2R23A

Crystal structure of s25-2 fab in complex with kdo analogues
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
217
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, antibody fragment (IgG1k), light chain
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r23A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r23A01
3IT8D 1KJ3H 5E8DH 5I1HH 1PG7L 3KPPB 2R4RL 4XVTH 1MWAA 2C3VA 2QQLH 4LLQA 3PQYA 3GUTA 2AXGB 3GIVB 4U1IB 4AEEA 4ONGH 3O9WC 1T2XA 3EJYD 4ODTL 3UTTE 4YPJA 4U1MB 1FVDA 1WZKA 3CX2A 4MLIA 5D2LF 4D9QD 3LEYL 3MJ9A 3NFSL 4WTXA 5GS1B 5IW1A 3HKFA 4KVCH 5FYKD 4ZG1A 1CD9B 1G6RA 4GG6E 5GGVL 5FCUL 2YR3A 1K6QL 5E1AA 5DJ2B 2A73A 1QBBA 4P99A 2NY6D 5KN5A 3TZVB 1INDL 1FDLH 1GVIA 1H3PH 3GM0A 2J6EL 3ILPB 4LKCA 4HWNA 2PF6A 4MAUL 3S4SB 3TT3H 4DAGH 3BPCA 5HHVH 2N7AA 3L6FA 4X6EA 5IHZA 3O4LE 1KTDA 4FXGA 2Z4QA 1UJ3B 1MLCA 4PJ9A 5J13C 2C4FU 5JHLH 2VLMD 2ZG1A 1DDHA 5BRZA 3DVGB 4Z7WA 4YK4C 2XIDA 2Z8RA 1VKXA 1IT9H 1GXEA 5EIQA 4LRIC 2OP4L 2EDTA 2GK0B 1EA9C 1FN4B 5KSBA 3HZKA 5E2WH 1OW0C 3GBML 4UBDD 2RB8A 4MQ7A 3I9GL 3LN5A 1U8JA 3AREC 3OTTA 1A6WL 1Q9OB 1FORL 3S7GA 3VXPA 5TE6H 3PGCB 4J3TA 1NBYA 1C5BH 1DTUA 1JNJA 1EH9A 4AG4H 1JWMB 3GZKA 3KHOA 3VD9A 1T66C 4JRYB 3ZDYF 4LP5A 4P9HH 3RKPA 1H5BA 2HFGH 5EOCJ 3SBWC 3BEVA 2IBGA 4HBCH 2PN5A 1TVHA 2DN7A 3QUZC 1ZVSB 4AT6B 3MRPA 3RWIB 1KEML 1T5XA 5EWIH 3MLZL 3RVVC 4JHBA 5I75C 1BM3H 1X6LA 1MCBA 4GXUN 3LZFL 2FBJL 4JZJA 1C1EL 1KG0B 5DJAA 3MLXH 1HIMH 5C3TA 5IB4B 3MODH 2GSGA 5LQBH 2PR4H 4Y7MA 5E4EC 2VXSH 2O61A 4MNGB 2VL5B 3DMMA 4IRZL 3VDCA 1I1FB 4YWGH 3OKEB 5IESH 2UWEF 3HC0B 3W0WA 3PWLA 4QOKE 3MRQA 3T3ME 1NMAL 2BNRE 1A2YB 2HWZH 1A7QL 4F33A 5FOBB 1CFQA 1XGUB 3VXME 2BMKA 1DQJA 5B39B 3PWPB 2HRPH 4LLYA 3ULUH 5JW4M 3ARYA 3LKPB 3QIBB 1S7VB 1DE4A 2CRMA 2VUYA 4TUKH 4G6AC 5DYOB 3SQBA 1OB1A 1XGQA 4JFHD 3QQ9C 1CL7I 4P2OC 3PP4L 1YYMH 1BFVH 3OG4B 3K8KA 4ZOEA 5H94B 5TQ2H 3I84A 4OZFH 2G5BA 1WBZA 3VFSB 1OQOA 4JPKH 2FX9L 4NQDD 1V3MA 3HR5A 4RAUA 5CEXB 3SQOH 1DANU 3SJVA 4Z78B 1T21B 3DROB 4J4PC 1CZ8H 2Z31C 1OSPL 4M62H 1IC5L 4M00A 4JFDA 4X6CA 4NFBA 5GGUB 3MZGB 3OB0H 5D93C 3JTSA 5ETUA 3PL6C 4MMXC 5D96C 5I1DB 5D70L 2CKNA 3DI2B 3INUH 4ODHH 5DQDH 4QXUH 5E5MB 3U7AA 3V0AC 1MCEA 4PLNC 3N50A 3MRGB 2Z93A 3EO1B 4ZAKC 3UPAA 3FZUD 4WENB 4YPGA 4LEXL 1BFOB 3M8OL 1I3UA 4HD9A 1LO4L 2FGWH 4P57B 1FJ1A 5EIVA 5GZNC 4K7PH 4KK8D 3MA9H 4ZS6C 3HE6C 4JB9L 3HI1A 3OL2A 3SE8L 3P4OA 3QRGL 5CCKH 5IFJB 3OKOB 5E94B 3UJTH 1A1OB 5LGJA 1KLFA 4PJFA 3ULVF 3WDIA 5IKCB 1LNUA 1WCQA 2NYYC 4X9FA 1JFQL 2D7TL 3GMNB 4LBEB 1OTTD 2YRZA 2PYFA 4P2RA 5DJ8A 1W0VB 2Q1EA 3O6LH 5FF6A 1QSFB 4JPWL 4JY5H 3MV9E 4M6ML 5FKAA 4I4WA 5D7LE 3GI8L 2ZUWA 3G04A 3CSGA 5BQ7A 3ECBA 1RZJH 2XY1A 3AUVA 3AS0A 1HQRA 2AK1H 3KYMB 3QO0B 1SMAA 2XTJB 4APQA 4OF5A 4OM1L 5CUSL 1MQKL 3EFDL 3B8SA 1AKJB 3SGDI 3AS3A 4XMPL 2PO6C 5IW3A 3GMOB 1TETL 4Y2DC 1J88A 3BPNB 3QDGD 5SWQB 5AG9A 4FP8H 3MRBB 5F9DC 2B4CL 3KPQB 4GBXD 1Z9LA 1IARB 4U1LA 4YR6B 3W2DL 4U6HA 1B4JH 1JTOA 1VFOA 4R3SB 3NZHH 1AIFB 5CBAA 4ZO6A 3HPLA 5A40E 1FL6B 1KB9K 2FJFB 5F8RC 4QRTA 4YXKL 4LPVA 1KBGH 3FT2A 3C6LB 3LH2L 2NY7L 4HS6B 2C3GA 1RUAL 2MKLC 1UKQA 4LASL 4OUUA 1G6VK 4RGNB 3FTGB 3L5IA 4X4ME 3QPQD 4E41E 4KTEH 1RK1A 4JN2B 4NWTH 4U3CA 1U9KA 5EU6E 5EZIH 2C3VB 4G8FA 1HINH 2VXQL 2XG4A 2FYYA 3PQYB 5MEND 3JVGA 1ITCA 5E9DA 5ECJE 5KS9F 3W9EA 3DVFA 3SDDA 5DHXB 3ALWA 1CU4H 1FVDB 4HPYL 1PGRB 5EBLB 4HZAA 1WFTA 3PP3K 4XAKE 5C09E 5ESVA 3VFGH 2RBLA 3SO3C 1BVLA 1YEEL 5IW1B 1GGCL 1QRNE 4OFIA 3UC0L 4UDTA 3C08L 4JKPH 1G6RB 2CPCA 4F9PA 1Y0LA 4NO3A 4W81A 3DX6B 1NCBL 5E1AB 2A73B 2EYSA 5TQ0H 4DQOH 3CXHK 2ARJA 4HZLA 4MA7H 2JJWA 2VDKL 5KN5B 2ZUUA 1KFAL 4N90D 4HAFA 1U3HB 5DRZA 1NCAL 3NH7L 4KRPB 2IG2H 3JTTB 3OKMA 4LKCB 2VZ3A 1TFHA 2DMBA 3O3EA 3BPCB 4X7DC 2IFFL 3C5ZC 3LPGA 2QHLA 1ROWA 4X6EB 4YFEA 4ETQA 5IHZB 4C57C 1KTDB 1U0QA 4FXGB 2BX5A 2Z4QB 1MLCB 4Z95H 3B43A 4PJ9B 5I1LA 4C54A 1TTGA 2VISB 1F4AA 1IBGH 5I74B 5GQBA 5IQ7H 5KSAD 5BRZB 1RAMA 35C8L 5T5FL 2W0LA 2DOCA 3PIQA 5SWSA 2R0ZL 4YHMH 1ORQA 3TA3D 1VKXB 2OMNA 4QLRA 1IEHA 1J0HA 1UCBL 3ARQA 5KSBB 4PS4L 5BS0E 2NY3D 3SEPA 1A6VH 1U58A 1CF8L 1U8JB 2X89A 2Q87A 2P4AB 3OPZL 4M4RA 4YHPA 4WDIA 1F4YL 4L5FH 4PTUA 3FO1B 1J0JA 3L1OL 3OF6D 3UBXA 2K7PA 4D3CL 1AY1L 2DQGL 4I3RH 1LDPH 1T03L 1G0XA 3EO9L 3QUKA 1MCPL 2OL3H 4K2UL 1S7QA 1HE7A 1R5WA 2LV4A 5DK2A 3L5XH 1H5BB 4KK6D 2OR9L 3BEVB 4FTVE 1MCHA 2CQVA 4XC3L 15C8H 1D9KD 1YEHH 4WW1A 1JRHH 4ELKB 2B20A 5JOEA 1T5XB 2GTWA 3LMJH 1JZ6A 3DNKA 5GRZA 3RI5K 3L3IB 3KLAA 1BD2D 2EXYD 2ARWA 2CIKB 4JZJB 4G9FA 5DJAB 2NY0C 5GGSA 4PYGA 4CW1B 1OAXL 1D6VL 3CMGA 1K3ZA 2GSGB 3BAEL 4PY8J 1QBML 3K2UL 2GJ6A 3K46A 3SKJL 1WLHA 2DTSA 2O61B 4NQED 1C5CH 3DMMB 3W0WB 4NQCA 3IETB 5ADPH 1NLBL 3PWLB 3RIFF 3MRQB 2XWTA 3LPFA 5GRYA 2Z91A 4N8PA 1CFQB 2BMKB 3W39B 1DQJB 3BGAA 2AEIT 2ADJA 1YQVL 1EAPA 2CLZA 4Z7OE 4ZPTA 2F53D 1DE4B 2H1PL 1CLYL 2VXTL 3AY4C 4GMSL 5JQ6L 1GOGA 5BO1L 1OQXA 3L3KA 1XGQB 1U95A 4LQ1A 4TSAL 1KJVB 1R3LA 5J3HD 1OT2A 3OKKB 4F7PA 3BIKB 1U92A 3F5WA 2Z9TA 3QQ3A 2G5BB 1QSVA 4Y5XC 2DQHH 2ZCLL 