC 1DBBL 1I1YA 2R9HC 1QR4A 2PYFA 5EUOE 1RI8A 5FECA 2FATL 5I17B 3BP5A 5LCVL 4L1HA 1EZVX 2O5XL 4I2XA 3QT2A 3H3PH 3BGMB 3HR5A 3JV6A 3RY5A 2CIIB 4G9FA 1CFNB 4JZJB 3GHEL 1RZ8A 3MJ7B 4WHTB 1RUKL 4I4WB 3V8CA 5IJKC 1CDCA 5EU7E 4YR6B 2R29H 1CGUA 2DDQH 3AB0B 4RGOL 4JE4B 1NGZB 1SVCP 3QA3B 2NYYC 3AS2A 4RX4A 3STBA 3FB6B 4NO2A 3PV7A 4N1HB 1BD2A 3TIDB 3Q2CA 1U6AH 1UB5B 4J3VA 3ZKNC 4LKXA 1FYTB 4PJEB 2EE3A 1Q38A 3UPAA 1ACZA 3RP1A 4HMCA 5C0RL 3ZKND 3IGAB 5D7JA 4UZGA 3U4BH 5EU4A 3U2SA 4QY8A 1RSFA 2DQTL 2X44D 4KY1L 3RWDA 3RGVC 3TO2A 4OM1L 3SE8L 1UM4L 4Z7NE 2AK1L 1DUZA 2CPCA 4PIRF 1S7TB 4ODHH 3L5XH 2BX5A 2F5AL 2H8PA 3NCJL 4QHUA 4XPGL 4KI5F 5FGBA 1CR9L 5CGTA 4M6OL 1JMXA 1NLDL 1QYGH 1TXKA 1FQ9C 3HMXL 3CUPA 1ZGLB 3MBXH 3P0YH 3TO4C 2XTJE 3HZKA 3TH2T 3ARXA 3C60A 3FN0L 1UG9A 2XQBL 4GT7A 2OBGA 5GS1A 2YC1B 3WNOA 4XNMB 5IVXA 3MNWA 3DX6A 2XZZA 1Y0LA 5GIRA 3KG5A 3QQ4A 1JWUB 4RFEB 1MI5E 3D2UB 1A21A 2EDNA 5EU6D 2BOCA 3BIBX 5EULV 1CFQA 1CG9A 1NLBL 2IH1B 3VJ6A 3U4EB 4AG4L 2RBLA 1U2HA 1D6EA 3KYNA 5HYJE 3HMWH 3QAZB 1KJMB 4PGDB 1JPGB 3DX9A 1X9QA 2CIIA 4MXWH 2EYRB 4U1NB 4PJDE 4PJ8B 3DO3A 4G6FD 3NCYS 5I1GL 1IAKB 4XHJD 3PQYA 1MWAA 3GRWA 1LK3L 2EXYC 4NCC2 4PBVC 4IHOB 5D2LA 5I73B 4HUNB 4LF3B 2HVJA 4P23C 4PJXF 3MCLL 4XAKE 1ETZB 5GHWH 2OR7A 1U93B 1XGQA 4YE4L 4XNZB 1JRHI 1VADA 1QBLH 3GSWB 4FNLH 5C71A 4OLUH 1DQQB 3FN0H 2WBJD 1GZPB 2VL5A 4HEPG 4EI5B 4UTAH 5E2JA 5CEYB 2XZQH 3L5IA 1I7RB 4XCFH 4HJ0C 3GNMH 3QUMB 4EI5D 3VDAA 4KZEL 4XCNB 3F5WA 5C07E 2R0KL 2VIRB 2J88H 4M8QA 3KPRA 2MSPA 3QUYB 4ZTOH 4XTRD 1S7VB 2BDNH 3O6FC 3AY4A 3DUUA 1EGJL 1N7ML 4F7MB 4MSWA 4OD2A 5I8OH 4J23A 1PG7W 1ND0A 4ZOEA 3BKCL 1TLKA 1JHKL 1X4XA 2X4TB 2LFGA 4OCRH 1FSKB 1TQBB 1PKOA 2EEAA 1GOHA 1E27B 1WZLA 5IHLB 1BWMA 4O51A 1A14H 1MVUA 1EX0A 2A6KB 3MR9B 1CLYH 4LSUL 3BPNC 3TCLB 1MJUL 1RIHL 2HTKD 4IMLB 5EU6B 4XVUC 2DDQL 3MQIA 1VKXA 3RUGE 2P8LB 4KI5D 2XTJD 3WS6A 3P2TA 5I1AA 2F53B 4LASL 3IB4A 1F6AB 4OUOA 1C7TA 4MNHB 2CDEB 3VI3F 4ZS7H 5IVOA 3DO7B 3IDMA 1JK8A 1T1ZB 5JORB 4CJ1A 1MCHA 3PUCA 4ZD3L 5IW3A 1ZVSA 1ACYH 4ZDHA 3TO2B 3ARRA 3F7VB 1DDHB 4L8CA 5H2BA 3JV4B 4HIHA 3N9GL 1A7NL 4DN3H 1NGWB 1DQML 1A9EA 4WHCA 3VXUB 3R0MA 1MFAL 4FQIH 3E6HB 5H94A 2YR3A 4GLRI 3ZYZA 2BSRB 4NO0A 1TZGL 5IEHB 4HKBA 5FOJA 2MCPH 2HLFC 1J5OH 1OP5K 3T3PE 4NRZA 1E6OL 2Y36L 1X7QA 5HDBE 1KOAA 3GFUA 1YPZF 2HLFD 4OZFB 3RNQB 3IFOA 4I3SL 2AJVL 4JM2A 3LH2H 5FGSA 1FLTX 3LV3B 3N85L 1BGXH 4AZ8A 2DI8A 3K46A 4MQXD 1OTUD 4K23L 4R4BA 1U8OB 4J3OC 1OHQA 3NFPB 5CJOL 3ULUD 5GZOC 2GFBA 