1TETL

Crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCKSSQSIVHSSGNTYFEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYEWHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 TE33 FAB (LIGHT CHAIN)
publication title Crystal structure of an anticholera toxin peptide complex at 2.3 A.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 51
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL01
4D0CA 2P8MB 4LMQE 1G7PA 4JHWL 3ARDD 3U83A 2ESVB 5E8OB 5C6PB 2AXHA 2PO6C 2FGZA 3NOIA 4AIXA 3MXWL 4E41D 1EXUA 3OKLB 4OUUA 5GS3A 3O3BB 3D85D 4O9HL 4LSRH 3MRDA 5TQ2H 2VQ1A 4QHUA 2CO6B 1T3FB 4DKAA 3WFZA 2VSCA 3KDMB 1BM3L 4XPBL 1MJ7H 1O0VA 4KPHL 3FN0H 4OZHF 3HRPA 4Y2DB 3O6FC 1K2DB 3E6HA 2FIRT 3WFEH 5AZEH 3MUHL 4JFDD 3UC0L 4BYHA 3RVXC 4Y19D 5DRNB 3QUZC 5JW5A 3NPSC 2KKQA 1S3KH 4M61B 4HIHB 2GKIA 3P11H 3C6LC 5D5MA 3C87A 3OSKA 4Z8FH 1W0VA 2IFGA 3NPZB 3MRLA 3MLPA 1GC1L 3RWFB 3P9WB 4Z95H 4CU7A 1TJIH 4M43L 3V6FA 3DUSA 3PWJB 3QXVA 5CINL 1TJHL 1U8KB 3VWKC 3KNBB 1ACZA 2NY7H 4Y8DC 3LEYL 4ISVB 1WJ3A 4JZNB 4YK4C 1YN6A 4U33A 3O2DL 1MH5A 3C8KB 3VU2A 5KS9E 5LCVL 4JB9H 1ZHKA 4GMTH 3DARA 3QAZC 5IVXF 2UYLA 4I0PB 3L3GA 1F4XL 1S7RB 4PJGF 3V5KB 3BW9A 1GGTA 1FL6A 4ZXBC 4DTGH 3EYQC 1U8OA 2OSLA 3LHPH 1BIIB 1U93B 3SKJL 5C1MB 1R5VB 5DJ8B 1UB5A 1I8LA 2B39A 3I6KA 3N85L 3FAXA 4Z78B 5J06A 2ERJC 5E70A 3U0PB 5EBWA 3FO9A 4HJJH 5DUPL 2ARJA 1BOYA 3LZFL 5FA4B 1E28B 5SX4H 3BPCB 1YEIL 3WLWC 5B39B 1WCBB 1PBYA 4WFEE 3BESR 2DMKA 3TO4B 1P53A 4KK8D 4HEME 4FQIL 5JPNB 43CAA 3FRUA 3ZKXC 5DK0B 3VXUB 5ALBH 1H5BB 3QJFB 5LXGL 1KENH 4I77L 4G3YL 3LEVL 1V7MH 3JBG7 1DE4B 3UTTB 2BSRB 3S36H 5D1QD 2GIYA 1MFEH 3ZT6A 3RUGA 5D5ME 4LIQE 2BCKB 2BZDA 1Q0YL 1PKQB 4KDTA 4O58H 1F4HA 3RZCA 2Q20A 4U1KB 2CUIA 5L9DL 1J12A 1N6VA 4K94L 1NDMA 1RFDL 1LO0L 3LPWA 1MCNA 3HAEG 4JQXC 5F7UA 3W9DA 3LSOB 1LP9F 2IBGA 3D0VB 1I8MA 4UTBH 4NKDB 5DDHA 2RCSH 3DRTA 4MAYC 4BM7A 2F15A 1KEGL 3GI8L 2IPKB 1HSBB 3S37L 2Y36L 4YHML 4N1EA 1A9BA 1NCTA 4OZ4B 4FG6D 4WW2F 3JTTA 4YDKH 1CICA 4OCYL 2J8HA 3PP4L 1LNUB 4S1QH 3PL6C 3HHRB 3F6IA 5C2UB 4G8GD 2DRUA 2Q76B 3V7AE 2K3TA 1W72H 3ILQD 1OAQL 2Q7YB 4PGBA 4Q2ZA 4WGVB 5J6HA 1AXSB 3TNNB 3EOAB 3HG1A 2IAND 5H94A 1MCFA 5JDJA 5DVNA 4GAYA 3QIUC 5H2BB 2H9GB 1UM5L 5F9AC 3T8XB 4JRYB 4I4WA 1KJ2H 3BRGC 1YQ2A 3KJ4C 1NC2A 4PJEB 1U8HB 2R2HB 3QXDB 3KWWB 4E0RA 4MJIB 2DDQH 4U1GB 1Q9LB 4ZUVA 2ADIB 1J0ZA 4P46B 5I73B 2W92A 3MACL 2HA1A 5C0RL 3DXAD 2G2RB 3ZE0E 4EVNB 2JJSA 2Q1EA 3F7QA 5DZOA 4FQCH 2FECL 4MHHI 3F7YA 3RUGE 4MNHB 3DI3B 3WNLA 1QBBA 4Z0XA 5B4MD 3WKMH 5T1DH 4DN4H 3MFFB 2A0LC 2CDFA 1T7VA 1D5ZA 4ENED 4JFED 1A02N 3OJ2C 1EZVX 1TPXC 1UCBL 3ZZ1A 5L6YH 2XNAB 4OV5B 5JIPA 1I4FB 3MRFA 4KJWD 4LCIH 1AXTL 2C4XA 5GSRB 1TNNA 1SEQL 3L5WB 1AI1H 3LOWA 4W70A 1XF5B 1J88A 2Q8BL 5E2WH 2VSDA 4UILL 5C0CB 3RJDA 2CK2A 2KBGA 5JW3L 1LVEA 3G5VB 3IU3A 4OAWB 5TF0A 5LGKA 1GJIA 1EAPB 5I8EB 3PGFH 3NCYS 4YHIA 4XP1L 3FO1B 4KZDL 2D4DA 4DVBA 5DJZB 3EOTH 1VERA 3D18A 4MAUL 4JRXD 5DD5L 2EICA 4NKIL 4KAQH 5IMOB 3D2UD 5B8CC 3TBTB 2I9LB 5C3TA 4EI5D 2NCMA 2RGSA 1R24B 4K8RD 4KI5D 2LU3A 3HB3C 4I9WD 3CMGA 1ND0B 4OLVH 3ESUF 3TBSB 4BFIA 1FZKA 3BZ4B 1A7RH 3TH4T 3ALWA 4UUJB 1CE6A 5I1EH 3MJ8B 5C6TL 5J4MA 2EZ0D 2F54A 3IF1B 5JLZA 1A47A 1ZVSA 3L9RB 2ZSVB 2C7UB 1WWBX 3MNZA 4HCRA 4X8JA 3VE0A 1WTLA 4M6OL 1RJZB 1ZS8A 2H32B 2AJZB 3ZDZF 4I48B 4L8CB 3W39B 5DZLA 1I9RH 2DQFB 3O41A 4OCNC 1YY8B 1OGAB 4KMLB 4NOBA 4JFZH 3EFFA 2Y25A 1W72A 4TNVK 5KSUA 3BPLB 4QXTB 5HYJD 4OKVB 5D2NC 1F4YL 1UC6A 1WGOA 4KKLD 1MAJA 4Z7WA 5EWIL 3RNQB 4PGJA 5JHDA 1I9JL 1PDKA 5I17B 3A6BL 3P0VH 3F58L 2XPGA 5DI8B 1A6TA 2JCCB 4MVBD 2WWMC 5F6IB 1KJ2A 4UQ3B 1CXKA 1XH3B 1NMCB 4IDLA 1EO8L 1BZ7B 3RA7H 1LP9E 1UADC 1FBIL 1EHXA 1EEZB 1MIMH 5E1HB 3S5LG 2X4PA 2FWOA 3D9AH 1C1EL 1EZVY 5D7SL 4PGDA 2DQIH 3VXSB 1IAOB 2D0FA 2J6EL 4N0UA 4NRYA 4XCYB 4UV4L 3WFDL 3DWTA 3QIBB 2C3VA 1KV3A 2PW1B 4PRIE 3L95B 1YPZB 4WV1A 3U30C 1R3JB 4FNLH 1D6VL 4HH9A 1FFNA 2NLJB 5JW4N 3KPOB 5EIVA 4OZFG 5JOPD 1NEUA 3K1KC 4LAQH 4U6YB 1X3DA 3ZYZA 5JZ7D 2F74B 2XQYK 4ZO7A 2N1KA 4YDLC 1M71B 4JREC 3CIQA 3PWPD 4V1DA 5I66B 3NA4A 2GEEA 2QQKL 5F7YC 2DL9A 4NO0D 4NC1C 1NGWB 5CEZL 4DAGH 1NEZB 2YZ8A 1IFHH 3TT3L 4X5XA 2XQBL 1CFSA 3CVHB 3O3AB 5KSBF 1BD2B 3DVNB 3ZKMC 2F5AH 5ITBH 2VH5H 1T83A 1UACH 2RB8A 1D5MA 4YDVB 4I8DA 4M4RA 3WFBH 3TN0B 4F15C 1I8KA 1HH6B 3U6RB 1A6ZA 5HHPA 3MV8D 2X4OB 5C0BD 1INDL 2VQUA 2Z35A 5GRXG 1DUYB 1P84J 3IB4A 1FVCA 5HI3D 4ZAKA 4HKZB 1Z2KA 2H3NB 3JSSA 4Z7WE 2DM4A 2JIXA 2OTPA 3DX7A 1IQDB 4RFNC 5A2FA 3BE1H 5EOTA 1A7BA 2CH8A 4AM0B 1OPGH 1CG9B 5IHLB 2VL5A 5ICZB 1KPRB 2KZ1B 1F00I 2R29L 5C0AB 4NWUL 3UYRL 1AR1D 2P44B 2WUCL 2BSTB 3L7FA 4FZEL 1F4WL 2QR0B 1KCSH 1OSPL 3UDWA 2HVKA 1MCOL 2I5YH 1B6UA 5IG7B 3VH8G 4G7YL 4C56B 2W9DL 1MVUB 5EBLA 2VAAB 5CD5C 4XVSL 5D9SA 1JWSA 1P4IL 2WBWB 1UEMA 4J8RA 3LQZB 4NNYA 3T4YA 5DMGD 3O2WH 4N9GA 3RQ3A 1QOKA 3WLBA 4N0UE 4XTRD 4Q9QL 5FUCC 4WNQB 2P8LB 5GJSH 3FQWB 1FZMB 5ETUB 3SGDI 1ZGLP 2IAMA 3KPSA 3NVQA 1CT8B 3CMOH 1MLCB 1GAFH 4LHQB 2EEAA 5SWQB 1EEQA 1V7NH 1G6RB 1HSAA 2O61A 5I8OL 2YS4A 5GRUH 3OKMA 2ZOKB 