2R23A

Crystal structure of s25-2 fab in complex with kdo analogues
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
217
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, antibody fragment (IgG1k), light chain
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r23A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r23A01
4JFED 4F7PB 3FFCB 4Z8FL 3SE9L 2EXYC 2RR3A 4NO2A 4N9OB 1RPQA 4LLYA 3ZTJH 3BD5A 4FQ1H 4YHMH 1MFCH 3HR5A 3C09C 3QWQB 5F21B 2VLJE 2R15A 4OF7A 4U1KA 4X5WA 1FNFA 4PJCB 5JOFB 1QR4A 2FEEI 1ULVA 3VGBA 1YEFL 2Y6SD 2UWEF 5J06A 2OTUB 2P43B 3F58L 5DJ0B 2AQ3A 1NCBL 1Q72L 4Q9RH 4L3ED 1M7XA 3QEQD 1WZ1H 5I1AA 4Y19B 3BEVA 1FYTD 3RL1A 3QCVH 4OI9A 3MUGA 5CEZE 2NY2C 1XGUB 2GCYA 5E00B 3MV8D 4AEFA 3FZUC 1KPUB 3TT3H 3BXNA 3VU2A 3RDTD 1MLBA 3WIFB 1DDHA 1A22B 1DBAL 1TVHA 1W72B 3P77A 3EJZD 4NZTH 4D9RE 3EFDL 4DN3H 5C9KA 1HI6B 4XHQA 1MRDL 4P9ML 1KLGA 1CGTA 4ZYKB 4E0RB 4YPGB 4KQ3L 2XTJB 2VXVH 5DR5L 5TDNB 4Y5XA 2BNQE 2XKUA 3Q5OA 2X9WA 1XF4B 1GJIA 1TJIH 4QRUA 4JANA 4J3VA 1FAKT 3TFKC 4JZOA 3FONA 4FFZH 1IJ9A 3QZWG 3B3IA 1XCQB 4M8VA 1AE6H 3O2DH 1GGCH 4Y2DB 5CZVH 5DLMH 2E9BA 2VC2L 3QUMA 4ZUSB 5CWSA 4HF5L 3I2CL 2XWJB 3BIAX 3WLBA 3QUXC 5BZDA 1IAKB 1BQHB 4YDJB 4Z7UA 1I1YB 5IG7B 4ZAKB 5IVNA 1HILB 3VXTA 2X4RA 3GI9H 4Z0BH 4XVUD 1AR2A 3V5KA 4M02A 2V2XB 1S78D 1FBIL 3QFDA 5CEYB 4HUNB 1F4WH 5DDHA 1OAZL 4G8GA 4I0PA 4F7TB 4JN2A 2MQCA 1HH6A 3UJIL 2Y72A 3P73A 2BP3A 1Q0XH 3RGVD 5EWIL 4FP8L 1K2DA 3R8QA 1HINH 1I3UA 4BH7B 2NY4B 4I18B 2ZOKA 3ROOB 3BUTA 1YMMA 1P53A 1MAML 4POZD 1NCAH 2DLFH 3FT4A 1YN6A 3K80A 2IMMA 4LCUB 4JG1L 1G7QA 2W9EL 3M1BB 5EN2B 3MXWL 5INDA 3SEPA 2C26A 5IOPB 4JE4B 5FEBA 3EYUL 3CZFB 3G6DL 4NKQB 1UJ3C 3RIFK 3T3MF 1MCHA 3U0PA 4PJEE 4JQIL 1KLFA 5H94B 1QSFD 1MLCA 1W0WB 2XZQH 2BJMH 5DI8B 2I60L 1KF9B 5LGJB 4NQEE 1C5DA 4MD4B 5T33H 5HJ3A 1PYWA 3TWCL 2HJFB 3MRNB 5I2IA 3I50H 1SVCP 1A3LL 3LVEA 1JFQH 1CGVA 3NFSH 2Z8VC 1FO0L 5D7LB 2BNRE 2YXMA 4AH2A 1P4LA 1UWGH 3VFVA 2AXFA 1LEGA 3L9RA 2J3SA 3ZKND 2PCPA 4GKSB 5D96B 1BGXH 5DJYA 4HJGB 4KMTL 4YAQA 2WINB 4WW2F 4UV4H 3GHEH 3QXDB 3I75A 2JKXA 1Q9WB 1JV5B 4OQTL 5D8JL 2HKFH 3FQRA 4YHLH 2VWEE 3RTQD 5C0IA 3VRJA 1KJVB 5DRNB 5J9PB 5CSZB 1WFOA 4ONFL 5I1KH 1WBXB 3M07A 1CI5A 2EZ0C 1S7VB 3KDMB 1DQQB 4MQXC 3DX7A 1EEUA 4PPTA 1PX3A 2J6EH 2O5YH 5JIKA 3VXUE 2ADIB 3BPOC 4YEFA 2VYRE 3HUJA 4MVBD 4PJHB 4YJZL 3BRGC 1AO7E 3QDJA 2J1KA 3ULUD 3WDIA 1PLGL 4KDWA 2YN3A 3C9NB 3MRIA 3CX5K 4NN7B 2P7TB 3HCVA 5INCA 4P5TB 3NABH 3UBXI 1MIEH 4N90E 4YC2C 4WFHE 2DQEL 4LVNB 4R8WL 4EUPG 4BZ2L 2VDRH 1AXSB 1U92B 1FNGA 4NOFA 3TN0A 2O61A 3IKKA 3L1OH 3D85A 3N1QC 4J8RA 4LLAA 1MEXL 2EEBA 3L3DB 4LOUC 2CGRH 2XNAB 4BSWA 5CILL 4N5ED 2GAZA 4YHYB 4YZFE 4ZFZB 4YXKL 3U30B 3IVKB 2C3HA 2QQKH 2VXUH 1KJMA 1JMXA 2ARJQ 1YEDA 2Z31C 4PJAE 2DWDA 5DFVC 2LE9A 4PRNB 5HYFA 3P4NA 5JO5B 