3E1F1 3VG0H 4Y5XC 2NY1C 1N0XL 2WM0A 2D7MA 5DLML 5I9QC 3QFJD 4J3UA 5DSCA 3RZCD 4PGCA 2YMXL 3P4OA 5IMLA 5HHXL 3VFPA 2QQQA 2R0KH 4E41B 1YEDB 5EPMA 1EAPB 1FFQA 4Q6YA 3UC0L 3RZCA 5TFSL 2LAAA 5IHUL 4I2XE 3O2DH 3ZKMC 2IQAB 3CXDH 4ZFGL 4HIEA 4GS7B 5IM7A 4HKJB 5DC4B 3MRPB 3EJZC 2NTSP 1G6VK 3ULUC 1IAIM 3JTSA 3ARVA 1QBAA 4AEHL 1JYVA 4P2RB 4DVRL 1LO3L 3MROA 4KHTH 2QL1A 4DFIA 5I1JH 1HCVA 1IAOA 4JLRA 1OQOA 1L7IH 4QY8B 3BE1H 3C87A 3HZMA 2CKBL 4XCNA 3QNYB 5EU5B 5FF6B 3K8LA 2R4SL 4PJCF 4Z78B 3CC5B 4FFVD 1D6VL 2VDKL 3GO1L 2JELL 3OJDB 3H9SD 5IFHH 2XWJB 5HGDA 5HJ3A 4NO0B 5AYUL 5KW9H 3MYZA 5DD5L 1LE5B 4P59H 4Z7VB 3BIAX 5HHME 3AM8C 5C2BH 2J2ZA 3LHPL 1RUQH 2FO1A 2WQRA 1IZJA 1VDGA 4IRJD 1U8IB 1YEFH 3HZKB 4OLZL 4P59L 5D7KE 2BJMH 2ZUVA 4O5LH 4PJBE 3KS0H 4CADB 1VEMA 1MCBA 4AYFA 2D7TL 2BC4B 5HHMB 4YR6A 3LKPA 5C07D 2BRRL 3VFRA 4UU9A 3O3DA 4FQQB 4PRAB 1JWUA 2HJFA 3KXFA 3DBXA 4ZS6C 4APQA 1OAUH 3ARGC 3BPLB 1K3ZA 1HWGB 1K5NB 2Q3AA 1TETH 3C08H 3RUGF 3T0AA 1TITA 3T4YA 4GRWE 1B4JL 5IHZB 1I9IL 4WFFE 3BWUC 1SYSB 3MV8A 1W0WA 1G0XA 4LSPH 1KT2A 4RFNB 3WIHL 4JY5L 2AQ1A 4XHJC 4FQHA 4QO1A 4YAQB 2HVJB 5C0CE 4H1LH 3V4PL 4QHUB 4HV8B 4XBGA 5ELIA 4QRRE 1S5HA 3RVVD 3FONA 5D1QB 1NFIA 1QD0A 4D9RD 3W0WE 1RHFA 1A3QA 4JR9H 5F89B 1QKZL 3WJLC 1UWXH 3MFGB 1Q9OB 2IQ9H 3UP1A 1J1OL 3OJVC 4EI5C 1I3GL 4YHNB 3FT4A 3QUMA 2ZUQC 5I30H 4FQXD 5K9OA 4N8VB 5D6CB 3FO2B 1EJOL 1A1OA 3QISA 3PNWA 2AJYL 4HLZG 4DN4L 2VLME 3MRMA 1MCJA 2WLYA 1DBJL 2O5XH 5CEXB 1FDLH 4DKFH 5F7LB 4R2GB 1YPZE 1BEYL 4XC3L 5CBAA 4Z7VA 5DD6B 3OKEA 2JKXA 4BSWB 1ND0B 1RK0B 4DK3A 4YHIA 3VFPB 5IKCA 5F8RC 3WLBB 5GGTL 3BOVA 1TDQA 3QDHA 2AW2A 2NY4C 4G80B 1RJZB 2PO6B 1GAFL 3EAKA 4QTIH 1T3FB 3G5YB 3GMMA 1YEJH 3QWOB 4HF5H 2NR6C 3ARFD 4ZO7A 4MAYC 5DMJB 4EBQL 5DD3L 5I8EB 2UWEE 5IMKA 5I16A 4UAOB 5HVFB 1HILB 4XC1L 3AAZB 2BXZA 3C60D 4LEOA 5C0IB 3FO0L 5LGJB 2EH8H 4PG9B 1ZANH 1EFXB 3VD5A 1XGUB 1YJDH 1J1PH 1PG7H 4OTXH 1JPTH 1OSZB 1S8DA 4FP8L 5FK9B 1AC6A 4KXZH 4NO3B 3GMNA 2AK4E 3BN3B 3O3UN 1XT5A 1DANU 3BGFC 4WFEE 1IEHA 2CLVB 3NIGF 3HI5H 5A40E 3TA3B 4U1LB 5JO5B 1CCZA 4Q58C 4QXGH 3VWJA 5F89A 4DUWA 3FO1A 1WVZA 3CGTA 3QNZB 1N7MH 5DEFA 3GSQA 3LRHA 3BMVA 4ZTOL 2LTQB 4MNGB 2A6KA 3QZWA 4UU9B 4IJ3B 1J8HB 2IPTH 1FBIH 1MIEH 4GQPH 3CSYA 3HZVB 4YK4B 2FB4H 4GRWH 2C3WA 1I3VA 1KPUB 4KDTC 1T6VN 4K3DL 4BSWA 3WHE0 5C3TA 5A2LH 4RAUA 3ZDYF 3GMRA 1MFCL 2P8PA 4XZUA 4G9FD 4AENB 5A2KH 1C08B 3K1KC 4WV1A 3TA3C 3V4VL 5B38B 4RIRA 1DEDA 4PP2B 3UYRH 4KAQL 3ZTJH 1WICA 5GISL 3OL2A 2GITA 3QDJB 3GSRB 