1TETL

Crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCKSSQSIVHSSGNTYFEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYEWHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an anticholera toxin peptide complex at 2.3 A.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG1 TE33 FAB (LIGHT CHAIN)
total genus 51
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetL01
4LKXB 3QQ3A 1T1YA 4HQQH 3KR3L 3NPZB 1SHMA 4JKPH 3MNWB 4RMVA 5EU7E 5IHZB 4WNQA 3X3FL 2NZIA 1DBJL 3NA4A 4PJEA 5AYUH 5JDJA 4PGCA 1XCTB 3B9DA 4HIJB 1T1XB 5HPOA 3P77B 4HAFA 1NLDL 3RAJH 4Y4KB 5IFHH 2GAZB 3LD8C 2AJZA 4DVBA 4Z5RB 1G7LB 4Y2DB 1FL3A 4MGXA 2A83B 4CN4A 1UA6H 1I9RL 5KZCB 3P4OA 1MAKA 3QUXA 4HPYH 1WITA 2VH5H 4D9LL 4LSPH 1GZPA 3N0PB 1F13A 2FZ3B 4ZQKB 5T1DH 4ONOA 3BN3B 3N1FC 3ARYA 1TZIB 1ZLVH 3RX5A 3SDAB 3EYVB 5E5MB 3KPQB 1MEXL 1YZZA 3WO3B 4NNYA 2VDOH 4DGVL 1K6QL 3LQAL 5EA0H 3CUPA 5B22A 3BYTA 3BISA 3MJ9A 3QO1B 5IQ7L 1NBZB 5HYSB 3EJZC 3NIGF 2O5ZH 3D25B 4LHQB 2HKHL 4X9GA 5I74C 3LY6A 2JCCA 2VLJB 2X09A 4D9RE 1CFVL 1JF6A 2Q6WB 1OVZA 5F89B 1MHEA 2J2ZA 4LCIH 3S37H 5EUKB 4DN3H 5F3BB 1T2JA 4XWOC 2R4SH 2O5XL 4Y5XA 3VG9B 4AEHL 2VDRH 4LPCA 4CU7A 3T77A 4NN6C 2V5RA 1OTTC 3OXSB 4IRJD 4JVPA 2EIZA 4BSJA 4XBPA 2PR4L 5BXFA 4QXGL 3C60B 2JB5L 4QTHA 4UMGA 5DMGC 4WUUA 5LXGL 2E8ZA 2BNQA 4C58B 3K8MA 3O81A 3VFTA 2APWA 1LO4L 3NCYS 2EYSB 5EIIB 4OB5L 1XF3B 1FSKB 2GJZB 4UNTA 2BNRA 4JG0H 4NM8L 5J06A 2B4CH 2IMMA 2EZ0C 5EULV 2AK4B 4NWTL 4G5ZL 2BSRB 3FQWB 3T2QA 2NLJB 2DYPA 3TBSB 4MQ7B 1NKRA 1A7QL 3SPVA 3V6OA 5HJ3B 1DN0B 3TPUA 4V1DA 5FEBA 4ZSOB 1U58A 2ATKA 1A5FH 4RGMB 3ZKMD 3CSGA 3RQ3A 1LMKA 3ORJA 3RWGA 3CX5K 3CVHL 4IRJA 2NX5B 3RGVD 4PJBE 3WIHA 3I3EA 4WFED 3FRPG 3IU4L 2AJUL 1UZ6E 1P5UA 2BY1A 1P2CB 5LBSH 2DQDL 1FO0A 1KIRA 3KYOA 3SOBH 4FFYL 5CMAB 2WW8A 3RWFA 8CGTA 1C5CL 3BKJL 4BH7B 2G60L 1LE9A 4NNYB 4P2OB 5IHBA 2MOVA 1S7WB 4PJIB 4MXWH 2AGJH 1G6RL 5BZDA 4TNWF 4MXQD 1L7IH 5DK2A 3PP4H 3R0MA 3LN5A 1S8DA 1S9VA 3LHPL 3HI6L 3MRNA 5I16B 1NMAL 3U30B 3EOTH 4JDVB 4OV5B 1EHXA 3DI3B 2FD6H 1NBYB 5F7YC 5ERWB 2R2EA 2V17H 3UP1A 4DZ8A 4WHTB 5DJXB 4J6RH 3TIDB 4YAQA 1QPXA 4KMTH 2CUIA 4ZFGH 4KJPC 4LSQH 4ZODA 2G5BA 5A16A 4L8BB 2IH3B 1S7RA 2IQ9L 1NCWL 1YJDL 4OD1L 3Q2CA 5FYKL 4KPHH 1DEEA 5JLZB 5DYOA 1A47A 1MUJA 4LLWB 2X4UA 1D6EB 1MY5A 1HHIB 3AM8C 1V5JA 4M3JA 5KW9H 2XPGB 1J8HB 3IDIA 5F1IB 4M02A 4XMPL 4ZUSA 5CD3B 3A6BH 1KTRL 4XNUL 3I84A 1U92A 1FVCB 4J3TA 1MCKA 3OKMB 1DE4B 2BCKA 3DV6A 1MI5E 4HPOH 4XHQA 4ZUVA 1AGFB 1NGXB 5DK0A 5DQJA 4Z76B 4K3DL 3I6LE 2GJ6E 5HYSA 5ALBL 4FS0A 1HSBB 4KHTH 1XGUA 3WV0A 3D69A 5C92A 1T66C 2I26N 2RHEA 4HZLB 3SDXE 2GUOB 4KI5C 3U4EA 3I50H 2AK4A 1RZJC 4RIRB 1RIHH 4XCYA 1PZ5B 3LS4L 5EFIA 3MLRH 4YHLH 4Y4HD 4R3SA 4HG4K 4IRZL 1ZEAH 3FQRB 1FGNH 3QDMA 1Z0NA 3MRRB 3X14A 3SPVB 3WSQL 3REVA 2BVQB 1X5JA 4NPYA 5DGRA 4D0DA 4HW6A 3V5DB 4KJYA 3BFOA 3QUML 1NFDE 5GJSH 5DRWB 2CLVA 2AV7B 3B9EA 5IEKB 2NX5D 3WXVL 4LVOC 2VLKD 2NYYD 2PXYA 1BAFH 4JO3H 5D8JH 3D85A 1FQ9C 5FB8B 4S2SB 5KTEH 5C6WH 1AP2A 5INCB 3T3PE 2JK5A 3HZYB 4R0LB 5LAXA 4DK3A 4P4KA 2Y07L 2AEWA 1KJ2L 5I1LB 3NCMA 5EZIL 2GJZA 3GRWL 1MJUL 5EO9B 3DVFA 5ITFA 5F6IB 3OJ2C 1YECL 2Z4QA 2CKBL 3KNBA 4OTXL 1ADQH 3IAPA 2MCG1 3TH2T 2Q87A 2A6JB 1WFOA 3QXAA 5JIPA 4PG9B 1HYSD 5B38A 5D1ZA 5DWUL 1XR8A 4OZHA 2ORBL 4YPGA 3STZA 3KPQA 1Y6KR 1NCAL 4LAQL 1GHFL 4OBRA 1J0KA 5H8DA 1DUZB 1DBKH 4PLKC 4PD4J 4K55A 3I9GH 3QHZH 1MCFA 2X4NB 1CQYA 4MDIA 5JR1L 1MRFL 2PTTA 5E2TH 2EDQA 2DWEB 3BP6A 2YWYA 4PGZA 2IC2A 1QLRA 4NKMA 1TCMA 3O9WA 1HHIA 3JTSB 5IW1A 3CFIC 4IS6B 3DURA 4JREC 2A73B 4F9LC 2BFVL 2UWEF 1OAZH 5ADOL 4PLOB 3ULVF 4KXZH 4HIJA 3QQ4A 1QTYT 2CIKA 3BEWB 3VMOA 2JIXB 5HGAA 4FQIH 5ACLA 4P48A 3B2VH 1QEWB 1DP0A 2R1WA 4LNRA 5BVPL 3OG6B 2OZ4A 4ODHL 3WS6A 1X5XA 3V52L 4ZPVB 4Z5RA 3HPJA 4PJGA 3BO8B 1S7VA 1RZFH 4QRTA 1D6VL 1CICC 5BVJB 1KACB 5K9QG 5KANI 2VLLA 1LO0L 5HXMA 3VRJA 3WS3B 2WIMA 3EGSA 1VB9A 2VL5A 3SDYH 2X4SA 3P11L 1ZLSL 3O2VL 2RAMA 5ADPH 2CR6A 4D2NA 3VXSE 1AY1H 5FO9A 4XCCH 4HK0A 1IEHA 2Q7YB 1NAKL 2AVGA 4NQCE 1RZKL 2OI9B 1J11A 4YH6A 12E8H 2BSTB 3LEXA 3C08L 3QDAA 4ZD3L 5IFAL 5FA3A 1HINL 2ADIB 3LPWA 4H25B 4NT6B 5DQDH 5F89A 5F8RC 5AWNH 3TZVB 5TH2A 4KKNA 4P4KB 2OR7A 1RSFA 1JV5B 3OKYA 3ZDYE 1E6OH 1I9IH 3QEHB 4G9FA 4W4NA 5C2BL 2E7HA 5HHPA 1KOAA 1V05A 1H3XA 3C6SA 4ZO7A 2Y36H 3DOSA 4CJ0A 3C8DA 1FNGB 1CLOH 1G9NH 2EDJA 1JN6A 1BIIA 5T1MA 1MCCA 1F2QA 1HKLL 5SWSD 3WUZA 1PEZA 3OXSA 1FLRH 4F8QA 1IM3A 3WIHH 4KUZL 5HPMA 5EO1A 3LQZB 4QXTB 5CP3A 1GIGH 3K81A 2P5EE 5DJ0B 1QFWM 5TFSH 2CLVB 5ESVA 2VZ1A 4PJ7F 4OF7A 3VXMD 1I85A 4X9FA 3EYUH 4HK3N 4PUBL 5FYJE 3PQYA 5HYFA 5FOBA 5GS0D 3TJEH 2IANE 1PKQE 2XTJB 2MNUA 4PRIA 3ARRA 5GSVA 2CDFA 3JXAA 3MRIB 4MB3A 1ES0A 5EG6C 3QDGA 2D31A 2NXZC 3MCG1 4N8VG 3OKEB 3RWHB 5JIIA 2VISB 4PP2A 3B8SA 1K3IA 1G0DA 1JNHB 2C4FT 4GFTB 1LEGA 4AL8L 4J3OC 2LAAA 4JFOA 1C5DB 1MRDL 4OKDA 1CL7L 4P5TA 2F5AH 4G3YH 5I8CA 3QDGD 4YHIB 3HPJB 4PJGB 2ICWA 5CILL 4RDQF 2UUDK 1AO7A 4WEBL 5E1HB 4BH7A 1LP9B 4R2GB 1MHHB 4GXVL 5IMLA 4D9QD 4DUVA 4HXBL 2E9BA 2VL5B 3GJFH 1BQLL 3TH4T 4EI6A 