2BDNL 4P2OA 1KBGL 4XMPH 3DX8B 1OF2B 2AK4D 1IBGL 1F3DH 4E41A 4TSBH 2LU7A 1SY6A 4MWFA 1RUAL 3FQUA 3WXWH 1U8PB 2DKUA 5KG9B 3MUJA 5EIIA 2M8XA 3SDDD 4Q9CA 1HZHH 5HHOE 4UT9L 5DVOA 4ETQB 1BD2A 4KHTH 3VXSA 1NMAL 2NR6C 4HH9B 4KKNA 2QQLL 3V5DB 3W9EA 3MLUH 1OARL 2QBWA 4XGZB 3F12A 1FIEA 3PHOA 1I9RL 2W07A 4X8JA 5D1XA 3W82A 4DGYL 5KSUA 1VACA 1LD9A 1ACZA 4UQ2B 3QNZB 5KSAB 4WO4C 4FMFA 5HI5D 3ZYZA 5DSCA 1JI1A 3BDXA 4KJWD 4U3CA 1KV3A 3QG7H 5EU4B 1I75A 5DRXB 1P84J 5J1SC 3LD8B 4EDXB 3GMOA 3GBNL 2E6QA 1ZLVK 2WBJC 5A16B 3HE6D 4JM2B 3UYOD 5A40E 1MY7A 4OKVA 1ZA3B 1YEGH 3N1MC 5HHXH 3RZCC 4OUUB 2D0FA 4K7PH 4J6RH 4MXQD 4OF5A 1J8HB 3BN3B 3S8WA 4TUJB 3V6ZA 5H35B 4M1GH 3CZJA 4OTXH 3QULB 1FNSH 3RY6C 5CIPB 5BOPA 2F54E 1AQKL 3RNQB 3WJLA 1RU9L 3DETD 5JR1L 1MCWM 3T0EC 2EDRA 5D6CA 3JWOC 2PXYC 4UIMB 4JKWA 3WNPA 4C58B 2VKWA 1MVUA 3MXVH 3RUGE 5C0AB 2VE6A 4W81A 5GIRA 1PZ5A 3GMRA 1T22A 1WC7B 3ARDC 5IEKA 4WY7H 1DLFH 1XGTB 5F7NC 4RIRA 4LLMB 3DSFH 3CFCL 3TO2A 3D6GA 4RCAA 1T0PB 4YHIA 3UC0H 4LF3A 4KV5E 3MYJA 4H1LH 2B4CC 3TIEB 2VDQH 4GG6B 4K94L 2HTKD 4YWGH 4NKOA 2X9YA 2WBKA 3RY4A 1VA9A 1ZMYA 2D7PA 1PQZB 2ZSWB 2V7NB 5K33A 4M48H 4K7PX 3U0WL 3W11C 4PFEA 4NNPH 2RB8A 1TTUA 1IMHC 5FGCB 4MD0B 5J13B 1J1OH 1JGUL 4HUUB 2R2EA 3G6AA 3ZE2E 3EO0B 4DUXA 4V1DD 1QHPA 4I0KA 2Q7YA 4TULH 4QHUA 1CFSB 5EU7E 5HD8D 2AQ1A 4Y0GA 3CU1A 2VXSL 5A1AA 2G75B 2OQJA 3U9PH 1NFDB 1F4XL 5D93B 5DMIH 4F9LA 1DL7H 3KPSB 1XIWB 4PJ8A 1YNKL 5L2JB 1MCIA 2SEBB 3MCG1 5DQDH 4H1LA 5L6YL 2D9CA 3QI9D 4TSCL 4L8SB 5DJXB 1P5VA 1UADC 2IANE 3NGBB 4QLRA 2BK8A 3TZVD 1A6TB 1M6OA 5J12C 3EO1B 2EEAA 1A6ZA 1AGBB 2FYYB 5DUMH 4C83B 2L7JA 1LE5A 1P7QD 4FA8A 3JSSA 3ZKQD 1OTUD 3QO1B 5J6HA 2FWOA 4OZFG 4R7NB 3SGDI 5C7XH 4YDKH 5GRYA 4DVBB 4XVSL 1HQRA 1NDMA 1UXSB 4RBPH 3BISA 3LKQB 1DUYA 2OL3L 5AG8A 2DB8A 4LMQI 5E2VH 4OZGB 1X5LA 3KLAB 1CD0A 2HFGL 3BKML 3LDBC 4P5KA 3BVNA 1IZJA 3X3FH 1Q9KA 4CVZB 4HIHB 4JJ5A 3UTSA 1OGAB 3TV3L 3CFEB 2VN7A 1QYGH 1JNLL 4M7LH 4JQVC 1G7HB 1KACB 5FYKD 3OAZH 3GNMH 5L2KA 5F1IB 3RBSA 4MS8C 3ESVF 4PS4H 1NJ9A 3OXRB 1NBZA 1YDPB 3D39A 5LGHL 5IESL 4IRJD 3EYFB 5I16B 5A2FA 2HP4A 4PJ9C 2OTPA 3C87A 2VSCA 4DZ8B 1A14L 2ESVA 4DK6A 3T0DA 4MMZC 3MR9B 5EO0A 1B0GB 4M1CD 1RIHH 5C0ND 1RZKH 5KS9E 5FGBC 2DBLH 3O41B 3S96A 3FB5A 2LAGB 3MRFA 4ZPVB 4AY0A 3A6OA 5BRZB 2IQ9H 3PNWA 3QUZC 4ZFOL 5HVWA 1FL6A 5CD5C 1F97A 3NCJH 1A7QH 2E7BA 4X9IA 5EPMB 4UBDD 2BVOB 5DMJB 4G5ZL 4LRNH 1QR1A 1TENA 2H26B 4GMSH 4HS3B 1FIGL 1UWXK 4P4KB 4Z78A 1MHHB 3U0TB 2ZCLH 4X8XA 4PJ7E 5MEQA 1FO0B 3EOTL 4HMEA 1FGNL 4X98A 1AC0A 3NFNA 1WBZB 4ZSOE 2PYFA 2DQIL 2X1XR 2QQNL 3ARSA 1K6QL 2ZCHH 2IBZY 1IGIL 1T1XA 5TF1L 1I8IA 1J5OL 3VGGA 2VLME 5EBLA 4ONGL 1B4JL 5ESVB 3FO9B 4XP4L 3VXRD 1G9MH 5EU6E 3SDAA 4NM4H 1TJHH 5EIQA 4NQVB 3HNTH 1A0QL 35C8L 4JFYA 5DJAB 1EK3A 3QUYB 3QCTL 2RFXA 3QPQC 3BYYA 1HHGB 4YPJA 