4ODVL 4R7DA 1O0VA 1DL7L 1F6FB 4PJ7E 4PJAF 3PIQA 5GGRA 1Q0XL 2EC8A 1V7NH 3VXRE 4G42A 2VDQL 4YBLB 4MXQC 3QHZH 4UV7L 1D5ZA 3L5WA 4WW1A 3FN3A 4FXGB 1K8DB 3MLZL 2DQHL 2H2SD 4C4KT 2P49B 5LAXB 5HGHB 4F2MA 4I48A 3MYJB 3CC5A 4M5YH 2ZJSH 3LKQB 1LEKB 1M05B 1HINL 4TN9A 3KWWB 4ZO6A 1BQLH 3CIQA 3I85A 3OKLB 4AIXA 1MJ8L 1HI6B 3EDKA 4NUJB 5H35A 4I3RH 5DZOA 1Y18A 4PGCB 1MFBL 2FECI 4M48L 4KKAD 4NPYA 1NMBL 5BS0A 4DW2H 4GAGH 1B90A 4CJ0A 4P46B 5JPNB 5AEAA 5D93C 5KN5A 1CFSB 3TBVB 3CVHL 2F5AH 2FIKA 4LSSH 2IQAA 1CFVL 2B2XL 4LDOB 4UT7L 1X4ZA 4CVZA 4NP4L 5E4IA 1ZGLP 4BM7A 2P44B 2WSKA 3VH8G 4PJBA 4CKVX 4JPVH 4C56E 2ZPKH 3NFNB 3QEUA 1IQDB 5KBNC 3C6LD 1FSKC 4QT5A 3LB6D 1ORQB 4U2ZA 5DI8B 4KDVA 1A6PA 2LU4A 3NH7L 4QXUH 3MODL 3Q5TA 2X42A 3DXAA 3MGOA 5E5MB 1SBSL 4QYOA 1UVQB 2CH8A 2K1MA 4PG2C 1E4XL 5I1HL 4X7SH 1EPFA 4UQ2B 1I1AD 2HRPH 5E8EA 2UVEA 1VPOH 3UTTB 3MUHL 3B9DA 2DQCL 4Y2OA 4N5EC 3ULVL 2LAGB 4POYA 4DZ8A 5IJVB 3VFNB 1LO0H 3BAEH 3ZKXB 1DQJA 5IUSA 3MV9E 1EHLL 3KR3H 2DQUL 4XNMA 5IVXB 5C0NC 4XB7A 4RAVB 4CW1A 3N06B 3UTTE 3F12A 4HWZA 4OGYL 3G6AB 3E8UL 5CJQH 3LN5B 3FTGB 3QWQB 3S5LA 3EW3B 3SKNB 1NMAH 4GSDH 4LLUB 1TQCB 4PPTA 2H32H 5FYJH 4U3CA 4PTTB 3A6CL 2JCCB 1JPGA 5C0EA 3IDJA 3FQNB 5DJ2A 5D7LA 3NVQA 3BQUD 1A4KA 3GJFK 2RJMA 1C08A 2ESVB 2R4RL 5ID1B 4N90E 4L3AA 5CEZE 4MHHG 1MCRA 3S37L 4HSQA 2X5PA 1CU4L 4JFFE 1HQ4B 3KPPA 2OL3H 3ALXA 3ZL4H 3VXMD 2XN9A 1EEZB 3ARBD 4BFEA 2JJWA 3W39A 4K7FB 5FA3A 5EORL 1Z6JT 1MF2L 4E0RA 1FN4A 3FQTB 3CLFH 3B6SA 4EOWH 4KDWA 5E08H 1N59B 1K8DA 4FXGA 3A67L 5E8PA 5CP7A 5CHNB 4ZAKD 2OQJB 4PRHD 4ZSOB 1E6JH 5MERA 5AZEH 2GJ6E 4JKPL 2H9GB 3KYOA 2ARJA 4Y19D 3PNWB 2UWEA 3E2HC 4FFWD 4PJHE 4AIZA 1JPST 4I9WD 3BP5B 3RRQA 2HRLA 5F7KC 2IC2A 3RA7H 3DVNB 1MRDH 2BZDA 2AJSL 3RNQA 3UPCA 1MJJA 2FGWH 5DJ8A 3L3GB 1ZWIB 2BY1A 3AVEA 1UB6A 3C6LA 4AEIH 5LXGH 2FGWL 4OV5A 3D85D 4C57C 1QFHA 1W0VB 3QA3A 4Q6IC 1NFDF 4OTXL 2IALB 2EDQA 4DOHE 5DA0B 4XVSL 1QPXA 3CMGA 4JQIL 4P5MA 2FX8H 4P5TA 1HCFX 2W38A 3FQRA 4HUXA 3EZ8A 1IL1B 4M7JL 4G8GE 3JXAA 4PV8A 1AD9A 4J6RL 4PTTA 4DJMA 1L0XA 2AQ3A 1URLA 4XBEH 5KTEH 1ZVSB 1EK3A 4BFBD 4OD1L 3QI9C 1C5DA 1E6JL 1IGTA 4EVNB 4MMZC 3VG0L 3B2UD 4B53A 4U6XA 3WIHA 1FFNB 2A77H 1RIUH 2AABL 2Q87A 3BEVA 5TE7H 4L4VE 5BRZD 3GIZL 2H8PB 1QHPA 4XWOD 4PGJA 1CLZH 1RPQA 4CRPA 1T22B 1CQKA 1H9VA 4M7LT 4KVNH 4P2OB 4A6YA 2EC9T 4JFXB 4OIIH 3LQAC 3JTSB 4TNWK 4HKBB 1DBAL 3TWCL 2HKHL 1U3HB 1NDMB 2OL3L 1FVCA 3ZL4L 3HPJA 4M7LH 2BY3A 2WIIA 1S7XB 4HCRL 4K94H 4YIQA 5J89A 3BWAB 2VZ3A 1KIUA 5B22A 