3L3KB 2AJSL 5IWLA 3C6LB 4V1DE 4OTXL 4N8CH 2DLHA 5SWSB 1S78C 4P2QA 4XCEB 4QF1A 1L7TH 2CUMA 4OIIH 5FV2A 5JXEC 5GGUA 3IFPB 1L7IL 1I8IA 2AK4B 4WI6A 1QQDB 5IK3A 2YPKA 1U3HB 1PW3A 2V2WB 3QUML 5K9KB 1AFVL 1WZ1L 1BFVH 1A6AA 4JM4H 3L1OL 4YK4B 3VWJB 3S34L 4J4PA 1UG9A 2P4AB 3A67L 4XHQA 1Y18A 5F7LB 4A2MA 3QEQD 2G75A 4NO3A 3K81A 2DN7A 5I16A 4ONOA 5IFJA 2XKUA 2ORBL 4JO2L 4BH7A 4MDJB 5T1KD 3UAJC 5ACZA 3ARVA 2NY3D 5E8EA 2PO6D 4IIQB 4XP9L 3TC9A 5DD3H 4PJFF 2FL5B 2Z92B 4DKFL 3T2OA 1QYGL 7FABL 1F3JA 2ERJB 4JKPH 3S97C 4UU9B 3OB8A 1MCJA 1K4CB 1OCWH 4M1DH 2CJUH 4UT9H 5ADPL 3FOLB 1FL3A 3IJHB 3WUWA 3RU8L 3U82B 1V3JA 3LKOB 2AEQL 3O6FD 3V7MA 1BOGA 5IEHA 1FYTE 2X1PA 1KCVL 3KPSE 1A9EB 4R0LA 4PR5B 3MV9A 3ZE1F 4JY4B 1RJYB 3CSPA 2Z31C 1XEDA 5T3ZL 1U8JB 3G6DL 5DHVB 3E6FA 4XZUB 3QUZD 2D7QA 4PG2A 2OZ4H 4PJ8C 4HK0A 3FFDB 1RUML 3RKDC 5TJWK 4HUXA 1Y0LB 1MCLA 3RWEB 5C0GA 4CUCA 3TBVA 4OGAC 4IHOA 4OLUH 1JNLH 5KSBE 2V2TA 1AGBA 2M26A 4JFQB 4JVWA 2VDOL 3NCCB 3RHWF 4PY7A 4D0DA 1T1WA 3BFOA 5GRJH 4CDGC 1JZ8A 5E8PB 2YD9A 3OGCB 1KT2B 1IQWL 5FOBB 1ZA6B 3VWKD 2BVQA 5DJ0A 1R3KA 1NCUA 2FHBA 4OLYH 3B83A 5J3HC 1RZKL 2GTWB 5JORA 1WEJL 1U8PB 3NACL 4PTUB 1U6AH 1VSCA 3BKCH 5KTEH 5I18H 3QJHB 2A2QT 4MNGA 3QULB 3LKQA 5DRZA 4WO4C 3R8QA 4YHOH 1Q72H 3QNYA 2I9TA 3PL6B 4PP2A 4HDIA 4ZXBD 3QUYC 4YZFF 4M6MH 1ZLSH 2JF1A 5TGBA 3BGFC 5BZDB 4BZYA 5ALCL 5C0EB 5EZOL 2FJHA 3MJ9L 5DD0L 1NBZB 4UV7L 5DA4A 3L3IA 4XMPH 2E27L 3MC0A 1VPOL 4FXGB 4X6BB 4JRWA 3TZVA 2EDOA 1RMFL 4AMKL 4Y1AB 1FE8H 2NW3A 1NCDL 3BP4A 3CC5A 4N8VA 2P24A 2VXVL 4ODUB 4XNYH 2K9UA 3KJ4B 3FB7B 5JIIA 4LLAA 2HWZL 1YEHL 3MR9B 1QRKA 4DGVH 4FN0A 1N5YL 1J5OH 2IQ9H 3JXAA 3MRHA 1G9MH 1PJ9A 3AMLA 3MLXH 4HBCL 4LCYB 3RAJL 4FP8H 2XZQL 1NBVL 4PLJD 2VIRB 3KR3L 2ICWI 3JVGA 3OJDA 3T2NH 2V9QA 5C8JB 4LNVA 3TJHC 5DEFA 4RGND 4I0CC 1OP5K 4KVNL 3HA0A 4PS4H 4OZIA 3MCLH 3ABZA 1OP5H 1GGCL 4UT7L 4EQ2A 1N4XL 1RZFH 3IDYC 4J1UB 5CUSL 5CSBA 4XT1C 2NY6C 5SV4A 3LPFA 4G9DB 1W0WA 3ZKSD 1AD9A 3VFRB 4HKBB 3DX9A 3QEGH 4G5ZL 3VW3H 2IPTL 1RVFL 5DK2A 4NO2B 5LVEA 4YBHA 1F3DH 4LLWA 2X05A 2YD6A 4M1GL 3MO1B 2QBWA 2BOCA 1TFHA 1ZT4B 3VXQA 5AEAA 1BP3B 2R0KH 3PDGA 4YUEL 1WC7A 4MAYD 3HC4L 2LQRA 5DJAB 2WIIA 3V4VH 2OZ4A 5F88B 1XCQB 2L0DA 3GUTB 4MNGE 4JG0H 2N7BA 4BSVA 3PXHA 3FQRB 4LCWA 3CX2A 1K6QL 1FZJB 2C1PA 3E2HB 4PJFE 4X99B 4OCSH 1HOCA 5BZWA 3QNZB 3WN5C 1F6AB 1CGSH 1DQML 4ZPTA 4BZ2H 2Y5TB 3ARUA 4MD4A 3ZO0A 4L3CB 4L9LA 4DUVA 2EKSA 5GGQL 3QIUD 1MFAL 2XIDA 3Q2CA 3CFJA 3U4EA 5GHWH 4D9RE 3VFPB 3KLHC 1SY6L 4X83A 3PIQB 3TF7C 4QCIA 1U8IA 2G5BA 3QO1A 3ZE1E 1HQRB 4YDJA 3O6ML 3SY0B 4PGCA 4WWKA 5JOEA 1KG0B 3GBLA 1MQ8A 2J5LC 2EDHA 4BFBD 4P9HH 3ARDA 4HXBL 1YMMA 4LVNC 1R0AL 8FABB 1XGTA 4E41A 3KLSA 2FDBP 4OZIE 3OG4B 3B8YA 5EOQL 2VLMD 1ES0B 1IBGH 1T6VN 2LAGB 1I1AC 3MLYH 2A0LD 2XTJE 4R7DB 3SDDC 3VJ6B 5FO7A 4ODSH 3GMNB 5IB2A 5FGCE 5L7XH 1KB5B 1KN4L 1UWGL 3IDGA 2G60L 1MCHA 3D39E 5J1AA 5IKCA 3QCVL 4XNXH 2HYMA 3MLZL 2JB5L 2Y1VA 4X9GA 3TPUB 4P99A 1XR9B 1H15A 1QSVA 4JFDA 1MHEB 1CGTA 2PYEB 4XAWH 3VXRB 1G7LA 4WCYH 4APQC 1UA6H 5DO2C 3O6KH 4Y19A 5DJXB 4PJXB 5D1ZD 3NZHH 4OQ1A 2F58L 4WFFD 4ZFGH 5JHLH 1XIWC 4LCWE 5DMIL 3V0VA 2F8OA 2FIKA 4GKSB 4NZDA 1T03H 2D7TL 5C0DB 2DS4A 2OYPA 3MUJA 4JVPA 2V2XA 4NQVB 3HB3D 4ZQKA 2WWKO 4WEBH 4AIZA 2Z4QA 1J1OL 3FCTB 1YYMH 5BOPA 1Z5LA 1EHLL 1NCBL 2IGFH 4KDVA 4U1IA 2VKXA 5E00A 1IGYB 3GMMB 1FGNL 4XCCH 4KKAD 1S5HB 2X4UA 3MOBH 4KJQC 5F96H 3S96B 1NGXA 3P77A 3QRFM 2BNQD 2R0ZH 1C08A 1MFCL 3VFNA 2R0WL 2AEWA 4I13B 3S98A 4I3SL 1F3RB 5IBTH 1HXMA 3ARFC 2BOBA 2XYCA 1P7KA 1NFDA 4I0KA 2P8MA 4PG9B 3M17A 3P4OA 3QPXH 3EW3B 5E8OA 1VKXA 2R8SH 2DLFH 2CIIB 3CD4A 5CCKH 4E41E 5MERA 4UQ2A 4RFNB 3GBNL 3NABL 4X6DB 1L9NA 4FMKA 2MWCA 2Z91A 5D8JL 1AR2A 3QYCA 3U7YH 3RFZC 2WWMD 1KIUA 4EKXA 3MLRL 4LFHG 1WZMA 3KDMA 3VDAA 4NNXA 4JY6B 3LCYA 4ERSH 1ZVHA 2HRPL 3I9GL 3FTGB 3UTQB 2EDFA 2CDEB 5FB8B 1UYWL 4X5WA 5EORH 1MEXH 4JFDE 4PUBL 3BZEA 3NFSH 5DRNA 1I9IL 3M8OL 4Y19E 5HPMB 1XF2B 4FTVD 2VDKL 3BXNB 4ALAH 2FEEI 5D1QA 2YC1A 3SGEH 3SCMC 5TE4H 3L3JB 1HQ4A 1C5BL 2DQCL 5J13B 4HF5L 4U1NB 3QIWD 3EFDL 4RMWA 1DN2A 3TBYB 1IEBA 3RWFA 1NC4D 4HJGA 4K8RH 2DJSA 2P5WD 2Z93A 3VXNA 5EBMA 4W81A 4Y4HB 3FRPA 2ITDA 5CSGA 1AO7B 3AXLB 4IDJH 3NAAH 3H3PH 2DLGA 1JGVL 2ADJA 4U0RC 3B9VA 1J0YA 3OWEA 3SDCC 2E6JA 3ZKMD 4OT1L 1WAAA 4X8XA 4XP6L 5E9DD 5DLML 3WIFB 1E27B 3MCKB 4K3JH 5I8KH 4MXVF 1U8MA 2BNUB 1EHAA 4P57A 3V5KA 3WCYA 1NFDE 1TMCB 2X9XA 4Q9RH 1IC5L 4X6CF 2ITCB 3IDJB 4G8GA 1F11B 2FO1A 1YEJH 2PTTA 3QSKB 3C08H 5HYIA 2A38A 1U93A 4F3FA 5DFVC 4NKOB 3ARXA 5D72L 4Z78A 2XXCB 2IANA 5HXMA 1KCKA 3U0PA 5DT1L 1OQOA 1WTGT 5IR1B 4YXHH 2I07B 3BGAA 4MD0B 4D9LL 3O3UN 5HGHB 2B4CL 1WCBA 3WO3B 4XWGL 3IU4L 1SM3L 4RAVB 3TO4A 4P5KA 5CD3A 1BQHB 1C12B 5ICXB 4H1LB 4L4TE 5DK0A 3VXUA 2QSVA 2YEZB 1JGLH 4EIZC 3DXAA 5HJ3A 4TUJB 5F1SA 1KPVB 2A74A 3UTTA 4HZLB 2FO4A 2X4QB 3EO0A 4QNPF 4WW1A 1EEYB 1MHHB 5T1LB 2VXTL 4Y5VB 2ED8A 4RMTA 5EUOF 1TVHB 2ZPKH 4WY7H 4S2SB 4B41A 3UROR 1PLGH 1H3PL 4P2RB 4PJ8B 3ET9F 4OD3L 4JFEA 1K3ZA 4OM0L 3HPJA 1CD0A 4K3DH 4HC1L 2P5ED 4YR6A 5CBEA 3ZTJG 