4XC3H 2W9DL 1NCDL 2DQFB 3VWKC 5IB2B 4IDJL 4NQDE 5T1DH 1B2WL 3QIBC 1EHLH 3MNZB 4FHBD 3H7BB 2AXHA 4UMGA 4UNTA 3QRGL 2FGWL 4I0PD 1GSMA 1VGEH 2CKNA 1YUHA 1VFBA 2MKLC 4YNYA 1N5YL 5E2UH 2CLVA 2BSED 1YMMD 4Q6YA 3BN9D 4I77H 3BZEA 4G3YH 4HK3J 2YBRB 4Y1AE 4IHOB 1RHHB 5ANME 2AV7B 4HKZA 4Z7QF 2XZCL 1G0XA 3PG2A 1M7DA 3QJHB 2WAHA 4NKMB 3QIUA 3ZTNL 1H0DA 5E56A 3QNYB 1FSKB 1LK3L 1OY3B 1F2QA 3AMLA 4Z18A 3SCMD 3TO4A 3MGOB 1S7RA 2QLVB 3I9GH 2NY5L 4UOJA 3LIZH 4C54A 4DKEL 5DO2C 5D1ZA 3BPCA 4LKCB 1J88A 4NNXB 3SKJL 1S3KH 4KPHH 5DJ2B 4BM7A 5FKAA 4ELKB 3GSNL 1A7OL 1CFBA 4ZUWB 1MCQA 4NUJA 3ULVH 1CR9L 1RZIB 1NL0H 4TTDC 5SWZA 1BMGA 1NEUA 5FA4B 5DUBB 5TQ0L 1FVEA 2E7LA 1P5UA 3CVIL 4XNZB 3K2UL 5C07E 2P24A 5T3ZE 4U6XB 1UA6H 3V5HB 2X44D 3GO1H 2CUIA 3ZDXF 4OZIE 2AEWA 2AJVH 4DEPB 4PRIE 4OSUL 1D9KA 5FYJD 3O0RH 1PY9A 1QQDB 1T7XA 3BEWA 2XPGB 4Y4FD 4O5LH 4Z5RA 5CMAA 1PG7H 3SE4C 1DBBL 3GSVB 2BY1A 2FX8L 2DM2A 3VFOB 3DOSA 4LLUB 2HKHL 5JZ7D 1H3VA 3WJJC 4QOKA 3VH8B 4ZOCA 2VWEC 2YK1L 1ES0A 1G1YA 1KXQE 4XCNA 3VRLF 3S37H 1MCPL 5E99H 1NBVH 4NT6A 1IGYB 4OLEA 5M7QA 2A74A 4F57L 4YE4L 3WKML 2XYCA 3TM6A 4W6XB 3VXQA 4APQA 3QDJD 1A6AB 1G7PB 4P2QD 5BVJA 3SDCA 4MAYA 5TE7L 5FHAL 1ZT4B 2I07A 3FOMA 3O2WL 1LEIB 1AY1H 1JI2A 1T3FA 1X5ZA 1WFNA 1FP5A 3JTTB 5IW1A 1NFIA 2Q20A 2DLGA 5ACZB 4KY1H 2D7TH 5J6GB 2FJGA 4K55A 4Y4KB 4XZUA 2BNUA 1CLZL 4Z76B 4H20H 1XF3B 1AI1H 4MNHB 5JDSA 2VLKA 5ID0A 2Y5EA 4EDWL 3ARFB 1S7SA 3U6RA 3TN0D 3OKMA 1BWMA 5ICYB 1AHWA 4G6AD 4K7FA 3D85D 5I8EA 2WIIB 3TYGH 4JFQA 1PG7X 3HAEA 1MQKH 1UXWA 4O58L 4QT5B 4BQCA 3EBAA 2GFBB 1T04A 2EYTB 3LV3B 1U3HC 4OLUH 4OFYA 3PWPE 3HI5H 3UCRA 1KENH 2C4FT 1DQLL 4OIIL 1HSBB 1ZHNA 1WSST 3G08A 3S37X 4ONHA 3O4LD 5AG9A 3EO9L 1GC1L 1QRNB 2JELL 4JO2L 1AJ7L 4E41D 2JJUA 4CW1A 5DJ6A 1ZGLB 5JOPD 1J1PL 3GJFA 4L9LA 3MCKA 3ARZA 5JPMA 5D7JD 5IB1A 2IQAB 1I1RA 3P4OA 5F7LB 3RJDA 4GO6B 5BO1L 3VFMB 3VXSD 3SE3A 4HLJA 1CICC 4ZFGL 1E27B 4PV8B 5DJDB 3O6FC 2Q6WA 3IDIA 5I66B 1G9NC 1INEL 1JPGB 1XR9A 2FL5B 2I27N 5D1XD 4PY7A 1UYWH 4OAWA 5AYUH 2VXTL 4KVCH 3FAXA 4E5XA 3MJ9A 4WUUE 3SE8L 2P5WA 4KK6D 1QA9A 4QTIL 1TPXC 5AZ2L 3WFBL 1NMBH 2FO4A 1GIGH 4XHJC 1ZHBA 5KBNC 1BIIA 1TTFA 3MQIA 4KGLA 5JXEC 3RAJH 4KXZI 4EQ2A 3UXFA 3BPLC 3HKFA 3UBXB 3L5IA 4BFIB 3MRCB 2NQCA 4H26B 3GSUA 1JJUA 4CNIB 3V6OA 2RAMA 2RCSL 4QWWC 1HDMA 3WHXA 2OBGA 1A7PL 1HNGA 4GRWB 2DLEA 2R9HD 3O6ML 1X5XA 1Z6JT 3U4EA 3O6KH 2YMXL 2OL3B 4H25B 5E94A 4RGNB 3BZ4A 3MCLL 5I1EH 4O2CA 5C2BH 2XA8H 1IAMA 5ESQA 1T5XA 4RMSA 3INUH 3C09B 5I30H 4LLVB 5LWYH 3PQYA 3L3GB 1FH5H 4JFPB 2GTWA 3NFPA 3U9UA 3TVMA 3IKCB 2BXYA 4JFZL 3OKEA 3TJHC 1UZ6F 5F7MC 4F8QA 2WV3A 3MV7E 4XCEB 1H8OA 4GXVL 3E6FA 1UCBL 4LCWA 4QYOA 2X1QA 2XG4A 1CF8L 4PRBA 1OAUL 1GVIA 2I9TB 3D0VA 4P2CG 4BQ8A 3BKJH 3VDAA 2NY2B 1DQTA 4HCRL 4LMQE 4WI9A 4RA0C 3G5ZA 1NC4B 3C60A 3OKLB 2CR6A 3O9WD 5CUSH 