1BVZA 3AUVA 4JAMB 3QCUH 4PRPB 2VLRD 4JQXC 4QNPF 3TN0A 3TF7C 3ZE2F 3I3BA 5FYJL 5J13B 3CSYB 4OZHF 2Z91A 4FQJH 1KCVL 4NKMA 4WWKC 3WFDH 3NA9L 4DVBB 1KIPA 4DUVA 5DRWB 1TFHA 2NY6B 1FC1A 1FJ1A 4XVTH 4ZG1A 1WGOA 3UCRA 4EUPG 3OB0H 1DP0A 3FQUB 5GS0H 3SO3C 1RUAL 4LPVA 5INDA 3C6SB 2NX5E 1XCTB 3REWA 4LNRB 1MCKA 4PLKD 5F70A 4EI6A 4LU5L 3PWJA 2X4NB 1UM6L 4PLKC 4CVZB 4ESKA 4WI3A 4HDIA 2ATKB 3BD3A 2YK1L 5B38G 1QRNE 1YA5A 2AXGB 2NQCA 5DRNA 1K4DA 1J0JA 3GJFB 1NCAH 1ZHBA 2ZNXA 5TE4L 2JB6A 4YHLL 5HHOB 2OK0L 1WCBB 4FN0A 4M3KB 1IT9L 2XRAH 3O2DA 1N5YH 2ZJSL 1RV6X 4YDKH 4EIGB 4J4PC 4QRPB 1TJGL 3BGAA 1T4KB 3K7UA 1IGCH 5DUPH 4F7PA 2AJZB 4R9HA 4PRBA 4BH7B 4FFYL 2K7QA 4KKNA 3L7FA 1MLBB 1CF8H 4WEBH 5HGDB 4BYHA 1HH9B 5C9KA 1OD7A 2Z31B 4CL7A 5EO9B 5F6IB 1BZQK 2XA8H 4HIXH 3TBTB 4ETQB 1JIBA 4I77H 2DWEA 3GSOA 1HQRB 4YDVA 5MEOA 3TNNA 4ETYA 3PL6B 4MJ2A 1P2CA 1D6VH 2F9BT 2EO1A 1AQDB 4A2MA 1QSEB 3KJ6L 4HUUA 1VFOA 1Q9WB 1DQDH 4APQB 5HD8D 4G5ZH 2MNUA 4KGJA 5KSAC 1T0MA 3LEXA 3DTXB 5JUEH 5E94A 1G84A 3Q48A 2XQYK 3WXVH 1SEBA 3SJVE 4RMTA 5GXBB 3VI4E 4HZLA 3HMWL 4P9HH 2IAMD 5ESAB 1P4LB 3T77A 3VXME 4X6EA 4RGMC 3MLVH 5SWZB 4Q9RL 1DJSA 1IKFH 5DJZB 1JZ5A 3SDAD 3IU3B 2IPKA 5T1MA 4WTXA 4YXKL 1P7QD 2AKRA 5CILH 1NGWA 4X4YA 5KJRL 2EDDA 5HVGB 3ULUF 4G8IA 4JO2L 1DUYB 1U8KB 2DKSA 3EUUA 1GGTA 4D0BA 3PL6C 4N9GA 1EMTL 3MNZA 2FWOB 1F6LL 1JYXA 4WFHD 1QVOB 3VXOA 3QIWB 1EEYB 3BZDA 1MHCA 2FEEL 4S2SB 1YMMD 3ETBF 4YFLI 5D71L 5TDPB 5HPMA 3F6LA 4Y8AA 1LD9B 4M03A 4P2RE 4KH2A 4RGNB 5D6DC 4IMKA 5I1LA 1GYAA 4NO3A 5ICXA 2EYTB 2GCYA 3RWIB 3V5KA 1RAMA 3QULA 4U6HA 1MAJA 1G0DA 1LO2L 2VXVH 1S7RA 5HYSG 1SJHA 3UTPD 5JPMA 3UPRA 2DQTH 4L3CA 1TIUA 2OI9B 2B5IC 3P4MA 1V8HA 3MV8D 3X13A 4JM2C 3BKJH 3S37X 5C0RH 4EIZC 4ORGB 3T09A 2X40A 1Q72L 3QPQD 5KG9A 1QNZH 5L88H 1U6AL 1EBPA 1B0GA 3CXHJ 4MLIA 4P5TC 5GGQL 3KXFD 3L3JA 3T0EB 4X9GA 5HDOA 1IBGH 1F4XL 3RGVA 5BJTB 5E2WL 1U42A 2OR9L 4C56D 4DKEH 4PGDA 4JJ5A 5C1MB 4X7TA 5IG7A 5DHYA 3SE4A 4NQED 2BNRB 1ZANL 5C08E 4LIQE 2CR3A 5C7XL 4PP2A 2VKXA 5TF1L 4PRID 2VJXA 1QKZH 2OJEA 2XIDA 3S9DB 2E7LA 4MHHI 2AJUH 1Q72H 3U46B 3G5ZA 5LQBH 1C8PA 3QUXC 3U7WH 3GB7A 4WCYH 1UJ3A 3MPCA 1I85C 5ALCL 3O3AB 3ECBA 4K3HA 4QRRD 3VFOB 2E27L 3BX7C 2Z9TA 4WDIB 4WW1B 5CWSA 4LBEB 3PV6B 4M7ZC 4DCQB 5HPMB 1C16A 4N8CH 2A73A 5C09E 3O9WA 4U1MA 3G5XB 1F8TH 4KROC 4X9BA 5JW3L 3SEPA 4K3JL 5HGAB 1QFUL 1UA6L 3DETD 2KZ1B 1BAFH 3RL1A 3TP4A 5D1XC 1BEYH 3CH1A 1KENL 2BNUA 2UYLA 2OZ4H 4ONHB 5BZDB 3GUTA 5I18H 2DM3A 2L7JA 2E8ZA 2YXFA 3PGDB 3LVEA 