2R23A

Crystal structure of s25-2 fab in complex with kdo analogues
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
217
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab, antibody fragment (IgG1k), light chain
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
total genus 49
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r23A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r23A01
2VLRD 8FABA 1OP9A 3BISA 3GM8A 5IR1B 2G9HB 4U05A 3HMXA 1A5FH 4UB0L 1NSNH 2PTTB 5J4MA 3ZYIA 3O3BA 2PW2B 3MLSH 4ONHA 5E6ID 4LNRA 4QRRD 1RUPL 1ZLSH 3S5LG 1UXSB 2XKSA 3CZFB 3GSVA 4BFIA 4HK0B 5HI3D 4GAJH 1RUQL 4POZC 4JFDB 4KZDH 2Z93A 4NP4L 3BIKA 4JZNA 1R6VA 1U8IA 3GHBH 5EZLA 4KU1A 5D1XD 3NPSB 5FDYA 4CADA 4JFFB 5DJXB 5E99H 4R2GD 1KN4H 2D0HA 4ZNCD 3MA7A 5B39G 3VGGA 2R29H 5FKPB 1J10A 2D9CA 3FFDB 1TTFA 2AV1B 4JCMA 1NL0L 4NHUB 2AXFB 2CDGA 4CRPA 1MFDL 4M1CC 1IAOB 4GKOA 2DI9A 2JK5B 2JELH 2NY5C 4ZFGL 4PB9H 2QQQA 3H9SD 3A0OA 3MNWB 1N3NB 5HPMA 2BVOB 3NH7H 4EI5D 1E0OB 3PWUA 1PJ9A 2EYRB 4Y5YB 1LEKB 4M7JL 2HTLD 4X6CE 3TZVA 3GBNL 3MRFA 4PGDA 4PRHD 4Z7WB 4P59H 1IC1A 3D39B 4U1MB 3V6FA 5L2JB 4P4KD 5KAQG 5C0CD 1IE5A 4KROB 2XQBL 1BBDL 4N8CH 4RGOL 1U8NB 2GJZA 1JGEB 3NCBB 5CJOH 4CAGA 5I2IB 1UADC 3MRBB 4R4BB 3JBG7 4PRDB 2VN4A 1S7UA 5FO8B 3EYQD 1B90A 4OFVA 5DEGA 1FNSH 2Z35B 3X11B 2NY2D 5HXMA 4L29B 1HNFA 1JYWA 5SV4A 2FHFA 5CP3H 1F6AA 4JPVL 5I1AB 3FCTB 5EOQL 4KKBC 3D3VB 1FH5L 4DZ8B 1MCRA 2IANB 4I3GA 3FQWB 5C0FB 4IOFC 2ZSVB 3PQYD 2Y36H 3QUZD 5F96H 1BQLL 4XP5L 2BY0A 2ADGA 3B2UC 3TVMA 4KHXH 4AEHL 4IEFB 5CUSL 2SEBB 3GSWA 1FC2D 4MA1C 1OAZL 4C54A 1IGTA 3ARED 3G6JB 4WFGE 4HPYL 3W11D 3BPOB 3FRPA 4X4MA 2HRLA 1JZ3A 3ARFC 1LP9E 2KH2B 3S37X 4G6JL 4UTBL 3BPLB 4K94C 3UBXG 1MEXH 2A6KB 3QEQA 5CEZL 5FV1L 2D4FA 2ZUXA 3FMGL 3ZE1F 5I15L 2J5LC 3IDNB 3O3EA 2XTJD 3V0WH 3EHBD 1DQMH 1R3IH 2XY1A 2YD9A 4QWWC 3L9RA 5D1ZA 3T08A 2ICWB 1DSFL 3GB7B 4G7YH 1OSZB 4ZAKD 1E6OH 2FYYB 4JPKL 5I1KH 2G60H 1C7SA 4KQ4L 1FG2B 1XGPB 3SOBH 2DQEH 1CLCA 4Z7VE 5E6IA 1ED3A 1T89C 5DQ9A 3K8LA 4FFWD 2ORBH 5IIEA 3SY0B 1S7TB 4EXPX 2ICWI 1DBKH 1TTUA 4X80H 4OLWL 5I1CL 3ZKMD 2IALA 1M7IA 3D39E 3GFUA 1U58A 4NGHH 1J1OH 4L4VE 5D1XA 4PJIF 5F6HJ 5DJDB 4J1UB 1QNZH 2W0LA 1V3LA 3U30C 3D0LA 1QO3A 4AMKL 1YPZB 4U1JA 1J8HD 3LEXB 4X9IA 2XQYK 2R0WH 4L3EB 1LDSA 3CXDL 4ZUTB 2MQ0A 3T8XA 1JBJA 4XCYA 2DL9A 5ANME 3O2DL 4BM7A 1M1SA 3KYMA 3F65A 3SKOB 4LSSH 1S9VA 1S7VA 3H9SA 1EMTL 1NDMB 4YHKH 2W91A 2BVEA 2D0FA 4TNWF 3OXSA 4FQXD 3UTTE 3D3VE 3C5JB 3VG9B 4Z76B 5KSAB 2IANE 4PRHA 1AC0A 4O4YH 3RGVB 3VGFA 1FV1A 1KTLA 43CAB 4PJHA 1BQSA 4MDIB 4XC3H 1T1ZB 2XA3A 1OSPH 4P4KA 5F7HA 1F3DJ 5BVJA 4KTDH 2Y4SA 3MNZB 4WWKB 1ZTXL 3WFCL 1DLFH 5D1QC 2VLLA 3IFPB 1MF2H 4JRWA 5FEBA 2QADC 1AD0B 3EKCA 1F6LL 3C8HA 1GVIA 4J2XA 1MRDL 3L3IB 4GKZB 1HEZB 4MWFA 4OFKA 1ZA3B 5EOCJ 4HUUB 4XWGL 3TO4A 5KVFL 1EEYB 3C6LD 4JFEB 3NN8B 2V7HA 5C0NC 5DC0A 4XMLL 2HTKD 2ZWLT 4I3RH 2ESVB 3DSNA 3QUZA 4M7ZB 1QSFD 1RPQA 3OKMA 4HCRL 2KQMA 3DVNA 5EBLA 4M93C 3D85B 3FT4B 4WVRA 1MCWM 3AREA 2N4IA 3PIQB 1UQSA 3PABB 3I2CH 4ZSOA 2GAZB 3PWVA 3PHOB 1F6FB 1LE9A 1ZLUK 5C08A 2ENYA 5TDPA 3ILPB 1AGFA 4S1RH 2OTUA 3BP5A 3PWJA 3UC0L 4AQ1B 4M6MH 2MCPH 4X98A 5FF6A 4YDLB 4MDJA 1HZHL 1HSAB 1HHGA 1KLGB 2CK0H 2YK1H 4PJFF 1ND0B 1BQUA 4NQCD 3NMEA 3O3DB 2ED7A 1WWWX 2AGJH 3WCYA 1IZKA 3UZEA 1W0VB 4PD4J 4FNLL 4HC1A 4FZEL 2XZQL 3WJJC 3BPNB 4DGIH 3I50L 1UH3A 1IEBB 2ZG2A 4I2XE 3I9GL 5F7DB 5JW4M 4KK9C 4HIEB 3MCLL 3LN9A 5IV2A 1T21A 7CGTA 5JW4R 4HKXA 4G9FE 4NRYB 4WUUE 3B4NA 2ZSWB 4TUOB 3MCKB 2NYYD 4Y16C 4BQCA 5I6XB 3EDKA 1PW3A 3QFJA 9CGTA 4MNGB 1U3YA 1FFRA 1I7RA 4WNQA 1AGBA 1QLRA 4LCYA 1FFNA 3ROLB 5EU4B 3GMNB 4WW2C 4PJIA 2G75B 4NO3B 4IRJC 3ULSA 1CTNA 4S0TD 2DM7A 4LHUB 1Q9LB 5C9JA 2CK2A 4PIRF 1S7SB 1HDMB 4IHOB 4L8SC 2NW3B 4RQQA 3A6OA 3ESUF 2DBJA 4CMHC 3MBEC 3ILQC 4GUPA 1DFBL 1J8HA 4FA8A 2NY3D 2EDEA 1YQ2A 4WHCA 5DD3L 3RDTD 3QQ3B 3G9VA 2KUTA 4JRXE 3SQBA 3WN5C 3FFCA 3BAEH 1T80A 4QCIA 2WAHA 2CLRB 3LV3A 3MV9D 4R4NC 4P4RA 4R0LC 5JA8B 4FQXA 5J9PA 2Z91A 1YUHB 2QSCH 4LHJB 1Z5LB 3TA3C 1JGVH 4GBXD 1GGCL 3VH8A 2P42B 1YEFH 1VFAA 2HFEB 3KLSA 4MVBD 2H26B 2ESVE 2VABB 3DUUA 4XP4L 1U95A 2ICEA 1NCBH 1MQKH 2CKBH 3QUMB 1MLBB 1C16A 1CLYH 3TT1H 1HIML 5T1MB 2EDKA 4PRAA 5DQDL 1N64H 1DUYA 1TCRA 4LNRB 5CIPH 2W9EL 4OM0H 3WIHA 4YEEA 2RCSH 3GSVB 4BFIB 2BY3A 3BZFA 5HI5C 3C6LA 2WSKA 4CDGC 1D5MB 4Z78B 4N0UA 3BIKB 1U8IB 3D48R 1D5IL 4AG4L 3X13A 4N5ED 4CADB 1PG7H 3JWDL 1QSFA 3FAWA 1K3IA 3MA7B 3LQAC 3RIAK 4YHML 1QBML 4H20H 2IADB 3NCEB 4FQIL 5I73B 2Y72A 5T1DL 1FZJA 1QA9B 3VWKA 5EU7C 3MV7A 4HBQA 2ZCLL 1CGSH 2CDGB 4D8PA 2NXYD 1SM3H 5E2UL 3QHFH 1QYGL 2WWKO 1AHWA 4PRPB 1T1XA 1CN4A 1MCWW 1NAMH 3C8DA 4FQ1H 4JREB 1NCUA 1T7WA 5TF1L 5FGBC 2EE6A 2R23A 4NQCA 1V7MH 5IF0B 1CZ8L 3VXUB 2EDJA 4WW1B 1CFVL 4OAWA 4Y4HB 3U7YL 4DKFH 5C1MB 3V6FB 5LBSH 1D7FA 1UWGL 2PXYC 4X0KA 1P69B 5F1KC 3U2SB 4LIQL 4OZHE 2Q7YA 5DHVH 3ZKND 5IHLB 2OP4H 2F8VA 5ENWB 3L5JA 5GIRB 1YECL 3E0GA 1RMFH 4UI2A 3S97C 3V0AC 3VG0H 2DJSA 2DQTH 4XPHL 2K7QA 4LCIL 3WFEH 1HHJB 4OUUA 1REIA 3BXNA 3RWFA 