1KJ2H 2FLBT 1WBZB 2X2YA 3T4YA 1KCUL 3HR5B 1DFBL 5GGRB 4RAUB 3WD5L 1MSPA 3SJVB 1HKLH 3ARBC 4X6CB 3HI6H 3QH3A 2DQEH 3WKMH 5DD0L 1OWWA 5D6CA 3B9AA 1VB9A 3HS0B 1YMMA 4S1RH 2FB4H 2Z93B 1NC2A 1ACZA 1F4WH 2FD6L 4AH2A 5F9AC 2YXFA 2X05A 3B6SA 4Y19A 5JPMA 2ZPKL 1EBAA 4EKXA 2IAMD 1FJ1B 2MQ3A 1IGTA 3UTTD 3HI1B 7FABL 1IEAA 1JZ3A 4R7DA 1DSFL 5A3IC 5F7KC 3SCMC 4HX1B 1S7RA 1RZGA 5LGJB 5GISL 3S36X 3D48R 3LEVL 4Z7NE 1S9WA 4PJDA 4RCAA 2WANA 1XR8A 1LNUB 5E2TH 1RHHA 2VXUL 3DX7B 3UXFA 5GGRY 5JOFB 1OTSC 2ADFH 2DD8H 3OR6A 4P2RB 2E3VA 1HCVA 5T5NF 4JKKA 4LPXA 4LCCC 3L9RB 4EN3A 2PTTA 5DLML 4ISVA 2NXZB 1KC5H 2O5ZH 3P4LA 5FKAB 4I4WB 3DO7A 5C0CE 4KZEL 2DB8A 3ECBB 4BQCA 4BZ2H 5I8CA 1RHFA 5L2KE 1HQRB 1J10A 5F70A 1RSFA 1T4KA 2X4SA 3O4LD 5D2NC 3Q0HA 4GW1A 4C4KO 3IU4L 3H9SA 1TZIB 4N0CD 3S37X 4U1SB 5I1EH 1CGYA 2NZIA 2VLJE 1WEJL 1U3JA 2EDWA 4X80L 2EKSA 2BRRH 5IMKA 1NKOA 1IL1A 1CDYA 2OLDA 2OZ4A 4U1LB 4Z7WF 3RZCD 4EBQH 4U6HB 4OZIE 4JM2A 3FRPA 3HMWL 3LKSA 1KT2A 4MSWA 2BSTA 3A6OA 3NAAL 5BV7B 4EDWH 1RJLA 4LGRB 2YN5A 5EU7C 4R8WH 4QRTB 1OAZL 5IG7B 4BFGA 3DBXA 2LE9A 4RNRA 3S34H 3RUGE 3TFKD 3IJSB 3ZKXB 3F7PC 2B1AH 5I0DA 1QVOB 1J0ZA 4G5ZL 1IM9A 4OUUB 4NNPL 3ZDZF 5D6DA 4Q6IC 5E5UB 4G6KH 4DJMA 3C60D 5CIPA 5IJKC 1JMZA 3M45A 4GQ9L 2FX8H 2FYYB 3EAKA 4WY7L 3TBWA 5E9DB 3WFCL 1S8DB 4MA8H 3SDDB 1L7IH 1O5DT 2D31B 1BBDL 3T2NH 1XF1A 3JV6B 5ESVB 3GRWL 3U79A 1BVLB 4EUPH 4UDTB 5EA0H 2EE9A 4RMQA 5FYJE 3T0AA 4EZMA 3IJHA 3L3OA 3MRLA 1J11A 1VFUA 4HFUL 4WHDA 4NO3B 5C0GA 4LGSB 4KROB 1QKZL 2VR9A 1XH3A 4WNQA 4HZLB 2ARJB 3VXRE 4QOKD 5I17A 2XTLA 2AGJL 2BNRD 3QUXC 1ZHLB 2ITCA 2GY7B 2ITDA 4JFXB 1A22B 4LSSH 5MHSE 2BVUA 4LU5L 3VXMD 2NY4D 1RURL 3OKMB 2XA8L 1QTYT 4NJ9L 4R4BA 8FABA 3O3EB 4ETQB 3RX7A 5DMYA 3NCYP 2R0LL 4M1DL 1IE5A 1D5ZA 5I1LB 1JHTA 3WO3B 4C55A 5ERWB 3BW9A 4LARL 4NZTH 5A2IH 2FO1A 4R4ND 5EN2A 5SWSB 4NO2A 3V0WH 3C2SA 1IKFL 5E0QA 4BZ1H 5KZCB 1KPRA 2B8OT 1X5JA 1AGCB 2NY5H 1FSKB 4HF5H 5MI0C 2AJ3B 3HAEB 5ESAB 5HGDB 2EDLA 1TTUA 1WFNA 2YUXA 4GAYA 4YHPB 1BZ7B 4PTUB 3UBXB 4JHAL 2A9NH 1TQCB 4MVBC 3DV6A 3BP5B 4LVHC 1MVFA 3RTQC 1DLFL 3GHBH 4WVRA 4OCMC 4XCEB 1IC7H 1S7QB 1J9CT 2D7QA 2PNDA 2CKBL 2ORBH 3WUZA 4Q97A 1A7OL 3O81A 3FN0H 2EC9U 4QHKJ 2Y7QA 4WW1B 4KI1A 1BP3B 4O9HH 3HZVA 2GTWB 3GSWA 3QSKB 3QWRD 1IZKA 2X4UA 1EIBA 5ID0A 4G9FB 4RDQF 4GKNA 3VXSE 1T2JA 4WI5A 4RIRA 3CIQA 4PJFF 5MEPA 5KG9A 1MWAH 3RGHA 5B4MD 4P4KA 2CK0H 4G6MH 2GJ6B 3MV9D 3LKQA 5IB3A 5D7LD 5IJVB 5I15L 4NQCB 3MJ9H 4UILH 5EOCH 4HH8A 2XWTB 3B3IA 2Z91B 1NMCB 5TDOA 1AQKL 2ADJB 2D0HA 1EAPB 3ILQC 4ZPTB 3AU1A 2BVQA 4PUBL 3QXUA 2UZIH 1KELH 2E9BA 4Z8FH 1K3IA 1FLRH 4JQXA 1RULH 3L3KB 2QEJA 3G5YA 1U95B 3P30H 1ACYL 3V5DA 2YRLA 4MD4A 3FQUA 4F7PB 1CFBA 3N1GC 5D7SL 3G08A 3MLYL 3QQ3B 2VR5A 1CDHA 5J57B 2A77L 5T3ZH 5GGSY 1C16A 4OJFL 4XMKH 1UM5H 2W9EH 1X44A 4PJ8C 1N7MH 3P77A 2OR8A 3CXHJ 2AI0H 3NTCL 3HE7D 3ARRA 5FGRA 2VXVL 2AV1A 5HHXH 2CO7B 3SGKC 5C7XL 3U9PH 3TVMD 1GIGH 3QDGA 5D6CB 1IJ9A 5E6ZA 1AQDA 4FZ8H 4XVUC 3VRLF 4GBXA 2R0WL 4TVPH 4ELMF 4AH2B 3VGDA 4E41D 5FYKU 3QHZL 4QHNA 2V5TA 4Y19B 5EU6D 1UT9A 1V7NH 1XT5A 3CPLA 1OAUH 4NZRH 1IGTB 1T5WA 5CILH 4R7DB 4ZQKA 1S7XB 4E0RB 3OAZK 1S7RB 1RZGB 5D1XD 5C09D 1FZOA 4LVEA 3RGVA 3VA6A 1S9WB 1QRND 1XR8B 4QT5A 2DQCH 1UWEH 3DETC 5IB5A 4TUOA 2HN7B 4K7PX 4ZFFA 3QIWD 3LEXA 3UJIL 4EN3B 2PTTB 5MENA 4ISVB 3L5JA 4AK1A 1MF2H 3DO7B 1BBJB 3AXLB 1RZ7H 3EHBD 2K9UA 3PXHA 5I8CB 3U82B 4LOUC 4PJAE 5J1SC 1RIHH 3U4BL 3QEHB 3LQAH 2YD5A 4IBLT 1A7PH 1QFWM 2HT3C 4L3AA 5C0BE 1JHLH 1MCNA 1T4KB 2X4SB 3FQTA 4U6XA 1MRCL 2P42B 2AERT 4JRXD 5IBLC 2V7NA 2B2XL 2P44B 3H9SB 4XGZA 1KIUA 2HLFD 5IFHH 2E27L 5DVOA 3OV6A 3D1MC 2EKSB 4U31A 5B38G 1D7FA 5IMKB 5AAWA 1R0AL 1IL1B 4J7RA 1HYSC 1W72L 4R7NA 1U91A 1BQSA 1KCSH 3D2UA 5BS0D 1F6AA 5BW7A 3ZKMD 3LKSB 4LRNL 1FLTX 1KT2B 3G5XA 4MSWB 4BJLA 2BSTB 3PHOB 1LO3L 1RJLB 4XBGA 5I19H 2NCMA 2CIIA 1N5YH 5J0BA 3B9KC 4EVNA 3DBXB 1A7NH 4RNRB 2Z8WC 1AHWA 2MCPH 3MREA 2ZNXA 4YUEH 1IM9B 4K3JH 3OQ3B 2C1PA 3H42H 3HUJE 2UYLA 3MNZA 4FTVD 3VMPA 2VZUA 5T1DL 5CIPB 4XNQA 3V6ZB 5IBTH 3TBWB 3WLWC 5HGHA 3P4NA 3UZVB 2GI7A 3PGDA 3ULSB 4HUUB 2JB5H 3WFDH 2VN4A 5DMKB 2X70A 3T0XA 3CZJA 4FQXD 5KANG 5DZLA 3IJHB 3L3OB 2V5SA 5FM8A 2UUDK 3PHQA 3MXVL 4RMVA 5C0GB 3MRMA 1XH3B 4WNQB 2W38A 4DTGL 4UV7H 4H0HB 2PKDA 4ZXBC 5FA4A 2ITDB 5HVHC 4I2XE 1WAAA 2VDLL 4RMSA 4KUCF 3TESA 4I0PA 5EUKB 3VGBA 1GC1H 2VMFA 3R1GH 5SWZE 4L8SA 3RVWD 4YAQA 2XZQH 4R4BB 5DD3H 4PJHE 3V4UH 1C7TA 4TULH 3RIAK 2F15A 4CMHC 1YNTA 3E8UH 4B5EA 1JHTB 2X1WL 1YNKL 2CLRA 2Y1VA 3KPSB 4P23A 5EN2B 3QZWB 3RVXC 1FRGH 5DRNB 1CLOL 1IGFH 1U8IA 4NO2B 4EEEA 1KPRB 4K94C 3VW3L 2YC1A 5HDLA 3IRPX 4H1LG 3BZ4A 3OKDA 4GAYB 4YBLC 4EI5D 2P5EA 3S35H 4AQOA 4OZGE 1RZFL 2ID5A 3P0YL 4UZGA 1X7QA 1TCMA 1DBKH 5HI4D 4Z0BL 3QISA 3DPBA 3P73A 5IEKA 1G7IA 5TE7H 1RZ8A 5HYFA 1NCCL 4IJ3C 2Y7QB 4WWKA 3MBEC 4JFEE 5GRUL 1N0LA 3HZVB 1NSNH 2ED9A 4HS8H 2M8XA 4M7ZC 3EOBA 3H9HA 1MJ8L 2X4UB 4IRSA 4GKNB 5DVMA 1QFUH 5MEPB 1P7QA 1WZ1H 3RA7H 5KG9B 1ZGLB 3ZE2E 4BSWA 2P43B 4AJ0A 3S88H 3VG9B 4P4KB 1D5BB 3DTXA 2OBGA 1K8IA 3MLUL 