2YPLD 1BVKA 4O58L 3ULUH 1TVBB 4NN5B 4NGHH 3O8XA 5J1AB 4PJFE 5C07A 1CFTB 4I0PD 4MA8L 4C56D 5ERWA 3KYNA 2GTWB 2VQTA 3BD4A 1A1MB 1M1SA 4QO1A 2QQNL 4C55A 4JEGB 2BHYA 2PO6A 3T65B 5HI3C 1GCFA 1P84J 1LNUB 3DMMC 2ARJB 5D71H 5EH1A 1Q8MA 1J8HE 2GTZA 2DQGH 1AI1L 5H37H 5D7IE 3MV7A 1NDGB 3U46B 4KI5E 4R96A 2Z93B 1XF4A 1RFDL 2DQIL 4RMUA 2FHCA 2VZVA 5TF1L 5MEOB 4Z7UE 1BFOA 4AG4H 4Y8AA 5D7JD 4NHCH 5BOPA 5T3ZD 2GCYB 1EJ6A 4GXUM 4Q97A 1A3QA 5J6GB 5D5MA 1N64H 5F9OL 5D6DA 4H0GA 4R0LC 4R2GC 4ORGB 5D7LB 1C08B 5I2IA 4GKNB 4BQ9A 4Z76A 5AZEL 2J4WH 4XI5C 2YPKA 5GGSB 3TN0D 4OUOA 5I15H 4AYFA 3I75A 3ZKMC 3QUYC 5JHDB 2DM2A 5FHBH 1QZ1A 2YD3A 1YA5A 3WNNA 4JCLA 1UACL 2Q7YA 5L8KB 1KXTB 4XCYB 1MFEL 3IKKA 4JFFD 3L3KA 2J12B 1QR4A 1IQWL 4M6OL 2D9CA 2W91A 1JIBA 3QWQB 2OMNA 1XIWC 1U93B 4OZIB 1NLBH 4XVJH 2BJMH 2EDWA 5D7SL 4GBXA 3REVB 5DUML 3UO1L 5FYKU 4QF1A 1SYVB 1Z9OA 2HWZH 3LN9A 4R90L 3DX8A 1J10A 5HGDB 1ZGLP 1MSPA 4NQDB 5EWIH 1JPTH 2OR9H 1NFDA 1CIUA 2C1OB 3MCKA 3TO2B 3DVGB 4XC1L 3HLAA 1MHPH 1IFHH 4JREB 1G7QA 3UTSD 4EXPX 5J0BA 1AO7B 1HYSC 4DTGL 5IT2L 2KZ1B 5MI0C 2ADJB 1FZOB 5C0DB 3MOBH 5T1KB 3HCVA 3LZFL 3ALWA 1KNOB 5CZXD 43CAA 2MSPA 5ITFB 1YPZE 5TDPA 3K4ZA 3ARWA 3PWPB 1RULL 1RMFL 2W59A 1OW0A 2FCBA 2O26U 4AJ0A 2XZQL 3VFUB 5KSUA 1MWAA 4LSTL 5IG7A 1M7DB 3PHSA 4AT6B 3TBTA 1R3IH 4P46A 2D7TL 3BPCA 4EIZC 2XWTB 5DJ2B 3VXMA 3EGSB 4YC2C 4U6YB 3AREB 3NN8A 5GS1A 4LARH 4PV9B 1LE9B 4WO4D 1NL0L 5BCAA 2A1WH 5ICXB 3B3IA 3FO1B 3D39E 3ULVD 3S96B 2X6MA 4ZNCD 4JRXD 4ZDHA 5JNYA 4X98B 3U2SB 2LTQB 3U7YH 4HSQA 5IW6B 3LSOB 1I8KB 3SJVD 3VFSA 5EZOL 3CAFA 4OGYH 1EXUA 4L3ED 2EDLA 1OGTA 3MRCB 4Y16C 4GMSH 4U05A 3QI9B 2Z92B 3BI9X 2PNDA 4H8WC 3PGDB 2F54B 4QT5B 1OF2B 5TPWL 1G7PB 1B4RA 4Y5XC 2UV3A 1A2YB 1HZHH 1RZ7H 4QRQA 5CJ8A 3MOAL 2M1KA 1I4FB 1NAMA 2DB8A 5DMYA 3MXWL 2A74A 4PGBA 3QI9D 3L3OB 5FA4A 1R6VA 4MNGB 3CD4A 2EEBA 4YXHH 4M48H 1CXIA 4KZDL 5DZNA 3QFDA 2DQJH 4W6XB 3FCTB 3SJVB 3ZE1F 3WO4B 2NZ9C 2A6IB 3W9EB 2KZWA 4EOWH 3ULUE 2FJFB 1G7JA 5I1JH 3OTTA 3RZWA 1KGCD 1KLUB 5EORH 3QXDB 2VABA 1KB9K 5E8PB 1RUQH 3T0EE 2MKLC 4HKBB 3MXVL 2ZKHH 4JPKL 3U4EB 1WTLA 5IB2A 5L9DH 2DTML 5LGJA 4V1DE 2AJXL 4OCRL 4JO2H 4XBPB 3A67L 4PJDB 3ME0A 4ZS7L 5FA3B 3G6DL 3WJLC 5C0RH 3QDJB 3X14B 4DKAA 4OFDA 2DLFL 2PYFB 3L95B 4LLUA 3MLSL 1OTUD 3PWPE 3O2DH 4XP5H 3TNNB 4PJIE 4Z7WA 3CFKB 4OQTH 2BNRE 4PRAA 1L9MA 3HA0A 4NO0B 1FE8L 3SDCD 4MS8C 4LSSL 4LU5L 3DRTB 1YEFL 2X7LB 4RFNC 1WBZA 4NWTH 4I18B 3SE8L 4JZOA 2DAVA 1JWSA 3PWVA 4BH8A 2QQKL 4NNXA 1IGFH 2HTKD 4WU7A 5HY9A 3LQZA 4WY7L 2AW2A 3B6SB 4F15B 4X0KB 4RAVB 3QXWA 5H94B 3LQAC 4OF8A 4PTTA 2GY7B 5SV4A 2FX8L 5E8EB 1KJMA 1T21B 2WINB 3EO9L 3VWKD 5CZVL 5CUSH 5HHXH 3HE6A 4JFDA 4PJXA 2N1KA 1A6VH 3B3IB 3OJVC 4WWKD 4ZTOH 1I75A 1MPAH 2F53B 3S3JA 4ZSOE 1I8MB 5KN5A 5DD0H 3DSFL 2Q86A 2HT3C 2DLIA 1WTGT 1AGBA 1MCSA 5HGBB 4M7KL 1EXUB 4HXAH 4JM2A 3MNWA 4J3WA 5I73B 4XH2A 3T65A 3L3GB 3TH3T 3X11A 1CS6A 3OG4B 3FB6A 3VE0B 3E6FB 4GRWF 5ENWA 1SJXA 5EPMA 1G7LA 2IPUG 4P46D 4F7CA 3TT1H 5IQ9B 5DF0A 4K8RC 3V6BR 1FBIL 4GRWB 4KRPD 3BP5A 4PY7A 4FFVC 5KJRH 3MRGA 1A14H 1IC7L 1OGAB 5L7XL 3FT3A 3LHPH 4JKLA 1I9EA 1KCUL 4LRNH 3RKDC 2PYEE 4Z9KB 5IMLB 4KKLC 2R0WH 5D7JB 5GRUH 1IGTA 2FD6L 1A9BA 1U8OA 1CFBA 2OL3L 4YHZL 4IOFC 4XNQA 3UC0H 3PNWB 4G7VH 1BWWA 3IKCB 1IM9A 1YNKL 1FSKC 1DBMH 4IJ3B 2P24A 4GUPB 3W0WA 4I0PA 3BQUA 1YJDH 3L5JA 3T0EC 5CFHA 4P23A 3U2SA 4F7EB 1UH3A 2AJ3A 3HG1B 4X7FC 3I3BA 3U9UA 4GH7B 1W8NA 2QR0A 4ZOCA 3FTGA 3ZDZE 3BP4A 5KANG 4NKQB 2LU3A 2VZOA 3RVXC 3SCMB 1NGXA 2C26A 2HKFL 4V2CB 1MWAH 1SVCP 1EGJA 4H88L 3HI5L 1XF4B 3W0WE 3FQUB 4YBLC 1VEMA 1EAPA 3U7WH 3T77B 1DLHB 3AXLA 1GVIA 1X6LA 2EH8L 3QH3B 3I50L 1TTGA 1W2KT 4ORGA 5D7LA 5D1ZC 1AXSB 2PYEA 5EZJB 5KOMC 4CAGA 4N8VA 4M93C 2DQEH 3WYRA 2ZUUA 1S7SA 4OLZH 5SX4I 1S7UA 3CFJB 3H42L 1N6QH 5E1AA 2XN9E 4WFHE 3ZTJH 3T0BA 4JO1L 2PCPA 3TFKD 4YIQB 1BQHG 1MCWM 4S2SA 3F7YA 1M05A 1M7IA 2W9EH 4TTDC 1BAFL 4L3CB 3PXHA 2R2HB 4J23A 1K5NA 4L29A 2DICA 2XTJD 2DI8A 2NMSA 5LGHH 3MRJA 4WTXA 4FQCH 4P9MH 3IFNH 3IFOB 5JA8B 4MAUH 4HCRL 3FJTA 1D5ZA 1YMME 4NO5B 4X7DC 1JPFB 1BLNB 2C3HA 3P4NA 2B5IC 1U3JA 2FEEL 3V0WH 3GSNL 5CEZD 4S11A 5A2KH 5EBMB 2WIIB 1QLFA 1HQRB 2B1AL 3VFSB 1Q0XL 4PRHE 3RNKA 3QCVH 2NY3D 4WEMB 5C08B 5EBLA 2ZP0T 2FSEB 3QDGB 1P2CA 3SGEH 3V95A 3OAYH 5DR5L 1QLEL 1AR2A 4L3AA 2UZXB 1J0JA 3ARBA 2NNAB 4JKKA 5IVXA 3NZHL 4O2CA 1A02N 5DMIH 4JFOB 1S7WA 1A4JB 1SJVA 3O3EB 3WKNA 3BSZH 2YK1L 3PWPA 4JY6B 4LPVA 3GGWA 2HLAB 5E2TL 3ROOB 5GHWH 4YHML 3LVEA 2VSDA 3VFUA 4ACPA 4G6MH 5IOPB 2ITCA 1DSFH 5J8OA 2IMNA 2I5YH 1BFSA 1S5IL 1AGEA 5KSBE 4UQ3B 2VLRA 3NIDF 1MH5A 1OAZL 1QBBA 1RJLA 5HI4D 2CGRH 4Z7NF 3ZDXE 1IE5A 4R4FL 4CU8A 5IBLC 5I1CH 2VKWA 3GDBA 3O6KL 5GPRA 1KJ3H 1AHWB 2WANA 1MHCB 1CTOA 4OT1H 2L0DA 3PHQA 1A9BB 3FOLA 2YD8A 1NFDF 1LO0H 3DROA 3S36H 4JHWL 3GSWA 4P49A 4QT5A 3UBXA 4KGJA 3IU3B 2JB6A 6CGTA 1P7KA 4PP1D 3G5YB 3TBYB 4P23B 4MHHI 5K9JH 4G8IA 1DANT 3F65A 2A77H 3S35L 2WQRA 5TF0A 4UU9B 4RFNB 2AJYL 2AEQH 2EEAA 3S8WA 3BWAA 4P0DA 4AIZB 1XGTB 2BVQA 4NPYB 3IF1A 1Z2KA 3LKPB 3OKLA 4PJ7E 1C7SA 4ALAH 2FH8A 