4B7IA 5JXAL 2UWEB 1E4XI 5LCVH 2VDMH 1F02I 4BUHA 1F2XK 1IAKA 5HGDB 4Z7QF 3P4NA 1KSRA 1F6AB 4PP1C 5IQ9B 5HDLA 2IPKB 3UX9B 3C5ZD 3O81A 2DM2A 2O5XH 1GSMA 4G6FD 5J12C 5IVXB 2B5IB 5DD1L 2R4SH 1RFDH 2R15A 2ADGB 3TVMB 1Y18A 3RDTA 3GSWB 3PV6B 3UXFA 4AQOA 1CD0A 1A3LL 3LEYH 1FVCA 4BZ2L 3W0WD 2EO9A 1L0YA 4P3DA 1CD8A 1NFKA 3KPQA 1II4E 4JO2H 2WQRA 4TQEH 3QEQB 2VDRL 2FRGP 2XA8L 2N7AA 5E8NA 1SHMA 1F4HA 2YA1A 3FB5A 3RVVC 1IGIL 1G0YR 3O3EB 5I71C 2GIYA 2OR8A 5FA3B 1NCDH 1P7HL 4UT9L 4HMDA 5E4EB 3FOLB 2Y9RT 3L9RB 5D1ZB 2UZIH 2XFXA 2NY7L 4M5YL 1WEJH 4CMMA 2RB8A 4NZRH 5D7JC 1J18A 2PNDA 4X7DC 1G9NH 1QPPA 1W72A 2X41A 1IGYA 2J6EL 4MNQA 4RAVA 4MQTB 1ED3B 2MQCA 4S1SH 2APFA 5DQ9B 4H1LH 1AGEB 2VB5A 3PGDA 3LQZA 4B41A 5IMLB 2IMNA 4OGAC 1MLCA 3CVHB 3QCTL 3DYPA 3O11B 2MTPA 3B9AA 3BSZL 1R0AL 2N7BA 2EEAA 2F5AL 3FT3B 3EO0A 4NBXB 1I1AA 4OB5L 3U0WH 1EUUA 5FYJU 4X6DA 3D0LB 3VFNA 5JPNA 2HN7A 5B38G 1JI1A 3IXTA 3VXSD 5CD3B 4U1JB 4UOJA 4EOWH 2YKLH 4OLZL 5E00A 1JJUA 3QCVL 2VXSH 2X40A 3OJDB 1DVFD 4LSQL 5ACZB 5SX5H 1AY1H 3MLTA 5IW1A 3HAEA 4LASH 1S9VB 3EFFA 5CEZD 1VADA 4K7PH 3CK0H 3OXSB 3KPSD 1NANH 5BMFL 3BWUC 4PJHB 1UB6B 4O5LH 2CXKA 1CICC 2VUYA 4GOSA 4WO4C 3HNVL 4OT1H 5BVJB 5L88H 5BZDA 1N6QL 2OSLA 3E3QC 2PO6C 2CIKB 4X4ME 4LQFH 3GJFK 3S35L 3HZVA 1DQQA 3IDXL 1MIML 1YYMH 1I8LA 3TH2T 4BFBD 1CR9H 3QP3A 3QEQE 3QZWA 2X09A 3DMMA 1EIBA 4MWFB 1IQWH 5T1LA 3UZVB 1QFWI 3T4AA 3TO4B 5MEND 5IB4A 2OCFD 3ZDYF 4FXGB 1QRND 3NA9L 3IU4H 3FQXA 1N5YL 4LSPL 4O02H 3M1BA 1C1EH 1X9QA 3ARBA 3DVNB 2J2ZA 5EBLB 3MRRB 1PG7W 2BHYA 1GOFA 4ZSOB 3RKDD 3OAZH 2ADIB 1HCVA 1KFAH 4OFIA 3W0WA 1ONQA 3ARTA 4MA1B 1AGFB 3PWJB 3SJVB 2B1AL 5FF6B 2BY2A 1D5XB 4MDJB 1U91B 1QSEA 3ARFB 1DDHA 2IAMC 3J7HA 3LKQA 4NQED 1XT5A 4FFYL 3DI2B 4HKZA 2J5LB 2X1OA 1KJ2H 1NPUA 5IV2B 2VR5A 3GHEL 1MREH 2V17L 2AKRA 1A4JA 4YC2C 3H9SE 4W6WB 4UU9B 1JWMB 5FKAA 3R1GL 2RQ8A 5E8DL 1AGBB 3IJYA 4PRHE 5D72H 2F5BL 2QSTA 3SGEI 4PJHE 4QRQB 2CLZA 3K46A 3ULSB 3VI4F 1V3JA 1XF4A 4YUEL 3HE7D 5I1DB 4QRUB 3CSGA 4LOUD 3GMRB 4X6FA 3VXSA 3MRCB 3OG4B 2WBJA 4M6OH 4KVNH 4F7TA 3U30B 4G5ZH 3HA0A 4HIXL 1UEYA 1DVFA 2ARJQ 4YAQB 4X5WB 3FFCB 3MA9L 5GGSY 5B22A 2BXZA 1Q72L 5EB9A 2NY0B 3HZKA 4XPAL 3LV3B 5JUEL 3L3HA 5J9PB 3KPSA 3O6FA 1Q9OA 4LLYA 1HOCA 4AEIL 5IEKB 3V4VL 4JG0L 4KKNA 5BS0D 4X99A 1VFAB 3BVNA 2D03H 3VFOB 4X9GA 2NY6D 3DUUB 3BE1L 1U95B 1A7RH 3F6IA 2YRPA 1DQJB 3G08B 4DTGL 2DD8H 2FR4A 1PKOA 4N9GA 4ZSOE 3A6CH 1OP5K 1P7KA 5C08E 2P46B 4OCSH 4KRLB 3OR6A 3S9DB 1QPXA 3ZE1E 4RFEA 3VXRD 1WT5C 1R5WA 4ORGA 1A6TB 2F8XC 2QADB 5D6DC 4J6RL 1U6AL 2XTJE 4HWZA 3EW3B 1TJHH 2F54D 2VC2L 3FQRA 1I1YB 1U8KB 3TN0D 5I0DA 1HXMA 4N0UB 2FO4B 1U8JA 5CJBA 1X6NA 4RNRB 4KI1A 1MJ7L 1RSFA 2H2PC 5CJXC 2VRAA 1QRNA 4XVTL 3HNSH 1DBAH 4XP9H 1NAKH 3BRFA 3KPLB 3ZE2E 1KCRH 1HILB 2QKIB 1KIRA 5D96B 3QFJE 4QXGH 3BESR 1UWXK 3VWKB 3MV7B 3P73A 4MMZC 5H8DA 4LP4A 2DQDL 4D8PB 1S5HA 2MOVA 3CVIH 4PJIE 4RMRA 1QEWB 5FYJL 5JNYA 2F8OA 1DEDA 3JWOC 2WWMC 2P8LA 1AHWB 5HYFA 2XZCL 4PJCB 4PUBH 4MSWA 2R23B 5DRNA 2NY4D 1HE7A 5BV7L 1J8HE 4FN0A 4JZOA 4F2MA 1OQOA 4DK3A 2IFFH 1DR9A 1S5IL 2BVTA 5C0BD 1T7YA 2G2RA 3HE6C 4UNVA 3FFCE 2EDHA 4MS8D 1WFUA 5HI4C 5B3JF 4QHKJ 1T0NA 3O0RH 5CBAB 2FEEL 3GUTB 5CJQH 1OARL 2BDNH 4XI5C 4J4PA 5E94A 4YJZL 5DD5L 3S36X 4DGYH 1KCSH 4R90L 5IOPB 1K2DA 3QAZC 3W39B 1CFBA 1XZ0A 2GK2A 2HFGH 5JW4Q 5HHQB 4Y16B 2VLKB 3EYVA 4MQ7A 5FFLA 2VDLL 2JB6A 5A3ID 4HS8L 5H94A 2E7LA 3V8CA 4F57L 1YY8B 1L9NA 1UXWA 3V9FA 3DJ9A 1SEQL 4HWBH 4WW2B 3OXRB 1GGIL 2DBLH 3OB8A 4HCRA 4R96B 2CPCA 4IRJB 4LSVL 4PG9B 5TE4L 2R1YA 3ROOA 5K9QI 3G5YB 2ADFH 2R2HB 4HUKB 2WANA 4WI4A 5C0RH 2ITDB 3Q3GB 1W0WA 1R3HB 2WW8A 3LN4A 3HPJB 4L8SB 2BNQB 3QDMA 4CMHB 4P5KA 1Y18B 4FABH 4HD9A 4ZD3L 4ZOEA 1CL7I 5FDWB 4ZO7A 2I5YH 1ITBB 4P3DB 1RULL 3WKNA 4N0UE 3KPQB 3WN5B 1MRFL 5DLML 1P7QD 5EBWA 1DANU 1T04B 3QBTB 3MC0A 3VJ6B 1QSFE 3FB5B 4P9HH 2XRAH 1DBJL 2J8UA 1U8HA 5CZVH 3QIWC 4CU6A 1C5BH 3IS0X 5IFHH 1QRKA 1OTSD 3VCLB 5EZOL 1U8PB 3KPMA 4JDVB 2A73A 3MV7E 2XFXB 1YNTB 2DLHA 5F97E 2F15A 1JRHL 3HS0A 3ULUH 4FQCL 1SMOA 2EH7H 1MIEL 4OV6F 1IGYB 3VXRA 3BPCB 4MNQB 4RAVB 4HXBL 5JOFB 1MWAL 3ME0A 1LO5A 4U33A 3DO3A 3LQZB 4NQCE 5D2NA 3HR5A 4NZJA 2F54A 2FGZA 3TN0A 4WI9A 3LAFA 4KZEH 2XKUA 5L7XL 1F8TH 1HNGA 4GLRI 4M1DH 2AS5M 4XB7A 2V2TA 1FDLL 1I1AB 3TIEA 4X4YA 3ARUA 5GRVL 2GT9B 4X6DB 2HN7B 4FMFA 4KI5D 3QQNA 2DMCA 3BKML 4NQDD 4ETQB 4N1EA 5CGYD 1OTUC 3LMJH 5KOVC 4KI5F 1QQDB 1D3CA 4NN6C 4EVNB 3WD5H 3CLEL 4JJ5A 4XVSL 5LAXA 5IW1B 4XXDA 1NUGA 4I9WD 5IB1B 4WTZA 4MAYB 1AO7D 1RU9L 2XWTB 1EXUA 1MJUL 2E9IA 5IROA 4F3FB 2VLJB 3IVKA 1SYVB 1J7VR 1IARB 4F9LA 3OKDB 4PGEA 5HHPA 2DKMA 3WEXA 2GSGB 4HAFA 5FUZH 1L4IA 1VGKB 4KPHL 4LCCC 1NMCB 3GNMH 2UUDH 2VDOL 1LMKA 1GGBH 4XP1H 3DROA 2NR6C 5GS0H 2PXYB 1SMAA 4L4TA 4OD3H 2H1PL 1IEHA 3PDOB 4DKEL 3PL6D 4XNMB 3T0BA 4PRNB 3Q6FB 3QZWB 4Z95L 3AXLA 3TZVC 1J1PH 3GRWL 1LD9A 2JB5H 5EOTB 5F7FA 3DMMB 2VDQL 3ARGD 3OJVC 1JK8A 3D87B 4U6XB 3UO1H 5C3LD 4PRBA 5T1LB 3V7AE 3T4AB 1ORQA 1UM6L 4ZUVA 1KNOA 4EJ1C 3L3KA 1UJTA 5IB4B 1K4DA 3MRIA 1T03H 3EYOB 5LKNA 2EDQA 4I5BB 