1JHLL 2BVTA 3L6FA 1M6OA 5JIHA 4W6YB 5KS9B 1JYNA 1MHEA 4WHTA 1JWMA 2J12B 4PV9A 4FTVD 5GHWL 3A6OA 3B9KA 3PGCB 4W4NA 3F7YB 3BP4A 2FX9L 4W6WB 3ELAT 4JR9L 4Y1AB 3TFKD 3JWOC 1BQHA 4OZ4B 1Q9LB 5DVMA 2P8MB 3DHMA 5I1GH 3DETC 3O45A 2I5YH 2IH3A 4X0KA 1SMAA 4F15B 5H8DA 1AI1L 2DLGA 4TOYL 3H9YA 3S96A 1F6AA 3BKML 1I7UA 5B4MC 5T3ZD 3C2AL 4BH8A 3HFML 1Q1JH 1K2DA 1SBBA 4QRPA 1MAMH 5J9PB 2WIIB 3QIBC 4BELD 5EO1A 5KS9F 1RZFH 1LGVA 2EKJA 3CFDA 3BDYL 3LY6A 3CVHA 3T65B 3CD4A 3B9VA 3CFJB 4MX7B 3U0TB 2J5LC 4MDIB 4JZOB 4L29B 5ITBH 1IRAY 3JUYA 3BVNA 4WGVB 1MCDA 3CZJA 3C2SA 1G7PA 4NO5B 2IFFL 1CGSL 3TM6A 4OD2B 4JDVA 1ROWA 1HKFA 1SYVB 5C0AD 1B6DA 2DTMH 3U9UB 4IS6A 5TFSH 2E9WA 1NLDH 1HN1A 3QZWG 4JO3H 5T5NF 3NABL 1CR9H 1OP9A 4GRLA 2ZG2A 4IRSB 4X7FC 2MTPA 4ELKA 1VFBA 2X6MA 4PLJD 1U3JA 5DZLA 3IXAA 3RHWK 4P99A 1OP3H 2NNAB 1A3RL 4HS8H 5K59F 3SJVD 4Q9RH 2UWEF 2X4QA 5HHOA 3RY6A 1A4JB 4OCWL 4Z7UB 1NAML 5ILTL 2B0SL 4WI6A 1JWSB 3Q0HA 4YHLH 5ICZB 5BO1H 1GHFL 3AS3A 4GJTB 5EPMB 1HNFA 5DQ9B 4YHOH 5EZLB 4RAHA 3VW3H 2HTLD 1CDBA 3MA9H 3QPXL 4MXVF 2DM4A 4ACPA 5HI3C 4BQBA 4YDJA 43CAA 5D2NB 3TJHD 5MP6H 1HHJA 3JBG7 4O2FA 1GZQB 2R29L 2VWEE 4XNZC 4PJDA 4G8EB 5E8EB 4HIIB 2DQIL 2BSTB 3I3EA 1AGCA 1EHNA 1MCPH 5J3HC 1T1XA 2XZCL 2R2EB 3HZYA 3DURB 1F97A 1LO5B 1PX4A 2A2QT 1A2YA 5J3HD 1NCCL 2JJSA 1K2DB 3FO1B 1N59A 3TVMD 3CNKA 2VRAA 2DWEB 4YPGB 2AP2A 1HZHH 5IB4A 4KK9D 4UAOC 2IFGA 1G7HB 3QCUL 5JZ7D 3IYLW 3C8KA 1A7QH 2EYTA 2GCYB 3MV11 4S1QH 5BW7A 1UYWL 1MRCH 1PYWB 4DQOL 1QLEL 1QR1B 4Q9BA 4WVRA 1YEEH 4Z8FH 5GRXG 1A02N 1MEXL 4AK1A 1HOCB 4YDLC 1A6UH 2Y5TB 3VE0A 3N85H 1RJCA 4XMLH 4LCYB 4KMQA 2B4CL 1A6UL 3HG1B 3MFFB 2YK1H 4EEEA 4CN1A 3D69A 3EO1B 5I8OL 1ORSB 4OIAA 2F8XC 1TCRB 2MFNA 4XP1H 2CD0A 4PYHA 5T5FH 1L9MA 4GRWF 4I0PA 32C2A 2VN4A 4P5TB 4Y4HA 1T89A 2QLVB 2ERJB 3G5VB 5EG6C 4ZXBB 5F7FA 3IDYC 2M1KA 5KVGL 3L3DB 4AMKH 3GM8A 4WUUD 3BH8B 3U6RA 4QHKJ 5C7XH 3PHOB 3RUGA 2WBWB 1IM9D 4JFHE 3DMMB 4HS6A 4ZD3H 1HE7A 2P5EE 3MYJA 4JZOA 4WFGE 1WWBX 5HYIA 2QR0B 1GGYA 4WO4A 1BMGA 2OJEB 2NYYD 2XWTA 4O2EB 4F7EA 5DJYB 1NBZB 4WUUE 3ILQC 2DICA 8FABB 4A6YB 3DUUB 2E7CA 5LWYL 4X5LA 2O61A 3MLTA 4PUBH 3DX7A 1JHTA 3QDMD 1QFWI 1Q9OA 3MCKB 3MLXL 1U8MB 4WU5A 4YIQB 4Q0XH 2M8XA 4OKVA 3PHQB 3GI9H 5D7JD 4F57H 2GT9B 4J4PA 3D87B 1OTUC 2NW3A 5BW7C 3LN5A 2DQJL 2Y6SC 4FQ1L 1RUML 4NC1C 4GO6B 1NDGA 4OF7A 1KN2L 3C8HA 4WWID 3SY0A 2F54E 2BDNL 4B0MM 1T0PB 2ATPA 5C09B 3IDXH 4JN2B 5D96B 5M7QA 4JPKL 1E28A 5D7IE 1N8ZB 3DNKA 4HCRA 2FEEI 3IJSB 2HFEB 5DJAB 1M71B 3BP7A 