1DEDA 4HGMA 4M5YH 4YUEH 5I30L 1C16B 1U3HC 4LQFL 4Z6AT 5L6YL 4H8WL 4Z7OE 5DEGA 3BESR 5SX4H 1OD9A 3D39A 4S1DC 5BW7C 1JFQL 1L6ZA 1GGBL 2VLME 3IETB 5E6ZA 4CJ1A 4L8CA 1RJCA 2F53A 4UOW0 1RQ5A 4GW5B 1UEYA 3T8XA 2EKSB 3QJFB 3RVTD 1A7PH 2WIIA 4Q9BA 4X99A 3DX7A 1KJVA 5C70A 3K8KA 3WUWA 1RK0A 1AFVH 1BBJA 1E4XH 1PY9A 3F58H 5C08A 1J1XH 5JQ6H 2X2YA 4OCXH 1YMHA 1TENA 3OAZK 2AI0L 1B2WH 4HWBL 1ITCA 5D6CB 2MKWA 4JR9L 4DK6A 5TQ2H 3H9SD 3VGEA 1OB1B 4LL9A 4P2QD 3ZDYF 3DMMD 1IQDA 2A6DA 4RX4D 1U8JB 5GGQL 3U82B 3UBXI 3RGVC 5DK3A 1HH6A 4PG9A 5F6HI 2RJMA 3GSXB 1MIML 2X4TB 2JTDA 3MZGB 3V4VH 3T2OA 4PJ5D 3FT3B 4HS8L 5GSVB 5IB1B 2HJKB 4WNQB 3I3DA 5MEND 4X0KA 3JWOC 3NVQA 2CUHA 1YEDA 3S5LA 5DFVC 5HD8D 2EDEA 4U1JB 2DBLL 5HY9B 5I1GL 3TIEA 4ZO6A 1KCSH 3CH1B 1BQSA 3V5HB 1HHGA 2DL9A 1WVZA 3G6JF 4KQ3H 5GZOD 4IOFD 2AJZB 4KI5D 1KT2A 1JUFB 4TSCH 3W2DL 4M43L 3MLPA 4PJ9B 4KY1H 2O61A 5ID1B 2BRRL 3V8OA 2VR9A 1CE1L 3OB8A 2FJHA 3OJDB 3LMJL 4IRSD 1TJHH 3D0VB 3MGOA 4PRNA 5C0JA 3ZKXB 2K7PA 2OJEA 4RMQA 4UAOC 4AM0A 4GXVH 3UZQA 5B4MC 3VGDA 4F2MB 4IM8A 4AQOA 3UCRA 3NIFF 1V7NL 2PKDA 1MCIA 3OJMB 1CLZL 2OZ4H 1MFDH 3H3PH 4U6TA 4EDXB 1FFPB 1FV1A 4J8RB 3VXRE 3RFZC 2HT4C 1WZ1L 2CKBA 4XGZA 2CR3A 1D5MB 3VWKB 1T83A 2WZPD 3WD5L 2P44B 1EMTL 3D39D 1T5XA 3ULVE 1XGTA 4MNQD 1DQJA 1U0QA 1QFUH 4OLVH 4Z7UA 3ULVH 4HBCH 1P6AB 2DJ4A 4PJBB 3FAWA 3KPNA 3MUGB 4GRLB 5E2UH 1SY6A 1BQHB 2P24B 4GUPA 4JB9H 1LVEA 4W6YB 5GGRA 1FCCA 4HT1H 4CDHA 2XA8L 5DEFB 3C5ZA 3BRFA 2R69H 3LEXB 4C59B 2P4AB 1NFIA 4AG4L 2AQ1A 3NACL 1FJ1B 3GSNB 4OLUH 1HXMA 2YBRA 5HI5D 4PJXF 1OP5H 2DIJA 5FYJD 5DD6B 3CMOL 1VPOH 4LEXL 4NO5A 5DQ9A 5F6IC 3T1FA 4I3RH 2Q8BL 5EUOA 4UIMB 2P5ED 4LASL 4XBEL 2NXYB 1VFMA 2J1KA 3F7PC 2E7BA 4FTVD 1YQVL 1DVFC 5LGKA 1KPVB 4UDUB 4XXCA 1VHPA 2PYEB 3FQXB 1UYWL 2AXGB 3AVEA 1I1RA 2DF3A 5E95B 3QFJE 4JPIA 4N5EC 4RMWA 4YX2L 4QRRD 1I7TA 1YNLH 2SEBA 2R0LL 2YZ1A 5F44A 1KCKA 4JQVA 3CFEB 1WWBX 4R4ND 5GZND 2P46B 3D39B 4PRAB 3RPIB 2EEDA 3CGTA 4TUKH 1B4JL 1A4JA 3BH8A 3QPXH 4MWFA 1IAIL 1DBJH 1EBPA 3VH8B 3GKWH 1QSVA 3HC0A 4NC0B 4YJZL 4DQOL 2X9XA 2MPAL 1JHLL 4XC1H 1S78C 4FXKA 2E27H 5E99H 3MRJB 2IANA 4HS6B 4L1HA 2VLJE 2JKXA 3DMMB 4PTTB 5D6CA 5F7NC 4JRXE 1AQDB 1BLNA 1BOYA 1IKNC 4HLJA 4I4WB 5K9OA 1I8MA 3NTCH 4JRXB 1RMFH 3W39B 4M00A 5FYJH 4DOHB 3UMTA 1DUYA 1FV1B 2MWCA 5F21B 3WDIA 1H15A 3V6FB 1JZ5A 4YDKH 4WWKC 1YYLH 1NANI 1PYWA 1BD2B 1YYMH 5EPMB 4Z7VE 3NPSC 4F7CB 1P6FA 5T5FL 4LLVB 3RWDA 2C7UA 2DQTH 5EBGA 3DETD 4NOBA 3IDNA 5C0FA 1A6PA 1UJ3B 2ED8A 1I1CA 5DMKB 2R15A 1ZSDB 3CU1A 1WEJH 2VLJA 1SJHA 3QO0A 2EDYA 1LHZA 2QSCH 1LNUA 4LMQE 5IOPA 4K7FA 1U8OB 1P9MC 1UWEH 2AERT 4NM4L 3DVIA 2YN5A 2FGWH 2HJLB 2VXQL 4MYWB 1JPGA 2J88L 4N90E 3O3UN 1RVFL 4P5TD 3WHE0 1SEBA 3T3PF 4QXGH 3MPCA 1BREA 1NGYA 4JFYA 1MRCH 4LPWA 1T7WA 4EN3B 4XCNA 5CJOH 4NFDA 5BS0E 4MB4A 1R3LB 3HMXA 2BVUA 4Q6IC 5F7WC 3MXWH 2VDPL 4RAUA 4YEEA 4M93B 2FWOB 3MLYL 4XPGH 5C07D 5DT1H 3KPLA 1KF9B 3QG6A 1H3VA 2V9QA 1T6WA 2YPLA 4IJ3C 1PEWA 4Z7UB 3FZUC 3O6FD 2YPKB 1SBBA 5KAQF 3L7EB 4M61B 4OUUA 3NCCB 5BJTB 1JGVL 3HTLX 2ZSVB 1AGCB 2XI9A 3ARZA 2JCCB 5I66B 1O7VA 3DX9B 3K1KC 3LRSA 3MXVH 1PG7X 3MJ8A 2HRLA 5M95B 2VZUA 4K8RL 2E9IA 1Q72L 2I24N 1TJIH 1E27A 5E2VL 4UZGA 1MHEB 2VDQL 5J6HB 4QKXB 2GK0B 1CE6A 3MLWH 5GISL 2YD2A 1WLHA 3OMZA 2VAJA 2X5PA 5EU3A 5TDNB 5EC1B 3NCJH 3SKMA 3BDYH 1NMCB 1OAQH 3BN9D 5I71C 4RISH 1SYVA 2ZCHH 4FQJL 1BD2E 5DRZA 4I5BB 2ARWA 3DVGA 4L8CB 3QQ3B 2A6JA 2ITDA 5KVFH 1CXEA 3CVIL 5CBEB 1HXYA 2VYRE 3N06B 5B8CA 3QEGH 3U83A 3IDYC 1KXQE 1FAIL 4IIQC 4PG2C 1KNOA 4AEFA 4ZAKA 1EFQA 1UEMA 4AM0B 3P73A 5C0DA 4H1LB 5E8EA 4Z78B 2DQFA 4DVBB 5JW4R 1UXWA 3LH2L 3GSOB 1ND0A 3EO9H 4HIIB 4I77H 5D2NB 1JHKL 5F70A 4C56B 5GZOC 4MMXC 4JPWH 5EBMA 1A6VL 3ARDD 1CZ8H 4MQXD 4QOKE 2EIBA 5CJBA 1J1OH 4NUGH 2PTVA 4Q9RH 2QLVB 3GI9L 1IZJA 1CR9H 3GUTB 2IQ9H 2W0LA 3H9YA 4JFDD 3QHTC 3GMNB 2NY1B 4QHKJ 2IANB 4M7KH 3VD7A 3MUJA 5IF0A 4GMTH 1G7MA 3FONB 1IAKA 2FB4H 4O2FB 3RZCA 1R5IA 5FV2A 5IMMA 5AYQA 1ORSB 3HRPA 4GRLC 1VADB 2E8YA 5KSAD 3JTTB 4JGMA 3TVMD 3BDXA 3ARPA 3A6BL 3Q3GB 1JGEB 4I4WA 4ZPTA 4HGWB 3TT1L 1UC6A 2V5MA 4KK6D 1TXKA 4JRYE 3QFJA 1OGTB 2OS7A 3P4MA 4OIBA 3MLXH 5IEHB 3Q6FB 4NKIL 1YDPB 3KYKL 3HFML 3IDYB 5C7XH 5I0ZA 2IAND 4HFUL 3EW3B 3KDMA 1KCUH 4QGYA 3CK0H 1HWGB 3CJJA 2HT2D 3C6LA 2BSSB 5J7CC 5C3TA 1LE5A 3CDYA 3VWJC 4LFHG 1SM3H 5D2NC 4JQIL 5CCKL 5C0FB 1BBDH 3QP3A 1OW0C 1FFPA 4MA7L 5T33H 3PGCA 1DVFB 1RZJL 3T2NH 4L9DA 3FFCD 1VFAA 2VITA 3BRDA 3BKYH 4XHJD 3QUMH 4K71B 3M8OL 5FUZL 4NYLA 1EUUA 1PW3A 4K7FB 3FCTA 1HE7A 3K4AA 2WNGA 3SCMA 5I75B 3KLAA 1KLUA 2OXGA 4J4PC 1XF3A 4Q9QH 4IOIA 4G9FB 4OIIH 4EDWH 3ARDA 4TVSa 4CW1B 4PGJA 4Z0XB 3MA7A 3C5SA 3N1MC 1CQKA 4WO4A 4AK1A 4LLYB 1SYSA 4X6FB 4EN3D 4YXLH 1O0VA 3N1PC 4HUUA 5DJZA 1XIWD 4H88H 1D5IL 4I5BA 2DBJA 4WVRA 3VH8A 4FMFA 3VFRB 4A2LA 1EO8L 5EN2A 1A3LL 3SE9L 3I02A 5EU5B 4ZFZB 3MZTA 5CBEA 4KRPB 1C12B 4ODXA 2N7BA 4OGAD 3GSQB 43C9A 4QF1B 3CFCL 1HSBA 1WFTA 1AC6A 4L4JA 3ARTA 4FFZL 1JYVA 1CVRA 4N9OB 3MFFB 5KVGL 1FC2D 3HZVB 1M7XA 2XN9B 3PWLB 1Z5LA 4LGPB 4BSVA 5JO5A 3IDJA 1IMHC 