3UTSD 2Y6SC 1YEEL 1S78D 1EVTC 3RWHB 2O5ZH 5JXED 4K7FB 3E8UH 4CU6A 1A14H 1WAAE 1KELH 3FQXB 2AVGA 4NM8L 1R6VA 4LAJH 4XGZB 2VABA 3BD5A 3CLFH 3QXAB 5D6DC 3HTLX 4LSQL 1A7QL 3QXUA 4N90E 1S7QA 4OD2A 1C7TA 3O3EB 1R3LB 4G8GE 2F53B 1EDQA 5I6XC 4EI5A 3QG6B 3REVA 2HJFB 2ATKA 3RNKB 4ELKA 3HS0B 2V5MA 4ODHH 3FT2B 4BQ9A 2ZWLT 1QHPA 4NBZB 2LTQC 4FFZL 3SGKA 4NFCA 3GMQB 3QUYB 1YJDH 3T8XA 4P3DB 4PLKD 3GSNL 1ODAA 4RMSA 4JY5H 5FCUH 1RI8A 2EEBA 3H2WA 3QXDA 4OFPA 3ARPA 3FONA 3FFCB 4MJIA 3W0WD 2ADIA 1FL5B 2XRAH 5ABDE 1E4KC 1VENA 3QUXB 4GSDH 1YQVL 4S1DD 1EH9A 2UVFA 4DK3A 3AS3A 5CMAB 2V5TA 5ITFB 4JM2B 3GMOB 2E6QA 1T89A 4X80L 4MCZA 3TJEH 1AE6H 5F7KC 5HYJA 3N9GH 1HH9B 3G04A 1W8OA 1FDLH 1URLA 1JF1A 3HMXH 3LIZH 2Z31D 3QQ3B 1SQ2N 2WQRA 4XBEL 3SGJC 1PZ5B 2EDBA 4PBXA 5FECA 2W1NA 3OAUH 5ESVA 3UPRB 4JFEE 4ZS6C 5HYFA 4R90L 1OM3L 2IPUK 1G1CA 3QCTL 4HHAB 1G9NH 5DF0A 1KPUA 3CXHJ 4KK5D 4OGAD 5I1CL 5DS8A 1T5XB 4ODWB 1XF5A 4PJAB 3DO7B 3S88L 3HRZB 5GGVH 3BIAX 3U4BL 4WHDA 4O51B 1S9KC 5T33L 1A1OB 1CN4A 3X11B 2AJXL 4B50A 1B0RB 1JWMB 3DIFB 5C07D 4CVWA 1EAPA 3IXTA 5I8EA 4NWTH 4DCQB 2OL3L 5BRZD 5J3HD 1XGRA 1J0HA 1CK0H 4JRXE 4RISH 3VI3F 3TBTA 4OFDA 3EGSB 1S7WA 4M48L 3LN4A 2DQUH 5EC2B 4KI5E 4F33B 4I9WE 4JPVH 4WO4D 1J8KA 1CBVH 3ROOB 4ODXB 4B5EA 5IVZB 4DW2H 1GGBH 3UYOD 5CHNB 4S0SD 3PWPA 1F58L 3IF1A 3MUGB 3LEXB 4I5BB 5EPMB 4TTDC 4XC3H 1QEWB 5DWUH 5KAQF 1VCAA 4WFHD 4PJ9B 4RIRA 1NBQA 1TZHB 2FJFA 4HT1H 2AJZA 2EDYA 3DUUB 4L8CA 3W39A 2I27N 2BRRH 2XZAL 1KIRB 3RDTB 5C0BA 1OAKL 1OGAA 3HI1A 3NH7H 1S9WA 4QNPE 3W9EA 1CU4L 1MCSA 2DBJA 5TFSL 4MQ7B 4QXTA 3OB0K 4K23H 2H41A 2DM7A 3RNQA 2YBRA 2PTUA 3OB0H 4LARL 4KVCH 2QEJA 5EU6E 2W60B 2A6JB 4HAGA 3FO2B 1AIFB 2C5DC 3TJHD 1T80A 2JCCA 1LO2H 1G6VK 2J5LB 3A6CL 3H9YA 4XVTH 1IGIL 1B6DA 4LVNB 1DEEA 1MCRA 1CE1H 4EI6B 1J11A 1DQLH 1BZ7A 12E8L 3ZTNH 5L2KB 1HEZA 4F7TB 1INQA 1CFNB 5A2KH 5FYLH 4FQ2H 2NY6D 3BDYH 4LIQL 1OQXA 4QOKD 4ZFFB 3SDDB 3AGVA 2EH7H 3VXSA 4Y4KC 4NO5A 1WBZB 4KTEH 5DQDH 1IAOA 2DTSA 4N9OB 5TE6H 6FABH 2HLFD 2XWJB 1JUFB 4GRWF 1UJ3A 2XOTA 3QUMB 3IKCA 3QWQB 1CL7H 3HMXA 1IAIM 2VLKB 1YPZA 4PRHE 4LSUH 3SO5A 1R3JA 1HWHB 5FKPB 4N1HB 2W59A 1FIGL 3IFLH 1FLRL 4GRMA 2W9EL 1RZ7H 4APQB 3KPOA 5E5MB 4HIXH 5JOPE 1HINH 2F74A 1Q9KB 5K9OB 1ITBB 1BEYH 3HFMH 4U4BA 4U2ZA 5LJYH 4KTDH 5I66A 1NJ9B 1WQVT 3JWDC 4UOJA 2FB4L 2HFGL 1SYSB 4NCC2 1LO3H 3WFHB 3ARZA 2E9IA 5BVPL 5GISL 3DTXB 3LS5H 1HHJB 2B4CC 4YDVA 1FPTL 4JPWL 1T04B 3OXSB 4A6YB 1WITA 3TGXA 1SVCP 1HH6A 4BFGA 3MV8E 3CSYA 3WNPA 4PGEA 1NMAL 3NN8A 1T21B 1IGJB 4GXVL 2VAJA 4RWHA 2FATL 5C0BE 3W82A 3KLHD 1DUYA 3T4AA 1MJJB 5KAQG 1MJ8H 1AGEA 3KPQB 5ADOH 1BJ1H 4IS6A 4LU5L 2EYSB 4J3OC 2CUHA 4HEPG 5T1KA 5ICZA 1KPRA 3SDXB 5C0AA 4H25A 4PB9L 2PO6A 1M7IB 5IBLC 1RIUL 4OZGB 1UFUA 1WBXB 4C56A 3EJYC 1AGCB 5IG7A 2YA2A 4QHNA 3IJSB 3SDAC 2VAAA 1I1AD 4XCFL 2R2EB 4LSRL 2GJ6D 3GSRA 4KUCF 3SJVD 2Y4SA 3LQZA 1Q9WB 4RFOH 3C5SB 1KTLB 2IEPA 5CJ5A 3T09A 2AGJH 2HMIC 4P0DA 4IRSB 4NNPH 2FNBA 4F9LC 2MOVA 2P8LA 3O6FA 5TDPB 3VI3E 1DJSA 1JI2A 3W11C 4QYOB 1QR4A 1A0QL 3WFEL 5AZEL 1MSPA 5K9JL 3DX8A 1G6RA 3QUZA 4F7PA 2W65A 3O4LD 5EU3B 1HHHB 1XIWD 1LO5B 2VERN 1KUMA 2CR3A 2AW2A 2VDNH 4JFHD 3C6LA 1CQYA 4XNUH 3ARGC 3P11L 3BPNC 3DYPA 2YD5A 4W6WB 3BH9B 5DJDB 2YKLL 4Z8FL 5SWSA 2EDJA 1QPPA 4POZC 3AB0C 3P73B 1RSFA 4FHBD 4NT6B 3LD8B 3BPOC 4Z95L 4P2OB 2QHRL 3IVKA 5JO5B 2JELL 2V2WA 3RX5A 5DVOA 3AM8C 5K9KA 4L8BA 4KJQD 3PWUA 3VWKA 1U3ZA 3QFJD 4U2YA 2NY7L 3OHXA 5IW1A 5INCB 3SDCB 2X41A 2Z8SA 2FHFA 1JHKH 3QEQE 5L8KB 5CWSA 3S4SA 4N0YH 5J56B 3ARFD 1OP3K 3T1FB 3B4NA 2NZIA 5EN2A 1FC2D 1WVZA 3KPMA 5K93A 1OP3H 3RPIB 2FX8H 4YHZH 4ZXBA 3UBXG 4GKNA 1GPOL 2Q86A 1OTUC 4NM4H 2I25N 3OJVC 2D7NA 2YRZA 4DTGL 2ED7A 3LQAL 3WFCL 2OJEB 3C6SB 2BFVL 4F80A 3WXVH 3ULVD 4WEMB 4LSTL 4UU9A 4K3EL 3O8XB 2FH8A 1DBAL 3U9UA 5HTSA 4GG8B 4HJJL 4LDOB 2LU7A 4GRWE 3IJHA 2YOCA 3L6FB 2KDGA 3LKOA 1OAZL 2IQAB 4OLWL 2D0HA 4AEEA 1NBYB 5HHXL 2B8OT 4PR5A 5EOCJ 2A6KA 3AREB 5CIPH 3PJSA 3H7BB 3CH1B 3KYKL 1RUKH 5ALBL 1U8QA 1KENL 4GAGH 5CGMA 1V7ML 4MZ3A 3R1GH 1R3IH 1FP5A 5HBBA 4HWBH 1DBBH 4I18C 3SCMD 3S36L 2IADB 4KU1A 3FQTB 1MFEL 3L7EB 1B4JH 4BQ6A 1QFWM 4JZJC 4GS7C 1IAII 5CP7B 4MA1C 1A6WL 2F8XC 1A6PA 2YPVH 1KSRA 5C08B 3EYSH 5E8PA 3VGAB 1LDSA 2FX7H 4JLRA 3I75B 2WNGA 4JQXA 4PRNA 1NSNH 4O9HH 4TRPH 4U1JA 3B6SB 4UTBL 4MAYA 1U8PA 5CJOL 2RCSL 3RWJA 2RAMA 2B5IC 2ZUWA 3HE7C 4OCLC 4X4XB 3QJHA 4PJHF 4XPBH 3D5OF 5JPMB 4JDVA 1JMXA 5IT2H 4ONGH 3PWVA 4I3RH 2DKUA 3PL6A 4R4BA 4YDKL 4XPTL 5F8QC 4S1QL 1QSED 5DC9B 3R8BB 3QDHA 3UC0H 3CZJA 1W72L 5BZDA 1BLNA 3RVWD 5BXFB 1CVSC 4J12A 3PABA 1FRGH 5DJYA 3QIUA 4Y1AA 4ODUA 1JHLL 3FB7A 2X09A 5C09E 4GO6B 1JRHI 5EZLA 5DC4B 1X5KA 5CINH 3V5DA 1PG7W 3NFNA 4F58H 2VIRA 3O45A 3GMLA 4OFIA 4HS6A 4JFFB 4MX7B 3BHBB 4UT6H 4XI5C 4WUUD 5C8JA 4PD4K 3F6LA 5CFHA 3B9DA 3O2DH 5TPWH 4RGNE 4XP4H 5D6CB 4FQCL 3TCLB 5JDSB 3MBED 4MWFB 2FYYB 3KG5A 4QRPD 5BV7C 2NXZB 3LB6C 2A77L 1F4XH 4ONFL 4ZUSA 4J1UA 3HZVB 2VISA 4HK3N 2D03L 4PREB 2UY7A 3WKML 4DN4L 2BNRD 1ED3B 3LKNB 5CGYC 3CXDH 1XGPB 2Y6SD 4ZODA 4U6XA 3WD5L 2YD7A 3BDBA 