1IGTB 4H0HB 2EKSA 4XPBH 1KTKE 3QIBA 1U8QB 3HG1A 4QYOB 1FH5L 5DRXB 2Y7QA 5FYLH 1ZLUH 1DR9A 3BGFB 4QOKB 4JM4L 4IJ3C 3TFKC 1FVEA 4GQ9H 5BS0E 4P57A 1JFQH 4X98A 5MEPA 3WDJA 2Y6SD 3SE9H 3G5ZB 3VXRD 3EZJB 4JHZA 2QQNH 4ISVA 1AE6H 4QHLA 5E9DE 5K9KB 4Q2ZB 3Q6FA 3Q6GH 4GAJL 1SQ2N 3SDDC 2BP3A 5F71A 1LHZA 5CILL 4K3EH 2ID5A 2FECL 3SDDD 4ZYKB 3U0WL 4BSVA 5JLZB 1NMAL 5JOPE 1AJ7L 5DD0H 1S9VA 2OTWA 5EU5A 3SHSA 4MNQB 3IAPA 2H6PB 4JG0L 3RBGA 4R4BB 2A6DB 4MJID 2Z91B 4LCIH 5F1SA 4OF5A 4P4KD 1HEZA 4MAYD 4KRLB 5I17A 5DR5H 4BUGA 1RULL 1H8NA 2EH7H 4U1LA 3EO0B 2WWKO 2LV4A 5IQ7L 3QH3A 1JPSH 4ZXBC 3GSVA 1MF2H 4EKXA 5EORH 1X5ZA 4H5SB 4GFTB 2OSLA 3OXSA 3B9KB 3PGCA 4OV5B 4HIXL 1Y0LB 2V5TA 3MO1B 5ESQA 2A6IA 4WU7B 4WO4C 5LBSL 1M7IA 1LMKA 2CO6B 5MHSD 4X5XA 4FQ2H 1KG0A 5C6PB 5ICYA 3MV9A 4H20H 4LKXB 1U36A 3D85A 2APWA 5EC2A 4UUJA 4YUEL 1RVFH 3WEXB 1GOFA 5INCA 4M9OA 4TUKL 3HMXA 3B6SB 5EUOF 3ZKQD 3L5XL 3I84A 2DBLL 4M3JA 1WBZA 2R1WA 4NJAH 4TVPD 4Q9QH 5BV7C 3QEQB 5DMYA 4G7YH 1GVIA 2DBLH 4NQCD 3B3IA 2F5BL 2O5YL 5IIEB 2H32B 3GMOA 4YDKL 1GZQA 3GK8L 2VAAB 4MZ2A 1CYGA 1RZJL 2IPUG 2AJ3B 4AIZB 5E2TH 4ODWA 5HYFA 1S5HB 3MNZB 4XCYB 2AJUL 4MNGE 4UTBH 3QEHB 3MUY1 1NC4A 4MAUL 4PRHA 3T2NH 5C0FB 3WDHA 3I50L 1AFVL 5HGGS 4RA0C 5MENB 1XF3B 3QG6A 2MWCA 5HGHA 5LAXA 2QSVA 3FAWA 1RUAH 5CCKL 1U3HC 3OG6B 4DGVL 3PP4L 2ZSVB 5I1LB 5EO0B 4O2CA 5EBLB 5F97E 3QUXB 1FFPB 4P2QD 4R97B 1G7JA 1XF4A 5CUSH 2C3HA 1SJEA 5DJCA 3HR6A 5IGXH 5T3XH 4H88H 1T03L 4R4FL 2HFEA 4LARH 4D94A 1BF8A 1BVKB 1S7UB 3C09C 4OUUA 5DQ9A 4X6BA 5B38A 2ZUWA 2IAND 1FGVH 4U0RC 1NCWH 2AKRB 2Q8AL 1NGXA 2RFXA 3JV5A 1GH7A 2XFXA 4GAJH 1U93A 4FQPA 4U1JB 5DJ0A 4ZUUA 2VXVL 3U7YL 4ZOAA 3RNKA 5GJTH 4PJXB 2VUOA 1UWEH 1FL5A 3HE6D 4GBXD 5F7EH 2HFTA 3SQOL 3PWPA 1I1CA 1T5XB 4JZNA 2Y23A 4JM4H 5DD1L 5E99H 1MCQA 4TVPH 5D8JL 2K7PA 3S3SA 4DZBB 5FKPB 1YEHH 3QEQA 4XPBL 1YEGL 1H15A 3I75B 4LCIL 5J57B 3VD9A 3W9DA 2ADJA 2HVKA 2R2BA 1RZKC 2DLTA 1ZGLM 1I1AA 2XWTB 5D72L 5DT1L 1PKQB 1CD0A 3OKLA 3TNMA 3UTZA 3V4UL 1OT2A 1VGEH 4NN5B 3GI8L 4NQCA 1L0YA 4ZUVA 1RMFH 2X70B 3WXWH 2BVPB 4NHUA 4WDIA 4Y4FC 1QBMH 5JOFA 1R5VB 4X6CE 1XF3A 2WWMD 3V0WH 2OJZL 4KHXL 4WI2A 1YYML 4HPOH 2KUTA 4RAVA 4CW1B 1QSZA 3N0PB 1P84K 5DO2C 4JRYD 5HVWA 2Z4QA 1MRDL 3ISWA 4NN7C 1BD2B 2CDFA 4U2YA 3TIDA 4FABH 1N3NB 3OKOB 5T1DL 4JFYA 3V4VH 3CH1B 2FLBT 4A2LA 3QHTC 3B2VL 1X3DA 4ZXBA 4NKIL 1G9ML 4LPTA 1JK8B 5DD3H 1EIBA 5A16A 3VFGH 4EDWL 2DOCA 5D7LB 2GUOA 5BXFB 5FB8A 2R1WB 4TRPH 2WWKT 4OLYL 4R7NA 2YSSB 3PABA 5F7DA 3QIBB 