3MODL 3RWJB 4L3CA 3RVXD 3UJTL 4NZUL 1JI1A 1DL7L 1T1WB 3FOMA 4YC2B 1AIFB 4BH8B 5JPNA 1A7NL 1A0QL 3QDMD 1QR1A 5JR1H 4P3WA 5F1NB 1UFUA 1Z3GH 2IAMB 1RIVL 4JHBA 4URTB 4NQEA 3ARFA 3PL6A 2Y6SC 4LHUA 4HUXB 2R0KH 4PB0H 4QRPA 1IQDB 2A6DB 1T5WB 1JVKA 4PJAF 3T08A 4LHJB 5BRZE 2DYPB 3VD3A 1MCNA 5DD3L 2XXMB 3GSNH 1SY6H 3VFGL 4HLZH 4F7PB 2HVJB 1HHKA 3BMVA 3BAEH 3V6OE 2EC8A 1DN2A 5KSBA 3G5ZA 4DAGH 1A21A 1CGYA 2CDGB 4OI7A 3D3VB 4H20L 4GBXC 1IKNA 4PB9L 4R7NB 4U49A 5D1QA 4Z7VF 3W5NA 1BZ7B 3JWDH 5E8OA 3IYLW 4M6NH 4NO3A 4LHUG 3PGFL 4HAGA 4KTEL 3M1BB 2Y6SD 3O2WL 2VIRA 1NAMH 5DLML 3WLBA 1IEAA 5FXCH 2NW3A 4YGVB 1FFNB 4WI6A 3ZL4H 1K9TA 3D18A 2BHUA 2B39A 2XQBH 2DLHA 3LOWA 1MELA 5K9OB 3DUSB 5EIVA 1BD2D 5E94A 3QI9A 3SKJH 2NY2C 1VDGA 5GJTH 3BUTA 1RURH 3UDWC 1I3UA 1A6AB 1IGTB 4Z95L 5E24E 4OJFH 3GMRB 3BHBA 5DVOA 5MERB 1DQDH 3VWJD 3PNWA 3WFDH 5HDOA 1UM5H 2ADFL 4HZLA 3ZKSD 5EOQL 5MEOA 4KTDL 4Y89A 5B38G 4KVNH 2AKRA 1YN6B 2P5EB 4P59H 4WW2F 1AHWA 4ZFOB 1I9JH 3QCTH 2NY4B 3G5XB 2BDNL 3EHBD 3BZDA 2FYYB 2WBWB 2C3VB 2Y9RT 3L6FB 5DRWA 2R39A 3NA9H 2VL4A 3SKMB 2A9ML 4JHWH 2FBOJ 1NPUA 5CGYD 4DFHA 1BECA 1IC4L 3RGVA 2EDTA 3QULA 4MNQE 3STBA 4XBGB 2XN9A 4NC1C 4X7TB 1D9KB 4ZUSB 4DGYL 1DLHA 4AY0A 5CD3A 2VLKB 4U1LB 3T0VA 3DYMA 2OJZH 2N4IA 4ZS6C 5IHLB 4MNQB 3VFMA 5SX5H 3CDGB 4PUBH 1GOGA 2PYED 2XKUA 4KRNA 5DEGB 5CEXB 4M5YL 4YUEL 2FIRT 3MLVL 1LGVA 1YY9D 1IBGH 2YS4A 1NUFA 4HFWA 4JFHE 2C3WA 1CFQB 3QHFH 3S9DB 5E9DB 5F96H 5IB4B 2VQUA 2VLRE 2HT4D 2FX9H 5LQBL 3IJSB 4O5LL 5A3IC 3LRSB 5FM5M 2HVJA 4RGNE 2R2HA 2G2RA 4PJHB 2CRIA 3K46A 1U95A 4QHKI 5CLTA 5EOCL 2AK1L 2LV4A 1JZ7A 5EBWB 3LEVL 5L8LB 3RI5F 3HUJF 1MLBB 4UNVA 1FL5A 4PP2B 4K3JH 2M2DA 5T1KD 1X5HA 1JPFA 3MFGB 1CFSB 5J12B 1R3JA 1UM6H 1QP1A 3TNMB 5FYLE 1AO7D 4EUPH 1AP2B 5I76B 4LSVH 3WN5A 1S3KL 1V8HA 1K3ZA 2V6HA 4ZAKC 2N7AA 4ELMB 1FCGA 5JXEA 3JVGC 2DBLH 1KEML 1XAUA 2H2PD 2LE9A 1JWUB 1ED3B 1A9EA 3EFDL 4XX1G 1FFOB 3DUUA 3DBXB 3BGAA 3DIFB 3LIZL 1U6AL 1OSZA 1CGUA 1N59B 4QRSA 2F5BL 2CRZA 3CFBB 1MCLA 4ZOBA 3FB5B 4XPTH 1A1MA 4RFOL 1QO3A 2CDGA 3NIGE 4MXVF 4I3SL 4KGLA 4LBEB 4PJCA 4HKXA 1KN4L 4AEIH 3O4LA 1CU4H 4NHCL 4MJIE 4WDIA 5J12C 4JFED 2EYRA 3VGBA 1CF8H 1JGLL 2X1WL 3PV6A 4JN2B 2UZIH 5EOTA 1ZHKB 1N64L 3BPLB 1ZHNA 4JO4L 4DKFL 1YEGH 3ULVC 3QUXC 2XZAL 5MHSE 4J3VA 4WI9A 5HVGB 1XGQA 3VWKA 1QRNA 3CX5J 3RWCB 2HN7B 1JK8A 5DFVD 5IIEB 1FO0H 2YUXA 5GRWA 5IJKC 4OZGA 1A6UL 2IFFL 4NJAL 2Z31D 4PJ5B 3KJ4C 5D2NE 2W65A 4MLSA 1N5AA 4ODVH 2X05A 4OZFH 3RDTC 2X44D 3KVQA 1BWMA 4FQ2H 1T1ZA 4F3FA 3EKCA 1H0DA 5GXBB 5HYJB 3QUXD 2VDMH 1MOEA 3ARVA 1BGXL 4YFLI 3UTQA 4G6KH 1A6TA 4OFYA 5T3ZL 3MV9A 3GMPA 5TDOA 4HWZB 2MFNA 2RQ8A 2ARJA 2VQ1B 5C71A 5JHDD 2YA1A 1ERNA 3SE4A 3G9AB 5KSVB 4HUXA 2PTUA 5EIQA 4MJIB 1TTUA 5SX5K 1P4IH 3MUY1 3T0EA 4H5SB 3SKNB 3TJHD 3F62A 1IFHL 4LEOA 2AEPL 4G8FA 3VXRD 2FGZA 3HLAB 5IT2H 5DJDB 1MFBH 5D1XD 5BQ7B 5ECJE 2CK0L 2QHLA 3IDXL 3QYCA 3WUWB 4D9RD 3CXDH 4X6BB 2RIKA 4L4TD 4YZFE 1RD6A 4MNQA 1CBVH 2NY5H 3VI4E 3G04B 5FYLD 4H1LH 2CIIB 3SY0A 4WCYL 5MP6H 4DEPC 3HMWH 3BVNB 4ONFH 4P23D 5FDWB 2JELL 3HR6A 4LCWE 1S9VB 3O45B 4JFQA 5IK3A 5GRXG 4MMZC 5DO2D 1N59A 2DLTA 4DUXA 2LQRA 4NRZB 1IAIH 3MRDB 4WWKA 3M17B 3ZKND 4LVHB 1OGAE 3RY5A 4F37K 5HGHA 5E8DH 1Z9MA 4MJ2A 5DJ0A 3N9GL 4LCIL 3AB0C 4ZSOA 2KPNA 4WUKH 3C2AH 5DVLA 1YEEH 2P8PB 3H9HA 2NTFB 1T03H 4QRPB 3BP5B 5DJCB 2AKRB 3HUJB 1IGJB 5D7KD 1IAOA 3MV9D 4GKSA 5AAMA 3RGHA 1OM3H 1WICA 1KB5L 4OZFB 2M8XA 3N85H 5KVDL 4OM1H 4NP4L 2YD6A 3WEXB 4P2QE 1S7QA 1Q94A 1MFCL 1LO2L 2IH1B 5F7FA 3PGDA 1NC2A 3VMPA 1T2QL 4X8XA 1G7IB 1V3MA 3RZCB 4B50A 4DGIL 5I9QC 1I4FA 1LO4H 4PJIA 2V7HA 2IADB 4R4NC 3RWDB 4XNMA 3AY4C 1CD1B 4WRLA 2DQJL 1C1EL 1H3UA 5FA4B 4UILL 3HAEA 2I60H 1VESA 5C0AA 2OMBA 3V5KB 4OZIE 4PFEA 1MJJA 1RZ8A 4TOYL 5DJ2A 4UV7H 3VXMB 1WCQA 4GKNA 4K3GA 4N0YL 3FQRA 4Z7OF 1QNZH 1NCTA 1HILA 2R56H 2H3NB 1XZ0A 1GGIL 5C08D 1DQMH 4QRPE 2FGWL 3O3DB 3DARA 3MRFA 2HFFB 2GIYA 5E9DA 4ZS7H 3CVHH 4Q0XL 1LQSR 4NQEE 2Q6WA 5IGXH 1Z9LA 1CXKA 2IPUK 4MCZA 3KXFB 3OV6A 4UDTB 3VJ6A 5F8QC 1BM3L 3I85A 2GHWB 1DLFL 3WIFA 3UAJC 1AJ7H 1LDSA 1QHPA 1KB9J 2ZWLT 1CFNB 3ZE1E 4R26H 4R8WL 3ZSTA 4I48B 4ZTPL 3OWEA 3WFEL 4FQLL 4HIEB 4IDLA 3ARGA 1CDUA 1PD6A 5JW3H 1S78D 3HE7C 3D2UD 3QNXA 1KC5L 2A74B 5FDWA 2CJUL 1YN7A 4GG6F 4PS4L 2P49B 4HC1L 3RIAF 1FGVH 3SGJA 4ZUUB 3ISWA 3C60A 1EFXA 1F90L 2FX8H 3H8NA 4KQ4H 4K8RH 5GGRY 2A6IA 2IAMC 3W9EA 2DTSA 1H8OA 1FG2B 4S10A 4TPRL 3GSQA 2WINA 3KPRD 4ZFGL 3GM0A 3KLDA 1IGCL 3EYFA 1ED3A 5F1SA 2FECL 1OGAD 3DSFH 2CMRL 2Q3AA 3VGFA 3W5MA 1N5YH 4P3CH 3DECA 4LEOB 3FT4B 3OAUH 3UTZA 4OLYL 3QIWA 5DD5H 4OV5A 3C8KA 5CBAB 3FB5A 3T0WA 1ZGLM 3L7FA 5E8NA 5F88B 1KTLA 1T0MB 5IB5B 1LEKB 3U1SH 5HYJD 3QUKB 3IRZA 1RY7B 3NIFE 4P3DB 2ZOLB 1U8IA 3TCXA 4EI5A 4XAWH 3HG1D 1UXWB 4N0FA 2WUBH 4A6YL 4J4PD 2BMKB 3BPLC 2WBJB 2VXVH 4I77L 3SDDB 5DHVH 1TDQA 4FNLH 3U4AA 2DWDA 1U92B 3NFNB 3INUH 3UAJD 4BKLB 4APQC 2BRQA 3W9DA 3HCVB 4JRYA 1U91A 4NUGL 1GL4B 4U1SB 2OJEB 3ET9F 4MJ5A 1I7UA 1U8QA 2WQ8A 3QUYA 4UIKH 1F3JA 1DZBA 3C09B 3HS0B 1BMGA 3GIZH 4FOMA 5MEQB 1OWRM 5E2WL 2VIRB 3DUHA 