1NGZA 2YZ8A 3LKQB 4KRNA 1Q94A 5IB3B 3REVA 5C0CD 1FCGA 4BZYA 3F6IA 1EHAA 4Y4HC 2AJXH 4X6DA 3ZSSA 3B3IB 4KV5E 5L2KD 5F7WC 1OP9A 4KUZH 5TDOB 1I75A 2Y06H 4RGOL 4I18A 5E99H 4NSKB 2BVQB 5FB8A 2JJVA 3DECA 2NTSP 3Q6GL 5HYJA 4ODVH 5LXGH 3HG1E 1GGIL 3G5YB 3GSQA 3V5DB 4RFOH 4MD4B 1N26A 5IHUH 5E2UH 1P4LA 3FQUB 4LKXA 3GSUA 2Q6WA 3SDAC 3L3HB 1TMCB 3G08B 4K71C 4LSVL 1C16B 3Q48A 4FNLH 3K8MA 5C07E 4HG4J 3IDIA 3MUJA 3PE9A 4JM2F 1FNAA 5DJYA 4BYHA 3SGJA 4X0KA 1V8HA 3BKYL 1GOHA 2V17H 2AV1B 5D7IF 4LIQH 4X98B 1X5XA 5CP7A 2DQTL 1JZ8A 1AQDB 2AQ1A 4WV1C 2YWZA 2FX7L 1ZSDA 1WWWX 3HLAA 1X9QA 4QHNB 2VAAA 3ARDA 3WUWA 3H2WA 5A2KH 1G7QB 3VWJA 3CPLB 1KCVL 4MJ6A 1B0GA 2E7HA 4FFVC 1ZANH 4JRWA 3K81A 1V7ML 4O5LL 1CGWA 4ZQKB 4YHZH 4A6YL 3Q5OA 1FZOB 3RGVB 3HC3L 2C4XA 3WCYA 4QT5B 4IMKA 4BQ8A 3LRHA 2EC8A 4NRYA 5TPWL 4QRRE 5IB5B 5FYJD 4PRBA 3QIUD 4H88H 5I18H 5TJWK 5F1SA 2DM7A 2L4OA 1IC1A 3MRDA 3GNML 4R26L 1C7SA 1MIMH 3VXRD 2AEPH 4JJHA 4P46D 1P6FA 5MHSD 2DLHA 4MZ3A 2ZUTA 4KVNL 1TCRB 2E7LA 3U0WH 4IRJA 5EORH 1NAMB 4X7TA 1SEBA 3WNLA 4NM4L 4OZHA 1T22B 4RFEA 1QPPA 4U6XB 5HPMB 3DXAB 1I9JL 3TJEH 2JTDA 2DMCA 2V7NB 5FO8B 4XGZB 1QZ1A 1NUFA 3O3AA 3O3UN 1GAFL 1JPTL 4QOKA 2EDQA 4PV9A 4ODXB 5EO9A 1FNSL 4I0CC 4LVOC 4UINL 2X42A 3RDTD 3MJ7A 4J1UA 1CXIA 4OFYD 1U91B 4R7NB 2DJ4A 3QCVH 4A2MA 4HWEL 5B8CA 5BXFA 3D2UB 1UM4L 4YX2H 3QG6A 4G8IA 4NT6B 2VDRL 5E6ID 3G5XB 4HCRH 1EMTL 1CS6A 1M05A 5ILTH 4XBGB 3BMWA 4G42A 1RJCA 6FABL 1PQZA 2CIIB 2Y07H 2ZJSL 2G2RA 4EVNB 2BSRA 1GGYA 1MEXL 4F7TA 5C08E 1AHWB 1JL8A 3QG7L 5E03A 4JREC 2BVYA 2C1PB 4AYFA 2FIRT 2UYLB 2P1YA 3MNZB 3OGCA 1MJUL 4XNQB 1F5WA 1U8LA 5IVOA 1XIWB 3IU3A 5DGQA 1GH7A 1F3JA 4HW6A 1FL5B 3P4NB 1NLDL 3O0RH 5MP6H 5JUEH 1NFIA 3PGDB 4OCWL 4IOIA 1ZV5A 1ES0A 1MCJA 1S5IH 3QI9A 2YWYA 5JXEA 3VXSD 1P9MC 5E24E 1IAIH 3D0VA 5KW9L 1UG9A 2WQRA 4KJYA 3S3PA 3PHQB 5CZVH 3V52L 2EDDA 3MRMB 2VB5A 3MBXL 4JQIL 1CGUA 1U2CA 5FA4B 1N8ZB 4D0CA 2P8PA 4I0PB 5HVWA 4YAQB 3D87B 1JGLL 1U36A 4RX4A 1QEWB 4K94L 2CGRL 3GMLA 4N1CA 4RFNB 3SDCA 2NW2A 1YNTB 4OFPA 1P5VA 5D7LA 3U1SL 2CLRB 5IFAL 5J4MA 1GGBL 1C5DA 5FA3A 4WUUA 2KH2B 1MREH 2NZ9D 4MXVE 1C8PA 4XXDA 2G60L 4GW5B 1U8IB 5JW3L 2VQ1A 1I8LC 1JYVA 3TO4D 4PGCA 5FYKH 4YHLH 2R39A 1QACA 1FAIH 2YC1B 4PRPA 3TN0B 1MVUA 1WGOA 4JCLA 3RI5F 3JUZA 3LY6A 3OKDB 1NDGA 3HNTL 2R56H 4AL8H 2N4IA 1A64A 2VWEE 5JW4R 3O6MH 1Q0XH 2O5YH 2P5EB 4L9LA 5GJTL 4FQIH 2VDQH 4U6TA 2OZ4H 5DJ0A 2GITB 3QDJA 1X7QB 3VD7A 3U0PA 3U0TA 4DKEL 1NGYA 5IEKB 4XPHH 2GAZA 3MV7D 4IDLA 1G7IB 4PLKC 1AD0A 3I6KA 5HDBE 4N0UA 4XH2A 1ERNA 5C0DB 4WWKB 3FAWA 1WBYB 5EBMA 3OAUH 1F11A 4BUHA 1ZLVK 3EOBB 3OR7A 3H9HB 3MACL 4IRSB 1MPAH 2B1HL 3SY0A 4ZODA 1H3TA 2BOCA 3X3GH 4LHUA 4X4MA 1P7QB 2NQCA 3BKMH 2E7MA 1OGAE 5HSFA 5DVNA 3DTXB 1K8IB 4BELD 3BUYA 4L4TA 4MCYB 1MCFA 1Z0MA 1Q94B 3REVB 2V9TA 3U7YH 1T1YA 3F7QA 1PY9A 4WU7A 4RA0C 4S1QH 3FQWA 1PY4A 3SDYL 4X6DB 2AJVH 3ZZ1A 4Y16D 2XTJC 3GJFA 5D1XA 5L0QB 3LIZH 5DD5H 5DS8A 5FDYA 3RPKA 2XZCH 4B7LA 4U1GB 4R2GC 1QRNA 3K8LA 4HFWA 5GIRB 5C0BD 4EXPX 5FB8B 4DUVA 5HYJB 5I2IA 3QIWA 1J1OH 4KQ3L 1I1AD 1P6AB 5J1AA 3D3VE 2ZKHH 3GSQB 2K7QA 2YMXL 4S10A 3ZTNL 3GSUB 2Q6WB 2L7UA 4DGIL 3MGTA 3EYFA 4Q6YA 3P3YA 3CVHL 4JFYA 1ADQL 4F58L 3C6SA 1OP5K 4XWGL 1A14H 2YPVH 3OZ9L 1ZGLM 4X7EC 3I50L 4LLDB 3FB6A 2E5EA 3QXDA 1HHGA 1U8QA 5D7JC 5D9SA 3HR6A 5D1QB 2ENYA 4PGEA 1SEQH 4POUB 5K33A 4WW2F 3CXDH 4H8WC 4I0KA 5CP7B 2YA0A 1B88A 3UTSE 3MRRB 4NBXB 3THMH 3MLVH 4RA3A 2YD9A 3HLAB 2VAAB 3WUWB 2OS7A 3PP3H 4HQQL 3BHBA 1YUHA 4KZDL 3MLTA 4M7JL 3VWJB 5F9WC 1Z9OA 4MJ6B 3NACH 1JF1B 1B0GB 4YXLL 3KJ6H 4LRIA 4F15B 4MD0A 1AI1L 2EH8L 1OW0A 3OWEA 4F57H 3MJGX 1K2DA 2V5MA 3AREA 4UB0H 1PAMA 4HMCA 3G6JB 1RI8A 2BXZA 3P40A 4XVJL 2LVEA 4DGYH 3LQZB 4NRYB 2P8LA 2H2PC 4JPVH 4FTVA 4FZEH 1LVEA 4PRBB 3IGAA 4P3DA 2VYRE 1XF4A 1RK0A 5D7KE 3MRDB 5D72L 3D9AH 4OZFG 2EECA 3ROLA 4UT9L 5GGVY 5JNYA 3SBWA 5E2VL 4Z18A 3QUZA 5GRXG 1TENA 5E6IC 2DQFA 4MS8D 3WIHL 1T20A 2WBJB 4XP9L 5L8KB 4X7TB 4XCFL 5KVFH 5KSVA 1SEBB 2HRLA 4OZHB 2XN9A 2HMID 4XPBH 3O6FD 1R3IH 2E8YA 2X4TA 3BXNA 1B2WL 3CSYA 4MAYC 3O3AB 3SDXA 4JO1L 5IVXF 3HI5H 4XTRD 3K0WA 4JZNA 4PV9B 4UV4H 3VWKC 5AZEL 3WEXA 2LU4A 3MJ7B 1N2RA 4J1UB 1MI5A 1ZHBA 5BXFB 5B8CB 1P2CB 3C09B 3QG6B 2EDRA 4G8IB 3WSQH 5FM4A 2ATKA 4UUJA 3ESUF 4PR5A 3QUYD 4F3FA 1KV3A 2GW5A 1M05B 3O2DH 2V5RA 1FNHA 4WFEE 3HNVL 1DN0A 2G2RB 3MROA 4N0RA 2BSRB 5IM7B 4F7TB 1BZQK 1M7IA 1S78D 4X4YA 2AJYH 3V95A 2A74A 2IBBA 3OAYK 4WI9A 5C2BL 4OQTH 1NCDH 3QQNA 3WJLC 4TSBL 2HFEB 3VGAB 4GXVH 4L3CA 2IANA 3OJDA 5E8PA 4BK5A 5DJZA 2ED8A 3OGCB 1KIQA 2QTEA 1TPXC 4JRYE 1U8LB 3WFHA 1JMXA 4JFED 5TDPA 1JWSA 2J88L 5BZWA 2OXGA 1QSEB 1KTKE 1U8KA 2RIKA 4K23L 1XCTA 3KXFA 12E8H 1IQDB 1NFIB 3NCJH 4OGXH 5D1ZD 2SEBB 4FABL 4IOIB 2NPLX 4GJTB 1HWHB 2Z31A 4J4PA 5FHBH 4XWOD 1S9KC 3H9ZA 3QI9B 4FQ1H 4HWUA 3JUYA 3KJ4C 3BN9D 5F9OH 3LOWA 2DQDL 2WUBL 4XNZB 3PL6A 3CX5K 1BQLH 4PJEA 3JBG7 3D0VB 4KJYB 2JJSC 2ZUYA 1AC0A 1O7SA 3W81A 2AEQL 5SX4I 2E9IA 4MQXC 2KUTA 4ZAKA 3KYKL 4K3DH 2A2QT 4MNGE 1U6AH 3FO9A 4CVXA 2FATH 3T0EC 4D0CB 2P8PB 1M71A 1MCKA 