5HYQA 1QO3A 2VISA 3LD8C 1DN0A 1R5IB 3EBAA 3BP4B 3CFCH 4UT9H 2E9JA 4TVPE 3GSNB 1JF1B 4MWFA 1HSAB 4P23B 2XPGB 3HE7B 2ZUUA 4MQ7A 5E6IC 4HFUL 3DUHA 4E0RB 2VZVA 3TBWB 3TZVB 4NRYB 4NCC1 1UM5L 5T3XL 4QOKE 1IGYA 4HGWB 1DBKL 4KWUA 5IVZB 3MCKA 2YPVL 3VFNA 3SDDA 5EC1B 1QRNA 5JQ6L 1CU4H 3T0DA 4XC3H 4JG1H 4YHKH 4DCQA 3QCVH 1OAQL 1CBVL 1AO7D 5KSAA 1CTNA 2W9LA 3NCFB 4M62L 4NYLB 1ZHNB 2GK0A 3HE7D 4XTRC 4P23D 3HKFA 1FIGH 1NDGB 3QFJE 3BW9A 5C0BE 1VACB 1QLEH 2PW1B 1ZLVH 5MI0C 4GRMB 1OAYH 3QIBD 4FOMA 4JM2F 2DQEH 4C55A 4HLJA 4HW6A 3WE6B 4CU7A 1IQWH 1INQB 3U1SL 4H1LB 1AXTH 2YRPA 4U49A 4ZUSB 3TZVC 1YPZA 1AR2A 1B0WA 2A83A 1A7RL 2V9QA 1B9ZA 3GJEB 2D0HA 4YFEA 3DV4A 4LF3A 4OLXH 2X09A 4NN6C 1D5IH 1IC4L 1Z9OA 1IGJA 2R1YA 1HHIB 2UY7A 4OZIE 3MRGA 1OM3L 1AKJD 2CDEA 3PXJA 1RZ7L 5DJXA 2YPLB 2PYEE 1MHCB 1IAOB 1MHPL 1OP5H 5CGYD 1OAQH 2VLMD 1EDQA 4N0YH 1XIWB 3QDMA 5EUOA 1FORL 3EO9H 3I75A 4N0UB 3VWJD 1DBKH 3WUWB 4OFVA 4M8QB 2H6PA 3VD7A 4K71B 3CXHK 3T3ME 4OD3L 5H37H 4I13B 4B50A 1X5HA 5ETUB 5FGBC 3U79A 1N6VA 1NAMA 5HYSB 3RAJL 4HLZH 1QA9B 4I1NB 4NHUB 4TTDC 3LHPH 4F37F 4OBRA 2I9TB 3L3GA 5CGYC 3FT4B 1SM3H 1SEQH 4OZGB 2VWEC 3FJTA 4HPYH 5KTEL 5TQ0L 1RZGA 4XMPH 1BFTA 1BZ7A 4DW2L 5HYJB 3HE6B 2CK0H 3G5XA 3DROA 1DVFD 3RY4A 3O3DB 1ES0A 2NX5D 1TPXC 2P7TA 4NKIH 4C58B 4NKDA 1CS6A 2V2XA 3VGAC 4PREA 2D7PA 3TN0C 1P7KA 3RBSA 4P4RB 4IIQB 1IL1A 2IANB 2O5ZH 2VABA 2VLJB 1S7WB 3Q6GL 2GK2A 2ZCLH 5IBUB 3GBML 3RVWD 5J6GB 3LAFA 1DCLA 4MB3A 4FZ8H 1N5AB 5ITBL 3FZUC 5L0QC 1YYMH 4X9FA 4OF6A 4LCWB 1W72A 4PRNB 3C5JA 1RZFL 4CNIA 4LHUB 3STZA 3VFSB 3GJEA 4S10A 1KLUA 1HQ4A 5GRUH 1DLHA 3P4LA 4ZFGH 3OKNA 4ZTPH 3VXSB 2VLKB 4IDLA 2VAAA 3WO4C 2VDLH 3AXLA 1R24A 3QO1A 3RTQD 1NGYB 3D39D 4K8RC 3TPUA 5TQ0H 4AT6A 32C2B 4GS7C 4JO3L 2XICA 4HMEA 4L1DA 5D2LF 1JTOA 1WTGT 3MROB 4OCSH 1OY3B 3VWKA 1KJ2H 4L5FL 4LLMA 1S7QA 4N0FB 3UYOD 5HXMA 2GKIA 4GW1B 3SDCD 4M61B 1PY4A 4DKAA 2CKBB 4UOJA 3VXTB 2HJLB 5JDSA 4HWUA 1FFPA 4NQSB 3V9FA 3SKNA 3M45A 1QR1A 2QQLH 1I1RA 5HJ3B 4K8RD 5IBLC 4M93B 5E6ZA 4HUVA 2FB4L 4YXHL 4G8GD 3C6LC 1ZGLA 1MNUH 1CVSC 4RGMB 5FV1L 3ZT5A 5IVXF 1ZEAL 1KNOB 5EU6E 1MI5A 5FO9A 4ZOBA 4KGLA 3TT3L 3QPQC 4PJHA 5J12B 3ARTA 3X14A 1YEDA 4D0CA 1CI5A 4LNRA 3MGAA 2I5YL 1GC1C 3QQ9D 5DJ6B 5IGXL 1FRGL 1VB9A 2DQFB 2RFXB 3FOMB 2ICCA 1DLFH 4PGBA 3G08A 1ZVHA 2QHRH 4LSRL 5IW6B 2V2TB 2FSEA 5DS8A 4D2NA 1YEKL 2MQCA 4R6UA 2E6JA 5C07A 3PWNA 4PRDB 2I07A 3TJEL 4GRLD 4J3WA 1V5JA 3WFHB 3PWPB 1I8MB 4HQQH 43C9B 4JFDE 1XH3A 2FJHB 2OZ4L 2JK5B 5C2UB 3EYSH 4DZBA 