1ORQB 3N50A 1U41A 1VFOA 1VFBA 3VD5A 4K8RD 4RIRA 2V2XB 2KBGA 1FFOA 4JHAL 3BPCB 3DUSA 1FYTB 4OF0A 4Q6YA 5H2BA 2NY4C 4DN4H 2R2EB 4DZ8B 3MLXL 3PHQB 1I3GL 4RMTA 1OTSD 2ADIA 4H25A 4FXGB 2C4XA 3FB8B 1PKQA 3MV01 2J5LB 1UKTA 1QD0A 5DHYA 1OAKL 3WHXA 1QEWA 2R1WB 3MV11 2HVKB 2KL6A 4YWGH 5I19H 4PJDF 3D0LB 5IQ9A 2CPCA 1K6QH 3G5YA 4UT6H 3TBYA 2BK8A 3T0DA 5F1IA 5H35B 3RI5K 2IGFL 4PRPD 4YLQT 3WL9A 5DA4A 4MJ6B 1G0XA 2CKBH 3HNVL 1F3RB 1HIMH 5FECB 1ADQL 5ISZA 5J1TC 3EDDA 4RAUB 1ZHLA 3MX0A 2OX5A 1G1CA 4GRLD 4LLDA 5JMOC 4F7MB 5IFJA 3M8OH 4LLUB 5FUZH 1CG9B 3OGCB 5I1EL 5JOPE 3PL6C 1QKZL 3TA3C 5L2KA 1TETH 1T0NB 2QSTA 3WDJA 5D7IA 5F7DB 3WE6B 2ZJSL 4U1MA 1N5AB 4X9BA 4BQBA 2EH7L 5BV7B 3SO3B 3MOQA 1MCBA 1OLZA 3X12A 4YXLL 2V9RA 1FYHB 4WU7B 4JN1L 3G5VB 5C6TH 2F19L 4ODXB 4O00A 5I18H 2DL2A 3LKSB 3TYGH 1G7JB 2P7TA 2VDNL 4I48A 1ZWIB 3W81A 3AB0B 5GQBA 3CFEA 2VE6A 1X5AA 4P2OD 3HE6B 2PXYC 4R97C 4P9HL 3C6SB 4ODHH 1SEQH 4CNIB 2B4CL 1KCVH 2JK5B 3FQNA 3BIKA 5BZWB 1E28A 3UEZA 1CVSC 4O9HH 3QQ9C 1F4WL 2VXSL 1AO7E 3E3QC 4K2UL 4D0BB 2XKNA 4NZUH 1JYXA 3ZDXF 5F7EH 3ARED 5BS0A 4FZEL 4UINH 1U58B 5K59F 1F8TH 1I7ZA 1MAJA 1R0AH 1K8DA 2C4FU 2IADA 4YHMH 2ZG1A 3O8XD 3IXAB 2PCPB 3OF6A 4QTIH 2HFEB 4ZUWB 5GGVL 2R1YA 5CGTA 5T3XL 3HAEB 4W4OC 5DA0B 5ICZB 1RUKL 1P4LB 3QAZC 2UY6A 2W38A 3QXAB 4OAWA 1SY6L 5LCVH 1N8ZB 4L5FL 1ZHBA 2HJFA 7FABH 4WW1B 3T4YA 1J0HA 2YMXH 3FT2A 1REIA 2VXTH 2VLRB 4TTDD 1RZGA 3KYMA 1DUZA 3JSSA 3BRGC 4N0UE 5DS8B 3GO1H 2NTFA 1E6OL 1PSKH 1KCRH 2CRYA 1UT9A 3ESVF 3ILPB 3RA7L 1JGEA 1TCRA 1BZQK 4NJ9L 1Z6JT 1KJ3L 4WJ5A 4ODSH 2FLBT 1ZSDA 4NQXB 4KTEH 1G6RH 2NXZD 1Q38A 5F6HJ 1AHWC 5GGUB 3QQ4B 1U8MB 1F6FB 1FLRL 4FQHA 4KI5F 5FKAA 3FHQA 4OZHE 5I73C 2BOCB 4RRPG 5DUPH 1BEYL 5ESQA 5I1HL 1YEJH 2V17L 1N4XL 1LE5B 1QFWL 1KPUA 4N9GA 3CDFA 5JMRA 3C6LB 4GOSA 4XNXL 4Z95H 4Y5YA 5AEAA 1T7ZA 4KU1A 4P5TC 4LLWA 1W72A 4JY6A 2HMIC 1M6OB 3HB3D 2V2XA 4KHXH 3BO8A 3KYNB 2EDDA 1JNNH 1MJJB 4M9PA 3L5WA 1UWGL 4GAJL 3QZWG 4N1CA 3OKMA 3QPQC 4ETYA 5D7JC 3M07A 1MI5D 1FVEB 2CXGA 3NAAL 3WXWH 5FUOH 3BT2L 3LKSA 4GXUN 5KG9A 1NFKA 3VRIB 1IKFH 5K93A 3CZJA 3D0LA 4BQCA 4CW1A 4GW5A 5HHOB 1U8KB 3GSVB 4KUCF 1KPVA 4UDTA 5GRVK 1NC4D 1NGPH 2B0SH 4G9FD 2MHAB 4HWBH 5I8KH 2IAMD 5FYKE 1UADC 4JR9H 5LG1A 3VFRA 1JV5A 4IIQB 2YXFA 1NJ9B 4G7YL 3TZVC 4NT6A 4ONGH 4PJGE 2YPVH 1ZEAL 5EU3B 4WGWB 5AZ2L 2AK4E 1ACZA 5CJQH 5J89A 3QNXB 3TV3L 3C8HA 2HFGL 3GNML 4BZ1H 3IFLH 5B39G 3GBML 4ZFFB 5GS2H 3D6GA 3B83A 4GS7B 4WFFD 4KVCL 1W72L 3TBSA 1HOCB 2VLJD 1A1OB 1GH7A 4R0LA 4DWHA 3SE3A 1TJGL 2DMKA 4WFFE 2ZCLH 2EXWD 5E1AB 4HH9B 2Z8WC 1LWRA 1HCVA 2DRUA 5EBWA 3TC9A 4YNYA 2YHGA 1S9XA 1KTKE 4E42B 4AMKL 1Q9LB 5MEQA 2Y07H 3F12B 4WV1B 3TVMB 1E6JH 1PFCA 1XH3A 4NNPL 4RFEA 3QIWC 4O51A 4MDJA 1A7RH 2DQIH 2D03H 1OAYH 4KAQL 3UTPE 3I6GB 4D8PB 5H2BB 1KTLB 4X4ME 3VFOB 1A4KB 1ZANH 3C8KB 2GQHA 2XV6B 2C5DC 1NCBH 4XPAH 5ISZD 1G7MB 1NCDL 5DUBA 2XZCL 4RNRA 2DS4A 4HUWB 1IVLA 4PJ8C 1CLZH 2QQLH 2J4WL 4F9PC 4GRWE 2R4RL 5ANMB 3LN4B 3IDNB 3AM8A 4KK8C 4F7TA 1AXTL 4KKCD 4NZTL 3TESA 3BP7A 3MLUL 3MLTB 1ZA3B 1RHHB 4IS6A 4N8PA 1PLGH 4GAGL 1GZPB 3G6AB 1U6AH 1UCTA 4DW2L 5FYLL 5IJVA 3QCUL 5E2UL 5E5MA 2DKSA 1BVZA 2CDEB 2F58H 3TIEB 1G9MH 4WI8A 4RWYL 4I3SH 5L2JA 4K94L 3AAZA 1LO3L 3WFBH 3MRLA 4KKLD 5DJYA 5JTWA 4XZUA 5CSZB 1TQBB 4PJ9A 1D7FA 3NGBB 5ILTL 2ZSWB 4XAKE 2H1PH 1MCEA 2R1XA 5JDSB 3IS1X 1H8SA 4FXGA 4M1CD 4OZIA 3FB7A 1X5GA 3QR2A 4Y4KC 2WP3O 3ARDB 4RMRA 4HUMB 4XPFH 4LSPL 1W0YT 4N68A 1ZT7B 4G6FD 4LLYA 4X6FA 4UIMA 1N2RA 2IQAA 2PW2A 4Y16D 5BXFB 3T8XB 4I18C 2AJSH 5ISZB 1WBZB 1U2CA 1AY1L 1UCBL 4UT7H 4ZYKA 4HZAA 2XZQH 4CBPA 4QY8B 1E27B 4YXKH 3WIFB 4D0BA 4NNXB 4IDJH 1QPPA 3DXAD 1F11A 3CFDA 4MAYA 3UYOD 4M7JH 5F9AC 4TUKL 2O5ZL 5E4EB 4RAVA 2VDML 1C5BL 3MBXH 3PXJA 5F9JA 4G6KL 1JNJA 1HINH 5AWNL 3OKOA 3MRBB 3ARGB 1ZT4B 4X7SH 1CFVH 3LKNB 5HHOD 1GPOL 3SKNA 3AC0A 1A1NA 2Y06H 5D7IF 3SQOL 1F4HA 1R24B 3HC0B 2BSRA 2DIBA 3DTXB 2YUVA 5DJ8A 5BMFH 1I9RH 4NO2B 2AEPH 3L3KB 1J0IA 3L3DB 2IPTL 1GJIA 2FLRT 1HKLH 5JZ7D 1N0LA 3I2CH 1NGZB 4NQEB 4ZUTA 1MEXH 3ARDC 4V1DB 2YWZA 5KS9B 4LCWA 2HTLC 4JFZH 3WKMH 3V4UH 4LSUH 4X6EB 5DUBB 5EA0L 2UY7A 4U6VL 4WO4C 1KULA 2QADC 1GIGL 4XNZB 3GK8H 3FQNB 4FABL 3B8YA 4D94A 4OCNC 5J3HC 2F74A 2JELH 1U8MA 2MJWA 2NY2B 2FBJL 3G5ZB 3MRDA 4WWKB 5JQHC 4OGZA 1X4YA 1B0WA 5EDXA 4GQ9H 1BFTA 4YHOL 4Z77A 5E4EC 2CSPA 1OP5K 4MS8D 3EYSL 1XFPA 5JPMA 1S9XB 3KS0H 2P45B 3IKCA 3O3AB 2R4SL 3WS6C 3H9HB 5JOPD 5CJXC 3GSXA 1T7VA 4ENEC 1A7QH 5DK2B 3DXAA 1IGJA 3W0WD 3O9WB 4P57A 4M7ZC 4CMHB 4P46C 1MI5B 3QJHA 4XCEB 5F7UA 2MQ0A 3Q5OA 5C0ND 5D9SA 2JB5H 3KHQA 4BKLA 3L3GA 4HUKB 1OM3L 4NDMB 5FO7B 5TE6H 3BEVA 3KYAA 1ZXQA 1U3ZA 2X70B 1LK3H 3DMMA 4DVRL 2DQCH 4HJJL 2VZTA 5ENWB 1QA9B 2NX5E 3AS1A 3MLSH 2CK2A 5ANMA 1VCAA 4J2XA 3FO1A 4XNZC 3GHEL 5INDB 3MTRA 5HHMB 2FEEI 2ZUQC 32C2A 1QBMH 5DVNA 2IQAB 1AE6H 2PW2B 3PJSA 3F6LA 2XPGA 1FZKB 1FFQA 2Z92A 2I60L 1X5ZA 1I1YA 2UVFA 1QRNE 2APVA 1M4KA 5HI4C 4QRRB 2NY6B 4R9HA 1VFUA 3E6HA 3CFDB 2HN7A 4OM0H 3NZ8B 4Y4HB 2W07A 4N9GB 2DMCA 1GGIH 1HKFA 1UZ8A 5ALCL 4FTVB 4KKAD 2X7LA 3CLEH 1AI1H 