4ZFOB 4R4BA 4YFDB 4ONOA 4MDJA 1JUFB 2OMBA 3BHBB 5JXAH 4XPHL 2VQ1A 3GB7A 5JPNA 4MCYB 5EU5B 1RUML 5EU7C 4PGBA 4QXGH 1IGJB 4PJ8D 1RSFA 4HHAB 4GBXD 4I1NB 4DFHA 4WI4A 3OKKA 5F7KC 3FN3A 3OJDA 3KYKL 5I1DA 3STLB 1T4KB 5IHZB 5ESAA 4N0FA 4X80L 3V4VL 4LBEB 5J11B 3ARBA 3VFUB 4WV1A 3QZWA 1JGDA 3WFEL 1G7JB 1CDIA 4YGAB 5E8PA 1MCNA 2B1HL 4PP2A 5FO7B 5ABDE 4C56B 5F7DA 1QPXA 5IBLC 1F3JA 5IW6A 4ZTPH 1A1OA 4JKPH 2R0WL 2Z4QB 4KAQH 4M7ZB 4XCCL 1CIUA 5IV2A 1OT1A 4R6UA 4NHUB 1BOGB 1YQVH 4O2FB 4GQ9L 4L3EE 4ZG1A 4ZNEA 4U1GB 1K4CA 1NGQH 2ZWLT 3S97C 3GIVA 4JDZB 4A2MA 3FO0H 2FZ3A 5DJ8A 1FYTE 3S34L 3THML 5TE6L 1RJCA 3MOQA 4Z7WE 4CAGA 3DBXA 3MV8E 1Z9LA 4HLZG 1UJ3B 5GS0L 3C5JB 3VRIB 3S6CA 5C0CB 1JZ2A 4XNYH 1OL0A 3K74B 1E0OB 4LSSL 3BMWA 5ITFB 4W6WB 4I3RL 2ESVD 2V9QA 5T5FL 4F3FA 1UKQA 2G9HB 5EO1A 3QXWA 3LKSA 5B3JF 5F88A 4UZGA 1DEEB 4GRMA 1KB9K 1I7TA 2GSIB 2AKRB 4AJ0A 3QFJA 3M8OH 4EQ3A 4HS6A 4LIQE 1KN2H 1XCTB 3SO3B 3PL6A 3SJVD 2VISA 4OV5B 5JDJA 3RVTD 3QRFM 1GPOH 3GSNB 3VI4F 1JIBA 1ZA6B 4X6CB 5J8OA 1U95A 3UTZA 5IP4A 1X5GA 3G6JE 2UVFA 1ZTXH 2W65B 4D2NA 3BWAB 1FN4B 1QKZH 4G7YL 4OLWL 3SQOL 3ECBA 1AD9A 4UT6H 4Y5YA 3BP7A 1N2RA 4QRRA 4Z7OE 1RJYB 5BXFA 2DMBA 2D4DA 1X5IA 5FB8B 1T1WA 5D7IA 3HMXH 4MSWA 1PKQB 5TF0A 1OTSC 1FGVL 4CVXA 1KCRH 2ITDB 4EUPH 3K1KC 1RV6X 3GSWB 5JIHA 5DGQA 4YGVA 5DEZA 1FJ1A 2EO9A 1G0DA 4JY4A 5FUOH 5I1CL 3KR3H 5TFSL 2YPLA 3SGJC 3BT2H 5GGVH 1HSAA 7FABH 5HHMD 1DJSA 4U0QB 4XP6L 4Y8AA 3LKOA 1QSFE 1SMOA 4QRTA 2HLAA 2P5EE 3V0VB 3EZJB 2A6JB 2DF3A 4B7IA 2A0LD 4Z7VA 4RAUB 1LDPH 3QDMA 3LY6A 1OM3L 4PLNC 2VN4A 4CMMB 2IPUG 5T3XH 1LO3H 4M62H 4MZ2A 3HHRB 5FGRA 5HGHA 1JTOA 4IOFC 1FNAA 4M7KL 5E08H 4NZRL 4ODBD 1MFEH 4QRQA 1OP3H 1KJ2L 1RK0A 5KZCB 3FO2B 1ZANL 2Z31B 3G5VB 3TO4D 2GT9A 3EDJA 3LQMA 3MNWA 2R2HA 1EO8L 3TBSB 1SEBB 5D1ZD 5K59E 9CGTA 2O5XH 2FATL 5ISZB 2Z8WC 4Z77B 3PP3K 5DEGB 5JMRA 2CMRL 1N3NA 2A83A 3QBTB 1YY8A 1D5XB 1JZ3A 4N0UA 1XFPA 3U4BH 2OP4H 4OFDA 4R3SB 4G42A 1BBDH 3CXDH 3BSZL 5E4IA 3IU4L 3RL2B 4TQEH 4KROD 3IS1X 5A3IC 1T2JA 1GH7A 2CRMA 1BEYL 4WO4B 5F93C 2CUHA 3ZYIA 1QBLH 3FTGB 1D9KD 2AABH 4MD5B 3ULUE 1E6OL 1JRHI 4GLRH 3C5ZB 1NLBH 3IDXL 3SBWA 4BZ1L 4PJIE 2DQUL 3T65A 3A6CH 2ZUXA 4U3XA 4GW5A 3KJ6H 5I19L 2VXQL 1YEEH 1MHEA 4QOKD 4GG6F 1X5JA 1IKNA 2H8PB 1CDGA 3JWDC 3GGWA 4IJ3C 1J86A 3RVXC 2GSGA 5KANI 5C0EA 5GGTH 5KSBE 1AQDA 1V7MH 4QHNA 1DTUA 1KT2A 4L3AA 4XBPB 5FYLL 4JRYA 2H6PA 5FOJA 1MF2H 4APQD 1EXUB 3O3BA 5JQ6L 2HMID 4XNUH 4MAYD 1HH9B 2AEQL 3T0EB 1NCCH 3PWNA 1NFDF 2DYPA 3QNXB 3B5TA 3QCUH 3MNVB 2PXYB 2OR8A 3H0TA 5EORL 4XRCA 2KZWA 2UVEA 4UDTB 3VWJA 1O0VA 5LXGL 4XAWH 4G9FA 4U1LA 4BKLB 4G6JH 1MJ7H 2F8OA 5GGTA 5IB4B 4MXWL 1BZ7B 4P48A 3CVHL 2ARJA 3DIFB 4GSDL 3H2WA 3VGEA 5IBUG 3HI6H 2AJYL 3MLVL 2VDMH 1R3HA 3DROB 4LAQL 4UOW1 1D6EB 1MCBA 3OR7A 3QXAB 1FVDB 4I3GA 1IEBA 3O3UN 4MLSA 4A6YL 