4O4YL 5CIPA 3DVFA 1RULH 2VLJB 3UPAA 4PJ7B 3MRKA 5D7LB 4WTXA 2NTFB 1I1YB 1D5BB 3CH8A 1YEDA 4HWBA 3RL2A 3RGVC 1NH6A 2O5YL 2PF6A 3U36B 4JDZB 4POYA 4FQIH 4K7PY 3RZWA 4FQQA 2HN7A 3R06B 5B8CA 5MEND 3TIDB 1TDQA 1FZJA 1IEHA 1JPFA 4BKLB 5BS0D 3KHOA 1KCUH 4I77H 4BQBA 4X4YB 4GRLB 3C2AH 1F6AA 3D3VD 5TDOB 4MCYA 2YR3A 4KQ4H 1N59A 4LPTA 1D9KC 2OTUB 4OLVL 1QSFD 4I2XE 5FYKD 1NGYA 1R5WB 5C3LD 2AJUH 1FVEA 4KRPB 1A7RL 1MUJB 3KXFB 5M7QA 3E1F1 1Q0YH 1JYNA 3DYMA 3VRIA 2FBJH 3QISA 4QHKJ 4MXWH 2BNQA 3O11B 1RAMA 2NY4B 1LK2A 4RFEA 2DYPD 5L9DH 3G6JF 1HQRA 1RFDH 1LO0H 1MFDH 4EUPG 3LAFA 4O2CB 3RL1B 5IESH 1F8TH 1S7UA 1I9RL 4ODTL 4NKMB 3X14B 2BXZA 3LDBC 3NIGE 2PXYC 4TVSa 3L5HA 4JFZL 5ISZD 4HPOL 5D2NA 4J3WA 8FABA 1FV1A 5F7EH 1FNFA 4BH8A 5I1LB 5IBUG 4YHMH 3TV3H 2ENYA 5EFIA 5DD1H 3GHEL 4MB3A 3TIEB 3P0VL 4R7DA 4ZS6D 1T2JA 1BZQK 1OAQH 4WI3A 3VA2C 1GGIH 3CK0H 3RPKA 3G5YB 1FQ9C 5INDB 4Z5RB 1JF6A 1IGMH 5ANMB 5EB9A 3D9AL 1QFWI 4PJHE 5HYQB 1YN7B 2DQIL 1G7QB 1LWRA 3O2DA 4QTHB 5ESAB 4DVRL 4PJXA 4WHYG 1TTGA 4FTVA 5E6YA 3CX5K 3FJTA 4QT5A 4WFFE 2AQ3A 2WUBH 4MJ6B 5C0DA 2GTZB 1FC1A 1E4WL 5DQJB 4FNLL 4OI9A 1NC4A 2DF3A 2P5WA 3JTSA 4LAQL 5B38B 4FQJL 1N7ML 3LQAC 4PJIB 1RUAL 3L5IA 1MCKA 1FN4B 3TVMC 3MLWL 2GW5A 3BSZH 1S5IL 4JAMA 2BNQE 5JIKA 1PZUB 2WBKA 1IFHL 2IBBA 1KIQB 4P5MB 5J6GB 1HK6A 1UCBH 2R2BB 4C4KT 1UVQA 3EYVA 2F5AL 2VH5L 3F7VA 4XBGB 3IDNB 3X12B 3WFBL 5DZNA 4DZBB 5AAMA 1SEQH 4UOW0 4PRBA 3K8KA 2Q8BH 4PG9A 4LRIC 3WEXB 4UILH 4B53A 4KJYB 4PRAB 2XA8H 3JWOL 5IM7A 4KZEL 5D2NE 1T1XB 4XRCB 2GAZB 5F93C 5JW3H 1JNNH 4GW5A 3TYFB 2IH3A 3HUJB 4NHCH 4KZDH 4ETQA 4Q6YA 1P7QD 4ELMB 3EAKA 3MGAA 1CFQB 5LBSH 5D2LF 5F70A 5DD5H 4NKIH 4F57L 3LV3A 4EXKA 3FT3A 1KCSL 5CBAB 2I5YL 1W2KT 3BJLA 1TTFA 2PW2B 2Y23A 3OKDB 2X4NB 3N1QC 3S35X 4HIEA 4HD9A 4MJ4A 5C6TH 5GGRY 3LRGA 4Y4KD 4NP4H 2CDEA 3O2WL 1MCIA 2MNUA 2BERA 3ILPA 3FMGL 5HPMA 3W2DH 3KPTA 4N0CC 4R3SB 3MZTA 4FTVE 5E0QA 4M6OH 1QLFA 3BUYA 1HHGB 2G9HA 4EBQL 3TBYA 2P7TB 4HUVA 1V7NL 2P5WE 1F4YH 3OKYA 1F90H 5EWIH 2X44D 3ARGB 1OLZA 2P5EA 2D7OA 3CCHA 3UTSA 3ZSSA 4NC1E 4D8PB 5FKAB 3A6BH 3AB0B 5FXCH 3BWAB 5JXEA 1DSFL 1L7TL 2DJUA 1WIUA 3MJ7A 3P4MB 5CJQL 5TH2A 3BPOB 3GSNB 1JYXA 4LL9A 1J1PL 1E27A 3MCKA 3MRNB 2AK1H 5E9DE 4CNIA 2SEBA 1BFTA 1EO8H 1TZIA 3DVIA 3C60B 2BNUA 2A6IB 1BFVL 3NCJL 3OMZA 5FF6B 4TVPD 2BC4B 1MAKA 2ITCA 4LRNH 4KJPC 1I75A 1F11A 1VGEH 1X6NA 1RUPH 1LD9B 2HT4D 5FEBA 5B21A 4NHUA 4LGRB 4UV4H 2HFTA 3FN9A 1LE9A 2BXYA 1MCPH 3QI9D 4GBXB 4PJ5D 1UT9A 3QQ4B 1IM9D 3FL7A 3WS6C 4NQED 2YUXA 3VRLE 4JHBA 1MOEA 3EJYD 3K4ZA 5HGHA 3SDAD 5KG9A 1AKJD 3WJJC 1DR9A 1C12A 2GUOB 3QZWB 3W0WA 5FYKU 4JKPL 3G08B 2XKSA 2RJMA 3TA3C 5K9QG 1ORQB 2VC2L 2HMID 2QQKH 4NKQB 1N5AA 5CEZH 5IB5A 2CJUL 4TUJA 3GSVA 5FUCE 4UT9L 2XQBH 1CDGA 4XMKH 1X44A 3RBSA 1MHHA 3W11D 2OL3B 2AERT 5D7IA 2Z31A 1M6OB 2EDTA 5HVGB 4S2SA 1QBLL 4PJ8A 2OZ4L 1BVZA 5KS9B 4NQSB 5E2TL 1RJLA 3QHFL 1J8HB 4GJTB 2P5EE 4JZJB 3UTSE 1EBAA 2YPLB 4POZD 3BWUC 2WMPA 1AXIB 4CDHA 3QNXB 1G7HA 4D0CB 4NWUH 3UYRH 1G7PB 4FZEH 1OGTA 5C07A 4NDMA 3GNMH 1MCDA 5E4EB 4G7YH 3QXAA 1NFKA 1KN2H 3DGCR 4H88H 1RU9H 5BRZA 3S37X 1P4IH 4OLYL 3MRDB 2VQ1B 5CZVH 4QHUB 5DRWA 2H6PA 3V52H 2HJFA 1F45A 4Q9QH 1U6AL 5KTEL 5I18L 3HS0A 2RFXA 1SJEA 2X1WL 4CN6A 3N0PB 4WO4A 5FGRA 4EN3C 4OCXL 3OKEA 5HGAB 1Q72L 4CRPA 3GB7A 3E6HB 3GMQA 4CVUA 3QUYA 4V2CB 1OTUD 1IEAA 2HP4A 4P3DA 4RMUA 4M6ML 4WTZG 5DFTA 5AWNL 5D7KE 4BK4A 5I75B 1NCAH 1SJXA 5FHBL 4P59L 2AJSH 4P2CG 3W0WE 4OTXH 5E4IA 5D5MB 3N1PC 1W0VB 5HHOE 5LAXA 3GMOA 3U48A 4AQOA 3O9WD 1YMHB 4U1SB 2KUTA 3KS0H 4G6ML 4YO0A 3QUKA 5GRVL 1BF2A 4DGVL 1G9ML 3DUSB 5KSVB 3MLXL 1AFVH 1MY7A 5D7IE 3QQ3A 1CFVL 1K8DA 1IAKA 2L7UA 4XVUD 5GS2D 3L1OH 4P4KD 1UM4H 4KGJA 3S34H 2P1YA 1PZ5A 3MV01 1YN6B 3A67H 3BKJH 3RJQB 5CLWA 3QDMD 3UMTA 3UTZB 1MH5B 4Z7UA 5C2BL 5A2JH 1S7SA 2AABH 2YUWA 1ZHKB 1IM3A 2P42B 5F44A 2UYLB 2QADB 4PJAA 3L3GB 3HRZA 1RZFL 2DKSA 4QOKA 4O51A 4J3TA 3N1MC 1JZ6A 3BW9B 4WI2A 2XICA 3PWNB 5DR5H 4XP9H 5FUZH 3QEGL 1U8OB 2EXWC 4Z0BH 1ZHBA 2OSLB 4HLZG 3WE6A 1IC7H 4DKFH 1QYGH 5I74C 5BRZE 3I6KB 1QACA 1T2QL 3HE7D 1U0QA 2ARJB 5ADPH 4QRSA 5IHBA 1E4XI 3RU8H 3JWOC 3V4VL 5T5NF 2AEQH 2VDLL 3ROOA 3DHJA 4JG0L 2DBLL 5IVZA 5GGSY 4Y7MA 1A3QA 4Y89A 1PG7X 1UGNA 43CAB 1A7NH 4DEPC 2X40A 1HXYA 3G6DH 3WN5A 3DSNA 5A16B 1RHHA 4WFHE 1DUZA 1RZJL 3UEZA 3FRPG 4RGOH 2F5BH 4X98A 1T22A 3NA9H 5IEKB 3Q1SH 3RUGB 1YA5A 5FFLA 3FHAA 3QHZH 2VDOH 2DD8H 2FH6A 4MQ7A 2P49B 2FHCA 1OVZA 3KJ6H 1HN1A 3PP3K 4LPVA 3RIFK 1NDMB 2UWEA 3PP3H 3ARRA 4MLSA 4XI5D 3WXWL 1AIFA 3W9DB 1I8MB 2XWTA 1EUUA 5DDHB 3WNNA 1IKFL 1Q9OA 3GSQB 4LSPH 4P9HL 3I6GA 5FO8B 3LB6D 4PJEF 1KBGH 4F7TA 4ZSOE 5F1KC 1I1AA 1MCCA 1A9BB 3BEVA 4FXLA 4PJDF 2GJ6A 3JTTB 3SDDA 2VZ3A 1CICB 3SJVA 4QOKE 1UENA 3P4LA 4YNYB 4DFIA 1FNAA 1VFOA 3ULVF 3EYUL 5CGYD 4ODVL 3B2UD 3IS0X 4ODSL 5B39G 1JUFA 5ALCH 4MQTB 1A1MA 1MRDH 4PGBB 2HJLA 3VFTA 5L7XL 5E5UB 3MJ9H 5DD0H 4Q2ZB 3QUMA 3DRQA 3HG1B 2VLKA 5H94B 1QNZL 4XNXL 3VFSA 5C71A 4X7CC 1VPOH 1GGUA 3QDJD 1BFOA 1RMFH 4AMKH 3KPNB 3TZVC 4GAYB 1BGXH 2VXVH 2QJDA 4XAWL 5I1KH 4WCYL 4I4WB 3O4LA 