3RTQA 3O4LE 3HE6D 4DEPB 5H35A 4J6RL 2EDNA 2EE3A 3QT2A 1CT8A 4O02L 4UDUA 2VB5A 3WL9B 2VXUH 3MCLL 4NCC1 2QTEA 3VGAC 1JWSB 1BX2A 5HYJA 5TF1H 2NY3C 4Y19D 3QQ9D 1OCWL 1MAMH 5FO8A 2DQDH 4Y4FA 1OAQL 3UJJL 3SOBL 4FZ8H 1KPRB 3VXTB 2H9GA 1MF2H 3HC3H 1UH2A 4EI5C 1EA9C 3ESUF 4JKWA 4JM4H 4QCIA 1I7RB 1BJ1H 3WUWG 1CYGA 3UTTD 1NUNB 4AENA 4XMPH 5DSCB 4JFYB 4X80L 2W0PA 3OKKB 4X5WB 3S4SB 5ID0A 4Y5VA 4HUNB 3F7QA 4JY5H 1UACH 2XXCB 3MRKB 1MJ8H 3BPOB 5D7LE 3HZYA 2YRZA 4F80A 1FIGH 4MNGE 1B6DA 1EDQA 4G9DB 4H1LA 1F90H 5DRXB 3CFJA 4U1GC 5D1QD 2E6PA 4KMLB 4LSQL 1JE6A 1TQCB 3TA3B 3TT3L 3E1F1 2FIKB 3D85D 2F8VA 3DX8B 5AG9A 5LWYL 1WFUA 3B9KA 3S5LG 2A9NH 2Q8AH 4WU5B 4UT9H 3UTZB 1FLTX 4JLRB 1KG0A 4NRZA 3K2UH 3MV8D 4IBLT 4NCDA 2ZUVA 5IK3B 4OLYH 1Q9OA 5BO1L 3BPNC 3PWPD 3QWOA 3BGMA 4UBDD 4TSBH 3UTOA 4IRSB 4YHKH 4HH9A 3VDCA 2XWBA 4HPOL 4JO3L 5D8JL 3KPMA 1SMAA 3LPFA 1KEGH 4ODUB 3THML 5BV7H 5IMMB 3E8UH 4HPYL 5FGSA 1JZ3A 4MDJB 3ZYZA 3HFMH 2WP3T 3DBXA 3HG1A 5C7XL 3TVMA 3FFCE 1OAUL 5B3JE 4HGWA 1TNNA 1AKJB 1A4KA 4KKCC 1Q1JH 5F71A 3AFLA 4NQDD 3I6GA 4WI5A 1U8NA 2ERJB 4Y2OA 4I3GA 1GAFL 4OLXL 4TVPE 2YD1A 4JG1L 5MENB 3INUL 1BJ1J 3ZT5A 1UENA 3SDDD 3GSWB 3KJ4B 4FQXA 3H42H 2A6KA 2H45A 1RZJH 3B5GA 3V6ZA 5DWUH 3VFPB 3MLZL 5JW4M 4MZ2A 5EUOF 1FZJB 5J9PB 4FQ1L 4OCWH 3H9SB 3RX7A 4OZ4A 4TULL 1DBKL 3HMXH 1VFAB 1JZ6A 5HYJE 3BWAB 3FQTA 3VRJB 5EZOH 2FO4A 3WS3A 4AEHH 2YZ8A 1U3HB 4XP6H 3BIBX 2XY1A 3IFNL 4GSDL 4MAUL 5HYIA 4JFDE 2APXA 1MJUH 4N8CL 2X4PA 3D2UA 1HHJB 1M71B 5ACZA 5LXGH 5JDSA 1KIQA 4JFXA 1CGSL 3HNVH 3SJVA 1QQDA 3EO1A 2BY0A 5D7KE 1X5LA 2ORBH 2EYSA 5EIIA 3PP3K 4TQEL 5SWQA 1F6AB 1SJEB 5ANME 3VFNB 1SEBB 2BNUA 3GJFA 3L5XL 2H8PB 5IM7B 4Z7WE 1ADQA 1D6VH 4RMSA 1EAPB 1T4KB 1X7QB 3AS0A 5FYKD 4MD0B 4PLNC 2YXMA 1UB5A 1HH6B 4P2QB 5EORL 2VC2L 3VFVB 1JN6B 5T1MB 2XT1B 3RNKB 5HVHC 3BSZL 4L8SC 3RKDD 1KG0B 3HC4H 2FWOA 4Y7MA 1RIVH 4JDZB 1XGPA 4RRPA 1I1AD 1VGEH 1EAJA 5GHWL 1S7SB 1YPZF 2ZZUT 3O2VH 4JZNB 1FG2A 4NYLB 2DDQH 4MNHA 3QWOB 1U8LB 2W0KA 2YKLL 4K3HA 2PYFA 3DXAE 2Z8SA 3TF7C 5C0RL 2XWJA 4LCYA 3NH7L 5J13B 3B2VL 1KIPB 4LKXA 3IU4H 5ESVB 1KN2L 3L9RB 2OR8A 4WTZA 4XTRD 4Y5VB 5KVEH 1CDBA 1FDLH 2Y1VA 3GMLA 2J8UA 3STZB 1WUNT 1GXEA 4O9HL 4W6WB 5IBUG 3D0VA 3IGAA 3O2WH 4PPTA 2AGJL 1CLOL 1G9NL 4TUOB 5EU6D 4O2FA 5I17A 3M1BA 5FUCE 1X4ZA 2J8HA 2NY5C 3OHXA 5E8OB 3I6KA 4RGOH 3MROA 5CKAA 4OZIF 2HG5B 4QHLB 4YDVB 4FRWA 4Y19A 5GGVH 5HHNB 1NBYA 4KMTL 1OY3B 4LF3A 5TJWK 3TBVA 2FATL 2BY3A 3UJIL 1X5KA 2AEQL 2DKUA 5T3XD 3X11B 5TE7L 4U1JA 5DQDL 5FYKH 2P8LB 1EVTC 2YC1A 5D1ZD 4HXAL 4M6MH 1I3RB 4Y5YC 1NMBL 1CIDA 5B39A 5IROC 4K9EC 1L0YA 1T5WA 4OFPA 4O2CB 4H8WH 2XFXB 5CEZH 4HH8A 1K8IB 1RZIB 3HI1A 1CD1A 3O3BA 1S7VB 4NZJA 3RVWC 5IW6A 2AXFB 2R29H 5BV7C 4NQUA 3SO3C 3C5ZB 3LB6C 1YY8B 3BUYB 2EC9T 3EJJX 5EUKA 2H2SD 5BVJA 1T80A 3RY6C 3GMQA 5JW4N 3CVHA 5FKAB 3FRUB 2BOCA 1FHGA 4YFDB 5IMOA 3KPPB 1BIHA 1IM9B 4S0SD 1BEYH 5GS0H 1B2WL 2C3VA 2CLRB 3QWRA 1U8PA 4Y2DC 3C5SB 5CILH 5M94B 4LVOB 4N5UA 2HFFA 1YC8A 2YRLA 4OCYH 1YNKH 5IBTL 3P4MB 1EK3A 1GGUA 1OAXH 5ID0B 3T1WA 4X4YA 4MCZB 3KXFA 3L5WB 4KFZC 4ZQKA 5HDQH 1T83C 4LGSB 5JUEL 2NY0D 1T7YA 2BNQB 1IBGL 2A38A 2SEBB 1ZK9A 4HIEA 8FABB 2AABL 3GMRA 4RSVA 1S7TA 1KCSL 4BSWA 3FQWA 3GB7B 4AL8H 1IEBB 3TGXA 3GI8H 4OLWL 1FH5H 4ZO8A 2H6PA 3QEUB 5A2IH 3ABZA 3C5ZC 1MCHA 1HDMA 5EOCH 4MB5A 5EO0B 3IFPB 3IRPX 1FJ1A 3GSNA 3EBAA 1EFXB 2BRRH 3U7WL 3LKPA 4LDOB 2K7QA 1KPRA 2X1OA 1OL0A 4QOKA 4YDIL 4XXDA 3MA7B 2DQEL 3WNLA 1F4XL 5SWZE 4UUJB 3WIIL 3I6KB 1G84A 3HRZA 2HFGH 4NGHL 3DWTA 4XXCC 3MACL 5CINH 4PRPE 4F7PA 2R8SL 1N6VA 1HHKB 2EKSA 5AZEH 1IGYB 4Z18A 4PRID 4X4MA 2YSSA 4KV5F 2XKSA 4JANB 1FO0B 5HGHB 3WBDA 4S1DD 4MNHB 2XKNB 2QQNH 5FHBL 3MREB 3X3GH 4P2RA 1ZS8A 5EU6A 4MA1B 4ZXBB 4ELMA 1GGCL 1MRFH 2ZCLL 3KJ6H 1BD2A 1IGMH 2YD9A 1MFEH 5J57B 1C5DA 4HCRH 4HLZG 1JYWA 3HZVA 1AD9A 1INEH 3L9RA 4MJID 4BZ2H 4JLRA 1T3FA 2BMKA 4HX1B 1RFDH 2ZNXA 5TQ0L 1HSAB 4APQD 4YR6A 4P46B 3MRNB 2F54E 2Y7QA 5C8JA 3RU8H 1PVHA 3SCMD 3S5LB 4MCYB 4L9LC 1A7RL 3ZHDA 2FX7H 4FQIL 2X4QA 5F9OH 4G43B 3MRQB 1S7RB 5JHLL 5BVPH 5CZKA 4WFGE 1NBZA 4MVBD 1WF5A 2D0FA 5KAQG 2C9AA 1HHGB 3FFDB 1AR1D 4K3EL 1KSRA 4S1QL 4TSAH 1D3CA 4OCSL 3EAKA 4I3RL 1CFTA 3PV6B 4JN2A 4EBQL 2HG5A 2X4UB 4QHLA 5HI3D 3VFWA 4ETQB 3VXSD 4GRMB 1I8KA 2DM4A 4LP4A 5GRJH 1EUTA 5GGUA 3ARFD 1DQLL 4XMLH 3DV4A 5ADPL 4G6ML 4P2OC 1A6ZB 4M4RA 2BJML 2XICA 1OSPL 1ZT1A 4OZGB 1LO5A 3KR3H 5DUMH 2Z31A 4JKPL 2Z91A 5DJYB 1R3IL 2EXYD 3QULB 4XWGH 1AGCA 5JOEA 1H0DB 1R3HB 1D5MA 3MBEC 4WHTA 3KPOB 1PQZB 3RTQD 3AREC 2E7LA 4LSRH 1I9IL 1MHPL 2ATPA 4UOW1 2NY0C 1Y0LA 3TM6A 1CDJA 1ZMYA 3GJEA 3PQYE 1I8LA 4DTGH 4BELD 3UX9B 4OZFG 3EDFA 3KPNB 1UA6L 3KPRE 1UGNA 1Z0MA 3HZKB 4JGUA 3ULSA 4C56E 3EFFA 2Q3ZA 4OT1L 1H8NA 3KG5A 3D85B 4OZHF 1T6VN 3MMEB 1VACA 2ZUQB 2ICWI 5T1DL 3RL1B 2P5EA 4EN3A 1PX3A 2NPLX 5IW3A 1NFIB 1KELH 4Z7WF 2Y23A 2NW2A 4S1SH 3KLHC 4KUZH 2J8UB 4LSTH 4CUCA 5FYJL 5EZLB 3VRLE 1P9MA 3G6JB 4L8DB 2YBRB 4Y5XB 2HKHH 4CMMA 1YYLL 5HHOE 4U33A 1WISA 2I9LA 4ZXBA 2ZUTA 3SY0B 1DQTA 4YXHL 4N0UA 4C4KT 4P4RB 1QFPA 4OIAA 2BXZA 