3HE6A 3WIIH 2YK1H 1LO5A 5HI3D 3FO0H 3PWPE 4XCYA 3HG1D 4NM8L 3GMLB 3O45A 4D9LL 3LD8B 2NY2C 4GG6F 1D5IH 3SDCB 1OM3H 3CLEH 3RRQA 3FONA 3X3FH 3TBSA 3BQUC 3VG0H 1C5DB 2BRQA 5JXAL 4WUUB 5HDQL 4XXDB 1BFSA 5L2KA 1Z0NA 2VQ1B 4U1JA 4G3YH 5IOPB 5JZ7C 3MRHA 4PGCB 4UOW0 5C07D 3FFDA 4LLUA 2WP3O 2E6JA 2NR6D 4LVNC 4PRPB 1ONQA 2DTMH 1MVUB 1MFCH 1ZLSH 1ND0B 4YFLI 1VFMA 1P1ZA 2VLJA 4GW4A 1RUQH 4L9LB 4QRUA 5DJ0B 3QDJB 4U6YB 5FV2A 3U0PB 1E4WH 4MA1C 3TPKA 3L7FA 2PO6A 4OZIA 4OIBA 3U0TB 1NGYB 2IF7A 3NIDE 2MOVA 4B50A 5GRVK 4LDLB 1QLEL 2AJSH 3EOAA 1AD0B 3CC5A 3I6KB 4H0GA 3PWNA 4N0UB 4XH2B 4KK9C 5FUOH 3S35X 1JTPA 5GS2H 4GMTL 3E6FA 2PXYB 2OSLA 2DI7A 1F11B 1T7WA 2NX5B 2CO6B 3OR7B 3C8DA 4G7VH 4CNIB 1VACA 1XCQA 5I1CH 3SY0B 1NDMA 1NEZA 2GT9A 1XF3A 5IHLB 4LHUB 4QRRD 5I73B 4KJPC 3MQIA 2DIAA 3GB7A 2AVGA 4LCWA 1KJMA 3J7HA 3JWOC 3N1PC 1N6UA 2DLFL 2NY1B 2F5AH 3BUYB 1DBJL 3DGGA 4GSDH 1EX0A 1OVZA 4L4TB 1T1YB 1QSFE 3FQWB 4ERSH 1FYHB 1YY8A 3GJFB 5F7YC 3WBDA 4PGBA 2Q8BL 3LDBC 3O9WB 1PFCA 2DM3A 4HFWB 5I1KH 5IROC 5I2IB 4MMZC 2R69L 4HK0A 5J1AB 4XNYH 3VXRA 4P59L 2HKHL 4H8WL 4WGWB 1FL3A 3T3MF 2X9XA 4K8RD 4XP1H 3C6SB 5AYUH 1JBJA 4N8VA 3BRGC 4IS6B 4XXCA 4QF1B 3GRWA 3FB6B 1HHGB 1DBBH 4JCMA 5D9SB 2FSEA 5GGQH 1BX2A 2HYMA 4PGEB 4GLRH 4NN5C 3C5ZA 4ODSH 4Q74A 4P3CL 5C08D 3ARXA 3P9MA 5HGAA 1JPSL 1KB5A 3GI9L 3BT2H 4GT7A 1L0YA 1UJTA 4OFYA 5J13B 3BKCH 4G43A 4KRMB 4KKAD 3BHBB 4R6UA 5EBGA 1YUHB 4RGNE 3QDMA 4YK4B 3P9WB 5I30L 4HWZA 4JFQA 2DDQL 2VDNL 4YBQC 3HMXL 2BP3A 4MD0B 4YDKH 3PQYE 2Z0BA 3TWCL 4P2YA 4NKOB 4UDUA 2YD7A 2P45B 5F1IA 1K2DB 3AREB 3ESVF 2DWEA 1EO5A 2DMKA 4XPTL 2P8LB 3ZL4H 4G9DA 4NZUL 5F9JA 3VXNA 5INDA 4UI2A 2OM5A 3P11L 5EBWB 4P3DB 2VH5L 1XF4B 1RK0B 5INCA 3GKWH 1TJHL 3N9GL 4YXHL 3ROLB 2XY2A 2YPLA 4KQ4L 3S4SG 2R15A 1EZVY 3WHXA 3V4VL 3QUZB 4X8JB 1YEKH 4U6VH 2AW2A 1T20B 4PRIA 1K4DA 4XC1L 1S9VA 2F54D 5KSVB 5I75B 3TCXA 1DBAH 3BOVA 2FEDC 5CINL 2XN9B 2DL2A 4U0QB 5LBSL 1BJ1J 3FRUA 1YYLL 2X4TB 3MGOB 3BXNB 4MZ2A 1S78C 5E2JA 4Y4FD 3CSYB 1QBLH 2HA1A 2LU7A 3B5GA 3SDXB 1DL7H 1ZWIA 2QHRH 3E3QC 1AC6A 3FAXA 5E95B 4JZNB 4KXZI 5E4EB 3WEXB 2YS4A 4HV8A 1N2RB 3I75B 1MI5B 1ZHBB 2IBZY 3S5LG 5BRZE 1WJ3A 3FCTA 4PBWD 5ENWA 5ICYA 2VDMH 1BWMA 1H9VA 2ATKB 4ZDHA 2XZZA 4PR5B 5I1GH 1JWUB 1JCKA 4Y4KC 3VGHA 1T0NA 5KSBE 1E6OL 4TVPE 1SVCP 2QQNL 4UOJA 4HIHA 3BN9C 3MROB 3AY4A 5T33H 5FYLL 2EO1A 2W59A 1CT8A 1M7IB 4X4YB 2A74B 5C0IA 3LEYH 4P2OB 4OKDA 1SY6H 5GGTA 1AFVL 4L3CB 2IANB 3OJDB 5E8PB 3VRIA 1JE6A 2CDFB 4RRPG 5DJZB 3PV6A 1CDJA 1J1XH 1XAUA 1K5NA 1KIQB 4Y5XA 3WFHB 3L5WA 4DZ8A 2KKQA 1U8KB 4POYA 1B4RA 3UAJC 1XCTB 3KXFB 5GSVA 1ZTXL 2Z31B 1INDH 3ARBA 4OFVA 4AM0A 3C2AH 3N1QC 5FYLE 5F6HI 5D93B 3RIAF 2HFFB 3ROOA 1V3KA 3PL6B 1OGAD 4CL7A 2EH7L 4PJEB 4WI8A 5D96B 3BH8A 1KN4L 3VFPB 5GZOD 2PW1A 2IMMA 2UZXB 2MPAH 2FR4B 5B39G 1CBVH 4ZAKB 2APXA 2IJ0C 4OLVL 1CICA 4HS3A 3FO9B 4CVXB 1Z9MA 5KTEL 2NR6C 3W0WE 3O2VH 3EYUL 4X9GA 5DR5L 3HE6B 4P9HC 3FHAA 1LO5B 1TITA 4LF3A 3SCMA 2OP4H 4FFZL 5EZJA 5C3LD 3EDKA 3O45B 4MXQD 2DI9A 3UBXI 3D3VD 4M7KL 3FONB 4I3SL 1EEYA 3TBSB 3UJJL 1BEYL 1FORH 4ZFOB 4PJAA 1CFNA 4LCCA 3RVTD 2FL5A 4JFPA 4W70A 1JYWA 1WBXA 2ATPA 3MRHB 2H32A 3LS5L 4LLUB 5C0BA 4WO4D 3RVUC 1ONQB 1A4JA 4BA8A 4NGHL 4S0TD 1U8PA 1LMKA 3SJVE 2ICWA 2VDPL 1KEMH 4BKLB 1P1ZB 3WKNA 2G75A 3MRFA 2XFXB 4OF7A 3MLZH 4QRUB 4X6CE 5D2NA 1NANI 4W4OC 3UTSD 4RGMC 1I9IH 3TPUB 3ULUC 3L7FB 1C1EH 1T1ZB 2PO6B 5FYJU 3NIFE 4Y2DB 4N68A 3OAZH 2VKXA 2I27N 2NMSA 2H9GA 3EOAB 3CC5B 4IEFB 3PWNB 3WE6B 1MHHB 3BWUC 2QADC 4D2NA 1MFEH 3JWOL 3E6FB 1J12A 2D7MA 1UFUA 1JNLL 5DVLA 2OSLB 4ZUUA 1NGXA 1Q9WA 4X5XA 1F4XL 1VACB 1XCQB 3CDGA 1DUYA 1NDMB 2GT9B 4GS7C 1XF3B 4YJZL 3IXTA 4CU6A 5F1KC 4I9WE 1W72A 3GB7B 5D7KD 4LCWB 3S36L 3BIAX 4K9EH 4Q6IA 1UH4A 5LGHL 3PGFH 3QEQA 3EYSL 4P2RE 3DHJA 3RZWA 3UTZA 2OI9C 5LG1A 1I1YA 3TZVD 3LPWA 4G80A 4PGBB 2O5XL 3GMRA 2R4SL 4L3EA 2FX9H 5TFSH 4YHYC 3OHXA 1EEUA 1G0DA 2EYRA 4DN4L 3BDYL 2IPTL 3RWFB 1FQ9C 3SO3B 1JP5A 1OSPH 3MMEB 4JN1H 1IC5H 2FDBP 1RUPL 1P4IL 5FAAA 4XAWH 5C6TH 5CSZB 2JELL 3VRJA 2YD1A 5JW5A 5I1AB 4H20H 5D70H 1HCFX 4Q9RH 1FL3B 4ODBD 1R5IA 5SWZA 4KDTC 1AGFA 4JFZL 4DUXA 3QUXA 2AQ3A 4PJHA 4N8VB 2X44D 5D5MA 4Z7OF 4XP4L 4PLJD 4LEXH 1CTOA 3M8OH 2FSEB 4WFED 1LO4H 1BX2B 3U7WL 5C71A 6CGTA 5J11C 1UB5A 3C5ZB 4JB9H 3SE8H 5L9DL 5T3XE 1RZJC 1J0IA 3P9MB 4NWUL 5BOPA 2LU3A 4M43H 3DIFB 2E7BA 4POZD 3TT1L 4LAJH 3LB6D 3UYPA 2LVCA 4P5KA 3I6LE 4JRYD 2Y36L 3QDMB 4WEBL 5EIIA 3DWTA 3OJVC 3VDBA 4HWZB 2MHAA 4JPWH 2HT2C 4KK5D 1IGCH 2APWA 4M6MH 4FQLL 4HUVA 5T5NG 3GI8H 5E9DE 4PJCB 5F1IB 3NA9L 4RAVA 2DWEB 4JDZB 2D4DA 1X4XA 3RWEB 3L7EB 3AROA 4G9DB 3VXNB 5F9JB 5E1HB 3UCRA 4OM1H 3UZEA 3RTQA 1MQKH 5I1HL 5E8DL 5INCB 3ARFC 1T04B 1F13A 1N59B 4F2MA 1LEIA 1YMHA 2EICA 4ONGL 4XMPH 3WHXB 5D1ZA 3SPVA 1DQQB 1EO8L 3GDBA 1G7HA 4GFTB 4Y89A 1DUZA 4OLZH 5KVGH 5DC9B 2B4CH 1K4DB 4PRIB 3W2DH 4L8CB 1S9VB 4Z7NF 3H8NA 3G9AB 3PWPD 2WM0A 3RFZC 3QIBD 4KVCL 2WMPA 2NY0B 5HHQA 4M9PA 3LRGA 1WWBX 2CKBB 1KIPA 1DEDA 3V7AE 1YA5A 4JGMA 4YXKH 2P5WA 3WN5A 3LH2H 4HV8B 1FDLL 4OAWA 1VSCA 