1PKOA 3RGVD 1XIWA 3PQYD 4UINH 1NC2B 5IMKA 1N5YH 3NZHL 4ZFGL 4E0RB 5H37G 4U6TA 1T03L 3BQUC 4HSQA 3VFGL 2X42A 4GW1A 1D9KD 4WEBL 4P3CL 1K85A 1HHJA 5HHMD 1YYML 5TQ0L 4B7LA 2IGFL 4KXZI 1GGCH 3F7YB 4XCCL 4KKBC 3QFJA 1N4XH 3H9ZA 5D1XC 3WL9A 1T21A 5DJ2A 4MJ5A 5F96L 2OK0H 4Z0XB 5HDBE 3GKWL 3V4PL 2R0ZL 2XTJC 1BHGA 4YBQC 1D5ZB 3VD3A 2IPTH 1RVFH 2QQNL 3HCVB 4R96B 3SKUD 2NY0B 2UWEE 3ARFA 3MRFB 2MTPA 1MJUH 3GO1H 4RWYL 5IBTL 2PR4H 2PXYD 2ENSA 4AL8L 2R8SL 2DLFL 1D7FA 1JL8A 3IU3B 4IOFC 3P30L 4BK5A 4E9LA 3GMPA 4YHIB 5JW4M 5ICYA 4NUJA 4DVBB 4OCMC 4BQ8A 3C5SA 3D18B 3U7YL 5IJVA 3HI5H 1BBJB 4PLOB 5DUML 4BFIB 4ERSL 4UB0L 1FZKB 4XHJC 2IC2A 5BW7C 3BZFA 1CE6B 2J8UA 2OCFD 5MI0C 2MFNA 5JLZB 1ZVSB 3B3IB 3NFSL 1TCRA 4JKKA 3O4LE 3FQUB 3MNZB 4K3HA 2ZUTA 4X8JB 3SHSA 2NX5D 3SCMA 4ALAL 4JFHE 1ZS8B 5E08L 2OLDA 5DVMA 5TE4L 3RWGA 1ZLVK 3O41B 3MYZA 3P73A 1VFMA 2I60L 1WFOA 2NXYD 1ZLVH 3EFFB 1W72B 4K8RL 1MAMH 4NRZA 5KSUB 4HJ0D 4GKZB 1PX3A 5L0QB 3MJ9A 5F9OL 2X7LB 5AUMB 4Z7WB 5FYKH 5EOQH 4IDJL 3TVMD 3QFJE 5JHDB 3TM6A 4B0MM 3SDCA 5A2LH 2DM3A 2XPGB 1A6TB 4LP5A 4U1MA 3K74B 4X7FC 1QG3A 3ZYOA 1KJ2B 2ID5A 1SMOA 4K3JL 2ICES 2GQHA 4QRQA 5FHAH 1FO0H 1G9MC 2K1MA 3RPIA 3MLZH 4YLQT 4P23C 2X4PB 4M62H 2FWOB 4XCNB 4PGDB 1QSEA 5FK9B 1FLTX 1CYGA 3CGTA 1GCFA 2HKHH 3C08L 4N0UB 4PJDE 4NRYB 1EO5A 4YBLC 2HG5A 2XTLA 4KDWA 5IMLB 2C3VB 5DMIH 4C54A 3ULVE 4PRID 3O3DA 4M7KL 4GG6A 2EH8H 2NW2A 2D7TH 4WV1B 1NL0L 1IGCH 5D7JC 4YXHL 1HZHH 1N0XL 1F2QA 4XXCC 4HH9B 4HFWA 1UZ8B 3SDYL 1C5DA 3QA3A 4QHKI 4F37K 5F89A 1NCBH 4MB5A 4QXGH 1XF1A 4K7PH 4MNQD 1FGNH 5C70A 5GS1C 1S8DB 1Z9OA 5LQBH 4V1DB 1AY1H 3RKPA 2J8UE 5DURD 1JGLL 5MEQA 1N6QH 4WUUA 1MFCH 1EJ6A 4N0CD 5E94A 2R0WH 5DTFA 4X5XB 4XNQA 1CFSB 2H2PC 4LEOA 3VD7A 1CGWA 2IADA 5C9JA 1DLFH 1D5MB 4G43A 4QRPA 1I8KB 1GRWA 5CP7A 5HHPB 3UZVB 4WY7L 1KTRL 2OTWB 1PY4A 3ES6A 2QLVB 1PLGL 2Z35B 1QFOA 1FVCB 1RZJC 3LN9A 4LOUD 3GBNH 3NABH 3WSQH 3DX7B 2MHAA 2KL6A 5EOTB 5D8JH 1K8IA 2O5ZL 4PFEA 2BVPA 3E8UL 3FZUC 5HVFB 3L7FB 4XNZC 2HVKB 3STLA 1MCWM 1N6UA 5D6DA 5DK3A 2HRPH 3ZLQC 4OFYD 5EBLB 2CGRL 4FQXC 4LHUB 4WGWB 4KJPD 5D9SB 1JWSB 5MENA 1UXSA 4J8RB 4NNYB 3T4YB 1QSEE 3RY6C 5BS0A 3D48R 1UYWH 1Z9LA 2KQNA 3D3VA 1I9IH 3M8OH 2VDKH 3OPZH 5EDXA 1QSFA 5I1AB 4GG6E 1FYTB 2IAMB 1J1XL 3KPSB 1MNUH 3EFDH 1JPST 4U0QB 3U0TA 1CF8L 2X6MA 1NEZG 1MIEH 1WFNA 3OAYK 4NOFA 4X9FA 4JY5L 5FCUL 1HSAB 3CFKB 2O61B 2DYPA 2O93L 3OAYH 3TA3D 3CAFA 4JPKH 2AXJA 1E4KA 1FO0A 4LVOC 1ZHNA 2ZUSA 1JGVH 4GSDL 4G9FD 5KSBB 4JR9L 1XAUA 3UJIH 4QF1B 4IJ3C 3VFOA 5ISZA 4M9PA 4NCDA 5GGUB 5D6CA 3TJEL 1AE6L 4TTGA 1I8IB 1ZLWK 4Q6IC 5IK3B 2YPKB 3M45A 2XZZA 1ZLWH 3SGJA 1A3LL 4S1SH 3KYOA 1A6AB 5IJKC 5C0NC 4GH7B 2BNRE 2X4SA 4OF5A 4JE4B 4TN9A 1J9CT 4Z77A 3OAUL 3UJJL 1Y18B 5EU7C 3WNKA 3F5WB 5EG6C 2G75B 4NO3B 4U3CA 3EKCA 3ILQC 4D3CH 1G9NL 2WINA 5IFJB 4FQLL 4K2UH 3JWDH 5DT1H 4PJBA 3VI4F 3NFPB 3LN5B 5ACZB 5GGVL 3ZHDA 3QEUA 5E8EB 1ZT1B 2APXA 2B4CH 5JNYB 5L2JA 4NWTL 4Q7DA 5I74B 1TQCC 1U91A 3B43A 3R06A 3OL2A 3BH8A 5GRYA 5L8JB 4RX4D 2VXUH 2R23B 5F1IA 4NFBA 5HI5D 4L8SC 4YH6A 4ZO6A 4AQ1B 1NGQH 1KCLA 1T5WB 2DQUL 3D3VE 3WUWB 1OD9A 4JPVL 4RAHA 4JANB 1V3LA 4EN3D 1R5WA 1EIBA 4LLDA 5DFWH 5FYKE 2KPNA 3BRDA 5DMKA 3KYMA 1FYTD 2VXTH 1EFXD 1MUJA 1GGBL 5IEHB 1T1YA 2BY3A 2P45B 2CRMA 4R0LB 3QXWA 1A6VH 1JPSH 2VXQH 1U41A 4Y16D 5I0DA 2YD1A 2W9LA 3O11A 5T5FL 1ZGLA 3E6FB 5DWUL 3B9EA 2N4IA 3FB5B 3WDHA 3BP6A 3QWOA 4HK0B 4XMLH 4HUXB 4IM8A 5IB1A 1JZ3A 3IDMA 1YEEH 5C0GB 2BRRL 3TBVB 4NKMA 2BSSB 4IHOB 1AGBB 3V8OA 3NH7L 1CZ8H 3NMEA 5DD6A 5ISZE 4PY7B 1KJVA 4D0DB 4NM8H 5AAWA 2EE9A 1CDYA 3UZQA 4X9BA 2BVQB 4LSQH 5DJ0B 1JMZA 1R3KB 4F2MB 1P7QA 5FGBC 1Q8MA 1NQBA 3TIEA 5TE7L 4GLRI 3ULSA 4AEIL 1A2YA 1N8ZB 5GSVA 5DEGA 5ILTL 4XVTL 4Y5XC 4LSVL 1CE1L 5MEPA 3QPQC 2IJ0C 4KHTL 2HKFH 3G5YA 1X5YA 4MNGB 3RY4A 1QZ1A 5DRZB 4Z5RA 5J89A 4FQ2L 2AEPH 3BDYL 3QNYB 4M7ZB 4ODBD 1UWEL 4Y4KA 4PP2B 1T0MA 3X3FH 2EZ0C 1HI6A 4KTEL 2EXWD 4PJFB 3MNVA 4RQQA 1MCWW 5TE6L 4FABL 1TENA 5TGBB 6FABL 2YA1A 4HX1B 2FJHB 4PRPD 3AAZB 4RA0C 2R1WB 3JV5A 3L3IB 2UVEA 4OUOA 4LSUL 5I1HL 3TZVB 5DQJA 2NW3B 3BP4B 3CC5B 4N8VB 2P24B 4X80H 3HE6C 3GSXA 5E7FA 5B38A 1SJHA 1HINL 3ZL4L 1FNLA 1BEYL 1FZOB 3O0RL 4MZ2A 3BP5A 5CJ8A 3T0VA 2DQTH 1FN4A 5EO1A 4ACPA 1P9MC 5LWYH 2Q8AL 3OJDB 1LO3L 4ZOCA 1L4IA 1IGTA 5DEFB 4R90H 3THML 3LS5L 1OM3H 3IDNA 3X12A 4LGSB 5AD0B 4OZIB 2DTMH 1F3DJ 3V6BR 1DP0A 3S88H 3WEXA 3V4UH 4IOIA 4KJYA 3K4DA 1W0WB 1T1XA 2GAZA 4IMKC 1AD9B 2Y06L 3DX9B 4PTTA 5D71H 5DK2B 5FGCB 3D39B 4ELMA 4LLWB 1CFQA 3T77A 1FSKC 2BOCB 5CZXC 2VN4A 3VXQB 5GS2H 3HR6A 1IM9A 1N26A 4NQEA 4M48H 1LILA 3KPRD 4RZCA 2YHGA 3GM0A 5CBAA 5CILL 3SDAA 1AKJA 2VE6A 4BSVB 5I30L 4LCWB 1BAFL 3TPKA 2H26A 1AQKH 2CKBL 2HFFA 4TNWF 1J18A 2Y72A 2C1PB 2AGJL 2XT1B 3PDDA 3RY5A 1HOCB 5BZWB 3RWDA 4F9LA 3ZYJA 2OR9L 1S7TA 4LCCC 1UKQA 4U49A 4ZPTB 2EECA 4HKXA 4DGYL 1BQUA 4KY1L 2MQCA 4MD4B 4NN5C 2W0KA 4L9LB 2RHEA 4O5LH 3T0EC 4MSWB 2P7TA 3AVEA 4KWUA 4FS0A 3CFJB 3U4EB 3MNWA 1U58B 4H20L 4ZNCD 2YRPA 4QCIB 3ARGA 5HI3C 1U8IB 1NUFA 2G5BB 3EJZC 4C58B 5J1TC 1ETZA 4LARH 4PJCA 4YDJB 