3S7GA 5HVHB 2N56A 3FQXB 3WE6A 1H3PH 4CU8A 2GW5A 2VTFA 3ARBB 4MNQE 3ETBF 3T2QA 5FK9A 3NABH 5J12B 1A5FL 1XGUA 4WHDA 1NSNL 1JGUH 3MJ7A 3MLSL 5BVPH 1ONQB 3VFRA 1WBXB 5MI0B 1KBGH 3AM8C 4XPBH 1DQTA 2VR4A 2BSSA 3V8OA 1P7QA 4GAJL 3RIFK 4KZDL 3BP6A 3W9EB 4I48B 1QSEB 5F3HB 4JDZA 3GHBL 3QCUH 3ZHKA 1X5HA 3P30H 1B9ZA 4GW5B 4X6DE 5E99L 1KN4L 4JDTH 3RWGA 2R29L 2EYSA 4HKZB 2P49B 1OD7A 4PJBF 1FVDA 4YHIA 4MXQD 3CX5J 2AKRB 4RX4D 2NCMA 1DN2A 4U6HA 1MI5A 3S6CA 2DRUA 3MROB 1CFTA 4PB9L 2YRZA 5D7JB 2AJZA 5CKAA 2W0FA 3IJYB 3NH7L 1ZGLM 4PJ8C 4HBCH 4NNXA 1ZHKA 5BQ7A 1EFXD 1I4FA 4ODTL 3TCLA 1FVEA 4N8VG 1I9JH 3OKLA 1QFPA 4JFHE 1GXEA 1BFSA 1X5KA 3SDAD 1GJIA 1XF4B 3VWJD 3N1GC 1M6OA 1PLGH 5KSBA 4K7FA 4KTEH 3CFDA 3RBGA 3QG7H 3MRDA 3JSSA 3KXFD 3ARDD 4N8CL 4PBXA 1TQCB 1B0WA 5E6IC 4DVRH 4F7TB 4UOW0 1KXVC 3BWAA 1QLFA 4GKSB 4M4PA 3V4UH 1ADQH 3O8XA 4HV8A 1FNSL 2JTDA 3IAQA 1T4KB 2XACC 4U1LB 3HZKB 5I8OH 1C5DB 4M48H 3L3HB 4IRZL 3O6FB 4LLYB 2LABA 4R2GC 4ZUWB 4MCZA 5DURB 3TYFB 5JHLH 3GK8L 3EOAB 2DQUH 4XCEA 3KS0H 5L9DH 2Y36L 5KSVB 1B0RB 2F58H 1MHCB 1VHPA 1NBQA 5F96L 4N9GB 3DGCR 1FRGH 1R24B 3SKJH 4S0SD 3W0WE 2X70A 4FFZL 4G43B 5ESQB 1MVUB 1JNLH 3PL6A 3HC0A 2PO6B 5HHNB 4RFEB 4EI5C 5I1LA 3LPWA 4NUGH 3EOTH 4KRPD 1NLDH 2HTLC 1QSEE 1R5WB 1MEXL 3ARGA 3GZKA 5D7LD 3FQRB 4JFZH 2BCKA 1HXMB 3V0WL 5DRWA 1DQML 1R3IL 4BK4A 1F90H 4LPVA 1S7WA 5J6HA 1JUFA 4UQ2A 1E6OL 3QUMH 5D71H 2D4DA 1J86A 5I1KL 5ISZD 1KIRB 1G9MC 4I18A 3EYQC 4U6VH 2UYLA 5DZLA 2DQEL 3FTGA 3SOBL 5D7KE 3LS5L 2YC1B 3P73B 4CVXA 1KJVA 4PV8B 2E9JA 2ORBL 4BYHA 1TXKA 5JQ6H 1S5HB 3T0AA 1EHXA 3HCVB 4D0BA 1I75A 1ZEAH 1MH5A 4X80L 3AGVA 1I3RB 1YMMB 3NIFF 4NGHL 1Z6JT 1B6DA 4MSWB 2YD6A 1QNZL 5IHUH 3VXSE 2GJJA 1KCUL 3BW9B 4N8VB 1WITA 3MRGA 1H8SA 2EIZA 1IRAY 4TULH 1DUZB 5JPMA 6FABH 4XCNA 2R0WL 3K8MA 3W11C 3PWPD 1FSKC 3HG1B 4RX4A 4NKMA 1J0YA 5CEZE 1E28A 3RNQA 3O45B 4Y8DC 2DI8A 3C60D 3EOBB 4LSSL 5E94B 2HJKA 3KPSE 3N1QC 4YHKL 1T5XA 4K23H 4ISVA 2R2BA 4DK6A 1AXSA 1EFXA 3EYVB 5HHXH 3KWWA 3EHBC 4MQ7B 4O4YL 5HYSG 4B5EA 4XC3L 3VWJA 1G0XA 1UXWB 1HXYB 1OSPL 4ZAKC 4F7EB 3W82A 3OR7B 4KTDL 4POYA 3ARDA 2FLRT 3FN0H 3UROR 1A9EA 1UB5A 2DAVA 5E9DA 1A7NH 3CPLB 1HCFX 2RFXB 1E4XH 4MD4B 1QFUH 4QOKB 5D7SH 5CD5C 5IG7A 1MF2L 1YA5A 2HLFD 3WFDH 2HLAA 2KZ1B 3QDMB 4FFWC 4P5KB 3GSUA 4XVJH 1QKZL 3L7FA 4EIZC 3A6BH 3LSOA 2GITB 2C9AA 3SDCD 3ZKMC 1DE4B 5CILL 2UY6A 4GAGH 2CD0A 4MNHB 2R4RH 5EBWB 1QRNE 3DVGA 3VD5A 1WFOA 2J8UB 3QXDA 1DLHB 4I3RL 4Z77A 2AQ2A 2Y25A 4HFUH 5GZND 3X17A 4UDUA 5CLTA 5DMKB 2A73B 2DYPD 3KAAA 4P57B 5E08H 3I2CL 3BGFC 4G6ML 2W59A 1CVRA 1XCTA 3V6ZA 2NTFA 3MCG1 4O2CA 4S1RL 1R3LB 2ZUUA 4OF5A 1S9XB 1LO5B 2LAAA 4M6ML 4TSBH 2MCPL 3LY6A 3HR5B 3MV8D 4NCDA 5D7LA 4PJ5A 3MZTA 5GGTH 2YK1L 5GS1C 2QHRH 3VXMD 3IFOA 5DK0A 2AGJL 1LEIA 2VWEE 3W5MA 1TZIA 4DGIL 4HHAA 2V2TB 3IGAB 4AT6A 4V2BA 1EEUA 5ISZA 4R26H 1AD9B 3U0TA 4QTHA 5HGAA 5FECA 4ODVH 3MOAH 2PTVA 2AEPL 1OTTD 1EEZA 4JJ5B 4U7MA 2D9QB 5LAXB 2I9TB 4K8RC 2YD4A 4LCWD 5EO0B 1OHQA 1F3JB 2VZUA 3CVHH 2HTKC 4G8IA 3WHXA 1QOKA 5D9SA 4G6AC 1CF8L 3RUGB 4N0CD 1KV3A 2BMKA 2QQLH 5HHPB 2DQCH 3QDME 3WEXB 5LGKA 3B9VA 1WFNA 3OBAA 3QI9D 4EN3D 2VISA 2IEPA 2XXMB 2R0ZL 2Z31C 1BBJA 2YOCA 3DROB 4AZ8A 1YQVL 3C60A 4L4TB 3BH8B 4U6YB 2VZTA 2AJSH 1H5BC 4OFYD 3ZKXB 2X5PA 1ETZA 5F1IB 3T2NH 2QSCL 1JGVL 2VE6A 5DT1H 3N50A 5TQ0H 4DUVA 2HJLB 2J8UE 12E8H 2Y06H 3MLRH 3MFGB 5E8OB 3DX7A 2NY5H 2VQTA 4PRBB 2W65A 1ORQB 2EDBA 4ZUVB 1MQKL 1K4DB 4G8GA 3X3FH 2CKBL 3QDGA 5IBLC 2C3VB 3CDGA 1CLYL 3TT1L 4F9PC 1HHIA 5CGTA 3WE6B 3CU7A 3VXRE 1QFWH 1N64L 4ZO8A 1R3KA 4LCUA 4A2LA 2NX5D 3KPPA 3SDCA 3T1FB 3MJ7B 3OAYH 5D2NE 3WO4C 3ZL4H 3FO1B 2F54E 3G6AB 3GSQA 3O9WA 1D5ZB 1NQBA 2RCSL 4MX7A 3RWJA 3GBLA 3OX8A 1JPTH 3BP6B 4Y4FA 4UT7H 1UJ3C 1OD9A 1XAUA 5FO9A 3H3KA 3RIFF 2R2CA 3RFZC 2NY3C 4HLJA 3BP4B 5FXCH 4R4FH 1CFSA 2NNAA 3RWGB 3G5VB 4H20L 1NC2A 5IGXH 3QIWB 4KDTC 4WFFE 4MA7L 4LLVA 1CGSL 3RY5A 1H15A 4WEUD 4NC1C 4U6HB 1MI5B 2AI0H 1RZIA 1SM3L 1DQLH 1OAUH 3IKCA 1MELA 3QHFL 4XMKL 2OM5A 4GBXC 2MQ3A 4NNYA 5GSVA 4MVBC 1WZMA 4FQ1L 5HHVH 1UZ6F 3G5ZB 5EU3A 3RJDA 5INDB 3VXMA 4NNXB 1V7ML 1ZHKB 2DI7A 4G7VH 1I4FB 1OLLA 4OJFH 4D3CH 1FVEB 4XNXH 1R5IB 3OKLB 1PDKA 1IT9L 2W38A 4AIZB 4DKFL 5C0GA 4Q9CA 5LBSL 2AQ1A 5IT2H 1QZ1A 3MRDB 2DQGH 3FQTA 1QFWM 4YE4H 1YY9D 3TBYB 3TV3H 3SGEH 4L4TE 2OP4L 4FQLH 4LL9A 2I9LA 1XGQA 3VG0L 2DQTL 1KCLA 2B7DT 3WFEL 3E8UH 3LEVH 3QRGH 4M43H 3O8XB 4HV8B 4CDHA 3CH8A 4DJMA 5IB5A 5HY9B 1OL0A 4OD1H 1TITA 4LCWA 4Q0XH 3DRTA 4JGUA 4JHBA 4JO3H 3WLBA 4U1HB 4NN6B 5LCVL 2VDML 1KELH 1BOGA 4Z7UF 4HKBA 1FNGA 2EICA 4ZFFA 3KLDA 4I0PB 4MCZB 4PJXA 2O5XL 4QRTA 4XCEB 5C07D 3FB8A 1OT2A 4JM2D 5IMMB 2R4SL 3MRMA 5ILTH 4F7MB 3MUGA 5IQ7L 1RFDL 4EN3A 3EO1A 4JM2F 4JO1L 2EO1A 1BIIA 4KRNA 2NMSA 2NXYC 3NFPA 5C70A 3LEYL 1MCKA 5HPOA 2DF3A 4YGAB 2Q86B 2EECA 3WL9A 1JYXA 4NQVB 2K9UA 1WBYA 4OFYA 1P6AB 4YDJA 4QTIL 4JO2L 4TQEL 3RVXD 3ECBA 4L8CB 5AD0B 2MSPA 3BEVB 2CGRH 2VXQH 5E8EA 1NCDL 4J12A 3GKZA 2DLFH 4JKPH 4WI3A 1CT8B 2C4FT 2UZIL 1PYWB 4P46D 4XBPA 1S7WB 3JTTB 5J6HB 3U46A 4UQ2B 1Q9KA 1WEJL 1MI5E 