4DKDC 4X99B 2FEEI 1RUAH 5ENWB 5ICYB 5SWSE 4XBPA 3TIDA 4LIQE 1JPGA 4ZDHB 1TVBA 5K59E 1G9MH 4DAGL 4OB5H 5HHVL 4GRLA 1T0NB 4NKDA 5CJOH 3WNNA 3I2CH 1NFDA 1A7RH 2VXQH 1QG3A 2J4WH 4PJ7A 4XPGH 1Y6MR 4X83A 4IOFC 1RV6X 3V6OC 3SKOB 1CT8B 1OD9A 5C0IB 1I3RA 5B21A 4AENA 4ZSOA 2EIDA 1YEEH 1IT9L 3BN3B 2PTVA 1GGCH 3UC0H 3VRIB 4OZIF 3PV6B 1WC7A 4WUKH 1K5NB 2QL1A 3C08H 4Y5XB 3NFPA 4OCXL 5E2WL 2V5YA 3L5WB 4O00A 4DZ8B 3QXWA 3MLRH 1XGPB 4PYHA 2R9HC 5GSVB 3MV8A 4PJ8A 3B9EA 2VDKH 5TE6L 3HTLX 3ARBB 4L4VD 1NCWL 3RUGF 3FB7A 4MXQC 4PGDA 4QRQB 5ACLA 1MY7A 3NH7H 3ROOB 3SGKA 4G9FE 1FE8H 4P9HL 5HHNA 3GSNH 5JO5A 3O11B 1EJOL 4HBCL 2PW1B 3CJJA 1WQVT 4JO3H 1QSFD 4X4ZA 4MCZA 2GJ6E 3TP4A 5C9KA 4HS3B 3S8WA 3FFCB 2I5YH 5DZOA 4KKBC 4ZFGH 35C8H 2BCKA 4ONOA 1BIIB 4NQCE 4ZUSA 1CL7H 3W11C 1DP0A 1LE5A 4XPFL 3S97C 3MLXL 1UCBH 3SCMB 3DX8A 4QHMA 5EZJB 1HIML 4PS4H 5TH2B 1JGVH 5JDJA 4F8QA 3MODL 4ZTOH 5LQBL 3OPZH 4YDIH 1EEYB 1AKJD 2VXSL 4O4YL 1F4YH 4WFHE 5IESL 3L1OH 4YWGL 5ACZA 1UM6L 4D3CH 3QQ4A 1CFNB 2DQGH 4LCCB 3ORJA 2FL5B 4MDIA 1T03H 4K3EH 2HWZL 2VAJA 1WBXB 2ATPB 4A6YA 1MCPH 2OX5A 3ULUL 2H32B 4MJ5A 2D3VA 3PDOA 5I66A 3WFZA 1A4JB 4YZFE 4ZPVA 4Q9QL 3OX8A 1QO3A 4TUKL 2C1OA 4XC3H 5DQ9A 3ULVC 1DR9A 1BOGA 2ICWB 2W92A 1NGWA 3CFDB 3MRFB 4WGVB 5D2NB 1U42A 3T2OA 3PABA 1BFVL 4H26A 1I3GH 5ID1A 5TQ2L 1FNLA 3C6LD 3D39A 1H15A 5DZNA 3M17A 4JZOB 1MJ7L 1EXUA 4OUOA 2H9GB 1OAXH 1YDPA 1I8IB 5L8JB 3IXAB 4Y19E 1HWGB 3K2UH 3SKJH 4M62L 3DUUA 1F45A 1WSST 5ADOL 2Y25A 3PQYD 3MTRA 3BGMA 3QAZC 4ZUUB 1NGXB 3BZDA 1RUKH 4X5XB 2X10A 5C08A 2Q7NA 3MC0A 1PG7W 3KLSA 3CDGB 4ODHL 1DUYB 4QXUL 1A02N 5IBUB 4LDEB 3B9KA 1FFQA 1P84K 4X4XA 5IP4A 2ZCHH 1YQVH 4FMFA 1W72B 4PJDE 4QEGA 1ZS8B 2IPUG 1EEQA 2H1PH 1CLYH 1R3JB 2VXTH 4TSCH 4GMSH 2HJLA 1UCTA 4Q6IB 1J86A 5EDXA 4CJ0A 4K7PL 3MA9L 4RISL 4HUKB 2CDGA 4G80B 1W0WA 3GMRB 4L3EB 3SGDH 1U3HD 4HJJL 5E8EA 4NQSB 4KTDL 4KRPD 2K1MA 4NHUA 3WD5H 2WWMD 1CIUA 3O8XC 5CZXC 4HLZH 4JY5L 5L2JA 3H9SE 3VRJB 4PJ9D 5DD0H 4CN4A 4ALAL 1CTNA 1ZHKA 2UV3A 3CFJA 3T65A 2QR0A 1R5IB 5BRZD 2B0SH 5L7XH 1RZJL 4BH7A 2AK1L 3QUXB 5T1KA 1S5HB 1X5GA 4EI6A 2FEEL 5D5MB 4GKOA 4TVPD 4XHJC 3TBYB 2BJMH 4K07A 2ZPKH 4BH8B 4J3SA 4WCYH 2MCG1 1UB5B 3IFLH 3RP1A 7FABH 1DSFH 2Q76A 3MCLL 1AO7A 2J8UA 4FP8L 1S3KL 2DIJA 5GISH 4Z77A 4WHTA 3MXWL 5MERA 4P5KB 2FHFA 3RWDA 2IH1B 1B4JL 2AXFA 4G6JH 4PIRF 1CXHA 3RIFK 5EIIB 3BPLC 4P5TA 4KC3B 2MHAB 4XNXH 4LAQH 5DLMH 2R2EA 5MI0B 3U4EA 3MA7B 1INEH 4RAVB 4MNHA 4OF3A 1XGYL 4C83A 4LVHB 4ZS7L 3RTQB 4NWTL 4LSQL 1JGEA 1F3RB 3D18A 2BY3A 3MO1A 3IU4H 4F2MB 4H5SA 1CVRA 1LEIB 3UTQA 1YMHB 3DMMD 3ETBF 3SPVB 5T1MA 1WEJH 3W0WD 1CU4L 4FS0A 3MBEA 3DSFH 5J6HA 2A6KB 2CH8A 4NNYA 4GG8A 4UNVA 3FB5B 4JKPL 1RVFH 1BJMA 3Q1SL 1KIPB 2HP4A 1RZKH 3F58H 4QXGH 3K2MC 5TQ0L 4DQOL 2P5WB 4Z7VA 4MA7L 4OAWB 3KPSE 4L9DA 1VFAA 4PJAF 4G5ZH 1ULVA 3RHWK 3TIDB 2IG2L 4Y4HA 1JPGB 1REIA 1TVBB 3AS1A 3UBXG 3PXJA 3T0BA 4B7IA 3VCLB 4NKDB 1XGRA 3SJVD 4GQ9H 4ESKA 1NFDB 3STZA 1ED3A 4ZYKA 4PJ7B 1U8MA 3WFCH 4TTDD 1WK0A 4Z95L 1BJ1H 2R0KL 4AENB 4OZ4A 4ZSOB 3GRWH 1PG7X 1FNFA 3SDAA 5DK0A 3TJHC 4XP6L 3NFPB 1FFOB 4HFUH 1L4IA 1Q1JH 5FO9B 5JA8B 4L5FL 3MV8B 5DWUH 4PJ8B 1KB5H 4PB9L 1VESA 4JG1L 4LU5H 2YKLL 3RWCA 4PGDB 4Y0GA 4I9WD 5CKGA 2FGZA 4PG2C 1IC4H 2XA8H 3CVHA 1UGNA 3V5KB 3HUJF 5HHNB 4WV1A 3VFOA 4KH2A 4P2RD 3KPPA 3RNQA 1YEHL 1DVFC 1JRHL 1X3DA 3GIVA 2NXZD 4U1IA 4MDJB 5LCVH 4JQVC 1E4XI 1Q38A 2BCKB 2E8ZA 4ZUSB 2V2XB 4HDIA 4U1MA 5A16B 3KLHD 1BIHA 1IGJA 1ZEAH 4YEFA 1LE5B 1KIRA 1I8MA 3DX8B 4QHMB 5CD5C 2YD4A 5EG6C 2MSPA 4HEME 1L9NA 1C5CL 3CH8A 1B90A 5ABDE 3ULVL 1BVKA 2VABB 4JHAH 5FUZH 1A9EA 1HNFA 3SGEI 5ACZB 3WHE0 3QQ4B 5HVGB 5JR1L 5ADPL 4MDIB 4PJBA 2DIBA 2ESVA 1PBYA 4A6YB 5A1AA 3DHMA 3ILPA 3PDOB 3B9VA 3O3BA 5I66B 4KMTL 1INQA 2Y6SD 4PJHF 4ZPVB 1QO3B 2FLRT 4WHYG 5DQ9B 1IEBA 1A7OH 2HTLD 5T1LA 3WXWH 4N0YL 1BOGB 2IC2A 5I1IH 4GRWB 3KR3H 1NGWB 4FFWC 3RWHA 1NC4A 2QV2A 5T3XD 1UJ3A 3PABB 4LLWA 1A6UL 5ID1B 3D39B 1H15B 1UVQA 4NDMA 3STLA 4YDVA 4WI2A 1LK3L 3M17B 2DQHL 1KJ2L 3I6LD 3E2HC 1EXUB 4FOMA 3WIHA 1YDPB 2ERJC 4S11A 5GRJL 4HJGA 2R8SL 2DF3A 3BDBA 4PRDB 3ARPA 1HKLL 4M5ZH 1EUUA 4MXWL 5E9DD 5IV2B 3HI6L 3WKML 2XOTA 3SDDD 5CGMA 2C7UA 3CFEA 3QHFH 5GGTH 4OZGF 1Z3GL 3O4OC 3B9KB 4S1RL 4X4XB 1Q9LA 5FDWB 1F4WL 1T7YA 4ZOBA 1JWMA 1EFXA 4YHIB 4P9ML 1CK0L 4PUBH 4PJXA 1TJGH 2HJLB 4QY8A 1A7BA 4PJGA 2IEPA 4NJAH 4Y5YC 1ZVSA 4AT6A 4KROD 2RR3A 3D69A 2CDGB 3MLYH 1ZA6A 1W0WB 1MY5A 4C58B 4LSTH 2A77H 5E8EB 4OKVB 5K9QG 4LHQB 5K9KA 5ISZA 3ZE2F 2VN7A 2ADFL 5C0JA 1FVCA 2DD8L 4W4NA 3NTCH 4NHCL 3DXAE 4FHBD 5L2JB 3HFMH 3FRPG 1U41A 4MNGA 2VL5A 5F96H 1KCLA 1ZHKB 3CFJB 3T65B 5C7XH 4BZ2L 2J8HA 4KV5F 3GFUA 2BDNH 5SWSD 4BH7B 4F7MA 5FOBA 4ZXBB 5HVHB 3DYMA 3OAYH 5KZCD 4M48L 5C0ND 4TOYH 4N1HB 1S7VA 5DFWH 2X89D 4QRSA 5JPNA 4M7LH 4PP1D 1DLHA 4LSDA 5I1EL 1P7KA 3LS4H 3LQAC 1AO7B 2BRRL 5H94A 2J8UB 3Q2CA 4CMHB 2H32H 4WHTB 3VFVA 4UTAH 5MERB 1FGVL 3K1KC 3VFSA 3RWDB 4EBQL 2AXFB 4HPOL 5C0AA 2X40A 4JO4H 4XVSL 2IPUK 3I85A 4YIQA 3DROA 3N0PB 3RX8A 4HWBL 2R2EB 4R8WL 3U4EB 3BRFA 5GGUA 4UIKL 4DZBA 