3BQUD 5FKAA 4LHJB 4WWKB 3DV6A 3MJ6A 3GSNA 4NJAL 4K55A 1IGIH 1UZ6F 3ARDB 1AR1C 3AM8A 3NZ8B 1XGTB 4KKBD 4E41B 4PRDA 4OF8A 5D1XD 2APTA 4LQFL 3D85B 5GS0D 2KH2B 3BN3B 1Q94B 2XTJD 4JQIL 4TVPE 5E6ID 4YBQD 3UX9B 5FO7B 2CQVA 3HR5B 3QRGL 3EOBA 1JHKL 2XACC 5DMGC 1TQBB 2R69L 5IB2B 4XTRC 4CMMA 4NSKB 5ID0A 5J1AB 2VQTA 3I50L 4PJ5E 4YPGA 4EJ1C 2P46B 1FIGH 2CLZA 4NQEE 2W0PA 1FLRH 2W9EH 4NM4L 1H15B 3WIHL 3KYAA 4JFDB 2HLAA 1G7LB 4Y19B 4F7CA 3UBXI 5BV7H 2DQGL 2YZ1A 4DZ8A 3P9MA 1XCTA 1U92A 1G9NC 3WXVL 4M5ZH 3V0VB 3P2TA 3BISA 2FIKB 2FB4H 3U2SA 5DHXB 2HFGH 2YXFA 2V2XB 3T0XA 3T3PE 3O9WA 2CIKA 5BVPH 4ZQKB 2DQJL 5GISH 3PHOB 4AIZB 2Z4QB 4XHJD 2ED9A 3CU7A 2WP3O 4JPWH 4K9EC 1Z5LB 3W5MA 5J12C 3V6ZA 4U1IB 2MKWA 5FYJD 5E00B 1TIUA 1VEPA 4DKDC 4X6DF 4OIAA 4HZAA 2X4UB 1NMAH 4GXVH 2FATH 3P77B 5KN5B 2YD3A 2VWEC 4GAGL 4R2GC 3GRWH 4I18A 1TNMA 5KS9A 3QDMA 4HWBL 3DROB 4LU5H 1EJOH 4PJCE 4JZJA 2NR6C 5I1GH 4JFPA 3F8UB 1B4JL 1HXMB 1ONQA 3SPVB 2BOBB 4UBDC 4ZDHA 1P7KB 4UAOB 1NFDB 3EIFA 4PB9H 3M17B 3P4OB 2YPVL 2NY3C 3EYSL 1RIUH 3HAEH 4Z9KB 2FX7L 1VKXB 3IDXH 1MQKH 2IMMA 2W0LA 2ARWA 1R5IA 4CJ1A 5MERB 4P5TD 2X9YA 4KRNA 3ECBA 4UQ2B 3L5XH 4XCFH 1NSNL 2DQHL 3R4DA 3VXOA 2Z91B 4TRPL 5IFAL 1AGFA 1UQSA 4GUPA 1XZ0A 3D0LA 3HE7A 5DUBA 3QO0A 2E7CA 2A73A 1J10A 1F2XK 4NNXB 3LH2L 3C5ZC 5IT2L 4KROD 1C5CL 4P23D 4ONGL 5HGAA 4I3RL 1LO4L 3BT2L 3NIFE 1PYWA 1A0QH 1B0GA 5JIHA 5K9JH 1OB1B 4X5WB 3BZEB 2C3WA 2BVOA 4OFKA 2JB6A 1JRHH 5D1QB 3HKFA 1BZ9A 4Z7VE 2YC1B 3GJEA 5D7JD 1OWRM 2YKLH 1FRGL 1ZK9A 2D7MA 1HQ4B 1D6EA 3SBWC 1YMHA 1IEBB 1CR9H 4MA8L 4U1SA 43C9A 4HJGB 2QHRH 2ZUQB 1U3JA 2VZOA 2Z93B 2JELH 4ZS7H 5EBMB 2BVYA 5ACMA 3VXNB 3VD4A 2ITDB 5KSVA 3PUCA 2APFA 2BVEA 2D3VA 1UKTA 2J7LA 4F58L 5A3IC 1MFBH 3VFWB 4MQXC 2ADJB 4NYLB 4UT6L 5D96C 2H2PD 3V5HB 4WI8A 2XA3A 3P3YA 2YD2A 3UTZA 5TPWL 1IMHC 1NANI 3QDME 4XP4L 5EZJB 2J1KA 4HIJA 1U8MB 1NGZB 3QBTB 1SYVA 2D0GA 4LFHD 1Z9SA 4C55A 1FIEA 5GPRA 3EDDA 4P57B 3OKNA 1IKNC 1GPOH 3ZHKA 2FR4A 4NC2B 5CP3H 3VMOA 3PWNA 1IILE 4L8DB 4G8GB 2PTTB 3CXDL 5GGSA 3LRHA 1FGVH 3LQAH 1I7UA 3WFCH 4F3FB 1GZQA 1V8HA 2BFVH 2NTSP 4LSTH 2IBZX 2IANB 1UWXK 4K3EH 1DBAH 4QRUA 1RULL 3FZUD 1UWXH 5F9WB 2YUVA 4OZHA 1GXEA 1ORSA 4HS8H 3GRWA 4JPIA 1OAZH 4OLWH 3RGVA 1G7MA 3V6OC 3PQYA 1OAYH 4FQXD 3MYJB 4P5KB 5CD3B 5HHXH 4L4TD 4ORZC 2V5YA 1BX2A 1WFUA 3N1GC 1ADQH 3KYKH 4DN3L 4LLUA 4PLJC 3BEWA 1KCUL 2A6DA 5A16A 1RJCA 2HJKA 3C2AL 3DXAB 4RGMB 5HJ3B 3VFVB 3HAEA 4KQ4L 1D9KA 2BMKA 2A74B 4ZNEA 4HUUA 1QHOA 2YA0A 2FO4B 3EO0B 1I3RA 4RGNC 4WW1B 4YHYC 5IEKA 1GOFA 2AJUL 5KJRL 4M7JH 2FBJL 1DDHA 1A6WH 1TXKA 2EDKA 2CO7B 4MXWL 3HNTH 4ZYKB 3QP3A 4JFEB 4WUKL 2OBGA 1MFDL 3G6AA 3HPJB 4N8PA 4U1HA 1I7RA 4YR6B 5CBEB 5IESL 1F8TL 4IMLA 1Q38A 4YAQA 1DBJH 2PXYA 2WBJC 2DI7A 4U1LA 2PUQT 5CJOH 3GSQA 1I1FA 3VGEA 5IVXA 5FO8A 5F7EL 4J3VA 4PJGA 5IP4A 2VABB 3TV3L 5CEXA 1X5IA 3AU1A 5EUKB 5D70H 5DD1L 4N90D 5C0ND 2OI9C 4XPTH 1S7QB 4OD2B 3MUY1 4YNYA 4JRXB 2AKRB 3UYPA 3OR7B 4JM2F 3D2UB 4HFUH 4EI5B 3REVB 4BSWB 3O2VH 2ATKB 1GGIL 4ELKB 3CK0L 3JV4A 1S9VA 1BQHG 3BDXA 4JN2B 5F8RC 3GKZA 4H1LG 3WO4B 1IGML 3Q5TA 3T0WA 3QDJE 3KPNA 3GK8L 2N7AA 4OZHE 1ZE3C 1JHLH 5C86A 3MGTB 3PQYE 1JPGA 1UCTA 2NX5A 3FONB 4DJMA 2VR9A 4LLYA 5IGXL 3WHE0 5FYJU 2WUBL 4HGWB 5HY9A 1F97A 4OZFH 3DV4A 5CP3A 3GBMH 4LKCB 5ESQA 2NQCA 4ZNEE 5KVGH 4S10A 1T66C 5HHME 1EAJA 4MCZB 5HYJB 3G04B 4QRTA 3L3HA 1JE6A 2VJXA 1P5VA 1JF1B 4CKVX 1PD6A 2A77H 4ONFH 3TVMA 3T3MF 2J2ZA 2E9BA 2D03H 3C09C 1DVFC 3BSZL 2C1OA 3B5GA 3BN9C 4GQPH 4MLIA 4JO4L 5FECB 2GCYB 5ESVB 3HCVA 4R96A 4KV5F 1Q0XL 1LP9A 1KPUB 5C0FA 2E5EA 2D7PA 3WD5H 5DS8B 4LRIA 4O4YH 2EDLA 1ADQA 1KLGB 3S9DB 1DL7H 2HRLA 2XA8L 1BJMA 5IVXE 1JNNL 3H9SD 4TSCH 1X5ZA 3IXTB 3RIAF 4F9PC 4PJGE 4NHCL 2O5YH 1HKLL 5D1ZC 4M02A 4PRIA 3VGBA 5LBSL 1HHIB 3ULUD 1XGRB 2VO5A 1BBJA 1QRND 1QFUL 1S7WB 3DJ9A 3QPQD 3LN4B 1NUGA 3DSFH 1JZ5A 1JVKA 3T0AA 4MNQA 4U31A 1AC6A 4LVHB 2FEDC 3VD5A 3PWPB 4H8WC 4KKAC 4NP4L 1CDBA 3B3IA 1WZLA 4NO0B 4F8QA 3HMWL 2H1PL 4LCCB 4PBWD 3FQUA 3W2DL 4RIRB 2EC9U 2FJFB 3UJTL 3BKYL 5D93B 2NX5E 3V0AC 3HZYB 4ODTH 1K9TA 1YNKH 1RZ8B 4Q9BA 3MV8B 5L88L 5AYUH 5C0BB 3HE6D 3HI1B 1S9WB 1OARL 4HPOH 3W9EB 3GIZH 3VXPA 4OSUH 1SBBA 4GKZA 5F7DA 1F90L 2X7LA 3ZT5A 5AUMA 1VB9A 4ORGA 1G0XA 1OAXL 3P0YH 2YBRB 5EU6D 4TUKH 1WFTA 1G0YR 3GHEH 3REWA 2DJ4A 2VLRD 4ZFOA 1BVLA 4IRJC 1F5WA 1XT5A 2APWA 1UEYA 4OLXH 4U3XA 1DEEB 4M8VA 2AK1L 4L4JA 1HEZB 1XR8B 4OFYA 1INQB 4LLQA 1I7TA 2YSSA 5HYSB 3FQNA 5IF0B 4OZFA 4XCNA 4LRNL 5FK9A 2WAHA 2HAZA 3FFCE 3MBXH 4NO5B 1VGEL 1RUPL 4DVRH 5IMLA 1UJ3B 4PIRF 1MCPL 2EO1A 3IKCB 4PRHD 5CZXD 1OF2A 3ZDYF 3WS6A 1JGEA 3RI5F 1JP5A 1E4WH 3DMMC 3QIWC 1FNGB 1NLDH 3BO8A 4GRMB 5I8CB 1NAML 1UZ8A 3WJJA 1X4XA 3WV0A 4XXDA 2WW8A 2ZJSL 3M07A 4FQJH 1N7MH 4KMTL 5EH1A 4MNQE 5FV1L 4YHLL 4NQXA 3TA3A 1S8DA 4J6RH 5MEOA 1RUAH 3EHBC 1YYLH 1BIHA 3GJFK 4G9FA 3MLWH 4NN6C 1S5IH 3SDXF 5B3JF 1JGDB 4IRZH 3GJFH 3X3GL 5K9QI 4OZGF 2VLLA 3VG9C 4XMKL 1T7WA 4POUB 4ZFZB 3SKOB 5J12B 3T0ED 3S36X 4HGMA 1L9MA 4DFHA 1JWUA 1B4RA 2OTWA 3CSYB 5GRZA 4PGEB 1ERNA 2R4RL 3NN8B 4K71C 5I71C 3JWOH 