3C5SA 4NZRL 5HDBF 1TQBB 1FYHB 1I8LC 5F7WC 1S7XA 4Q7DA 1GIGH 1G9NL 4O2EA 2ED9A 4I18B 5AG8A 2NX5A 4S1SL 3SN6N 4E41B 4GRWF 3ZT7A 3WNPA 3B8SA 3H42H 1LO3H 3DTXA 4D0BB 3WIHH 1MH5B 5E70A 3KPOA 3DXAD 4R7NB 5KSBE 2XIDA 3C5ZC 5FO7B 3DV4A 3VMNA 3BMVA 2NXZC 4YHOH 5JLZB 3U0WL 1F3RB 4Y7MA 4KI5E 1MCFA 4YPJA 5TDNA 1A6PA 5JPMB 4Y2DC 4XCNB 2KL6A 2YKLL 4MJID 4JPIB 3TIDA 3ZTJG 4OZIF 2VXSL 2P8PA 1TJIH 3IT8D 1E28B 3RNQB 1CDYA 5TF0A 2NLJA 1JV5B 1AY1L 3ORJA 3DRQB 3GRWA 4LASL 1RZ8A 3RGHA 4XPGH 1EAPA 3QQ9D 1BPVA 1T5XB 3B43A 3IF1B 2ILLA 2H9GB 3CK0L 1S9WB 1FYTB 1XR9B 3GMMB 1YN6B 1ZE3C 2UVEA 2PCPB 3N1MC 1YJDC 1ZVYA 4O5LL 4PJ8B 4GFTB 4YFLF 3WIIH 3F62A 1MFCH 3T0XA 2O26U 3B9DA 5DVKA 4OCLC 4OT1L 5L88L 1ZXQA 2YS4A 1HYSD 1F58L 1FFOA 3ESVF 5DMGD 5TJWK 4UTAL 3EGSA 3EDEA 1KJMA 1T83C 4LQFL 4F80A 5I76B 1PY4A 5IG7B 3ZDZF 3QO1A 4NYLB 4OZ4B 1YYML 1CR9L 3LSOB 3QEUA 4CW1A 3SDYH 4Z7UA 2BSED 2GTZA 4JRYD 4G8FA 5J06A 1IQWL 4RMVA 3BZEB 5DJAB 3I3BA 5DI8A 4RIRB 1U8OA 5F1OB 2PYEA 1CL7H 1WZLA 1A02N 3DVGB 4WDIA 2NTSP 5C07A 1PKQB 4Q6IA 2V5MA 4JM2A 4Z77B 4P5TA 5BW7A 2UVFA 5C0AA 3IU4L 5CP7A 3WJLA 4O02L 1JPGA 1RQ5A 1C1EL 4OLXL 2EYTB 2WLYA 3ZT5A 3EYSL 5DUML 1KFAL 2ADJA 4ORZC 1DTUA 3P9MA 3O3UN 3V6ZB 1IGJA 2EC9T 5I30H 3I02B 1FIEA 4MGXA 5C6TH 2CLVA 5DS8A 4AYFA 1K8IA 1Y6MR 2WIMA 4KV5F 4YGVA 1A6WH 3VI3E 1A47A 4GXVH 3P4MA 3UYRH 4YDVA 1B6UA 5JHDB 1CGYA 4GS7C 3ZE0E 3N1FC 5ICXB 1KJ2L 4AT6B 4R97C 4M7KH 3MUY1 1MREL 1K9TA 2F9BT 3U0TB 1O7SA 5TH2A 1OPGL 5C3TA 4GLRH 5F6HI 1RHHA 4ODUA 2WIIB 1N2RA 1B88A 3OPZH 4N68A 2A0LC 4OGXH 4JY4B 5CP3A 5D72L 5EIQA 3PP3H 3K7UA 3LRSA 2Q8AH 5JR1H 1DJSA 3DXAA 4AJ0A 1B4RA 1NDGA 1KIQA 4NO5A 4G8IB 2ARJA 2Z92A 4F7PA 4OCMC 3GI9H 4M3JA 3WHXB 5E9DE 2V5SA 1CGUA 3IDIA 4OZIA 4FQHA 1P5UA 2IH3A 4X7TA 1XF1A 4G3YH 4MJIA 4M6OL 2VISB 4G5ZL 1BBJB 3F12B 3SGKA 2J8HA 3LQAH 1BECA 2WNGA 4PBWD 5KN5A 2JCCF 3H7LA 4HEME 3RZCC 4PJ7F 5I18H 3KNBA 1T20B 3HZMB 5K9OA 2X2YA 4IOIB 1S7RA 4MXVF 5I16A 5I1JH 3F7PC 2VQ1B 3PDGA 1I3GH 4YHNA 4RRPA 4X7SL 1A7RL 2DKSA 4G8GB 1NJ9B 1GZPB 4ZMAT 3QDGB 3CDGB 1AFVH 1L7IH 3A6CL 1RJLA 1WZKA 3R8BB 2V9TA 2FECI 1JZ4A 4UIMA 5D5MF 4OCSL 5IBUG 5KTEH 3S8WA 2CSPA 4LCUB 1JN6B 2FIRT 2VO5A 3B3IA 5LQBH 2VZ3A 5HVGB 4I4WB 5D7LE 4PJ5E 3UYPA 3O9WB 4JRYA 1RZKC 1U8MA 4MX7B 1RHFA 1TJHL 3HE7C 4J3XA 3B9KA 2HFFB 1G7HA 4NRXA 4Y4FB 4Y1AD 4LOUC 3QDJA 4NN5B 1XIWD 5ISZE 3HNSL 1DBAL 4XP9L 1NAKL 3WLWD 2FHBA 5MEPA 1KCRL 5I19H 3JV6A 4QXGL 1NC2B 3MLVL 4HH8A 4XXCC 3T0DA 2EE2A 3T4YA 3WFZA 5HGHB 1EZVX 3GEWB 4LLVB 5KJRH 3JUZA 1RUMH 3CVIL 1RZIB 1WGOA 5HHMB 5HGBA 1BJ1J 3IKCB 2FNBA 2CJUH 2W92A 2C3XA 3BGFB 3VGEA 4C4KO 3MACH 2ZUQC 4NNYB 3FONA 5JZ7D 1BD2B 4PUBL 3IU3A 5DDHA 2W60A 1I9EA 2MWCA 4JY5H 3GSOB 3GO1L 1EFQA 2IFFL 5DMJB 4R7DA 3REWA 3FQTB 2RR3A 4HXAH 2BOBA 3SE8H 3CAFA 2P5WD 5FYKH 4HK3J 1OY3B 3O0RL 4OCYH 1TCMA 5CJQL 1FORH 1A7QH 4KAQH 5GGVH 4DGYL 1WQVT 2OR9H 1VSCA 5IB5B 2C3WA 2PW1A 4U0QB 2HFGL 5ADOH 4FOMA 3DRTB 3V5KB 3WLBB 3QUXD 4YNYA 4WENB 1ZV5A 1A7BA 4G8GE 3QDGE 4HKBB 4HWBL 1FNGB 5GPRA 3OG6B 2DBLL 4PJXB 3UTSD 4Y4KA 3QHZH 3FB8B 4M8VA 3CSBA 1A64A 1TPXC 4FABL 1FNHA 3NFPB 1E4WH 3S96A 2I5YL 5I66B 2X1WL 3WL9B 2OTPA 4XNYL 2Z31B 4D0DA 1V05A 2NY4C 3BKCH 3ECBB 4PJFB 15C8L 4HIIA 4MA8H 5EH1A 3MRLB 1H5BB 4P9HL 2XRAL 4OGYH 4PGBA 5CZVL 1XGTB 1C5BL 3MRPA 5GGSB 3H9YA 4NHCH 5IFHL 3RWDA 4UZGA 3LS4L 2BERA 3L95B 1VFMA 4MB3A 3PNWB 1F45A 4KHTH 1FO0B 1Y6KR 1I9IH 3C5SB 5CCKH 5HHME 5I9QB 4PTUB 3SCMC 2EH7L 2NZIA 4KWUA 4NQTA 3VXTA 1XEDA 1A7PL 1X5GA 1SYSB 2L0DA 3ULVE 3VXME 4RA3A 4HWEH 5A3IC 3GMQA 1HSBB 3DTXB 3OZ9H 3WO4B 3MJ8A 5T1KB 3JWDC 3KPOB 4Y1AA 4KZEL 1F8TL 3WKMH 3MYJA 1ZSDB 1N5AA 3SKUD 4M1DL 4QRPB 2BX5A 4HUXA 5E7BA 1D9KD 2FL5A 2D2OA 3LVEA 3MREA 5LGJA 2FJGA 4GAYA 3MBXH 4NOFA 2FZ3A 4XRCB 2NY3B 4LK4A 3LMJL 3WNLA 4NO2A 3RP1A 2YSSA 1WAAA 3WD5L 2ENSA 4LCWE 4Z0XB 3TJHD 5D70H 2NLJB 1SY6A 1QP1A 4L9LA 4TOYH 3B6SA 4RWYH 1BLNB 2GJ6A 2HWZL 4PJXE 4LSRH 2CKBA 1OTSC 3QJHA 5C86A 2WBKA 3NCYP 1QTYT 4TPRH 3EZ8A 3LKSB 3FN3A 3U36B 4MB5A 5FUZL 5IVZB 3IXAB 1HH6A 4G80B 2GK0A 4YO0A 3GNML 1MCQA 1GGBL 4XP1L 5GS0L 3QO1B 4OD3L 3O3AA 2APVA 1RIHH 4LPUA 1EERB 3MLUH 4XPFH 4CW1B 4ENED 3MX0A 1J1PL 4RA0C 2GTZB 4JQVA 5KSUB 2JB5L 5ABDE 4EDXA 2Y6SD 3O4LB 3OKKA 3UO1L 2OMNA 1DZBA 4K07A 4ZS7H 4QO1A 1U3HA 2PYEB 4ZTOH 4WDIB 3UTSA 1T03L 4P5TB 2ZCKH 4XGZA 1H3PL 1J8KA 2NX5E 1FE8H 2OYPA 5C2UB 1A6VH 1N26A 1LVEA 1MCPL 3NABL 4APQD 1JGUL 4Z8FH 5BVPL 3P9MB 4ESKA 1IGJB 2IH1A 1NAMA 3ARRA 4XPBL 3NZ8A 2YEZB 1JGDA 5F6IB 5DTFB 1KGCE 4DKAA 2LV4A 1CXLA 2X4OB 3CXHK 3QCUL 4UDTA 4Z5RA 3P30L 5ADPH 4LP5A 3RVTC 1MCLA 2YZ1A 3P4MB 4JDTL 5DHVA 2A6DB 4I8DA 1OM3H 1GAFL 2OX5A 1KULA 1HQRA 2ATKB 1WISA 5E1AB 4G9DB 3JWNC 2APTA 4XT1C 1ZVHA 3MLYH 1MY5A 5ERWB 3B2VH 1RJCA 4J3VA 3D2UB 3IRPX 4ZODA 5EDXA 2H41A 2Z0BA 5EO9A 1BZQK 3ARGC 4OZGF 4Z7OE 2QSVA 1TENA 4HBCL 1K4CB 1VESA 5IMKA 3NCJL 1I9JL 5DK2A 1M7DA 1KIQB 1NDGB 4IDLA 1EO8H 2IQ9H 1FJ1A 1WC7B 4NO5B 4U1NB 1PLGL 3HUJF 4DZBB 1G6RA 3PG2A 1D9KA 5DVOA 4M62L 3IDIB 4PRID 2E27H 1EHNA 1UT9A 4AL8H 4N9OB 3OB0K 5FM5O 5D7IF 4FQHB 5JDSA 4HJ0D 5ICYA 2NXZB 