4WI6A 2ZG3A 1OP3H 3S34L 4YBLB 1EEZA 3U4BH 4L8BA 1NMBH 5EC1A 4G9FD 3MRGA 2I25N 4C83B 1NL0H 5IT2H 3ZYZA 2QLVB 1KEGL 1FP5A 4G6KL 4I1NB 1FIGH 1BLNA 1JGEB 4YC2C 3MO1B 1AR1D 5JORA 2GJ6D 4OV6F 1JI2A 1CE1H 3D25A 4OLXH 1BJ8A 3UTQB 4P57A 1KLUA 4MA8L 4LLMB 4NQCD 1L7IL 2D7PA 1LO2H 4IJ3B 5IMOB 3MBEB 5IFJA 1R0AH 2PETA 5E94A 5J6HB 1WAAE 2HG5A 1A1OA 1RIVL 3MGAA 4M7ZB 4JLRA 4GG8B 1EVUA 3BD4A 5F7EL 4LRNH 5EA0L 1GRWA 1PKQA 4WFHD 3FOMB 1N0XL 4UMGA 5ELIA 4Z7VB 3CK0H 4NO5A 1P84J 2X41A 4HBQA 4NQXA 4LSSL 2XG5A 2UVEA 4Y4HB 4KKLD 4BQBA 4G8EA 1AP2A 1MRFH 3F7YA 4X5LA 5T1DH 1XGRB 1ED3B 4ZYKB 1U8MB 3VMNA 3QRFM 5HDOA 1JNNH 3GMOA 1EVTC 5DVKA 2P5EE 1JJUA 4KAQH 1KENL 1QD0A 3MRBA 1HDMA 1NC2D 3E1F1 3KPMA 4BZ1L 4YR6A 3KPQA 4GQPH 3R4DA 3ARGC 2H26A 4HF5L 4Y19D 4K71B 3RY6C 1RU9L 2AJUL 2VNCA 3MXVH 4GXUM 1HH6A 4M7LT 5D7JA 4ZMAT 3WDJA 4APQC 5C09B 1HOCA 4NKMA 5A2FA 3IDXH 4HS6A 1NBVH 3GHBL 4X7FC 1IC7L 2R29L 2XQBL 3BWAB 3CVHB 1R3KA 2CSPA 1EZVX 3HNSH 1ZOXA 4JKLA 4WV1B 2ORBL 3VFOB 3NCBB 2VRAA 3RNQB 2FO4A 2QQKH 3FN0L 4HIIA 4EN3D 5CP3A 4NKIL 2CRZA 1F58L 2JLLA 3QDHA 4HDIB 1IFHH 4X6DE 1IGJB 1CFSA 5EBLA 4KTYA 1CI5A 4YQXH 3QXAB 2CXGA 3IDGA 1KIRB 1I8MB 3VW3H 4HJ0D 1D5MA 1FPTL 4JRXB 2IBZX 5HYJE 4G6ML 3H9SD 1BVKB 3DX6A 1A9EB 1Q72L 1RZFH 3HMXA 4UILL 5EOCL 1YEFH 2DJUA 4PJBB 1FYTA 4U4BA 3TLRA 2ESVB 1U3HA 2F19L 3CNKA 1NFKA 5EOTA 4RSVA 3JTTA 3O3BB 3WJJA 5BS0B 3VGEA 1I9EA 4JM2D 3P2TA 1INQB 2UZIL 4Z8FL 4QNPE 1IEBB 4OM0L 5T1LB 4UT7L 1NCCH 1RULL 3R06A 2Q20A 1FIEA 3RWHB 2XXCB 4JGJA 1NC4B 5AEAA 4LLWB 2VISA 5CLWA 1P53A 4D94A 5E70A 3BZEA 3MLSH 1UVQB 4NDMB 4MAYA 4MXVF 4N5ED 4YDVB 3STLB 5GS0H 2CRYA 3LSOA 1IM9D 3GMQA 5T3ZL 3VWKA 4LVOB 1LK2A 1G7LA 4S1DC 2YEZB 1QQDA 4HJGB 1N7ML 3MLUH 4PV8A 1QR4A 3FO1A 5HHXL 3RWGA 2C7UB 3CFEB 2R23A 3N1FC 3U9PL 1GIGL 3UPRA 4FZ8L 2YUZA 1Q9LB 4V1DA 1W8OA 4I77L 1S7SA 5HD8C 1IGMH 1EFXB 3G6JE 3FN9A 4PJXB 2UZYB 3MCKA 4QY8B 4JREB 5HDBF 3WJLA 1OAUL 5FM5O 1RZIA 4PJGB 3X11A 1UKSA 4NZRL 4GAFB 1MCQA 3H0TA 4ELKA 3D69B 1ZA6B 4PB0H 3KPOA 1A3RH 2FH6A 3UO1H 3L3IA 2A1WL 5CD3A 5IW6B 2CIKA 2DQCL 1UWEL 3VFTA 3QEGH 5K9KB 4LMQI 5ISZB 3VJ6A 4CW1A 5C0JB 1FVCB 1WWAX 4OZHE 1X5AA 3BKYH 4Q9CA 4KMLB 1MF2L 2JJSA 4PBVC 2I24N 1RZ7L 1BGXH 2DQTH 3IETA 3KPSD 4LGPB 5EU5B 2F8XC 3MFFB 2Z92B 1RIHL 3H3PH 2AK4A 2FX7H 3LQAL 4F7MB 3U2SA 2JK5A 1EGJL 3W39A 3NFNA 3SOBL 3T0EA 3LHPH 9CGTA 5FUCE 2QBWA 1JHLL 2C5DC 3T04D 1MHPH 3R0NA 4QRSB 4Y5VC 3ZE1E 5JPNB 1DLHB 2H3NA 4PY8I 1UACH 1KJVA 1P7KB 2EIBA 2LAGB 4O5LH 2D03L 2VERN 4M02A 3OKKA 4MHHI 4A6YH 2KL6A 3BIKA 5CEZL 1G9EA 1CLZH 3VFVB 3BQUA 1KCSL 4HEPG 1MAJA 4F7EB 5C0AB 4NZJA 3FMGL 4OIAA 3RU8H 2VQUA 4AEHH 5GGRA 4PRNB 4GRWH 2UY6A 4R26H 4YIQB 3GNMH 2FNBA 4E42A 3SKUD 5I19L 3RBSA 1YEGL 5ALCL 1QSEE 1A7NL 4K8RH 4U05A 4DZBB 3OXSB 1EEZB 3MFGB 3QA3A 4L8BB 2MCPL 1X5HA 2O93L 3IFPA 5EC1B 4K3JL 3HS0A 3T1WA 5HHPB 3NPZB 4PGJA 5C6PB 3H42L 4PJ5A 3AMKA 3BE1H 3MNVA 4NM4H 3T3PE 3CU1A 4CKVX 1BLNB 1U2HA 1RJZA 3K4ZA 4GAJH 1I9JH 4P4KD 5DEGA 1Q9KA 1Z9SA 2GY5A 2EO9A 3EDEA 5IBTL 3VXUA 4FQPA 5IIEA 5JORB 4WJ5A 3D25B 5C1MB 4OGYL 1KLUB 5EUOA 3QT2A 1FNSH 4LP4A 4UINH 5HPOA 4OF0A 1PX3A 2ICEA 4HX1A 2HG5B 4I5BA 1V5JA 4HWEH 5EULV 4HULB 4JLRB 3B2UC 2X4QA 3FT4A 1GSMA 2VDRH 4D8PA 3DX7A 5DFVD 5JOFA 1F3DJ 5ICZB 1EK3A 1PKQB 1X5ZA 5TF1L 3L9RA 3Q5YA 2ZJSH 2I26N 4UV7L 4NNXB 1MEXH 4NO5B 1GL4B 5J6GB 1RUMH 1NEUA 4NQXB 4PJIB 1OTUD 4WUUE 3QG7H 3HRZB 4JANB 2EZ0D 4G8EB 2XZQL 1AP2B 3V4UL 3F7YB 1MJUH 2M2DA 1ODAA 3MOBL 4R2GB 4PRPE 4TULL 5FECA 3EUUA 1NLDH 5DO2C 1TZIA 5IROA 5JLZA 4OCWH 4U1SA 2PW2B 3DYPA 3KHQA 5I8OH 4M1CD 4ZNEA 1FRGL 1L7TH 1IGFL 4OLWL 1FO0L 1HDMB 3KPMB 3QDJE 2EDNA 2DL9A 5DF0A 4JDVA 5FGCB 1FFPA 4MX7A 2H26B 5F7HA 1QFHA 3EJYC 5KBNC 1OAQH 4N0UE 1HH6B 4GKSA 1I4FA 4DW2H 2E7CA 3MBXH 4JQIH 2XKUA 5D7JB 3BD3A 4GAGL 4C4KT 5IG7A 1HOCB 1HQ4B 4NKMB 1BHGA 2NX5E 3IJSA 3RGVD 1QVOA 3OXRB 1R3KB 1G1CA 4DVRH 1XGTB 3VGFA 4XZUB 2CGRH 3ELAT 1FNGB 3HPJB 2NY6C 2FO4B 4HIIB 4P46B 4L4TE 3U1SH 5EU3B 1NSNL 1GGBH 5F9WB 2YD8A 1S8DA 4X8XA 1P69B 4JM2C 1RJYB 5DFTA 2D31A 1X6NA 4O02H 1CFSB 1IAII 3JV6A 1NAKH 4YNYB 3IDGB 1LP9A 4CGTA 1PEWA 3S88L 1CIDA 1D5MB 1T6WA 4HIXL 3PWUB 3EJZD 5LAXA 1BAFH 4XP5H 5I6XC 1QSZA 1NBZA 3QWOA 4MJIA 2AJXL 3SE9L 1ZHLA 1FYTB 4JFXA 1ZA3A 4KUZL 4UBDC 1MCOH 2Y06L 5EOTB 1QA9A 3D2UD 4DKEH 5E6IB 4BFIA 1RFDH 1T7ZA 1JPFA 1MUJB 4ODVL 25C8H 3R06B 4PRAA 1FZKA 2WWKO 4RFOL 1E0OB 5DJXA 3WUWG 5HYSA 4NC1C 3BZEB 5GS2D 2HAZA 3C9NA 4ZD3H 7CGTA 4MAYB 5ERWA 4HKXA 2BSED 3OKYA 3LSOB 2B1HH 2WBWB 2E6QA 2HTKD 3GMQB 3VWKB 2GJZA 4L8DA 3UYRL 1LK2B 2XRAL 2VLRA 1G7LB 4MGXA 5EO0B 4AIXA 1AGCA 1QQDB 2AJ3A 3HAEA 5ESAA 2ZUQC 2APFA 4NPYA 5HGDA 1XIWD 4PV8B 2A6DB 4JVWA 4Y4KA 1BZ7A 4FQ2L 2V17L 3RWGB 3SDYH 5DEZA 4PRHB 1HILA 2R23B 3C5JA 3UPRB 4RWHA 4S1SL 4V1DB 3BP5A 1FC2D 1S7SB 3KWWA 1X4ZA 4FQJH 4XCEA 1MELA 4O2CA 5EH1A 3NIDF 3MCKB 4DKFL 4HGWB 4UQ2B 4KQ3H 1J5OL 1RZIB 4NC2B 3X11B 3ZLQC 3H0TB 3ZTNH 1TPXB 4DGIH 1CXLA 3Q3GA 4G7YL 3NOIA 1DQLH 3NMEA 2Y5TA 3KPOB 4FQCH 4YHZL 5CD3B 5E08H 4I0PD 2DQJH 2D0GA 4XWGH 3OZ9H 3VFTB 3I50H 4DKAA 4XMLH 1FZMB 1WIUA 