2P8MB 3ULVF 4Z0XB 4F33B 4MNGB 3C5SB 3HNVL 4KTYA 1KPVB 2CIIA 4OZGF 5HI3D 3WNLA 2X10A 1KNOA 3REVA 3T0WA 4LGRB 1QHOA 2ZPKH 4OUOA 1CD1A 1OQXA 4O4YH 1CE1L 4HS8L 4I3SL 1AGEB 1ZT1B 2NTSP 3PJSB 4OD2B 1JVKA 2K7QA 5JLZB 4MJ5B 4OZFH 5FOBB 2BXZA 3S98A 1RAMA 5BZWA 5GQBA 4UQ3A 2A38A 1OD9A 2FR4A 4UINL 2BSRA 1U8MB 2VDKH 3MLYL 2DWEA 4IBLT 2VAAA 1SEQL 4RWYH 4JFDB 1MPAH 3PGDB 3Q1SL 4ZO9A 2P5WD 3FB6B 4OF6A 1LO4H 1PSKH 5BW7C 4FABH 3MROA 4RAVB 2XKNB 1AIFB 4OZFA 1UM4L 1PW3A 3LDBB 3KPPA 2NY6C 1SJEB 5GS1B 5DS8B 2BX5A 1CDHA 4I48A 5KSVA 3CH1A 2BVQA 3ZYOA 1NKOA 1MRCL 1AGCB 3ORJA 4G7VL 1MH5A 1NPUA 2R0KL 4JPKL 1OSZB 3NTCL 4AK1A 1RVFH 1K8IB 5IT2L 1UWEH 4OCYH 1IAIM 5HHPA 5JUEL 1ADQL 1QLEL 2R23A 1UKTA 5DQ9B 3RX5A 5JMOC 4JLRA 4HUXB 1OW0A 2VL5B 3PQYD 4V2BA 1YYLH 4AEHL 2IPKB 1JHTB 1NUDA 2JJSA 4HBCL 1T66C 3U7YH 4PJ9B 3MLZL 3STZB 2Y9RT 3EOAB 4OZHB 3C6LB 3LN5B 4FQJH 1ZLWK 4I9WE 1VPOL 5EZOH 3ABZA 3FN0L 4WFED 5F70A 5HGBA 5IB5B 2IAMA 1N0LA 3U82B 1I9IL 4ZOEA 43C9A 3UPRB 1ZVHA 3WNNA 2XWTB 2J4WL 3AXLB 5C1MB 5K9QI 5IMKA 4L4VA 1KCVL 2C1PA 3UTPE 5DC4B 4PREB 3O2VL 2BOBB 1G7MA 4WEBL 4J2XA 3TJEL 3L95A 2GK2A 5MENB 2VSDA 1L7IH 3HE7A 2OI9C 1TZHB 1B0RA 1IFHH 2AI0H 3ZL4L 3CU7A 4X7DC 1PDKA 1YC8A 2YUZA 3CDCA 3G5XB 3TA3A 3E3QC 4IM8A 5D2LA 1QSEB 4FG6C 3Q3GB 1E4XL 4PP1D 4HMDA 2ERJC 3L6FA 4Y4HC 1WJ3A 4F7MA 3JWOH 2HWZL 2CXGA 4F7PA 1CVSC 2BNQB 3C8DA 1ZSDA 3FFCA 2AEPH 4PJ5B 3AS2A 4FFYL 4TOYL 2E5EA 3T09A 4HJ0C 3NCBB 4JRXB 1CBVL 5ILTH 1MVFA 2DD8H 3VMPA 5BS0A 4P57B 1U8JB 1UT9A 2EICA 2W0PA 4PJCA 5E8DH 2B4CH 3HE6B 2AJXL 4P59H 5FF6A 3QUKB 4UAOB 1CGSH 3CFDB 1N4XH 3QIBB 4Y16A 1BAFH 3QAZB 4JY5H 3BUYA 3ZDYE 3H3KA 1GYAA 3CDGB 1Z3GL 4OLVH 3MOAL 1GOFA 5I1JL 2ZKHL 3D25B 4NYLA 1EDQA 3BP5A 5DZLA 4DWHA 5FYKU 5I8OL 1UM5H 3GIZH 3GM0A 2BC4A 1KPUA 4ODUA 3ARGD 2Y1VA 2DTMH 4DCQB 3WIFA 4XNMB 3BRFA 4PJXB 2ITCA 1H3TA 4MA8H 1ROWA 1HI6A 1MFAL 2X1OA 4LARL 3QEUB 4E0RA 2Q8AH 4EOWH 4X4YA 2MPAH 3MV9B 3I85A 4L1HA 2J88L 5F9AC 4YBQD 3RDTC 1WIPA 1XGQB 3W2DH 1XF4A 3TBVB 4NP4L 1T83C 1S9YB 1NGPL 5FUCE 1J9CT 4ZUTB 2AJZB 1KJ2B 4NQEB 4RFEA 2F53B 3QQ9D 1XCQA 2BHUA 1QFUL 4AT6B 5D71H 1C08A 2J8UF 3KYOB 1DQML 4Q9BA 2DQCH 3MO1A 5GRWA 1IAKA 1BQHA 2R56L 1TCRA 3LKRA 3TIDA 1HILA 4V1DB 5IFAH 1N5AB 5HHVH 3IJSA 5HYJA 1IM9D 2PO6B 3GEWB 4LSVL 5CEYA 4XPAL 4NWTH 3BP6A 1X6LA 3EZ8A 5GRJH 3RI5K 4FQPA 3AY4C 2DM4A 3CSBA 4Q2ZB 1YMHB 3QWOB 4BH7A 4NSKB 3QI9B 2UUDK 2OR9H 3ROOA 1CQYA 4NRYB 4PTTB 4QRRD 1LO2H 1YYML 3I6GA 1S78C 3QISA 2AXGA 4LCUA 4AIXA 4KJPC 4OV6F 4J23A 3EDDA 5E6IA 3DGGB 5IOPA 3M17B 3RGVC 2OLDA 1YMME 2JB6B 2AJUL 1TIUA 4WW1B 3LQAC 1MIMH 2R1YB 1KXTB 5H94A 1UQSB 4LHJB 4POZC 1W0WA 2IG2L 2YD8A 1BP3B 1CXLA 1ZKAA 2JJWA 2A1WL 5DI8A 6CGTA 3REWA 3BGMB 5E5MB 2NX5B 1N6QL 4MQ7A 4TNVK 5CEZH 4R26L 4YH6A 1TXKA 4Q6IA 3GKZA 3B6SB 4NQCD 4BYHA 1I4FB 3QDMD 5AZEL 3D48R 5KVEH 4G6MH 