32C2B 4DVRL 4JFXA 2D7OA 1MCNA 1ZLWK 2XWJB 3V4UL 1ADQL 4Z7UE 4HZAA 2M2DA 4ALAH 3KPRD 4Y2DB 3MRKB 5I8OL 5EC2B 5IJKA 5D2LF 4M48L 2HVKB 4U1KB 5KN5B 3GIVA 2PYEE 3KNBB 1A7OH 5FA4A 5C07E 4LEOB 1J9CT 3R06A 1QHPA 2ZOKB 3QIUD 5JHLL 5C0AE 2DQUL 4RGMC 3HC4L 5CINH 5KS9A 5K9JL 5L9DL 2F58L 3RX7A 3GMPB 4MXQC 2C7UA 3V5DA 4E42A 1FRGL 3SKJL 4LPXA 3C6SA 1FL5A 4UIMB 1KB5A 2AP2A 4H1LA 1U92A 1JNLL 1EGJL 3L3DA 3B3IB 1G7JB 1JPFB 4D0CB 4X4XB 1CDUA 4JM4H 1FBIH 4KQ3H 4PG2C 1GHFH 2WP3T 2VSDA 1C08B 2V9RA 3VFVA 3SDAC 2H8PB 4TNVF 2PKDA 2X7LB 3AY4C 1EV2E 3B9KB 4JFZL 4X6BA 4NRXB 1TVBB 1UA6H 7FABL 5BRZD 3VFPA 3GMLA 2ZP0T 3QDJB 1F90L 4BSWA 4FQ2H 2PUQT 3UPCA 1BREA 4ETYA 1P84K 5D71L 4H26A 2DN7A 3LB6D 4GG8B 4APQA 4U6VL 5JIHA 2IGFL 1WWBX 2EEBA 2YXFA 1WF5A 5JQ6L 1ZT1B 5H35A 2KBGA 3DXAE 5HGBB 5KOMC 1SJHA 5EBMB 2WZPD 1ZEAL 4GMTH 1RK0A 4EBQH 4NN7C 5INCB 2EIEA 3S34H 1CK0H 2BNRB 5HD8C 5DDHB 1VEOA 1WIPA 4OZIE 4XBGB 1QBLL 5IHUL 4TRPH 2QBWA 4MJIE 1ZHNB 3VE0A 3QA3A 1GCFA 6FABL 3REWB 3LKOB 4RBPK 2E8ZA 4TYUA 5E8PA 1U8QA 3TM6A 5BZWB 5F7UA 1CXIA 4GS7B 5C0IB 1QVOA 2VUOA 2VERN 4G8EA 4R97B 1NC4A 3D69A 2X4UB 1AXIB 1RVFH 2Y5TA 4K23L 1G7QB 1XMWA 4MCYA 4P2CG 1JTTA 4F58H 1PEZA 5HHXL 2FBJH 5IVNA 2DLGA 4Z0BL 2P7TA 5EG6C 2W9DH 3ZDZE 5ESVB 3BUYB 1ZMYA 4PRIA 1YEGH 3D9AH 4Y4KB 1A7NL 5IHZA 1INQB 5D7SL 1QFUL 5E24E 4K3JH 3WFDL 2OJEB 4YK4C 1PX4A 1I7TA 2BJMH 5ITBH 3KJ6L 4RAUA 4FTVA 4XNQA 4Q9QH 4JRYE 3A6BL 4O2FB 3ZSTA 1LDPH 3KPRA 1KT2B 4GW4B 4XBEH 5E5MB 1K5NB 3VFWB 1FL3B 1PGRB 2YPVH 2HJFB 1KYOK 1T7VA 5I8EB 4HH9A 4K3GA 4GAGL 3U6RA 4D0DB 4JFDD 4YX2H 4U1IA 4JY6A 2R4RL 4NUJB 1DCLA 1UWEH 3PHQA 3Q6GH 1CIUA 3QDJE 3QIUA 5B4MD 4FP8H 2BOCA 4AIXA 4PFEA 5AZEH 2V5RA 3RZCB 4JFFD 4PGBB 4X5XA 1KJ2A 3MRPB 2WK2A 4HFUL 4DQOL 4NQEB 4PJEB 1G7IA 1L6ZA 3DSFH 4M7LT 5E08L 1ZT4A 3EJYC 1PZ5A 1JZ2A 5F72S 1FIGH 1V3MA 3OHXA 5DXWA 4Q9RH 4KV5E 5CWSB 4OF8A 4QHMA 4OSUL 4QT5A 4E0RA 4TSBL 4EDWH 4MJ2A 1E4KC 1MCIA 5DJ6B 2IF7A 4WTZG 3AROA 3SDDA 3RL1A 6CGTA 2QHRL 2JJUA 3MO1A 3SKNA 4E9LA 3WXVL 1M71A 3WS6A 3AMLA 1YN7B 5BRZA 1N59A 5HVFB 1N5AB 2DM3A 3D39D 3TC9A 3HE7B 2HLFC 3IETA 1MNUH 4HUXB 4KROD 1PEWA 4XCFH 4R26L 2OBGA 5LGJB 3O4OB 1JNNH 3MOAL 4NO2B 4UAOC 3C08L 2YSSB 4ZS6D 1MUJA 4KK6C 3AS2A 3GKWH 4YEFA 4NQXA 1KPRB 1G1CA 1O0VA 4KFZC 5BV7C 1KJ3H 1V7NH 1JFQH 2W1NA 3CVHL 2GJ6B 1OP3K 4QHKI 3ZZ1A 4ODSH 4POUB 3D3VD 1GC1C 5BS0B 3ELAT 2IAND 4CN4A 3MLWH 5I17A 1FZKA 1TMCB 2DQCL 2OQJA 3O2WH 3Q5TA 2AW2A 3ULUD 1HH6B 5LGHH 3VRLE 2COQA 2MFNA 5FCSH 1HHKA 3O3AB 4HGWA 4HZLB 5E2TH 1PQZA 1E27A 2AJSL 3ZHLA 3MQIA 3T2NL 5DT1L 5TQ0L 2DM4A 2EKJA 12E8L 2Y06L 2FCBA 1K8DB 3MLRL 3DV6B 2NY5L 4W6YB 5ETUA 4OF7A 4XHJD 1U3HB 1WIUA 1FP5A 1RK1B 3X3FL 4QF1B 1JYNA 2XKNA 1MFAH 2WM0A 1G7PB 2XN9B 5BOPA 3K2MC 4Y88A 1BZ9A 5CZXC 3WFHA 4L9DA 4LFHD 5IR1A 2G9HA 3R0NA 1QFWL 4P9MH 3ZKSD 4RGNC 2PTTA 3K2UH 5E2VH 5F9OH 5FUCC 2PW2A 5T3ZH 3SGJA 3ZL4L 1YNLL 4ZFOA 1UXSA 3VXQB 4KC3B 2IH1B 1NAMB 3VD7A 3VA2C 4HK0A 4JFDA 4Y1AE 3QSKB 1JGDB 3V2AR 1JPTL 3RVWD 4UT7L 1CDBA 1V5JA 4HMCA 4WHYH 4JFFA 5DJXA 4Z5RB 2X9XA 1RUAH 3QI9C 3NFNB 5BXFB 3FFDA 4I77H 5IGXL 3BT2L 5GS0D 1WAAE 2AV1A 4L3ED 4NHUA 4DOHB 1ACYL 1MY7A 2JK5A 4G9FD 2AI0L 1DQLL 1OAUL 5CSBA 3NGBC 3NAAH 1NCCL 3MNWA 1N3NA 2GJ6E 1GOHA 2RIKA 3HRZB 1CIDA 3SCMB 4M5ZH 1RUKL 2EXWD 1M05B 2EYRA 4FG6D 5HHVL 4BQBA 1LEKA 1LO2H 5KSAD 1MAMH 2AEQH 4HWBA 4G7VL 3RGVD 4IIQC 3HPLB 4OJFL 4Z7WA 4D3CL 4GMSH 4XNXL 4UILH 1M7DB 3QIBA 1KIPB 4NCC2 1G6RB 5IT2L 4WWKD 2DQGL 3ARZA 4HC1L 1U8NA 4YE4L 3TV3L 2YD5A 1JGEA 4FQLL 4UNTA 1L6XA 3MRBA 4R4BA 5ACLA 3V6OC 4JFXB 4PRDA 1A1NA 5FO8A 3E6FA 3E8UL 3LEVL 4M43L 4L29A 2VMFA 2C1OA 4JRXD 4OD1L 4XAKE 2JIXA 3ZTJH 4Q0XL 3RQ3A 4Q97A 1CLOH 1KELL 4U3XA 1MFEH 5DJYB 3GIVB 5JORA 2PR4H 5B3NA 5I1AA 2HA1A 2FJFB 4JFED 1KXTB 5CFHA 1EJOH 5FA4B 3UTSE 4DUWA 3R06B 5FB8A 1IKNC 2ESVD 1F3DH 3DURB 3UDWC 2OS7A 3A67H 4JZJC 5ILTL 2C7UB 4H0GA 3TYGH 2SEBA 2I27N 3D85D 2BSRA 3G6JA 3IDYC 1FAIL 3SE3C 1PSKH 3MXWH 5IB2A 1FL5B 1CXEA 1KB5B 1KPUB 3FQNB 2J88H 4JFYA 2IWGA 3TESA 3FHQA 3K0WA 4N0RA 1NH6A 1P4IH 4PREA 1XR8B 3S5LA 1BFTA 5IFAH 2CO7B 4M6AA 4Y19A 2CGRL 5EOCH 2VXQL 3IDNA 3SDXA 3BDYH 4N1HB 5MEOB 3QWQB 4RMQA 3I6GB 1QR4A 4X6BB 2ICWA 1IFHL 1YY9C 4EQ3A 1EHAA 3GB7A 3VFPB 1J0KA 3GMLB 4DOHE 1JI2A 1PX3A 5KVMC 5I74B 2FEDD 5B39A 5HVWA 3CXHJ 2APXA 4JAMB 3V7MA 1GIGL 4CVWA 2L7UA 3ARXA 4JKLA 4LKCA 5L2KA 3LPFA 4EKXA 4LSUH 1CFQB 1S7TA 2OLDA 3H42L 4I3SL 4KXZI 1SJHB 2Q20A 4OI8A 3GMOA 2CDFB 3WIHL 5E2WH 1NCNA 4LHUD 5TE6H 4IMKC 4JM2C 4YHOL 3OV6A 3L7EB 5B8CB 1YPZA 2H2SC 3LEXA 3QG6B 4NWTL 4NRZB 2DS4A 4L3EA 1INEH 4ZUTA 4CN1A 4TNWK 1T0MB 1TJIL 2EIDA 3KPNB 3MOQA 1QVOB 3SKOA 5F88B 1LQSR 3T0EB 1NDMA 4UT6L 3RVXC 1NC4B 3D69B 4IRSC 4XPGL 3GJFB 1WTGT 4PY7A 3C09C 3C5JA 4MCYB 1ZGLA 4Z76A 1BEYH 4FZ8H 3BN9D 3UPRA 2FH8A 3OL2A 3RGVA 5DHYA 4HULB 1I9RH 43CAA 3F58H 4MDIA 5KS9E 1T1ZA 3WS3B 4FFVD 1IC5H 1QSVA 1Z9OA 4P46C 5E6YA 3MLZH 4YWGH 3MNZA 4Y5VC 4WHTB 4CU7A 3FB7B 3BYYA 5IHZB 3NTCH 3SO5A 4IDJH 3DO7A 1ACZA 4AENA 1I7TB 4P2OC 1WJ3A 1OT1A 4FTVB 5ID1A 5F9WC 3SDYL 1HEZA 5HDQH 4HUUA 3RWHA 3WDHA 4HS6B 4JFEA 