2X1XR 4XVSH 2GUOA 3MYJA 3TNMA 3BKCL 5L6YH 4KDVA 1CDIA 5ELIA 1A1OA 4MXQC 2W60A 5AD0B 3O2DA 5EFIB 3CXHK 4UTAL 3L3DA 3V6FA 5FOJA 1IAMA 2XY2A 5IB5A 5FCUH 2WK2A 4KRLB 2ICEB 3CLFH 4X6CE 4PJGF 4NQCA 2ZKHL 4JPKH 5L9DL 3VXUB 1CK0H 1U8IB 4EI5B 3SGKC 1KIPA 4M1DL 4OCRH 3ALXA 4LLVA 3VXSA 4HV8A 5FK9A 1J18A 3V4UL 2J88H 1S8DB 4GKSB 4NN5C 3MOAH 3CC5A 3UPAA 3Q6GH 3GZKA 1TQBC 1TLKA 3V9FA 1CDHA 2G75A 4TVPH 4M62H 4R4BA 3FKUS 3QEQE 2XWTA 4U7SA 4HXBH 2R9HC 4JANA 4KZDH 3V4VL 2G5RA 2KDGA 4AZ8A 4XVTH 3K4DA 2ENYA 4PJAA 4XH2B 4ZOEA 5JOFA 1BZ9A 4EUPG 2W9DH 5A2LH 4HUWA 3BXNB 1CGXA 3OZ9H 1YEFH 4GQ9L 2OSLA 5K9KB 5BS0D 4EOWL 1V7ML 4XC3H 1QYGH 5EUOE 2J7LA 4KDWA 2QQKH 3TN0A 4QRTB 3BP7B 2D7MA 2UWEE 2HLAA 4KQ3L 1QHOA 1HSAA 4X4YB 2VN4A 1E4WH 3QJHB 1QNZL 2P43B 2NCMA 4OKVB 4JO2L 4HHAA 4RBPH 1MIEH 1RPQA 1HILB 5CZVH 3RX8A 3MNZA 5GS3A 1EGJH 3OAYK 5MENA 3W0WB 2E9JA 1OARH 4FN0A 2DJUA 3GJFK 5E6YA 4Z8FL 2YC1B 3FO0H 3MNVA 1E4KA 1VADA 5DXWA 5HYQB 2QHRL 2VUYA 4YDJA 5I1AA 1YMMB 3O3DA 4U1IA 5C09B 3U4BH 4LSSH 1F58L 2NY6D 3GHEH 1ZOXA 4X4ZA 3R1GL 3PWJB 3V6OC 1UM4H 2WAHA 4I1NB 3N1GC 4OCMC 1MFDL 3H3PL 4ODBD 1BFVL 1EEZB 1BPVA 4HWZA 4M4PA 5TH2B 5E2JA 1N7ML 1HI6B 3IU3A 4PGDA 4CVXB 5SWZA 2JJTA 1WIOA 3PE9A 3VWJA 2RR3A 4CGTA 5IB2B 2WLYA 4G8IB 4O2EA 5DEFA 4I0KA 4OSUL 2PW1B 1JHKH 1RJZB 5EZJA 1R3LA 4N8VB 3UPRA 3D1MC 5EO1B 5D7SH 1DBML 1A3RH 1ZVYA 3IJHB 4HQQL 1Y0LB 3VCLB 4P2RB 3L3IA 4Q9RL 1QR1B 1IARB 5DD6A 3MR9B 1F02I 3HE7D 1ZT4A 1J88A 1IAII 1L7TH 3ILQC 4J4PA 3SKOA 4ZMAT 1JPTL 2OR9L 5AYUL 3FN3A 2ZSVA 3SDAD 2X4RA 1ONQB 1QFOA 3HR5B 2MQCA 3B9KC 1ITBB 3BVNA 3L7EA 1NLDH 3RAJL 3RDTB 1A6WH 1EERB 3ZT7A 3OPZL 2H6PB 3QEUA 5F9DC 3O9WC 1F97A 3UTSA 4HUVB 3QDJE 1S9KC 5DJ8B 4M6AA 3MRKA 4K3DH 1H5BB 3MRPB 4HIXL 2D7OA 2RFXB 4KI1A 3MJGX 4KJYB 3SCMC 4KK9D 5IF0B 1Q0YH 2WUBL 5D93B 3MV8E 4A6YH 5E08L 3KPSD 1FNEA 1L4IA 3ARSA 3LQMA 3VG9C 4DCQB 4EZMA 1P69B 2XN9D 3SDXA 2R0ZL 2D7NA 3QEQD 1CGTA 2QV2A 3GSRB 4UTBH 4NQED 3S37X 2A83A 2ITDB 1CLYL 3P9MA 4ISVA 4RFEB 2D7TH 2X4TA 1AR1C 2MQ3A 1WIPA 1YN7B 5LWYH 2YD7A 4JQIH 2WV3A 4Y1AD 3WSQH 5IG7B 4MA7H 5T33L 2R2BB 5C0EB 1YDPA 1EEQA 4X6DF 2R9HD 5C08E 4X6BA 1MCJA 4PG2A 4U6YA 3WXVH 3NN8B 3EYVA 3FMGH 2ZNWA 2A1WL 2DN7A 1U9KA 5I8EB 3QG7L 2F53E 4ELMF 1EJOL 5JIHA 1KT2B 4HV8B 5FM5O 4Z78A 4QYOA 4C83B 3RIAK 1MWAL 4XNYL 4ZPVA 4ZDHB 5JNYB 1H3PL 4YE4H 2O5XH 1OOAA 1KEGL 3T09A 1OWWA 1F42A 3OR6B 2ZUSA 3FT4A 5FGCB 2KUTA 5J1AA 1XR8B 1JF5A 1I3GH 1LP9E 3DXAB 4MQXC 1XF2A 1RHHA 1AKJA 1IGIL 3GUTA 1F3DH 1UVQA 2DQUL 2OXHA 1ES0B 4GJTB 1RZ8B 4RGNC 3MRQA 4G43A 4KKAC 5E70A 3FB8A 3WO4C 2OP4H 4Y19E 3QIBD 3FFCB 4LLMA 5IB3B 1BZ9B 2PETA 1UQSA 1XZ0B 1TZHB 4ERSL 2ESVB 4OLXH 4MXVE 4M8QB 4LGRB 4MAYD 5GRYA 5C9KA 1MJ7H 4OB5H 1YYML 3IB4A 4QHNB 1EHAA 1M6OA 4JG0L 1AD0B 1CGVA 4GRMA 4NM8H 2A73A 3W11C 1QLEH 5D5MB 2VDKL 2LABA 1GHFH 3VFWB 3ZZ1A 4ETQA 2ICES 1ULVA 4OCWL 4R2GD 1X5FA 2VRAA 1T5XB 1DL7H 2HFTA 35C8L 3DGGA 5C2UB 3W9DB 5DD1H 2UZYB 2ED9A 1VKXA 4X4XB 3T0XA 4YGAB 3CCHB 2H26A 1JL8A 4PJBA 1JCKA 2EH7H 4XP6L 4R6UA 5KSAB 1O5DT 2HLFD 2BHZA 3HNTL 4BUHA 1JRHL 5C0CA 5IVZB 2X4RB 3HR5A 4DKDC 4XCNB 2KKQA 4XMKL 2IG2H 1FNHA 3DVNA 4NC2B 1QG3A 3SN6N 1AIFA 1EHLL 3W11D 3R06B 4K71C 4UNUA 4IMKA 4PRHB 4F15C 4DAGL 2ICWJ 5DR5H 3QZWB 4JFPA 3U46A 3KLAB 4LU5H 5FO9B 1SEQL 3O6KH 3BJ91 1KFAH 1IEBA 1CFSA 5IVXE 3L5XH 4PTUA 1NEZG 4P2QA 2ICCA 3RL1A 4YHYC 4S1RH 5DTFA 1L7IL 2VWEC 1EBAA 5EO0A 1W0VA 1JGVH 3HI6H 4WUUE 3U7AA 1LEKA 3AMLA 3QUKA 4JJ5A 1CE6B 1JGUL 1KJ2A 4U1HB 3L3HA 5CUSL 2AEIT 3JUYA 1QVOB 4L8DA 2B2XL 1WBYB 1JNHA 1QSZA 3VI3F 4DZBA 2V2WB 3LV3A 5SV3A 4AIOA 5E5UB 5L2KB 3MYZA 1DBAL 5F9WC 5IESL 4PJIF 1FFNA 3N1QC 2YEZB 3JWNC 1QSFB 3UXFA 2R1YB 3BQUD 1YNTA 4RISL 4KTDH 5IB1A 1FORH 4W81A 4JDVA 3NFSH 4MQTB 1JZ4A 2FSEA 2JIXD 5C2BH 1FNAA 1EZVX 2XG5A 2FEDC 1PSKL 4O4YH 3KHOA 4Z77B 1X9QA 1TTFA 3RA7H 3VDAA 4TRPH 4NQTA 1F3JB 4LLMB 4NQDE 5K59E 4EJ1C 4ODSL 3MA9L 1ZTXL 2J8OA 1JRHI 4XPBL 5ICXA 4FP8L 1WBXA 2E3VA 1DEEB 5JLZA 1I1AC 1FPTH 4NIKB 1IC4H 3WIHL 3A6CH 3OKDA 3IDIB 1YEJL 2OTUA 4JPWL 2NY6C 4PJAB 5D6DC 5A1AA 2NQCA 2JJSC 4AEEA 3TBWA 1JF1A 3C9NB 1T1XA 1NDGA 4KRMB 1I3RA 3V6ZB 3DYOA 3RIFK 5L2JB 4XTRC 1P7HL 4PJ5A 4P5TB 4ZFOL 1W72B 3JTTA 2EO9A 4FMKA 3TN0C 5JW5B 1UWGH 3SDDA 1KENH 1AGDB 2JJVA 5CEZL 1MVUA 3WMSA 3F7VB 3PJSB 3AROA 3BGFC 3QFDB 5DEZA 4PJEE 2WWMC 4L8SB 3NAAH 2C3XA 1TNMA 2FJGA 3V8CA 1ZGLB 3VFTB 4NRYB 4JQXC 4ZNEA 1E4XL 4OCXL 5FM8A 3CDGA 4LQ1A 2JB6B 4I0PC 4KY1L 2FJFA 1B88A 2BOBA 1LO5B 4OD3H 1IJ9A 1PGRB 4MA3A 2I9TA 5D96C 3BZEB 4FTVA 3ARUA 2ADGB 4OZGE 4WI3A 4F58H 5GS0L 3LMJH 4HKBA 4K23H 1OP3K 3PGCB 4J3XA 2BP3A 4OCYL 1BOGA 2HT3D 4OTXH 3PWJA 1CD8A 4GBXD 2NXZB 4J7RA 3ARXA 1NBQA 4K07A 1XR9B 3GMOA 3AGVA 1P4BL 2IEPA 3RWGB 1G9MC 5EUOB 3QUZC 3PHOA 4XP9L 4BQ8A 3SDCC 5C0BB 4X6DB 2H32B 1WZ1H 2XQYG 3C5JA 3IDGB 1N3NA 3EFDH 4X5WA 4OQTA 2FEDD 1IILE 4K7PY 2NW2B 3MBEB 2FRGP 3OR7A 3BPNB 2EE9A 1JZ2A 4P9HC 5B8CC 1BBJB 4HBCL 3CSBA 2XTJE 4LNVA 4JDTH 1A22B 4G9DA 3RPKA 1K2DB 3RBGA 1J1PL 4TUJA 4LCYB 1CDYA 4XPHH 3KS0J 1PZUB 2I9LB 3T04D 4GW4B 3F12A 4CVZA 3IDUA 3PIQA 5TE4H 5D96B 3TFKC 