4YBLB 5EC2B 1VEPA 2EH8H 4OT1L 5IMLA 4JHWL 1FCGA 4GKOA 1BX2A 4HK0B 2AXJA 4JREC 3ES6B 3HZMA 2ATPB 5AEAA 4HPYH 4U1JB 4IRJB 5L8JB 3G9VA 5CJOH 1FZKB 5AWNL 4AMKH 1Q9WA 2PYED 2BFVL 2OXGA 4PG2A 4D8PB 4ZD3L 3OAUH 1RIUH 3H42L 1IAIH 3RWEA 3EJYD 2YD1A 3VXNB 3B2UC 5ERWA 1SJVA 1DBKH 1U8KB 5B4MD 2KZ1B 5FYJE 1QP1A 3BX7C 3P30L 3T2NL 3LEVH 3HA0A 3KDMA 1S7VA 4A6YB 3I6LE 3CX2A 4P5MB 4YHNA 3S5LG 1PD6A 2PR4L 2IFFH 3PP4L 4IRSC 3NA4A 1CICB 4U6YB 4UB0H 4PLJD 4N9GB 4PJHA 4WUKL 5FYJU 2YUWA 1TZIA 2BVUA 4DTGH 1VFOA 1DQJB 4YQXL 1CT8A 3C9NA 2IJ0C 4GMTH 4UTBL 2P7TA 3GMNB 1EFXB 4P5TA 5EUKA 4KK8D 3HUJE 1A64A 2XWBB 1CFVL 3QDJE 4P2QE 4YX2L 2LAAA 2BMKB 4OFPA 1WBYB 3T3PF 3ULUC 1AXSA 2IADB 4CU6A 1U92A 1FORL 4XP9H 4NZUH 2ICWI 2P46B 3BPLB 4LKXB 4L4TB 4WTXA 4MJ6B 3L3DA 3WIIL 4RBPK 2XNAA 1XGYH 3L5HA 3LEYH 1WVZA 3L5JA 1MNUH 4Q0XL 3HI1A 1VKXB 3DHJA 1IAOA 2VABB 4PRNA 4HUMB 4JRYD 5JO5A 3L5XL 3WIHA 2XN9A 2A9NL 5EOQL 1X5FA 3GMQB 3MZTA 1OF2A 4JHAL 4LVHC 1V05A 3EW3B 1CLCA 2QTEA 1FQ9C 1OP5H 1F4YL 2E7MA 4ZS7L 3OAZK 1KTRL 1OCWH 3TNNA 3WDHA 5KG9A 1Z5LA 5CJXC 2B8OT 4ETQA 1E4WH 4E41E 2HT3C 1IL1A 4HH9A 4W4OC 5A2LH 1W0YT 5IBTL 1RURH 2YPVH 5L8LB 4K71B 4XGZA 4YHPA 1BJ1H 3LS4L 1EGJL 4WWKD 4ZXBD 4UQ2A 3QNZA 4AEEA 1BD2E 4U33A 3VXSE 3O6LL 4XC1L 3SCMB 3SDDC 4JPWH 5HYQB 5CJQL 4J3SA 5DRZB 3AREC 5EU4A 1DVFB 3GK8L 4P46D 4TVSa 5DRXA 4JZNA 3WFCL 5BVPH 1WISA 4TNWF 2VO5A 5FM5M 5A16A 4LSUH 4JM2A 1ZA3A 3IXTB 3DGCR 3IF1B 4NRZB 4OUUA 1N8ZB 2NW2B 2VDOH 5HI5C 1URLA 1J8HA 4KJWC 4B53A 1J05B 4U1IB 2NY7L 2DICA 4TUJA 5H35A 3OKNB 3N9GL 3OTTA 5ICZA 3Q48A 2UYLA 1I7ZB 5CIPA 2F5BH 2ICWJ 1A6WL 3RNQA 3FAWA 3O3DB 1OTTD 4MXQC 1S7XA 1IC7H 3V6FB 2AK1L 1TITA 1NAMH 4XAKD 4Y4FB 1UZ8A 2DS4A 3CFBB 3GSRB 2X05A 2B0SH 5C0AA 2H32H 3H3PL 5JNYA 1JPSL 1KCUH 1S9XB 2DQJL 1JZ5A 3DETC 1FRGH 1WC7A 3NA9H 5FDWA 4LLMA 1Y18A 1AO7A 4L1DA 4BK5A 4HLZH 5I8KH 4WHYG 4OLYH 5LCVL 2Y36L 1EEYB 5DF0A 2JJTA 1UENA 2V7NA 5C08B 3L7EB 1IC4H 3FQXA 1NCWH 2JTDA 4MD0A 2R1WB 3F5WA 3E0GA 4HUUA 4IDLA 3EO0A 2HTKC 5KW9H 2H32A 2D03H 3KS0J 1CFSA 1J7VR 4JO3H 2AAVA 2EXWC 1G9NH 3BWUC 4YDLC 3DVNB 1FC1A 5DYOA 4ORZC 2DQHH 4RDQG 4X6DF 5L2JA 3IFLH 5TE4H 2SEBA 2UZIH 1QVOA 5IVXB 3N1GC 4L8SA 2ADFL 2I25N 2IAMD 5DJXA 5D1QC 5HD8C 4NDMB 2GJZA 3L7FB 5KS9B 4L4VD 4M5YL 1D5MB 1K5NA 1A6TA 2P1YA 4NWUL 5GGUA 4OCXL 2FYYA 2WUCL 4NN6C 3UEZA 3WCYA 5L7XL 1JGLL 1M71B 5ALCH 4R7NA 2HTLD 1S5IH 2FHFA 4DVBA 1UXSA 1EFQA 4HKJA 3LKQA 3KYAA 3TZVC 1FFPB 3TA3D 4JFFD 1AC6A 3KLAA 3MXWH 4JFOB 4P3WA 4HIHA 5EOCH 3I3DA 1OTUC 3G6DH 4Q97A 3T77B 3PDDA 3U36A 4LEXH 4PJDF 5B8CC 4LSQH 5EZIL 4HG4K 3CFEA 1G6RL 4YDIL 3FFCD 1N6UA 1G7HA 2UV3A 1P7HL 5F1IA 1RZJC 2F74B 1EHNA 4LQFH 4W68A 3UTSE 3WHE1 4MAUL 3VW3L 3OXRA 5EU6B 1YDPA 3K4ZA 3VD7A 1ZLSL 1KB5L 3DXAD 4CKVX 4JY6A 3EYFA 5I16A 1XH3B 3FCTA 4PLKD 4J12A 4LCIH 1WICA 4K23L 2XOTA 5I18H 3MR9A 1LO0L 