4UMGA 4WU7B 4XH2A 3LDBC 3TBTB 5LJYH 2PF6A 4JFPB 3BKYH 4K8RH 4KH2A 3KHQA 4X5XB 2BNUA 2X4QA 1A8JH 3U4AA 1PVHA 5C09A 5J56B 5DD6A 4PJBB 3PABA 3MYZA 5J0BA 3RY6A 2EXYD 5KVGH 3ILPA 3BIBX 3MUZ1 5A16A 5I30L 4Y5XC 3EDFA 3LN5A 4D9LH 1P84J 3DLQR 4QT5B 4E0RB 4PRPD 1U8LA 3LKPB 1A3RH 3BP7B 4JVUA 1HSAA 3SDDB 1AJ7L 3TBSA 1ND0A 3RL1B 1S9YB 2AJYH 1A6WL 1BQHB 3MO1B 4KDWA 4NSKB 3VXUD 1YNKH 1Z9LA 1HYSC 1C5CH 4GXVL 5DMGC 4ELMA 1N59B 3UYRL 1IEBA 5F7DA 4ZTPH 1RURH 5KZCB 4EI6A 4ONFH 3IETB 4M7KL 5DWUH 4PJ9A 4NRYA 5DK3A 2DDQH 2ZSWA 1ADQA 4TUOA 3MCKA 1FO0H 2Y07H 3STZB 4JB9H 4MNGA 5M7QA 3U0PB 2UZXB 1W72L 3FJTA 1P9MC 1ZS8A 3SPVB 3OPZL 4OGXL 3ROLA 3U82B 4LARH 4LVOC 3KLAA 5DFTA 1XCQB 2Q8AL 5JR1L 2G75A 5JTWA 4NO3A 2GY5A 1XH3A 2UWEF 4RCAA 4PGZA 1JWSA 4JGJA 1Q9LA 1S7SA 1HDMA 4IHOA 4PRIE 4PLKD 5KW9L 3QUYB 4NN7B 4OQTH 1NCAH 3LKRB 5GJSL 3RWCB 5BO1H 4LLDA 1AKJB 4G3YL 3TVMD 4FTVE 4OM1H 3QQ3A 4MQXC 3KPRE 1IGCH 3M45A 1FN4B 3L3OB 3V6BR 1RZJH 1HHKB 1X7QA 4X8JB 4HGWB 2CLRA 3LQAL 5FHAH 1ZLVH 1YUHA 2YZ8A 4KK5D 5I18L 3QEQD 4LGPB 3IFNH 1A3QA 2HFEA 3KYKH 2H26A 1R3JB 5D4QA 1RIVH 1IKFL 2VABA 3QPQC 5I1JL 2EZ0C 2LU3A 1KYOJ 2AK1H 3THMH 5A2JH 3QUMA 5D1ZD 3SBWC 5BOZG 1AFVL 5T1MA 1L7IL 4KKCD 5CHNB 1BZ9B 3WFHB 5KTEL 3CMOL 4J3WA 1XF3A 3C9NB 4PY8J 2CR3A 5LQBL 2FHCA 4C56A 4ZFOB 2B0SH 5I8KH 4GXUM 1B3JA 2B1HH 4XX1E 1D5MA 4Z78A 5BRZE 1AI1L 3T3PE 1NEZG 1ERNA 2Y7QB 4JHWH 1X5JA 4PBVC 4POZD 5SWSB 2VKWA 4GH7B 2J8OA 4TSCH 2ZUSA 2BRRH 1YEIL 2IADA 4ODXB 2D7PA 5I19L 3RAJH 4O51B 3HR6A 1QA9A 5L6YH 4OLUL 2IBBA 1IGFH 3PWPB 3LD8B 2HT4C 5KJRL 3BQUB 4BH7A 1RUML 1JP5A 2IPUK 4XPTH 2FB4H 3QB7C 2KPNA 4PRPA 3MACL 1W8NA 4S2SA 1ZHLA 2P5EA 4OI9A 5IW6B 4M1CD 3WUWG 5IF0A 4JVWA 3VXUA 4WW1A 5IWLC 4ZXBC 4Y4HA 1RIUH 4PS4H 3HI5H 1U41A 2VXUH 1NFDA 4PJHF 3QIBB 3U2SA 3MJ9H 1S78D 2YRLA 5HYJB 4L5FH 5GGRA 4HXAL 5ENWA 3QXTA 5GIRA 4ZUUB 1T7ZA 5FYKL 2QEJA 3TNNA 4Q2ZB 5JW5A 1CDIA 1FORL 1ZHBB 2VITB 1A1NB 1HHJA 4KAQL 2DQJH 5GGVL 2IBGA 3E6FB 2OR9L 1YDPB 5JXEC 4X7FC 2C1OB 2UWEA 1Z0MA 2JIXB 5ADOL 2VR9A 4TN9A 4F15C 4UAOB 5HGDA 3TO2B 3V5HA 5JORB 5IQ9A 3H3BC 3TO4D 5DJCA 4Z18A 2IPKA 1XIWC 4NP4H 3NACH 5FB8B 3WLWC 3QWRD 25C8H 5IVXA 3QHZL 4QXTB 1SEBA 2X1QA 3PV6A 3L6FB 3Q2CA 2BSRB 4IOFD 1J88A 1IC7H 1E4WL 5IB2B 4O9HH 1NL0H 4JFYB 3B2UD 4JFDE 5C08D 5GGTA 4ZPTA 3SJVD 2A1WL 4PREB 2AJXL 3LRHA 4MB4A 3S5LB 3BKCL 2OL3B 4JFFE 5J7CC 4Y19B 5C6WH 4MA8L 1H9VA 3SDXB 3I6LE 3MV8B 5JQHC 5FA3A 2QL1A 1UENA 1RY7B 4P5MB 2CIIB 3FOLA 3MNVB 3AB0C 3QXVA 2FEEI 2VQUA 3RZWA 1NEZB 2VJXA 4JQXA 4KHTL 2DTMH 5B39B 1KN2H 1I9IL 3ZO0A 2P43B 4FRWA 5CCKL 5DUPH 1YJDH 3FQUB 4LLAA 1VA9A 2IG2H 3JV5A 5C8JA 3QFJD 3DX9B 1AGEA 1BJMA 4LKCB 3ZE2F 5L2KB 5IMLA 3QUXC 4K3EH 3CVHA 3VDBA 4RGNB 3QT2A 4Z7WE 3DX6A 3O11A 3QXAA 3OZ9L 5EU6A 3GMOB 3VRJB 3FT3A 3WKML 4JPVH 3ZDXE 3D0VB 1IL1B 3ABZA 4YDKH 4Z9KB 5EUOB 3RA7L 5CD3A 1GRWA 3MBXL 5E1HB 5GRJH 4XP5H 1NBZA 3OJDA 5CUSH 1MCHA 2UY7A 2KQNA 3FFCD 5ACZA 5D70L 2NY0D 3PDDA 4UOW1 4TOYL 4PY7B 5HGGS 3HMWH 3ARYA 4RWYL 1ZGLB 1CLZH 4MAUH 4G6JH 3UPRB 5DHYB 3NGBB 4LSRL 5GHWL 1UB6A 2PETA 2Z8VC 4AM0B 3ULUE 4TPRL 2EDDA 4IIQB 4QXUH 3G6JE 2CIKA 1V3KA 1F11A 2P24A 3O2VH 1MJJA 4K3DL 3ZLQC 3DO7B 3PP4H 2IMMA 5E6ZA 3HC3H 3RTQB 4AENB 3D18A 1S8DB 5ID1B 3ZTNL 3MLUL 4XPFL 3B83A 4Y19E 5DJZB 2AJVH 3SDXE 1NGXB 4J3OC 2BC4B 3I3DA 3EFDH 3RWHB 3UBXB 2DJ4A 4XH2B 4ZS7L 1J11A 4ZTOL 3QWRA 4FXGA 3NCFB 2KZWA 5SWZB 1PG7X 2B2XH 2ZCKL 2BNUB 2X4QB 4PGCB 2LVEA 3DHMA 3MRRA 1FE8L 5C09B 5DD6B 3DUHA 3TJHC 5L2KE 1HYRC 4P3CL 2ADIA 5IEHA 5MHSE 5DRZB 3WFBH 3VWKD 3HI1A 3MV7D 4JZJB 3UBXI 4BQ8A 3ZSSA 3DUSB 3O2DH 5A16B 3IDYB 4QGYA 3SJVA 3LN5B 4D9QD 1D5XA 3B9EA 1JIBA 1IGMH 1U91A 1EMTH 3B8YA 1U8LB 4QNPE 3ARFA 3IYLW 1FZOB 4M03A 3TBSB 1ZLUH 4IOSD 2AXHA 3MRNB 3PF2A 5DVLA 5ADPL 1YPZE 4GRLC 1KXQE 5EA0H 1ORSB 3RWEA 4ELMB 4HGKC 4L3EE 4MA3A 1G9NC 3P40A 4EI6B 5HTSA 3FO9B 3CDFA 4PJ9B 2OXGA 5DSCB 1GL4B 3MLYL 4UU9A 1JWMA 1X4YA 1A6UH 2A38A 3B2VL 1T1YB 2Y6SC 1ZS8B 1QACA 4WUKH 2DB8A 4Y16D 2VLKD 3KLAB 4QRQA 1QG3A 1MRDH 1T89A 2DTSA 2LU4A 1XH3B 3ES6A 1JWSB 1EO8L 2IQ9L 5KVFH 5I1DA 4QRUA 4NWUH 2HG5B 3MTRA 3GMRA 4YDIH 1RZKH 4C59B 4WW2F 2E27L 3MRCA 4AL8L 2E6JA 3GSXB 3ARVA 4LLDB 4S1DC 1QSZA 4YHLL 4YAQA 4X5WA 3F7VA 3CSYB 4WWID 3TBVB 2YPLA 3BYTA 1X7QB 3QNYB 1WCBA 4ALAL 3RWIB 2BK8A 4JFEE 1PFCA 3B5TA 2O5YL 5FOJA 2CKNA 4K9EL 3IDJA 1EVTC 5IEKA 1SY6H 4LLMB 4IRSB 4QHUB 3TJEH 4R4ND 3VFOA 1TZHB 3C09B 3QNXB 5CINL 3G08A 5C09E 1DQJA 3GGWA 4O58H 5GSRA 4P2RB 2XZQH 4HUNB 1JPSH 4LVNC 2DLTA 3C8KB 5EC1B 1UZ8B 3AU1B 1XF3B 4MNQD 1WBZB 4C56B 1NUDA 2YA2A 3EJJX 4JM4L 1A6TA 1FBIL 4GRWB 4UV7H 1GHFL 1X4ZA 2FJHB 1JHKH 4P2OB 1I1YA 1U8KA 2FO4A 4ELME 4RNRA 1UA6L 4PJAA 3PE9A 1OCWH 5HI5D 5F89B 5C0DB 1I1AD 1J0IA 1H3TA 1YZZA 3KPLA 1HILA 2QKIA 2V2XB 4GG6B 3DHJA 5HHOA 4MNGE 4QY8A 4PLJD 3BUTA 4X6DF 5TGBB 5AEAA 3BZDA 1KLUB 5F21B 3O41B 1FFPB 2OXHA 3BOVA 3RPIA 1QEWA 1X5IA 4BH7B 1I7ZB 3F7QA 1DQDH 4PJCA 2DQHH 4GMTL 4K7PX 4MAYD 4S2SB 1ZHLB 4ZOBA 2P5EB 4EBQL 3S34L 4KKLD 4Y5XB 1CK0L 2VLJD 5IFJB 4TRPL 1PY9A 4KKAD 4B0MM 3CZJA 4DAGH 1A0QH 4ODHH 4XP4H 1K3ZA 1NFDB 