1ZWIA 4WRLA 4KZEH 1CI5A 3T4AB 1AGEB 3EJZD 3QEQB 2MPAH 4YC2C 4IS6B 1RD6A 3D87B 1UXWA 1MCEA 5GGTH 2L7JA 3K0WA 5T1KB 4F57H 4PP1C 1KNOA 2NY3B 5BVJA 4H25B 2XWBA 3U7WL 3QQ9C 3T0DA 2PO6B 3MGOA 4PBVC 4RNRA 3GNML 4QHNB 5DMYA 1KN2L 3PHQA 4H88L 1RU9L 4LHUA 2DAVA 4M6NH 3GSRB 4RX4A 5CZKA 3ROLB 5CZVL 4GRWB 3V52L 3FMGH 1HILA 3MOQA 2EYTA 3OGOE 4AIOA 4EN3A 1K3IA 3O6FB 5I1AA 1FYTA 1TZGH 1EFXA 4AEFA 4PV9B 3RZCD 5I9QC 3UTOA 2J88H 4EBQH 1TTUA 3F62A 2ZG1A 3QDGD 2LABA 3WS3A 3DX8B 1NCAL 2F9BT 4W4OC 4LNRA 3CFKA 3QUZB 4F7PB 2W65B 3NPSB 5JQHC 4YIQA 4GAJL 2R0LL 1BFSA 3RVUC 5KSBA 1OWWA 4P4RA 1EO7A 3H8NA 4G9FE 3B5HA 5FGSA 1DSFH 1V5JA 5CJQH 3QH3B 3ZDZE 1J1PH 3IRPX 4YGAB 4OFVA 3IVKB 1J0IA 1CXFA 4M00A 5HDLA 4L8BB 3PWUB 3VWKB 3NCJH 3OBAA 1NGPL 1D5IH 1UM4L 3OHXB 5IW1B 4R2GD 1HNGA 2AXGA 4QHLB 3WDJA 1AP2A 3BKJL 5KSAC 3F5WA 1HHKA 1A3RH 4AENA 2NR6D 5CWSB 3S4SB 3QAZB 3DLQR 2OXHA 2AABL 2R1YA 4UBDD 5EN2B 3KPMB 5F7FA 3NFPA 4L4VD 3LN5A 3MV7D 4ZXBB 2LVCA 4GKNB 2Q86B 3GJFA 3GGWA 1P4BL 1ZT1A 5DR5L 5J9PA 5FUZL 4BJLA 4OLEA 5JNYA 4PLKC 2CKNA 4Z0BL 1C7SA 2X70A 1IC7L 3RHWK 5J8OA 4EZMA 4PRPA 2ZCLH 5EU4A 1YDPA 3K2MC 2VC2H 2Q7NA 1FFQA 2R23A 3U9UB 3MA9L 2FX9H 3PV6A 4S1DC 1T5WA 1LE5B 3C5ZD 4JANA 1ZLUK 4KH2A 4Z7QF 1FVDB 3O4OC 1X5GA 3QEHA 1ZLUH 3FO0H 3ZKXB 4QRRD 2A6KB 5GGTA 4R26L 5EU5A 1A7NL 2DLIA 3PJSB 1QR1A 5FO9A 2IG2H 4KTYA 1QBLH 1U8QB 3FOMA 2ADFL 3FB5A 3IAPA 2NY1C 4UIMA 1YNTB 4RGNB 3BP7A 5E2TH 5H35A 2X10A 3QHFH 4RGOL 2F5BL 1RURH 4ZOAA 3NA9L 3Q1SL 3ULVL 4KK5C 1BJ8A 2BSSA 4UNVA 5J11C 1MF2H 5FCSH 3QHZL 3ARBC 2DD8L 4QGYA 4NN7C 5BQ7A 3S6CA 2EC9T 3QG7L 3KJ6L 4JLRB 4G42A 5A3ID 4F2MA 4ESKA 2YK1L 4MQXD 4FQHA 3IJYA 4PRNB 3PV7A 4WWID 1MI5D 4R4NC 3RTQC 4BSJA 1N8ZA 3SO3C 4U1JB 5GZNC 1F02I 4MAYB 3RWJB 3KPRA 4LSPL 1CDIA 1BWMA 2GSIA 2X1XR 3WJLC 2F54D 4JDVB 1KBGL 3OR6B 3FB6B 4OCXH 3PWVB 1P4LA 1I3VA 4R4BB 3I85A 2MSPA 4NJ9H 1KACB 1P6FA 4PJFA 5AWNH 1PEZA 5FHBH 2QSCL 1BLNB 2VZVA 4KUCD 4P59H 1MRDL 4HX1A 3AAZA 4I2XB 4PRPE 4NQCD 2R1WA 3WHXB 2BHZA 4CVZA 4F7MA 3PABB 3MLVL 5DJYB 3QIUB 3ETBF 3WYRA 4ONHA 5HDQH 5GRVK 1BGXL 2YUZA 1H3WM 5I1KL 5C09D 1DQQB 4G6MH 3MA7A 5IQ9A 4O2FA 4PD4J 4UINL 1FZOA 5EZLB 2NY2D 2CLVA 1CFVH 3BQUA 3V5DB 3NFNB 4KXZH 3O45B 3GMLB 4HS6B 5KANG 4PJ7F 2EXYC 1GSMA 3KLAA 2EEDA 2EDEA 4Y2DC 1F42A 2J3SA 5C2BH 3AROA 1LEGA 5AD0A 5K59F 5D1XA 4FFYH 4ZUSB 3C09B 4P49A 2VISB 2OK0L 1TPXB 2VUYA 4Z7OF 2ZKHH 2HLFC 3D39A 4QO1A 4TOYH 1T2QH 1MJUL 2VN7A 3GO1L 4U6XB 2WBJD 4ZUUB 2PR4L 6CGTA 5CIPB 4PJHB 1A1NA 3T04D 3SGEI 3MRKB 1H3GA 3C5JA 3KPRE 3MTRA 1WZKA 4JJHA 2VDLH 2DBLH 1YEDB 2Y5EA 3RL2B 5D1ZB 4F7EB 4HKJA 1PAMA 4XC1L 3JV0A 4FQQB 2HN7B 5B8CB 1JPFB 3HI5L 4Y88A 2YD4A 4MCYB 1RZJH 1N59B 1S9YB 3IFOA 1VEOA 5BW7A 4I0PC 1ZTXL 4L3ED 1NGYB 1T4KA 2FEEL 1FVEB 5EO9A 1H9VA 4MSWA 4ZAKD 3VRIB 2W0FB 4Z7QE 2BNQB 1U58A 4OGXL 2JIXD 2XKNB 3OXRB 1LK2B 4JFXB 4RFEB 3GIVA 3VGGA 2EIDA 4WU7A 1WF5A 3STZB 3CPLA 1KEML 3WXWH 1S7UB 3CVHL 4JFOA 3B2VL 5AYQA 4FXKA 1IKFH 1T66D 3CU1A 5D2NB 1GIGH 1MAML 3NZ8A 1FV1B 4BH8B 4LLVA 4H5SA 1OTSC 3M1BA 5FYKL 2UZIL 2XN9D 3D85A 1A6UH 5EFIB 2HTLD 1DVFD 1H5BC 1ZT7A 1ZSDA 2FGWH 1Q94A 1UB6A 4KKCD 3BN9D 2OX5A 4CBPA 1FNSH 3EYUH 3P0GB 3HR5A 2IH1A 4ODVH 1VFAA 4H0IA 3L5JA 3WMSA 2C3XA 2OJZL 2FJGA 4S11A 3CDYA 4ZPVB 5FHAL 4NSKA 4PJIF 3L3DB 1QNZH 3J8F7 4P23A 1FO0L 1G9EA 2NNAA 5K33A 5DC0A 1JV5A 3KPLA 4M62L 3TO2A 2IALB 1PSKH 3MREA 2CRIA 1FAIH 1U8NA 2HKHL 3UO1H 4L1DA 1WICA 4FTVB 3BOVA 1ACYL 4QT5B 4P2QD 4YZFE 5D7JA 3U30B 4X6FA 4Z7NF 2EH8L 1IGCL 2R56H 4X0KA 4XXCA 3QIWB 3VFGH 1HZHL 1MHCA 3MROA 1NC4B 3PHOA 4K07A 4P3CH 1NDGA 5CAYB 1AC0A 5TQ0H 1TLKA 1XGQA 2P5WB 3DECA 1TCMA 3JTSB 4QXGL 5GS1A 3HLAA 3HUJF 4K7PL 2FEDD 4JREB 4YDLB 1XF3A 5FYJE 4J4PD 2VDRH 1FYHB 2V17H 5LQBL 1AY1L 1DFBL 4QWWC 3GKWH 3HNVL 5KN5A 4JAMB 3V4PH 2CDGA 4WDIA 1N6QL 2X1OA 2Y9RT 4F8TA 4RBPK 5IVOA 3VCLA 2ZSWB 2QQNH 2CD0A 4RBPH 5E95B 1UVQB 3EYVB 5E9DB 3DROA 4F15B 2CMRH 3F7VB 1DLFL 2JLLA 4RWYH 1RK0A 4BUGA 3I6LD 3SPVA 2QL1A 4OLZH 4PRBB 1QO3A 1ROWA 2DI9A 5IM7B 4AL8H 3ZTJH 4YC2B 3WNOA 4GW5B 3ORJA 4EOWL 2DOCA 2IH3B 3P30H 4M1CC 1NAKL 1TETH 1G0DA 4YHKH 4P46C 4ETQB 3WSQL 3ULVC 4IRJD 1JK8A 1A4JA 1JN6B 4Z7OE 3VXMD 5CEYB 2YXMA 2OS7A 5EZIH 3T1WA 3LV3B 2AV7A 3FT3B 2OMBA 5DUMH 3MV9D 2GK0A 4UB0H 4M7LT 5CJXC 4FQXA 1F6LL 4RRPG 2JJUA 5DJCA 4HIEB 4L4TA 3RY6A 3PXJA 4AY0A 4KQ3H 4QHMB 1OB1A 4LSDA 3ILPB 5IQ7H 4HAFA 3ZT7A 4CW1A 5ECJE 5B38G 3OPZL 4HIIA 4FOMA 1QLFB 3BUYB 5E08H 1EFQA 2QQLH 5I9QB 4Z18A 2YN5A 1CXHA 1MNUL 3DMMD 2G9HB 3VRJA 1CD9B 4PV8B 2I60H 5DQ9B 1MIEL 2BJML 4HUVB 3QHTC 3GDBA 4OBRA 5EIIB 3RWIA 3EHBD 4JHZA 5F9OH 4X7SL 1FFPA 4JPKL 5T3XD 1JFQL 3IETA 2P5EB 3ZYIA 3CCHB 3UTSB 3VFWA 3F7RA 4NYLA 4M8QA 1G7IA 3V5HA 2K7QA 3UJIL 3CZFA 3MJ7B 5FIEA 5TH2B 1YEGL 5EZJA 4Q6IA 3DO3A 1L0YA 4CNIB 2SEBB 1DCLA 1NGZA 1TZIB 3GHBH 2A9NH 5IJKA 3U46A 4S1SL 2JJTC 3W81A 1F4AA 1HDMA 3ME0A 4NCC1 4HWZA 4L8DA 4WENB 5DGQA 3ULUF 1X5JA 2VZ1A 1JPTL 2X1QA 4NHUB 4XPFH 4D3CL 1Z3GH 4N5EC 1LE9B 4C59B 1KTDA 4K2UL 4M7KH 3RVWC 3EOYG 4PP1D 3JWDL 5IIEA 1NL0H 1OHQA 3OTTA 1Y6KR 1DQJA 3JWNC 3QQ9D 3LVEA 1BBDL 4HULB 1N0XH 