4PJXE 1FNFA 1OLLA 3MFFA 3NACH 5GZNC 3ECBB 2OQJB 3U0WL 3DUUB 4BZYA 3QCVL 1LDPH 2HH0L 3U30C 1M7DA 3MRPA 2G2RB 4JO4H 5DJXA 4QHMB 1NCDH 3UYRH 4Y4FC 5CEYB 2R8SH 4IHOA 1GOFA 3NABH 5GS1B 2E6JA 3RUGA 1WGOA 2X4OB 3SE4C 5A16B 3LS5L 3H3BC 2O93L 2QSQA 3DRQA 4U1NB 4YK4B 4ODTH 3MO1B 1FO0L 2AP2A 3VXUE 3KJ6L 5FV1L 2ILLA 1UYWH 2HRPH 5IBUB 1X6NA 5GRZA 1QSFA 3V0VA 3OB0K 5JW5A 3G6AA 2HT2C 4BZ2L 1YNLL 3ROLA 1S5IH 3QIWD 1ACYH 4ZO9A 1ZLVK 4P5KB 5TQ0H 2EDBA 4NWUL 3ARBD 1SMOA 5DD3H 5T1KA 2X4QB 2C3GA 1MCOH 2HWZL 1FYTD 2L7UA 4P2OA 1MLCA 1B4JH 4NRYA 2FX7L 3BXNA 3O41A 15C8L 4MZ3A 3MRMB 4PJ9D 3QIBC 4R4FH 4Z7VB 5HDBE 3F7RA 5HD8C 3BZ4B 4XZUB 3GMMB 5CSZA 2DWEA 2C7UB 2GJ6B 1I85C 4FG6D 3MRLB 5ICZA 2P5WB 2MPAH 3VXNA 4LASH 3O3BB 3H7BB 4K7PH 4S1QH 2UYLA 4LKCB 3H9SA 4BM7A 4R7DA 1S9WA 1NAML 4WW1A 2MCPL 3GRWA 2IBBA 4HDIA 5E94B 3AREA 5J4MA 1XCQA 2EDXA 3KDMB 1QO3B 1JF1B 2BVEA 3IDXH 3O4LB 4YX2H 3B9VA 5IEKA 4RNRB 2FHFA 4LBEA 5DJ6B 2V7HB 5E8PA 4NN6B 5F1OB 5TFSL 5CJ5A 1WZMA 4XVUC 4UU9A 1YN6A 3PDGA 3OGOE 5IKCB 2ENSA 5MP6L 5DJDA 1ZA3A 3MLTA 2WLZA 1T04A 4G8GA 4W70A 3KPOA 3NCBB 4QHUB 3ZE2E 1E4JA 1PDKA 3S3PA 4MQSB 4NSKB 2X1PA 1T22B 4DQOH 1VKXB 5F9JB 3L3HB 4KJQC 3KPLB 1FL6B 4XRCB 5IVNA 5E99L 4MA1C 4IOIB 4ZXBC 3C60D 3U9PH 4M61A 3V7AE 2H8PA 4WUKL 2PO6D 4YIQA 2VLMD 4X9IA 4U7MA 2COQA 2G9HB 4DFIA 3QIUB 2BVPA 4NUJB 3D69B 3GB7A 3T4AA 2IPTH 1UB5B 1DBBL 1GZQB 3KPRB 4JE4B 5FKPB 5DHVB 1MRDH 4QWWC 2L7JA 1HDMB 4X5XB 5FYJU 1Z9SA 4PIRF 5IVXF 4A6YA 1X4XA 3R8QA 3DVNB 3VXME 1K5NB 4L29B 1NGZA 4GW1A 3HUJE 4DGYH 4YDLB 4M1GL 1YEIL 3ARFC 3CIQA 4OFVA 1JI2A 5L0QC 3GMPB 5TDOB 4HD9A 2DJSA 3HZMA 3R4DA 3RPIA 4LPYA 3LRHA 4WFGD 4YBLB 4B53A 3KPSE 4G6AD 2P8MB 4N0FB 3P9LB 2DQTL 3CPLA 5CZXC 1MFNA 2ED7A 4O58H 2Q86B 3OKDB 4BQ6A 1C1EH 4YFEA 5I1JL 4P5KA 5BQ7A 4APQB 1JP5A 1U95B 1DDHB 3BIAX 1T89A 3KXFD 4N90D 3O6LH 4TOYH 4WHCA 1K4CB 3C09C 2BZDA 3BD5A 3V5HA 3P9WB 2A0LC 3P30H 1WBYA 3A67H 5KZCD 3T3MF 1R3JB 3G6DH 3LEVH 3R8BB 4HMCA 1CE1H 2BC4B 2GFBA 2BNQD 1MQKH 1M05B 1M7IB 1MRCL 5CLWA 3PABB 4Q0XH 2DLFH 3PQYD 4PRIB 2CLZB 3V5KA 3X13A 1NEZA 3OB0H 4UV4L 2AJUH 1YNTB 1CICB 2OTWA 5GIRA 4K94C 4RGNB 3BEVB 4UQ2B 4OI9A 3S4SG 2CUMA 1JNLH 1XIWA 4RBPK 5HDBF 2CDEA 2RGSA 5I6XB 2ZCHL 1G0YR 4XVTL 3NFPB 3G08B 2B20A 1KTDA 4JKMA 1Y6MR 3UTPD 2W9DL 4NBYB 3P4LA 5KVFL 2X4NA 4KK6C 1VGKB 3JTSA 4B41A 3DIFA 1YEKH 2WBJA 1FZKA 3QEGL 1F00I 1T20B 1YY8A 3BUYA 3ZT6A 1ZV5A 1II4E 1S5HB 5IHUH 4QXUH 3WLWD 1QFUL 4E41D 3D9AH 1LP9A 3C5ZD 3AMKA 4OZGF 4YHNB 5D1XC 4F8TA 1NBVH 4PRDB 5IJKA 4HIHA 3PP3H 5CIPB 1NLBL 3QUZB 2VXUL 4QOKD 5AG8A 1CZ8L 1NCWH 4Y2DD 3VXOA 3QNYB 4XNMB 5F7DA 3WE6A 1CR9L 1T66D 3AXLB 4E41B 1CDGA 2OLDA 4P3CL 5KW9L 3EJYD 3D48R 2JE8A 1AXSA 5I1KH 4OQ1A 1F4AA 4PRBB 4JRWA 1VPOL 2H9GB 4JM4L 4U0RC 2GI7A 3WLWC 3CCHA 3HE6C 3GSUB 1URLA 4XCFL 2ZG3A 1X7QA 4UB0L 4LRNL 1BFOB 5JIKA 3LH2H 5GGTA 2PXYD 2CO7B 1VEOA 4RGND 4X7TA 5D72H 1GYAA 2XTJC 5BZWA 4LSDA 3B5HA 5GSRB 1RIHL 3V79C 4R3SB 3G6JA 4IOSD 3F6IA 3UTSE 3MLRL 1SBSL 5D1XB 1FGNL 1NC2D 3RWHA 1A3RL 2DKMA 4JFHD 3RVUC 3UBXB 4QRPD 4A2MA 4YZFF 5CWSB 4M7LH 1BGXH 3TA3A 4ELKA 5JO5B 4BSVB 4PLJD 3BH8B 2EC9U 2IPKB 3IDGA 4YQXL 3D3VE 1JHLH 1A6WL 3DNKA 1MWAB 3BZFA 4JHAH 2DQHH 4Y8DC 4FQQA 4AIZA 2VKXA 1RV6X 2HKFH 4QRUA 5F1NA 2IAMA 3U7YL 2VH5L 4D9LH 2VLKE 1N8ZA 4JRYB 5JPNB 2VDRL 4HIXH 4BFEA 3OKOB 3MRBA 4QXTA 2NNAA 4LCUA 2K1MA 1OQXA 1D5IH 1MNUH 3JV5A 1KTDB 1PG7H 2R0ZH 5IWLC 1HZHL 1JUFA 1KXVC 1EVUA 2GEEA 3BMWA 1B6UA 3LKOA 4M8VA 1CLYH 2QL1A 2D31B 3LPGA 3HMWL 3KYOB 5C86A 3IFOA 2UVEA 3MRIA 1XCQB 4WTZG 1TITA 3NMEA 3ZMRA 3EOAA 3KWWA 2OSLB 2X70A 2P8LA 5T1LB 4OV6F 3MO1A 2A6KB 3S37L 3WHXB 2HVKA 4R7NA 1J0YA 4IMLA 5I8OL 3CU7A 5BZDB 1U8JA 5F9WB 5I1EH 4U1KB 4NN7B 4QRQB 1QKZH 1WEJL 1J05B 3BP6B 2ICWB 1JJUA 4G9FE 3UROR 4GRWH 1IAOB 4W4OA 5I8CB 1AQKH 2ZJSH 1F6LL 5DI8B 1CICA 5GIRB 2HJKA 5KVMC 2NR6D 1IGIH 2D0GA 2WMPA 3BGMB 2LFGA 4PRBA 4FFVD 3V0WL 2EXYC 4TNVF 1KB5H 4N8CH 3L1OH 4PJCB 5JHDA 3VXQB 3TYGL 1U8QB 3QUYB 1Q0XH 3O3EA 5CJOL 4YPJA 4E0RB 5D7IB 3MSPA 2YPLE 1ZHKA 4OF5A 1VGKA 3EJZD 3H3KA 3ZKQD 4DGIH 3IT8D 1GC1C 2VDPH 4MSWB 3WFCL 5H37G 2P5WA 5I1DA 1P1ZB 2BVYA 4G5ZH 3QEQA 4A6YB 3OSKA 4S0TD 1XGYL 3RVTC 2NY7L 2EDFA 4YDLC 1G7PA 4LPTA 5DQ9B 35C8H 4CVXA 4HGKC 1Q9KB 4JFEB 3PP4L 5F72S 4N0YH 2V5SA 1OT1A 5DJ6A 3RWIA 1J5OL 4GG6A 3VGGA 5JHDE 2WBKA 3EIFA 4HWEL 2IBZY 3D5OF 1MCDA 1UWXK 4XCCL 2F8OA 5HHXL 1JRHH 4MD0A 3L5IA 4WHYH 3D87B 4P2YA 2QKIA 5F7KC 2PW1A 3TO4C 4QHUA 3VI4F 5GISH 4QTHB 3SGJC 4WUUB 3VCLA 4AQ1B 4G8GB 5DJAA 1CCZA 5FAAA 5LCVL 2Q7NA 5B3NA 4HK3J 2ZUWA 4N0CC 2MMXA 1DLFH 5CD5C 5I0DA 5E00B 5C0BE 4H20H 4XXDB 4XHJC 5I1CL 3BKJH 2EXWC 5L2KE 3T0EB 5FHAH 3OX8B 5HHOA 3ZKNC 1FDLL 5DRZB 5EC2B 3QRFM 2Y36L 1MFAL 4PTUB 3EOBB 3T2PA 4G8FB 2Q1EA 4FQPA 4KTYA 1RHFA 5D70L 3W82A 4MWFB 1NGQH 1EX0A 2YRPA 3FN0H 3RNQA 4KJWC 3ZL4L 3VGAB 1NCCL 4HKZB 3FOMB 4GAYB 4Y4FB 1MCRA 5FDYA 1A14L 3FO2A 2GSIB 4J1UB 3PDOA 5ISZE 1TIUA 1ZWIA 4JM2B 1AQDA 4JFFA 1JHTA 2QBWA 3G08A 1NGWA 1UKSA 5T5NF 2R0WL 4Z7QE 5I1HH 4OJFL 3KPTA 3SDCB 1KLGA 4FFWC 4YHZH 1TPXC 4C56A 4JRXA 4PYGA 2E7MA 2UUDH 4KPHL