4JFHD 1X5ZA 1CD1B 4TSAL 5GGRB 3WJJA 2OZ4A 4XCCH 4ONOA 5CBAA 3TNNB 5JW5B 3GUTA 2PXYD 1MQ8A 3GSNB 5IOPA 1TNMA 1NMAH 1RVFL 3W39A 4XMPH 1UH2A 5HHQA 1X5XA 4Y16A 4YFLI 2VLKA 2YD3A 2E7HA 3RPKA 4F58L 1JPST 2FBJL 3DMMD 3WS6C 3V5HB 1YY8A 1T6WA 5T1LD 1YEKL 2NY1C 1MCEA 5DJCB 4WW2A 1T22B 3OXRA 2W9DL 2CUIA 4R96A 4IRJA 4PG9A 4TVPH 3G5YA 2R2HA 3VRIB 2ITDA 3Q3GA 3D9AL 2BZDA 2R8SH 1R3HA 3HPJA 1G6RH 4L8SA 1R5VA 2BNQA 1SEBB 4K3JL 1YEDB 3MBEA 3ARBD 4L3AA 2RJMA 4C56E 4NO0A 2BJML 5FDWA 5ITBL 1GOGA 2WLZA 1XF5A 5DMYA 5E2JA 4XBEL 2YPVL 1BJ8A 3WN5A 4FQPA 4XB8A 4CVZB 1MRCH 2D0GA 4ZPTB 2Z4QA 4YX2L 1QYGH 1T04A 1UWEL 3VJ6A 4DN4H 2OJZH 1QSED 4R0LA 2V2WB 1C12B 5AZEL 1CZ8H 1NGPL 4NKIH 2MHAB 3VCLA 1CFVH 3U7YH 1U8PA 1MAKA 4JDVA 3RVVD 5FYKD 1YNTA 1JE6A 1INDH 3DSFL 3KLHD 4PPTA 4YPGA 5MP6H 5H37H 1T6VN 3IAGC 3BPCA 4P0DA 4PRPE 1FIGL 2B8OT 4FHBD 4Q9RL 5JOFA 1AXTL 5C8JB 1KB5H 3CLFH 2P5EE 2ZUWA 5D7KD 4BSVB 4KJPD 1Z0NA 3VXUE 3DX6B 3QXAB 4RMTA 5EU6B 2B20A 4MXWH 1UACH 1NFDE 4IM8A 4NM4H 3CX5K 4OGAD 4GJTB 3ALPA 4F37F 2GT9A 3MSPA 1Y0LA 3AS3A 1MFBL 4XCFL 2WWKT 4ETQA 1YEHH 5DD1H 2WBJD 1IMHC 1JNNL 2EKSB 1QQDA 3SGJC 4EVNA 4LLQB 1NBZB 2JJSA 3QFDA 2UWEE 3DGGB 5FM8A 3GKWL 3EOYG 5F8RC 1A3LH 5A43C 5IB1A 4MAYA 1U2HA 2JCCB 5B4MC 2XWTA 1FLRL 1KJ3L 3O6FD 1V7NL 1JFQL 2VAJA 3NPSC 4F3FA 2OTWB 4ODSL 2VLJA 2EDWA 5IVXE 1SYVA 5DURD 3OKDA 2IPTH 3MLWL 5FGBA 2X89D 1W8OA 2DIAA 2GSGA 4NZTH 3BN3B 3O2WL 1VGKA 3DWTA 4HX1A 3OF6A 1IZJA 4ZXBB 4DCQB 4CGTA 1NGWB 5JA9A 1F11B 2P24B 5LGHL 1KB9J 2PXYA 1MJJB 4BK5A 1SJXA 3PDOA 1RJYA 5E2TL 3EDDA 2PO6D 3D18B 4XNMA 1CI5A 5DVMA 3KPTA 3RNKB 4PRNA 3Q6FA 3IS1X 3VGBA 4Y5YC 2QSQA 3G04B 2AJ3A 2X4PB 4NZUH 5EOTA 4UBDC 3GJFH 4AEFA 2C4XA 4U6XA 4KGJA 1IAII 1KF9B 3QCTH 4OTXH 3BSZH 3UP1A 4PR5B 4KROC 3EYOA 2VXTL 1JF6A 4I5BA 2EDXA 2EC8A 4DEPC 4XNUH 4E5XB 1GPOL 1XIWB 1XGRA 3TH3T 4ZS6C 5GRYA 4K3HA 3S4SG 4P9ML 5E2VL 3K2UL 5IEHB 2BSTA 4OLZH 5T3ZL 5F70A 5T5FL 3HI1B 5DQJB 1WBXA 4LLUB 5EU6E 2P8MA 2ARWA 3W9EA 4I48A 3TH4T 5F3HA 1YMMD 4GW5A 1CCZA 3V4PH 2K1MA 1RUAL 3RWEB 1EO5A 2ZCHH 4MA3B 3IAPA 4HJGB 1P4BH 3P9LB 4I77L 1HQ4B 2FGWL 4ZYKA 3BPOC 4NQSA 5LVEA 5CSGA 5DJ8A 5B38B 1Q0YH 5EN2A 4NFBA 4LPTA 3MROA 3S35H 3BPLC 1MIMH 2IQAA 5D7JA 4J4PD 4IS6B 3NAAL 1TVHA 5FGRA 3WNMA 4FQJL 4M5ZL 1LO2L 1MAML 2AEQL 4P23C 1VFOA 4JN2A 3P77B 4GMSL 3ES6B 4UILL 3BEWB 1Q0XH 1LEGB 4H25B 1D5BB 4JANB 2DQFA 3OGOE 1G7LB 4QOKD 2A9NL 4HKJB 3U9UB 2CMRH 3QDMD 1FNFA 4GKSA 5EZJB 4H1LG 3BDXA 3F7VB 1JZ5A 1T4KA 2YPLB 4U1LA 4XC1H 1WCBB 1C5DA 3KG5A 3RVWC 3VMPA 2GI7A 1MFEL 1KENH 2R56H 2XICA 2PR4L 3IDJB 4W70A 4ONGH 3DPBA 2B1AH 5I75C 1AR1D 4ZUWA 1EJOL 4MJ4A 2XNAB 3TYFA 4NFCA 1CBVL 3EOAA 1FHGA 3WIFB 2X89A 5CJ8A 1MCBA 5KSVA 1B0RA 1MHCA 3ALWA 5GS0C 3GGWB 2J8UF 1A9BB 4N0FB 1OAKL 1R24A 5GSRB 3TYGL 1F4XH 2G5BB 4WCYH 5K9KB 1PSKL 4G43A 4WO4A 3MXWL 1OQXA 2WUCL 5BJTA 1V8HA 5ESQA 1MVUA 4UINH 3SJVE 2PO6A 1IM9A 5D1QB 2OK0H 5HHNA 4FG6C 4WI8A 5I8CA 5KSAC 1P4IL 1OP5H 1QR1A 1JF1A 3FT2A 2FECL 5EOCL 3RRQA 1LK2A 2I26N 3LQMA 3BDYL 4P49A 5J13C 2A83B 5TPWH 2FX8H 4WWKC 1G7MB 4PJAB 1MHHA 4YQXH 3NPZB 1E6JH 3EJZD 4OF0A 3RBSA 2Q1EA 4JPWH 5ELIA 3EYUL 4QY8B 5HHOB 2ZUVA 4KUZH 1S9KC 4HIHA 5KANG 3V79C 2YC1A 4PV8A 3NIDF 3RPIB 3X3GH 2P48B 4LSUL 4M93B 4WFFD 3HCVA 1F4YH 1T66D 1QFHA 4KVCH 1I3RA 2HH0H 4PJGB 2AJUH 1UWXH 1YMMA 4QHLA 2ZOLB 5E2WL 3ET9F 2GCYA 1H0DB 4P2QB 4PV9B 2DKUA 4AEIH 1ROWA 5TE6L 2WWMD 2ZNWA 3V4VH 3BW9A 4N8VA 4UQ3A 4WY7H 4YHPA 3TGXA 5DO2D 5DD0H 1UG9A 3QWOA 4WGVB 3RUGF 2IAMA 3U7WH 1DUZA 1KG0B 3UTZB 1INEL 1I8KA 3D25A 1F5WA 3HG1A 4GRLB 2YPLE 5H2BB 3KDMB 1D6EA 1H3UA 3O45A 4L4TD 3EOBA 2AV7A 5CSZB 4HGMA 4HUWB 1SJEA 4YDLC 3TF7C 4MD0B 1I85C 4XI5D 3CNKA 1I9RL 1CE6B 3RI5F 3F58L 3ULVL 3BPNC 2L4OA 4GAFB 1IC5L 1HXYA 3GDBA 1SVCP 2VC2H 4F7EA 2DWEB 3VW3H 5GRWA 2B4CH 1BZ7A 3OR7A 4YWGL 4QRSA 5IM7A 2YBRB 4R3SB 2FEDC 1MJ7H 1OGAB 3CPLA 2RFXA 4MD4A 3STBA 4QOKA 3DX8B 3ZHDA 2ZG3A 2R2EB 2Q8BH 3OJ2C 5F3BB 1R5VB 4IDJL 1OGTB 3MBEB 5C0EB 1A1MB 2VL5B 4WV1C 4NO0B 3PGFH 2CRMA 2GITA 1XF5B 4HJJL 2X4RA 4Z6AT 1DE4A 1OW0A 4D9RE 5HDQL 4MNHA 5FYJH 2Z4QB 4PJAE 4R0LB 4XX1G 3BKYL 1DLHA 3TA3B 1ZWIA 5HHOE 3VFUA 5DMKA 2HT3C 4P57A 3F5WB 3QIWD 3L5WB 1GC1H 5KVGL 3T0VA 2F53B 3QNZB 4YPGB 3MRHB 4LF3B 5C0JB 4MMXC 4D9QE 1ZANH 2PYFA 4XTRD 2QLVB 1MI5D 1R3LA 2JKXA 4PJCE 4QEGA 3BN9C 4D9LL 1S9XA 4H5SA 3HZYA 5DD5H 1A3RL 3W9DB 3P9WB 4X6EB 5CEXA 1BF2A 1AE6H 1WT5A 2AJYL 1MJ8H 5GS3A 2OL3H 1YNKL 5D6DA 1KUMA 4OCXH 4DKDC 4DVBB 1EHLL 2R1XB 4IJ3C 4F57H 3IGAA 5GZOD 4ZTPL 5I1EH 1RURL 4ONFL 4YZFF 1Y0LB 3UTQA 5KSBF 1U2CA 5DWUL 1AD9A 4LSVH 5TE4H 2IJ0C 3WHE0 2DDQL 5CJXA 1NCWH 5ALBH 1ULVA 4JB9L 3QFDB 2VLKE 3O8XD 2I9TA 1AIFB 4ZD3H 2I25N 1U0QA 1MPAL 1JNHB 4LARL 3TPKA 4YFEA 5EO0A 2BY1A 3BFOA 3DYMA 3M07A 1F3JA 4H8WL 1VGEH 5DLMH 1G0DA 2LQRA 3RUGA 4I0PD 1N6UA 4OZFG 2BNQE 4WFHD 5L8KB 1NCAL 5I73C 2ZUYA 2MNUA 5BO1L 2EXYC 3FZUD 4HX1B 1X3DA 4OM1L 4JG1H 3BRDA 1IGCL 3BH8A 4U6YA 4V1DB 5GJTH 1Q94B 1RZJL 1KC5H 3MPCA 3HE6A 5DA4A 1RJYB 4FQCH 3LRGA 1WFTA 5IVOA 3Q5YA 5FHAL 5DC9B 5F1IA 4ZG1A 4LGRB 2AJ3B 1CYGA 3OGCB 1MHPH 2HJLA 3IFNL 