3D69A 3BPLC 4DGIL 5M94B 5GIRB 3SDYH 4N0RA 5KG9B 1DTUA 4M7LH 3MYJA 1X5AA 3W0WB 2VTFA 4L8SA 4XX1G 2VXUL 1N5AB 4TVPL 5F6IC 4OQTL 1NMCC 5IB5B 3NCBB 2Z9TA 3GSVB 1NGQL 3VFVA 1TVBA 2DIBA 2E9WA 3CFIC 5E6ZA 3B9KD 1H0DB 8CGTA 5BO1H 3MBEC 4NPYB 5D7IB 2Z31B 3X13A 1A6VL 1JPSL 2VXQL 3PF2A 3H7LA 4ZYKA 1WSST 3QIBC 3RVUD 4XMLL 1RJLB 5FM5O 25C8H 1UJTA 3RX8A 1WV7T 1G7HB 1CZ8L 4GLRH 3RVVD 3GSWA 5M95B 1CL7I 5I19L 1K5NA 1OGTB 1H8OA 3H9SA 4JG1H 5C07B 4NDMB 5FGBA 5EUKA 4X6CA 2ZOLA 3Q3GA 2CGRH 5BRZB 3U7AA 5D5MF 4N68A 1DQTA 4JRXA 3SO3B 2AKRA 5KSAD 3OR7A 4Y5XA 5FOJA 4YJZL 4JQVC 3D2UA 5DRWB 5EU7E 4DWHA 2H6PB 1QRNA 3CFCH 4BSWA 3TN0C 1CDCA 1XFPA 2HH0H 2RFXB 1SJEB 2HKFL 2QTEA 2XXMB 4WO4B 3QZWG 4JN2A 3AFLA 1J1XH 3OKEB 3DX6A 2AEPL 3GB7B 1MELA 4W6YB 1CF8H 3IYLW 3X3FL 5E2JA 2AJ3B 1IEAB 5D7KD 5BJTA 1ZEAH 3BGFB 4NGHH 1QBMH 2P48B 3MGTA 4E5XA 3KS0J 4DQOL 2QKIA 4PLNC 4HGWA 4AYFA 1YMMD 5HHOD 4JR9H 5LAXB 3TBWB 3HE6A 4LKCA 5A43C 3BI9X 3UTPD 3AS2A 1FG9C 3SQOL 4YO0B 5EUOA 3QUKB 2VR5A 3BX7C 3GI9H 1I3GH 2WZPD 1QFPA 3C2SA 5EU6A 5SWZD 1A3LH 1AHWC 1Z0MA 3MLSH 2XG4A 1P9MA 2DQTL 1K8DB 2HVJB 2X89D 1IAKB 3EJJX 1WISA 2N56A 1EUTA 2VLRA 5LWYL 5I76A 4JN1H 2NY1D 3S35L 4Y4FD 2GCYA 2P47B 3UJJH 1NAMB 4HQQH 1KLUB 3UZEA 1I1CA 4Z7UB 1CLOH 2DWEB 4R7NA 2V5SA 1S7SB 2HT3C 4FQLH 4Z6AT 1IM3B 2DTML 4ZSOB 3IDYB 2Y7QA 4PB0H 3ARBD 4XNMA 2NY6B 1KLGA 4J23A 3V4UL 2GT9A 4QOKB 1CLCA 3MSPA 4IMKA 4MXVE 1U2HA 2ATPA 3K46A 3RWCB 2B1AH 2R1XA 3T08A 3ZE0F 4K9EH 3H9SE 4FRWA 1ZHBB 2ADGA 4UDTA 5D71L 3WE6B 3FB8A 1S7VA 2GI7A 4X6CE 1LEIB 4R4ND 3RUGF 2EE2A 4PRHA 3RTQD 1HHIA 3LMJH 4WHTA 5GZND 3ULUE 1WUNT 3O6LL 4G6KL 3D25B 3IRZA 1KB5L 3SEPA 3ZMRA 1S7XA 4OV6F 1QRNE 4QRSB 1U3HC 5C0JA 1DANU 4X6EA 4HLJA 3VWJC 1AQKL 1C8PA 1J87A 2FRGP 4X4MA 4GW4A 4NO0A 1HXYB 1U36A 5T5FH 2GSGA 3WN5B 4LCCA 3CJJA 1J8HE 1LDPH 1RHHB 1DUZB 2YPLE 4NQDD 1F13A 2AAVA 4X7DC 4AZ8A 2LFGA 4X98B 1T22B 3T0EA 3HZYA 2ESVD 2UY6A 4O5LL 1LHZA 1RZ8A 3MV8A 4HWEH 2QQQA 3KPPA 4IIQC 4KK6C 4GRWH 1I7ZB 1K4DA 2ZNWA 4JJ5A 4J3XA 5EUOE 3TYGL 3LKSA 4AK1A 2UWEB 3SOBH 2YRLA 2EXYD 5TE7H 4AEIH 2AEIT 1RZIA 2VLRE 3ZHLA 5JA9A 2XWTB 3GSOA 1HKFA 5ILTH 4Y2DD 1Q9OB 4LSVH 3V7AG 2VDML 3I6GB 4LASL 4KHTH 2CXKA 1XR8A 1GYAA 1NPUA 1I1AB 5HYSA 3BEVB 2DI8A 4TSBH 5IF0A 1UWEH 2GJ6B 4ZTPL 5I0ZA 3SJVB 5ELIA 4MYWB 1VEMA 2ICWB 5MP6H 4LCUB 4FABH 3SE8H 4HG4J 3CLEL 1OW0C 1A1MB 1NUNB 2VNCA 2HJLB 4HUMB 3VFTB 1DBKL 3DRQB 3QCUH 2HTKC 3VFSB 5F9JA 5I1HH 3BGMA 1BFOB 4MDIB 3OJMB 1FNGA 3QDGA 1LGVA 5I8CA 5I1JL 3BYYA 4UDUB 5C7XH 3HC3H 3O4LB 5BV7L 2AJVH 3V9FA 1XIWB 3ZL4H 5IMKB 3O0RH 5C0IA 1PEWA 2OQJA 4M5ZL 4FZ8L 5HVWA 2Z8RA 1M1SA 1E0OB 4X4ME 1WCQA 2Q8AH 1B9ZA 1CTOA 1KOAA 4HCRH 4QTIL 1JGDA 4GW1B 4I0PD 3THMH 2WLYA 3UCRA 4ZFZA 3SKOA 2A1WL 2VZTA 5JW4Q 3T0EE 3QDAA 1IRAY 3QFJB 1WWCA 3WL9B 1CGVA 5DJ2B 4MJ5B 1IAIL 3F65A 3GRWL 3RVTC 2Y06H 3QEQA 5F3BA 5IB4A 2HT4C 1EJOL 4ZUTA 3ARFB 2OR7A 5I1GL 1CTNA 4L4VA 3QI9C 3MV7A 4NZRH 1GHFL 2DQDH 5IW3A 3LKPA 3TO4D 1E6JL 4HS3B 5CILH 4Z76B 1OTSD 3IDXL 3VXUD 1MQKL 4PJDB 4JGMA 3EDFA 3GMPB 1KIPA 3L5XL 5I30H 5KW9L 1BAFH 5ICYB 2GJZB 4NUJB 3DGGA 2E7LC 2W91A 2CKBH 2VB5A 3ROLA 3UTTD 4ZUWA 1R3HA 3Q6GH 4X7TB 5IJVB 1WIOA 1QLEL 4V2BA 2OR9H 3C5ZA 5E8NB 4DGYH 1HCFX 4OCRH 4Z7WF 4E42B 3G9AB 4KY1H 4PV9A 1GOHA 1JGUL 5KZCB 1YC7A 4QRRA 4WI4A 3BZFB 2J8UB 1OAUH 3QDGE 3ZKNC 4H20H 3S3SA 4LVEA 3EO9L 1TCRB 3MQIA 3SCMB 5BMFH 1JRHL 1KYOJ 1H8NA 5DJ6A 5KBNC 2HT2C 3SBWA 1N2RA 3RWGB 4ZG1A 3QH3A 3B8SA 4DOHE 4NJAH 1U9KA 1CR9L 4XPHH 5DMJB 1TITA 4NRZB 4ZS7L 2H2SC 1NANH 3UBXA 3ALXA 4LQFH 4QWWD 3E2HC 1MFBL 3IT8D 4JQIH 3ALPA 1MI5A 2VWEE 4U0RB 4QHLA 4PY8J 3TWCH 1BVKB 5LGJA 3QRGH 4U1MB 3HG1E 1PG7L 2UZYB 3NTCH 3CUPA 2R69H 3IFNL 2DIAA 4QRQB 3MZGB 3MRCA 3SE9H 3DURB 1CFTA 4LBEA 3I50H 32C2B 1QVOA 1IKNA 4JRYD 4L4VE 3MJGX 3MV7E 1N3NA 4GFTB 3OQ3B 3K1DA 5FUOH 1QSEB 3WIHH 4MJID 5E03A 4EDXA 4KRLB 4M1CD 4D0BA 1FGVL 4JO1H 4P46D 4W6XB 2DQGH 4XAKD 1GGYA 2HG5B 3MPCA 3H9HA 1YEKL 4NQCA 1A8JH 1WIPA 3O3DB 4GG6B 2NW2B 1X5XA 4LEXL 3SE4C 5FDYA 2VYRE 1LE5A 4X9IA 4HS8L 1UKSA 4YPJA 2DQJH 3V6OA 3O9WC 4HFWB 1D3CA 2ARJQ 2ZNXA 1C5DB 5C09A 4BZ1L 1FVDA 3QA3B 5F89B 1OAYL 5JUEL 5JMOC 5HDOA 5KZCD 4QRRE 5AG9A 3G5XA 1ADQL 1GC1C 4OJFH 4XVUC 5MEQB 4G6AC 4P4KC 3HZKB 4WUUB 5E94B 5I1DB 5DTFB 2XZCH 4Q0XL 4XNQB 1YNTA 4LEOB 1DANT 5C9JB 2FZ3B 3MBEB 4G43B 4QRPB 3KYNA 5C0CD 1DZBA 4IBLT 4M7JL 4KMQA 2CKBA 4OF3A 3U4AA 4YXLH 3ES6B 3HNTL 2R4SL 1JI1A 4WI9A 2BNRB 4EUPH 1SBSH 3VFUA 2PCPA 3K8LA 2EIZB 3MRMA 3DYOA 4MJ2A 4TNVF 2DQHH 4H8WH 1M05B 2A9ML 2MHAB 2WBJA 1DBJL 1MI5E 5IFAH 1K8IB 5DEZA 2BVPB 4DUWA 4Y8AA 1FNEA 1L0XA 3LH2H 1KJMA 3STLB 2VL4A 3BAEH 2F54E 3OR6A 4U05A 4CN1A 3FB6A 1C5CH 2VRAA 3F12A 3TNMB 4ETYA 1LO4H 3BT2H 5D70L 3C9NA 5MENB 2FECI 1UXSB 2KQMA 5I6XB 1QFWL 2Z0BA 5BS0B 1DLHA 4HFUL 1AGDA 4LF3A 2HFEA 3FT4A 3D3VB 4N5ED 1FORL 3O2VL 2BP3A 5GQBA 4I2XA 2BVTA 1QSFB 3WHXA 4L3EA 1OGAD 2LTQB 4NQCE 4YXKL 4KRMB 5GGVY 3SKMA 2ZUYA 3U0TB 4ZFOL 4WHYH 4MA8H 1W8NA 3DVGA 3MRGA 1DQQA 3V6OE 2E7MA 2AV1B 1J86A 5JHDE 4G7VL 2DYPB 1DN0A 1AQDA 3Q5YA 1MWAL 1FO0B 1RIVL 1Z0NA 1ZHNB 4NUGH 2ICEB