4CVZB 3KJ4B 3VJ6B 1CFTA 4H88L 5I18L 2XN9E 5GHWH 1MIML 1U93A 3FKUS 2AEPL 4QHKI 1RMFL 2ICCA 5IJVA 3FO2B 3SDXE 4CUCA 3ZKQD 4P23D 3F6LA 3MX0A 3U0WL 2AK4B 2KZ1B 5EORL 5EB9A 2JK5B 3U2SB 3NFNB 1MI5E 3SE4A 5K9OA 3PWVA 3LRSA 3T0EB 2YHGA 3GO1L 4M1GH 4KZDH 4RMRA 4OCYL 4X6BA 4NO0B 4YXLH 1EFQA 5DD6A 4M9OA 2H3NB 2EH8H 2JCCA 2P5ED 2NY2B 1AJ7H 4LPYA 4OD1H 1KXTB 2MTPA 3BQUB 3FZUC 4YX2L 1KULA 3MV7B 5CJXC 4Y8AA 4S2SA 2IANE 4HCRL 3VH8A 4KK8C 4AMKH 4QHLA 4E42B 5GRWA 5ILTL 1VA9A 4WWKD 4Q9BA 4LVNB 3MNWA 3KXFE 3IVKA 3QA3B 4CU7A 5BVPH 3IFPB 5BJTA 1OTTC 3RL2A 3FB8A 4IRSD 5JIHA 4PJ5B 4XCFH 3MNVB 4W4OA 3TBVA 1P7QD 4O2EA 3V4PH 1IGIH 4MA1B 4JM4H 4PJEE 1RJZB 2GCYA 5DEGB 3VXUB 4TN9A 1Q9KB 4NQUA 3BYYA 2I60H 5IIEB 4WJ5B 4Z7UA 3NZ8A 3RHWF 4JO1H 5JUEL 3O0RL 1ZHNA 4ZFOL 4G6FB 5EUOB 1KXQE 1S5IL 4NRXB 2AEWA 2BOBA 4XNUL 1S7XA 2ICEB 2BERA 4I5BB 4E0RA 1I7RA 3RQ3A 5L88L 2X4QB 3FT4B 1HYRC 4KJQD 4WIQA 5CAYB 2P8MB 2H2SD 5B22A 3KDMA 1IAIL 4D8PB 3MUHL 5B3NA 5HYJD 2HN7A 1YPZB 1ZVYA 3U30C 3HB3D 4UTBL 2HT4D 3H6JA 3KPRA 5HYEA 4GBXC 5IK3A 1BBJA 4KJWD 5K9JL 3AXLA 1HI6A 1V3LA 1JZ2A 3I6GB 3QEHA 1MLBA 3A6CH 3GIZH 1B6UA 3LDBB 1S7UA 3A67H 2DKMA 5FECB 1SYVB 2J88H 3UTOA 4QTHA 3VFRA 5D1QD 5EZLA 5JLZB 3BUTA 4FABH 3BSZH 4JJ5A 3WLBA 5BMFL 1T80A 4NOBA 3QPQC 1KTLA 3ARWA 1T2QL 4KY1L 4JDVB 4HGMA 2W9DH 5FYKL 1FFPB 4YHLL 3N1MC 1TDQA 4MX7B 3ARDD 1FAIL 1FAKT 3KAAA 4KDTA 4E5XA 1R3HA 3VWJD 4WEMB 2EYTB 5KSBF 3PHOA 2FH8A 4LHUG 4GKSB 1I4FB 1T0PB 3MUGB 1C12A 4AL8L 1Q0XL 5D2LA 4FQIL 3OBAA 4MLSA 3A6BH 4BSVA 3P0VL 4NN5B 3DYOA 1GPOL 1A0QH 4OTXL 4XPHL 5ESQA 1MRDL 1KN2H 3AAZB 4LCWE 3V6ZA 2DAVA 2OK0H 1VGEH 1I1CA 1P7HL 5M95B 1ZT7B 5HDQH 3S6CA 3ULSA 5DHYA 1IQWH 4HUUA 1F90H 4DOHB 2J12B 3GMPB 4IRJD 1NBQA 5DMKA 1LP9B 2ICWI 4WW2C 1L6ZA 3ARTA 3O6FB 2M26A 1TJIH 2IQAA 5C86A 5KSAC 3IAGC 2BC4B 4HG4K 4HH9A 5LAXB 2IPKA 1P4BH 5J8OA 3TA3C 4S1QL 1NBZB 4PREB 3QWOB 4MJIB 3TC9A 1BPVA 2AJVL 1PVHA 3ARFA 3QPXL 1BZ9A 1ZA3B 3LIZL 4M5YL 2NY3C 2XZCL 5EUKA 1QA9B 4ZOAA 3L5HA 4BFIB 3ZT7A 1JPFB 2APBA 2W65A 2R1YB 2NLJB 4PY7A 1J1OL 4PRAB 1FZKB 3K4AA 2ZKHL 1G7MA 5DJXB 5HYSB 2APTA 1LE9A 3B2VH 4K3HA 1YEIH 3LAFA 3C9NB 1J05B 2HLAA 3KPSA 5FEBA 4HKXB 4NP4H 4KK6C 3QZWA 4JE4B 5DRNA 1YY9D 2GJZB 4L8DB 4CN1A 2YPVL 3IKKA 3M1BA 1D9KC 2VLRB 2Q3AA 4NPYB 3QDME 1TZHA 1UZ6E 1YN7A 4JKMA 4Y4KB 2JIXA 2EXYC 1QSED 5I8KH 3CXDL 4L8SC 1HILB 2R2BA 3C5JB 4X6CF 1YEDB 2Q8BH 2IQ9L 3QI9D 4GRMA 4PJCE 3THML 3MLVL 5JXED 3KWWB 4OCSH 5F72S 2B39A 4O2CB 3NIFF 4H0IA 5DK3A 4P23C 4UAOC 3NACL 2WIIA 2UWEA 2RCSH 3KJ6L 4P59H 3Q3GB 4N5UA 5SV4A 4F57L 4MQTB 2A9MH 2YPLE 2Y5TB 2EE6A 4UB0L 4ORZC 5DUPH 4DGYL 2J5LC 3ZO0A 4PRIE 5JTWA 2Z8VC 4JPVL 4FZEL 1ZGLA 4RX4D 1CFTB 5KVEL 5J3HC 2KDGA 1D5BA 5CP3H 3D5OF 2VQTA 3D9AL 1U93B 1WVZA 2P49B 3SDCD 4OI8A 2RHEA 2EXWD 4JFHE 3VD3A 4WUUD 3GI9H 2A0LD 3T0WA 4R96A 1BF8A 1J1PL 4NFDA 1XZ0A 5K9OB 3PWVB 2HKFL 1G0YR 3LRSB 4NSKA 5KVFL 1G6RH 5I76A 5ANMA 4PRPD 2XXMB 4JY6A 4X6BB 1R3IL 4XPBL 3CFCH 4DFHA 5DD6B 3AGVA 1LD9B 2DQUH 4Z9KB 3HMXH 2PCPA 1CDCA 2JCCB 4X5WA 5DMGD 1KTRL 1GJIA 4UV4L 1H3UA 3L3HA 3T08A 4IOSD 3QDJD 1TZGL 2A6JB 3PDGA 5F93C 5CWSA 3WFBH 4G8GA 4XPTH 3EDFA 3WSQL 4NZUH 2IAMC 1F4HA 3P11H 4S2SB 3VH8B 1IVLA 3GSRA 4QHLB 4YXHH 4TQEL 3O2DL 1QYGL 4U1HB 1WF5A 2WUCH 3MNWB 4I18C 3V4VH 5SX4H 3IF1B 3LQMA 3IVKB 4X98A 4YLQT 2Q86A 5BJTB 2CJUL 5TE4H 3RL2B 3FB8B 4OQTL 1NCDL 5EOQH 3MJ6A 4LHUD 3O41B 4GXVL 3TBVB 4O2EB 4RGMB 3F7RA 4HLZG 3HB3C 4N8CH 4XI5D 5A2LH 2GCYB 1V05A 1G7QA 2XQYG 4KJWC 3V2AR 1MFAL 2NY1D 4L4TD 4Z7UB 3NZ8B 3U83A 1ZHNB 3NCJL 12E8L 4OGXL 5FHBL 2OJZH 1ZXQA 2QADB 3MJ8A 2BOBB 3GK8L 4FQ1L 4XAKD 3FFCE 3WS6C 4Q58C 5LKNA 1I7RB 3O9WD 4NCDA 1CE6A 1QRKA 1G9NC 1KJ2A 4N0CC 3KDMB 4YHKL 3MCG1 4GS7B 5AD0A 3ZDXF 2QQNH 3EDJA 1HHIA 4QTIL 4KHXL 1CXFA 4LHJB 4M6NH 5FYLH 2VE6A 3KPRB 3VXQB 4IMLB 5IK3B 2DS4A 2FECL 3RZCC 1HI6B 3GJEA 1UEYA 1HNGA 3F62A 2X1QA 1TCRA 4P5MA 1AFVH 1MLBB 2OI9B 1NAMA 3WIIL 2YK1L 3IFNH 1AH1A 3FO0L 4NUGH 1S7UB 2E6PA 1T22A 4HXAH 4YHYB 5HPMA 3DXAA 1CG9A 1D5IL 3TFKC 1Z6JT 1OM3L 4QTHB 3VFRB 3CLEL 2DYPB 2MNUA 3VD5A 5EZLB 5FO8A 3X3FL 1ZTXH 5EU4B 4JJ5B 1SBSH 1CR9H 4IMKC 2W0FB 3WLBB 3O8XA 1DQMH 1F3DH 1JPST 2EDJA 4ODXA 5D2NE 1KTLB 2BFVH 3QEUA 3C60C 5C8JB 3GSVA 4QCIB 2VITA 4TRPL 5SV3A 1TQBC 2Y4SA 4NT6A 1KN4H 4E5XB 5K59F 1R3HB 4XPAL 1NEZG 1E28A 1MFCL 1ZLSL 5DURB 1C12B 5KJRH 2E7LC 3MOAH 4DWHA 4OLVH 1RUQL 5D2LB 5CKAA 4BSVB 3EYUH 3ARED 5J11B 1E4WL 1F8TH 3BO8A 5EU7E 2YZ1A 5ESQB 1VCAA 4OLYL 1L0QA 1FH5H 1XIWA 1MNUH 1T66D 1J8KA 1BEYH 4Y1AA 2NY4C 1FL5A 1LGVA 1NGQH 2Z8SA 3QEQE 4UU9B 5AUMA 3WXVL 5DHYB 3QUZD 4G7VL 1QLFA 4N90E 2F54B 4L3EE 1ZLUK 3RVVD 3TNNA 2VZSA 5AZ2H 1QFWH 5JHDB 5L6YH 2HH0H 2XN9D 4NGHH 3DUSA 1K8DA 3VU2A 2IQAB 4OT1H 2F5AL 4GSDL 1YECH 4JHWL 4HH9B 2IPKB 4R4NC 2X1OA 4N8VG 5FIEA 4HWBA 4ERSL 4HC1L 1E27A 3ARFB 1BZ9B 2R1XA 1N8ZA 1MI5D 4MYWB 2GHWB 4MNQA 1PDKA 2QKIA 2W65B 4K9EC 3SKNB 2EIZB 4LPCA 1UXSA 1QEWA 1A6ZA 2R2HA 4PY7B 5D5ME 2WNGA 1SM3H 1BQHA 3JWOH 1G7MB 4XNYL 1LE9B 1JNLH 4WTWA 2AS5M 1MH5A 4G6AD 3NCYS 4LSRH 2HLAB 1F4XH 2YRPA 3F8UB 1N6QL 4YHNA 