3UAJD 4GKSA 1QOKA 3HC3L 3PQYB 2Y06L 3FO0H 3MRNA 2YUZA 5EU7C 3VGBA 4GG6A 4YO0A 1FVEB 1CLOL 2Z92B 3EOYG 3OKYA 3CDCA 4JDZB 3ARQA 1PKQA 4OF0A 3W2DH 1E4XH 5DMKB 1X5JA 1YC7A 1LO5A 7CGTA 2W9EL 3RGHA 1YEEL 1MRFL 1XAUA 2NY7H 1U8MA 4WU5B 2XI9A 1F4YH 4OZGA 1NPUA 3MNWB 2BC4A 4JFFD 5FFLA 1NFKA 1OSPH 4PR5B 3TT3H 1TJHH 2P7TB 4HC1A 1NSNL 3G04B 2J7LA 2HYMA 5ECJE 4BQ8A 4UT6L 5A1AA 3F62A 3KPNA 5CBAB 4NC2B 5LBSH 4Y8DC 1X5LA 1BIIB 4DN4H 1AGEB 4O4YL 2QQKH 4KI5E 5IHZA 1CFNA 5ESAA 4N0CC 2A74B 4OCXL 5INDB 3QIUA 5TDOA 2NY0C 2VISB 2IGFH 5FO7A 2A6JB 5MP6L 4Z76A 1JNNL 5JIPA 4N1EA 3SKOB 5KAQF 2YXMA 3KPSB 5DR5L 4W81A 2GITB 4AT6B 4E9LA 3UDWC 2PR4H 1CDGA 3QWOA 4RBPK 4X83A 2R2EA 3HZYB 3OSKA 1JHKH 4UOW0 4Y16B 5HI4C 4JDTH 5DJXB 3EGSB 3QUML 4KUCF 5IVZA 1MCOL 3NCCB 1KB5A 1R3IL 1R3LA 3HLAA 5HI4D 3VH8B 2C1PA 1QSVA 4L9LA 5E70A 4PBXA 2VQTA 3SKUD 1T83A 3GMPB 5F96L 3PJSB 3SGDI 4NNXA 4UB0H 3S35X 1A7BA 3C08L 4BSJA 1NFDB 2OXGA 3TESA 5ENWB 2D2OA 2XNAB 3S88H 3HNTH 4PRIA 4G7VH 4QXTA 3WN5B 3DMMD 3QFDA 4JY6A 4WHDA 3KJ6H 5TQ2H 5F44A 3I3DA 4M7KH 3WFCL 1XIWC 3PV6A 1IILE 1OAKL 1F90H 1FO0A 3EYOA 4NZUH 1I3RB 2QQKL 4Y4HC 4F58H 4OLZH 1OF2A 4K55A 3BT2H 3O3BB 2IEPA 4D0DA 1QFPA 1CG9B 4UMGA 1FYTA 1PY9A 4OCYL 3MREB 5HYJD 4MB4A 3SE3A 1IARB 3UBXG 5IMOB 4HH8A 3FAXA 1T5WA 3BKMH 1EFQA 4UDUB 3A6BH 3L3DA 2WQ8A 3L1OH 5AYQA 1BQUA 1WCQA 1MI5D 4HGMA 5KS9A 3JV0A 4BQ9A 1BLNB 5GS0C 5SWZA 3UDWA 1MPAL 4G8GA 5C08D 4G6AC 5I8CB 4JFPB 1KF9B 1IEAA 4B41A 2EEDA 3Q3GB 3CX2A 4OZ4A 3AY4C 1KCUH 3RJDA 3RVXC 1UCBH 4WV1C 3TA3A 3VWJB 1VA9A 3RWGB 1RZIB 5DUMH 1CXKA 2QSCL 2YA0A 2Y06H 2JJSC 2XQYG 4K9EC 3UC0H 3UZEA 4OAWA 3VGGA 5CGMA 4K3JH 2IBBA 1SY6L 3GIVA 4QHKI 4XNUH 2Q6WA 4H8WL 3GMPA 1FV1B 2X9YA 4YPJA 5HHVL 3RTQA 4HS3B 3VFVB 5EZJB 4F7TB 4P0DA 3QULB 4U6HB 1HYSD 5ITFA 1P7QA 2DLHA 4OM1H 4U3HA 3VCLB 2UYLB 3GUTB 5E1HB 3IKKA 5KVFL 1S9WB 4WY7L 4ZPVA 1MSPA 3U7WL 5DJAA 2ESVA 2OK0H 1FZMB 3AGVA 2VSCA 4HKXA 2AJVH 4JKKA 3BH9A 1IE5A 4HWEH 4U1SA 4PJ9C 4UQ3B 15C8L 3SKMA 3VFWB 3V2AR 1ZLSH 4J2XA 1MHHB 1YMME 3QUZA 5HBBA 2IPUK 5EU6A 4LU5H 4Q6IA 1UM5H 4W4OC 2AI0H 4X80H 5FCUH 4N9GB 2GTZA 2MMXA 3NCEB 4OB5H 3D3VD 1VEOA 1F02I 5F7MC 3O4OB 1FCCA 4G42B 4EZMA 2E7MA 2DYPA 3KPQA 3L3HB 3CH8A 1H5BB 5CZXD 4M61A 3DVGB 4MJ6A 5L8LB 2V6HA 1KFAH 3HRZA 2HVKB 3HUJA 5IEKB 1QNZL 2DM2A 1T22A 1ZHKB 3B2VH 3TNMB 2BSTA 4AEFA 3GSUB 4URTB 2RHEA 3KNBB 4ZTPL 4HBCL 1Y18B 3NTCL 1X7QB 3ULVD 3HPJB 3MA9L 4GXUM 4LQFL 4HHAA 2R39A 5CINH 1X6NA 2EZ0D 2VTFA 2QQNL 3QP3A 3X14B 1B4JH 2W60B 5GGUA 2DKUA 3K3QA