1UKTA 3BKJH 5DR5H 3KYKL 5E8OA 4PJDA 1N8ZA 5GRVK 1KOAA 2W07A 3BJLA 1QBBA 3THML 3UCRA 2C3VA 1NBYA 3QXWA 3IDMB 1LK3H 2Z8WC 2NY1B 4M9OA 2VN7A 1CS6A 1FCCA 1XGRB 2QR0B 1WZ1H 3N0PB 4CBPA 1KEMH 3K4AA 3T1FA 2BSTB 3FO1A 1ZLSL 3LCYA 3G6AA 4E41D 1D5ZA 3DI3B 2B0SL 5I8KL 1UVQA 4XVSH 5ICZA 3H0TB 2P8MB 1X6LA 2B1HL 4YR6B 5J1AA 4OD2B 2BVPB 4PLKC 4JHWL 2QHLA 3VXOB 3BP4A 3QDHA 1CU4H 1HINH 1VCAA 4X6CB 3TVMC 3G5VA 1CVSC 1ZK9A 2VIRB 5I71B 1CFNA 3QIWA 3VI3F 3RAJL 5L6YL 4ZYKB 4NQSB 5DJ8B 3CU1A 1IGFL 3MGTA 5EN2B 1U93B 3KJ4C 3VGDA 3ZE0F 4H88H 2JELL 4KK5C 4HSQA 3MR9B 2AK4A 2IQAB 2FB4L 1FZMB 4U1GC 4DKEH 5EUKA 3G5ZA 1TVHB 5INDA 2VLJE 2Y5EA 4LGSB 5E4EC 1R5IA 3CCHB 4P59L 4JN2B 1EZVY 5D1ZC 1RIUL 4AIZA 4PS4L 4XVUC 3HI5L 2VXUL 4PJ8D 2A6JB 1N4XH 3MJ9L 3TBYA 4L5FL 2DQFB 5E4IA 4OZFB 5E9DD 1AC6A 5AG9A 5CJOL 5EORH 5TE7H 5T3ZD 5J89A 4OIAA 1H8OA 5K59E 4EQ2A 2DQJL 5HY9A 3HKFA 2CUMA 5HI3C 3AAZA 4J7RA 4OLEA 5LG1A 4U1HA 2AXGB 3QISA 1CQKA 4R9HA 1B2WH 3CMGA 3O6KH 2JJTA 5D1XC 2E8YA 1IAMA 2HP4A 4HIJB 3BI9X 2A9MH 3TBWB 1JZ8A 4WU5A 1LP9B 3NCMA 4I0PA 2EE9A 3NACL 2CH8A 4MJ5A 1N7MH 25C8L 5IMMA 5MERB 4F7MA 1EO7A 3SE4A 1EAJA 4KHXL 4LFHG 3RY4A 5J6GA 1CICB 4HWUA 4WO4B 1IC7L 2DWDB 2CRZA 5BJTB 4O9HL 3H2WA 3UTPD 4LCCA 2Q86A 1IM9B 4LSTH 4NQVA 2EDTA 4QLRA 3MFFA 5I8CB 4L8CA 5AD0A 3FOMB 5JDJA 4Z7VB 4F7CB 1LE5A 3BEVA 2C1PB 1QR1B 1JF1B 3FT2B 4PJ5D 1MHEA 1LK2B 3DOSA 3L5IA 4P4KC 4ODTH 1EA9C 5JIPA 1S78C 5FYKE 4KGLA 1CT8A 1MHHB 1PYWA 4F33A 5JHDD 4G7YL 3JTTA 3T2OA 4L4VB 4A6YB 2EH8H 3L3GB 2DTML 2G60L 4YIQB 1KN2L 3TT3H 1DEEB 5DUPL 1YJDL 3K8KA 3FB6B 4PP2B 2NY2C 4LQ1A 4DEPB 4HIHB 2IG2L 4E41A 5FYLH 4GRMB 4K3EL 1DBKL 3TO4C 4GRWH 2X4NB 5CZKA 5ANMB 3QO0A 2CO6B 5DEZA 4R7NA 5FO7A 4IRZH 3AM8A 1MCDA 1J1OL 4QHLB 1BM3H 2GCYB 2R39A 5JLZA 2R0KH 3QUZC 1T3FB 3UTTB 4YHPB 4YDKL 4UQ3B 3QWOB 3GK8H 2IAMB 3AREC 5I1IH 4CNIB 3K4ZA 3P4LA 3DETD 4JPIA 1G84A 1I8KB 3D25B 5GRJL 3IDGA 1D6EB 3CDCA 4FFZH 1JV5A 1AP2A 2AV7B 3DRQA 4EEEA 1SJEB 4Y0GA 1QD0A 3IF1A 2H9GA 4YC2B 2O5ZH 3HMWL 1S9WA 4M00A 1FYTA 1XR9A 3SKMB 1CLZL 2XG5A 4MAUL 1UEMA 2XTJC 3GMMA 3I85A 3JXAA 1YN6A 1SJVA 2PCPA 1I7UB 2C3HA 4ODWA 4PJ8A 1BZ7B 4P23B 4QRSB 5IM7B 5L8LB 4G8GD 4QXUL 3QDGD 1DLFL 3M8OH 3BO8B 5T5NF 3MLPA 2A6IA 5I76A 4TUKH 1IBGH 3E3QE 3O2VL 2YR3A 2QJDA 4NYLA 2HRPH 4OZ4A 4BSJA 3PP4L 2VLRA 3HC3L 1A4KB 5CD5D 2X4RB 3Q5OA 3JTSB 3LS5H 5EU5A 4QRRA 4CL7A 1NGQH 3GSNH 3O9WD 2AJVL 5TQ2H 3BZEA 5DJAA 3EFDL 4M8QA 4RIRA 3E6HB 3S88H 2V5TA 3GJEA 3B5HA 4Y4FD 1AQDB 5CMAA 1PKQA 4GO6B 2B2XL 1ZWIB 5I75B 3EYFB 1KCUH 2EYTA 1BAFH 3CD4A 3VFUB 1NC2D 1BWWA 1Q9WB 2ICES 2NY0C 3PWNA 4U7SA 5DYOB 3WFBL 4I2XB 1VKXA 2FLBT 2PYFB 3I02A 4FQXC 5HHMD 4BKLB 3RKPA 5CEYB 4G9FB 1YMME 4H5SB 4WUUB 2H3NB 1IGML 3HZYB 5ID0A 1HI6B 2LTQC 5CEXB 4EI5A 2CK0L 3ULVD 1BD2D 3KYNA 3VFTB 4M61B 4LHUG 3ULVF 2VDPH 3Q48A 1DANT 4RFOH 2GSIB 5EA0L 5JHDA 1GH7A 3HG1E 5ICXA 5J13B 5FAAA 5DJ2B 4EUPG 5SWQB 3REVB 5C0CA 3UTQB 3PJSB 4ELKA 5HJ3B 4LBEA 1A6UL 1J0HA 3QXUA 2WIIA 1QKZH 4JY4A 1BJ1H 1BVKB 4WUKL 2DIJA 3C6LC 4U1SB 1CXFA 4JRXB 3QQ4B 4OV5A 3T04D 4P48A 1OAQH 4QYOA 3F7YA 5CILH 4X9FA 43C9A 4K8RD 3V0VB 1JWUB 3D1MC 4NWUL 4JLRA 4QOKE 4YDIL 5HYSB 1RZKL 5D96C 4HW6A 5ECJE 4PJXF 3PQYA 3HLAA 3VWKC 4G6AD 2CRYA 5FIEA 2YUXA 3U79A 4AH2B 3F12A 2YPKA 2AABH 2XY2A 3BAEL 4FXKA 3H7BB 4G6MH 3HE6B 1AHWC 1Q38A 2Z31D 1EEQA 3QH3A 1T20A 3HZMA 3S37H 2H6PB 3KYOB 4IOIA 1SY6L 1YEFL 5F7NC 1LNUA 4PJDB 4XAWH 3TJEL 1N8ZB 3QAZB 4N0YH 4NZDA 1P2CB 3P2TA 3U9PH 2VQ1A 4KY1H 4NKDA 5IK3B 1NCBL 1NJ9A 1GZPA 2VKXA 2X9WA 4O58L 1NBYB 3PGCB 3CC5A 3ARPA 3UJTH 1JPSL 4RISH 3UYOD 4ZAKA 2NYYC 1IAIH 4LRNH 4OBSA 5IBLD 1JN6A 4JN1H 3GSRA 3MUJA 4I4WA 3U1SH 4OM0L 2AEPH 4UV7L 5DVNA 5ICZB 1UVQB 1YC7A 3BMWA 1JZ7A 5T3XH 4WV1B 4RZCA 1JHKL 3RHWF 1I3VA 2HFFA 5DA0B 5T1KD 5J1AB 2D7MA 5GRUH 5LWYH 5IKCB 5IMOB 4L8BB 1KGCD 3BIAX 1OCWL 3UPAA 4QRPD 2YUWA 5DRXB 3V95A 1PG7L 1I8IA 3MMEA 3NIGE 2HMID 3QRFM 1CF8H 3NIDE 3RDTC 2BVQB 2HVJB 1CFNB 4A2MA 1ZVSB 4NPYA 5EO1B 3E1F1 4EUPB 1P5VA 1IC4H 5HGHA 4MJ6A 2VZ1A 3MGTB 2R0ZH 4OZHB 3KGRA 2KKQA 2QQKH 1YQVH 2AK4B 1DQDL 4S10A 1NAML 5EUKB 2DQHL 1BD2A 2MPAH 3RUGE 2B39A 4UNUA 1J5OH 2WV3A 3GSOA 3CFKB 5GS1A 4Z7OF 4NOBA 1PD6A 4DAGL 4K94H 1A0QL 4ODHL 1IAIM 4CJ1A 5IBTH 3MJGX 3B5GA 3QUKB 4IJ3B 4XCCL 1RMFL 3X12A 4XWOD 3FRPG 8FABB 1JYVA 4DFIA 5T33H 1NMAL 4XMPL 2X4TA 4PJDE 3AAZB 3O3BB 4ONHB 3V5KA 3LKNA 1RZ7H 2P44B 3O4LD 4N5EC 1I1AC 4WU5B 2Z93B 1H3XA 4JZNB 2PYED 4NJ9H 4TVPL 5EZLB 3UEZA 4MJ5B 4P5TD 4PLJC 4DW2H 2R8SL 1NLBH 2P1YA 1G6RL 5C0AD 3UTOA 3HHRB 2MKLC 2YD7A 1EX0A 2JJSC 3HFMH 5J6GB 3P0VH 2FATH 1NMBH 3PUCA 3WNNA 2KDGA 5I66A 4LCCB 4JKKA 4MA7H 4MAYC 4RFNC 2Z31A 4U31A 4X4ZA 4LNVA 3MFFB 4KKLC 1MRCL 4L8DA 1HWHB 4LPWA 2VAAA 4XMKH 1CDGA 3U4BH 1FG9C 4PJFA 5DMIH 1LE5B 1RV6X 4DN4L 2OJZL 3MRLA 1U9KA 4KKAC 1H5BA 4WRLA 1MHEB 5HPMB 1MCOH 3PWUB 3ARWA 1XGTA 5IJVA 1Z2KA 3TZVB 5GGSA 1S7QA 3MRFB 4PY8I 4NKIL 4PGDB 4M02A 4X8XA 3L95A 3ZKNC 2H45A 1NMCC 2HT2D 4F33B 1TVDA 3PNWA 1IT9H 4URTB 3Q1SH 1FO0A 1INDL 1M4KA 5MP6L 4X5LA 4PTUA 2H32A 5F7YC 2GJZB 2AK4E 1K85A 4F9PA 1DL7H 4YXHH 5AZ2H