4XP1L 4GW5A 1OGTA 4P2OD 1N4XH 2D7OA 2LABA 1WV7T 3M1BB 2IAND 5FHAH 4TUJA 4EUPA 4YZFF 2ZP0T 3TN0A 3DV4B 3RBGA 5GGQL 2Q8AL 1TZHB 3GJFK 3T4AA 1YN7B 1QLRB 2ED7A 2JIXB 3KXFD 4ODSL 2R2BB 4J4PD 2Z31D 1OL0A 1MJJA 5CJBA 2O5XH 4HXBH 4GRMB 1WISA 2GITA 3BT2L 4OCRL 5B4MC 3BKCL 3PL6D 2DBLL 4FQQA 4DN4H 3D85A 2IPTH 5BV7H 1GZQA 3G6AB 4R4FH 4MD5A 3VI4E 4W6YB 2PYEB 5T3XH 2WIIB 5DJCA 2UWEB 5C0DA 3FOLA 2W91A 5DQJA 1WBYA 1MFDL 2JELH 4ZAKD 3U46A 3KPTA 2VR4A 1LQSR 4QRPA 1EUTA 4KXZH 4WTZA 4ZS6D 3HE6D 3ZL4L 4IDJL 1A4KA 4XP4H 4PJDF 5IEHA 3ARZA 4YHOL 4PG2A 1MFNA 3GKWL 4KKNA 2NYYD 4MCYA 3LVEA 4YGVA 2X4PB 4I48A 5CFHA 1RQ5A 1JVKA 5L9DH 3ZHLA 4HK3N 1DBMH 2P5WE 2JB6A 4U6VL 4R96B 4TYUA 1DVFA 3MV01 3TT1H 3MRIA 1O0VA 4LCYA 1XZ0B 2F5BH 4O51A 5KVDL 1XFPA 2FBOJ 3EIFA 5GIRA 2Y36H 3HE7C 5I76B 5ANMB 4TPRH 1UWGL 4JY6B 3I02A 2FWOA 2V9QA 3NGBC 3TVMC 2DM4A 4WFFE 4NN7C 1QBLL 1NFDE 2PCPB 1BMGA 1DL7L 2QHRL 4PJ7E 4X5WB 4FQLH 3U36A 2VLJD 2EE3A 3IYLW 2QSCH 4OI9A 4XI5C 2VLKA 3C5SB 4OGAD 5CWSB 4G8GB 2PO6D 4N9GA 4ZSOE 1KYOJ 5I1GL 1VENA 3H7BA 4LLDA 1XEDA 3BKJH 1LEGA 2XWJA 3GSRB 3DI3B 5D1QA 5D1XC 3ZYIA 5FFLA 4KGLA 5T33L 4ZTPL 4YE4H 4J6RH 1EO8H 4QHUA 1JGUL 3MV8E 1JZ7A 2Q86B 5J7CC 1ZGLP 1IM3A 3MRRA 3QIWC 4DFIA 1SY6L 5DUMH 4NBZB 1G9MC 1IILE 3ES6A 1UA6L 3HAEH 4V2BA 5EZOL 1J1XL 2J6EA 3JSSA 5DUBB 3TNMB 1G9NL 4LCWD 4W68A 4CVUA 3EHBC 2OJEB 1JF1A 3PWJA 4WI4A 3IS1X 3G9VA 3KYNB 2ZOLB 3MJ8B 5C0EA 5GSRA 5J06A 3C2AL 4KRLB 5HHMB 3QAZB 4IM8A 3G6JA 4P2QB 1CGSL 1Q8MA 5F8QC 1CE6B 1MFBH 3LQZA 2XV6B 3FN3A 1KJ2B 2GYSA 3W5MA 2HLFC 4PFEA 5AD0B 4OSUH 4XBEL 1HHIB 2N7BA 1FCCA 2MPAL 2CXKA 2VDOL 1CBVL 4ZFZA 1EO7A 5I9QB 3WDHA 2VE6B 4M93C 2E9WA 4FQHA 1L9MA 1PYWA 3OKLA 3GJEB 1QR1B 1S9YA 3PNWA 3O2VL 4Y5YA 3ZKMC 2GEEA 4P5MB 1NANH 2WBJA 3BEWA 1U8OB 1DEEA 3U9UA 5D4QA 4OCXH 4DEPC 4WWID 1A9BB 1CG9B 4F80A 3S5LB 5EFIB 4BUGA 3OG6B 3O8XB 3C5ZD 4GRWE 3DGCR 1MIEL 1AE6L 2BSSA 3G6DH 1NCWH 1ETZA 3QEUB 1OLZA 3ME0A 3GSVB 3EKCA 1WZLA 3D39E 2VITB 1F6FB 4FXKA 3T09A 1P2CA 1EERB 4PD4K 5CMAA 1EJOH 1SHMA 3QDMD 5IBUG 1E28B 4LPWA 1GOFA 5KS9B 3AMLA 2COQA 4U33A 2XQYK 1EHLH 5IM7A 1M4KA 1I9IL 2IGFH 3EFFA 2K3TA 4FQXC 3BO8B 1JUFB 4XNMB 4XPFH 3NCFB 2HFEA 2JJUA 4U1KA 4OD2A 1EGJA 1A6AA 2PUQT 3DVNA 1YEJL 2YUVA 4JG0L 2CMRL 4ZO7A 3TYFA 1MFEL 2AQ2A 4O4YH 4Y1AB 1QSEA 1RIUH 5AUMB 2YPLD 2V6HA 3BPLB 1UM6H 1IQDA 4WHYH 5CJQH 3RVWC 2SEBA 1S7TA 3EGSA 5AYQA 1A3LH 1QLFB 2LTQC 4DN3H 4XCCL 4U0RC 1QHPA 2VZTA 4PRID 3TNNB 5EC2B 4EQ3A 1IRAY 4Q9QH 4OFKA 5F7NC 5M7QA 3DUSB 1K8DB 4K9EL 2B5IC 1JK8A 1VPOH 2NY0D 3PGFL 1DZBA 1M7DA 2RQ8A 2V9RA 3DJ9A 2D9QB 3TCLB 4YGAB 5AWNL 1E27B 4F37K 2R1XB 5IMMA 1T7XA 1XF2A 1MJ7H 4MNQB 4HAGA 4HIJA 5TFSL 2X1PA 1J7VR 1VGKA 3QJFA 1IAOA 2QKIB 4LQFL 4EI5C 5IMLB 1UXSB 2R2HB 1A6ZB 1FFNA 5HI5D 4Y88A 1BQHB 4JN1L 3KNBA 2IALA 5ADOH 5IVZB 4XAWL 5HI4C 5C6TL 1GYAA 1MH5B 5IHBA 3MRJB 4YHNB 4H20L 4Q9RL 4ODUA 4NFCA 1QHOA 1OGTB 1AO7E 2J8UE 5IOPA 1T89C 1KCRL 3ISWA 3IDNA 4TUJB 4EUPB 2ZOKB 3UDWC 1UADC 3JWDH 4JVUA 4LNRA 3T4AB 4P2CG 3WFEL 1MAML 1ND0A 1W0YT 3DRQA 1OAKH 2MKWA 2R1WA 4RISH 4L4VB 1MJJB 1CFVL 3ARBD 3EW3B 4M43L 4U6YA 4OF8A 4HJJH 3WL9A 1I1RA 4KTDH 4S0SD 4FQQB 5E00A 3D85B 2AJZB 1GZQB 4BSJA 4MD5B 1IKNA 5DJCB 2WP3T 4KDWA 3O2WH 3NBNA 3ARGA 3FOLB 5DQJB 3U46B 1IGCL 3RY6A 2PXYA 4L1DA 3MV11 1IAKA 4ALAH 1CICD 3BPOC 3FFCD 1WIOA 2NX5A 5DRXB 3QUML 3FJTA 4CNIA 4QRPB 4HT1H 2XZAH 3P4MA 1FO0A 3IDYC 4OFDA 4KI5E 1A4KB 3I3BA 5CIPH 3SCMD 5A3ID 5IEHB 1E6JH 2D9CA 1PSKH 4OGAC 4YGVB 4M8QB 1TNNA 4R0LC 4I48B 1OTSD 4LCIH 2F58H 3CVIL 3MCLH 4KWUA 2P46B 2JB6B 4Z7VE 1DVFB 1S3KH 4OLZL 3MRIB 5KVGL 3MXWH 1A5FL 4LCYB 2FZ3B 3O9WA 3TGXA 5IR1A 4O51B 1DQDH 1I85C 3WIFA 1PLGL 1SMOA 3I02B 2FWOB 1CGXA 5JW4N 2V2WB 3U36B 2JJTC 3L3JA 2BNQA 1N5AA 1GHFH 1OSZA 2OTUA 2VLKB 4NZDA 1O7VA 4ELMA 1XGYH 2BVPA 4N9GB 2WSKA 4IS6A 5DRWA 4QF1A 4ZS7H 1G9ML 3H7BB 5DJDA 4OB5L 4LSQH 1LEGB 2XWJB 3BP7A 1RZKC 1MWAB 5CJOL 3I2CL 4ZO9A 1A7RL 1OY3B 4LLQB 2J4WL 4XPGL 3GUTB 2GFBA 2ZSVA 2XICA 3QCUH 3TEUA 4QHUB 3VI3E 4ZUVA 1IM3B 3QIUC 4CJ1A 3HC4H 3ES6B 4C56A 1J87A 3FT3A 1YNLL 4WUKL 4P46C 3AB0C 3O6KL 5HHOA 3E2HB 3Q1SH 3C8KA 3MLRL 4M6OL 3PWJB 4OLUL 2ERJB 3V6BR 3QEQD 1I9RL 1UYWH 3R8BB 2VO5A 4XXCC 1MHCA 4NKOA 5C0EB 5GSRB 2FJHA 4L3ED 1BVZA 5C0RL 5D71H 5J12C 1FE8L 3BMVA 3O4OB 3GSNL 4EOWL 5DMJB 5EBWA 3L6FB 4JFFA 1JZ4A 3VGGA 2VOTA 4KHTH 3RDTC 1B6DA 4JRXE 4ZFZB 2NXYD 4JO3L 1E4KC 4FQHB 1PYWB 3OKLB 2I5YL 1DDHB 4ZFGL 2R0KH 1S9YB 3PNWB 1XMWA 4X8JA 3TIEA 4Y5YB 4Z7WB 1CL7L 1I8KA 4OQ1A 5SWZD 5IGXH 4PJBE 1WAAF 2HJKA 2C3HA 3BEWB 5F3HA 2ESVE 3QUXD 1JHKL 1DEEB 2ZCKL 4XP6H 3U9UB 1JGVL 3HZKB 3N85L 4HUMB 3NIGE 2W0PA 4MQ7B 1LWRA 4ZTOL 3LN5B 3MGOA 4YDIL 3VXPB 4PB9H 4WRLA 2DQIH 2YD6A 1NBYB 1HXMA 2BSSB 4LCUA 5F97E 1ETZB 4JG1H 2YKLH 4K3EL 3UX9B 3X14A 3I75A 4FXKB 2MWCA 1BQUA 1W8NA 3V0VA 4J23A 5IVNA 4CRPA 3DURA 5CMAB 1JWUA 1TVHB 1MCRA 4L4JA 5KANI 5HYQA 3MRPB 5ITBL 4LFHG 3DLQR 4J2XA 3WMSA 4P49A 1I3GL 1N64L 4Y5VA 3EFFB 3BYTA 3JZ7A 4P2OA 1J8HA 2KPNA 3VXOA 4U1KB 4MVBD 3EOTH 3EYVA 3QFJA 4OD2B 1A6AB 2OYPA 2CDFA 3DVNB 3RTQD 4O58H 4PJXE 1MCSA