8FABB 1B0GA 3UO1H 1QLFA 4NQDB 1B6DA 2R4RH 4GJTB 3O41A 5I6XC 1JF6A 4L5FH 5BRZA 4FFWD 4Y19D 4HC1H 1FPTL 5KVGH 2ESVE 3DARA 5GS2H 5AD0A 4IIQB 4WJ5B 5JW4N 2H2SD 1R5IB 4OZ4B 2BVOA 4N8VA 5I1HH 1INDL 5E5RB 2ILLA 2AV1B 2BERA 3UYPA 4M1CC 3GJFK 1OHQA 1JBJA 1WAAA 4JQXA 2H26A 1FG2B 4Z9KB 3S7GA 4P4KA 3TBWB 5EO9A 1CFTB 2YN5A 2CDGA 3SKNB 3U0TA 2FH6A 4Y1AB 1FO0A 3BKYH 1HKLL 4E9LA 2XZAL 3P11L 1F11A 2GKIA 4HQQH 1TNNA 1WBZA 4LLWB 3PWUB 4MXVF 2XTJD 3GMPB 1YPZB 2ICCA 3WYRA 3OGOE 1U58B 4DGIH 3JV6B 4ERSH 1X4XA 1GGBH 4HC1A 4JPVH 4CVUA 3C8KB 4OD3H 1CLOH 5ESVA 4RFOH 3FO9A 1F8TH 5HHQB 4XBEL 4OQTA 1LK2B 4Y2DD 2D0GA 3DSNA 2V2TB 4MCZA 4Y5XC 5DJAA 3P9MA 3MA7B 3ZO0A 1HHGA 1L9NA 4JDVA 5EU3A 4KQ4L 3QXTA 2EIDA 2BVEA 4ZAKD 4UV7H 3HNSL 2FJFA 4U1HB 5EBWB 4PJFA 4X5LA 2XICA 3H9SA 5C07B 3JV5A 1S7WA 5B38G 3B8YA 6FABH 1MJ8L 4LAJH 5ADOH 3UTQB 5FA3B 4YXKH 3NZHL 4H8WH 2NY4D 1HXYA 3LQAL 3QEGH 5GRVK 2Y06L 2YBRA 4R4NC 3G5YB 2ZUQC 1Q9LA 1RHHA 3HMWH 2N56A 4IJ3B 3TLRA 4I0PC 3QJHA 1O7SA 5E2TH 3KPQB 4NKMA 3SN6N 2DQGH 3QNYA 1QFWI 1F00I 4J3WA 5I17A 3L3OB 3MGOA 2KPNA 5E4EC 1IGFL 1MI5B 1QSZA 3N50A 3MBEA 4OGZA 5MHSE 3FRPG 3QIWB 2WQRA 3HZYB 3VFNB 5E7BA 2QQLH 4TVPD 4NNXA 3DUHA 5IQ9B 5DJ2A 2H9GB 3L3HA 2JLLA 1LDSA 1I9RH 4JZJC 3FJTA 2ID5A 2HT4D 2EDWA 4NRXB 3EDFA 1RZIA 4XH2B 5IUSA 1KLUA 3U1SH 5D7LD 3TEUA 4EEEA 3V95A 2ZCKL 5DUBA 1AXTH 4HWBH 5GJTL 1D5BB 4IRZL 3O11B 2HFEA 4U6XA 5DT1L 5K9JH 5SWZE 12E8H 4JR9H 3CSYB 3EIFA 3KWWB 1S8DB 2NZ9D 3T2OA 5IR1B 4TUOA 4YDVB 1P4IL 4X7TA 2XPGA 2J8HA 4YHOL 3MMEB 3PDOB 3GSVA 3PWPB 2G60L 2CIKB 2DDQL 2VZSA 3QWRD 4KK9C 3IDMA 3VH8A 2LU3A 1BIHA 3MYZA 2F19H 2R8SL 3VFTB 5C09B 3BKCL 4U05A 5EUOB 3SJVB 4QOKE 4YIQB 1KB9J 2FB4H 3ARUA 3LPGA 1DBJH 4U2YA 1OPGH 1G7PA 1ZT4A 1LEIA 1KCLA 3FB8B 1NH6A 4MA7H 4P5TD 3JTTA 3DVGB 3H9HA 4M1DH 5DUPH 5FUZL 4PR5B 5ACZA 5J6GA 4RISH 5CGYD 1RUKL 3FB7A 1XF3A 4LFHD 5FO8B 1IT9H 1KN4H 3IFNL 1QLRB 3RNKA 1V3JA 3V79C 2GK0B 2WIIA 4WCYL 3VG9C 2IEPA 4QT5A 2NCMA 3PF2A 3LQZB 4DKFH 4HEME 1XZ0B 2VLKE 2GFBA 3LV3A 2EYTA 4NJAH 5ALBH 3CNKA 2VXSH 4NO0B 4X6BB 3BPNB 1RJLB 4GG8A 1I9JL 4NOBA 1AKJD 3TN0C 4ODHL 1TETL 5HHMB 2MOVA 4G6AC 3QXVA 3IGAB 1QRNA 5L6YH 1A8JH 1JWUB 4OGXL 1ZGLA 4R96B 4QCIB 4HSQA 4WI2A 5DTFA 4MNQB 4OIBA 4P2YA 2W0FB 3RKPA 1QD0A 3BIKA 4HPOL 2FIKB 4MJ2A 2B2XH 4UTAL 4ZFFA 1J8KA 2YPKA 4Z6AT 4P2OC 4PJGA 5F9OH 3MC0A 4XVTH 5T3ZH 3VFMA 5DMYA 3OXSB 4I4WA 5FHBL 1E27A 5I71B 4HGWB 3X14B 5DJDA 4QXUL 4HEPG 4XMKL 4BH8B 3P4MB 1I3RA 4LSRL 2VR5A 5LBSH 5C0BB 1JPGA 4LU5L 2FL5A 5KSAD 1QUNA 1FG9C 1IM3B 3MX0A 1P4BH 4EN3A 4BFGA 3JWDH 3ARYA 5T1MB 1FZOB 4PY8I 2NXYD 5D1XC 4JM2D 1FAIH 1X9QA 2X4NB 2ICEB 3UBXA 3FKUS 4BFIA 4RA3A 2P5WE 3MRCA 4H26A 4CNIA 2HN7B 3BGFB 4PGCB 1Z0MA 1J8HD 4OZIA 4KK6C 2OYPA 2IWGA 3A67L 1QFWL 5FCUH 1NFKA 2ICWB 3V6OE 3ESUF 2OL3A 4H25A 5BQ7B 3MLTB 3BZDA 4AEIH 4XMLL 4XVJL 3ILPA 1DFBH 3GBML 2OTWA 5DMGD 5HYSG 4M9OA 3KLHD 5F7HA 5LQBH 2HRLA 1WWAX 2OX5A 1CFQB 4K3DH 1NLDH 1AP2B 1YECH 4JFPA 1G6RB 3GI8L 5C0AD 3IKCA 3KXFB 3LHPH 3WJLC 2KUTA 3O8XB 2QL1A 2EDTA 1A47A 4P49A 4XCEA 3ROLB 3PQYE 5GGRB 4TRPL 1V3MA 1BM3H 4OB5H 2OCFD 3NVQA 3EHBD 2EE9A 1KB5B 2BVPB 2I9TA 3HC3L 3MRGB 1AXIB 4V2CB 1JPFB 1FGNH 3U7WL 4XI5D 4HJJH 1I3GH 2UY7A 4GAJH 5I0DA 4HIIB 3OKDB 1NC4A 3OKLA 5TF1H 2YA1A 4ZFOA 1JNNH 2Y5TB 1JUFA 5D70H 1MWAL 3BHBA 1ITCA 3S35L 5I1GL 1JPST 4M5ZH 5DGRA 4MCYA 2JB5H 5IROA 1FZMB 1OP3K 3KPSD 1XIWD 4K7PY 4X6FB 1TQCC 3QCTH 4NO3B 1PVHA 5E03A 3E2HB 1T4KA 1VFMA 4KTDH 3T8XB 1DP0A 2Y07L 4YXLH 4GRLD 4F9LC 4LLQB 2MTPA 3HG1A 4XPFL 4PJ8C 1UB6B 1S9WA 3VFUA 3GMMA 4K8RL 4L8BB 1FNEB 4WHDA 3FQWA 2FBOJ 1E28A 5FO7A 4XWOD 4C56A 1XF2B 1T21A 2WANA 3B5HA 5M95B 2Z4QA 5EC1B 2EDDA 5MP6L 4F15C 4YLQT 4D9QE 4LP4A 4PGDB 4NHUA 1BOGA 5EA0L 1TDQA 4HZLB 4O2FA 1P7KB 1HOCA 1OGAD 1N0XL 3HPLA 4YXHL 2GITB 3H9YA 3LSOB 4M6OL 3X13A 4YZFF 1I1FB 4WW2B 4BUHA 4JO4H 1NC2A 5C0CA 4XBGB 5E9DB 2OR7A 3SGEI 2VZTA 2YUXA 2X7LB 5F1KC 2W60A 5ITFA 5JW3L 2KDGA 2E8YA 5CINH 1T03L 3SGDH 5CSBA 2B5IB 2G9HA 5AAMA 1R0AL 1F90H 3TYFB 5BRZD 1M05A 1IGML 4JVWA 1DEEA 3PGCB 2P5EB 5KJRH 2CKBH 1H3UA 2EYSB 4PG9A 4OV5A 4FQ1L 5TDOB 4ZUVA 4YHML 1MFCL 4WFGE 2VJXA 3WHE0 5L9DH 1KTDB 1ZA6A 1RD6A 2FX8H 4X6CA 4P4KD 2WWKT 3QFJE 1RHFA 4Q9QH 2W65A 5FK9B 3PWJB 4KVNH 1EIBA 5IIEB 3WS6A 5HDQH 3TBTB 4HKXA 1MCWW 3O4OC 2XG5A 1OAXH 4Q9RL 3G04B 4PRHB 4GW1A 1RJYA 4NKDB 1DANT 4PBXA 1WZ1L 3QCVL 3C2SA 4S11A 1I3VA 4LVOC 4LCCB 5F7EH 1EAPB 1PKQA 1KTLB 5J1TC 4QRRE 3U46B 1F02I 1ORSB 3GSWA 3OAYH 3QUYD 4IRSB 4X9HA 1ZS8B 5D7IE 4NZTL 4R7DB 1A1NA 4DN3L 3Q5YA 5GSVB 1S7QA 4ODVH 4QXTB 3CSGA 1HKFA 3SDAC 3D18B 3FFDA 3TBYB 2VXVL 2O5ZH 1KFAH 1DUZA 1ACYH 4CMHC 3SDXB 1A2YB 1TJIL 4RAUA 1F45A 2WP3T 4JFEA 3QQ3A 5GXBB 3FOLA 1ONQB 4FFZL 1DQLH 1JN6B 1AE6L 1AGDB 3IJYA 3O2DL 4PJIB 5CZVL 5DLML 5GZND 4Z7VE 4KV5F 2NYYC 3K0WA 3QDME 3QYCA 4Y5VA 3RIFF 3T1FA 1EO7A 1CIDA 1EO5A 1ZHKB 1TZGL 3G5VA 4HV8A 4Z0BL 5L88H 1G9MC 5CGTA 1FLTX 2GIYA 3TBSA 1F4WL 2AGJH 2NY1C 4KK5C 4L3EA 4ZNCD 1JYWA 3ILQD 3QEQA 3W39B 4LVHB 3ZE2F 5FO9B 5ISZA 3RWGB 1Q0XL 1ZLUH 5HYEA 1HINL 3QIUC 3ARQA 4LIQH 1ERNA 2A6IB 2X1WL 5IM7B 3TO4C 1D5XA 3MV8A 4S1RH 1NCAL 2DLFL 1JYXA 3ARGB 1YNLH 3MJ6A 5D1ZC 1FZJB 5BOZG 3BD4A 3RL2A 4U7MA 1KIPB 5C0JB 3CD4A 5CEXB 4HW6A 1HYSD 4G80B 3BAEH 3SPVB 3FTGA 3IAPA 2XZQL 2GJ6B 2BJML 3AREB 2J5LC 3EOBA 2HVKA 2E7LC 1A7BA 4KROC 3OHXB 3CFJA 2BSSA 3I50L 1OQOA 2Z91A 4XPBH 3AS1A 3NFSL 1JFQL 3EYOA 2H8PA 4IMLB 5TQ2H 1D9KC 3GHBH 1UWGL 5T5NG 4KKCC 2F5AH 4L3CB 3MFFA 1LILA 5DVKA 1F3DJ 3AY4A 1F6AB 1A6UH 1BGXL 5EULV 2IH3B 4OLXH 5ICXA 3RFZC 1BZ9A 1C16B 3BQUD 4WU5B 1KIQB 3IFPA 5IB3B 1EXUA 3RWIB 5DFWH 2X70B 1MHCB 2IFGA 4UV4L 3GHEL 3RPKA 1HH9A 4WHYH 4UDUB 2I5YH 3KHQA 3MNVA 4QF1A 2HKFL 4YHLL 4JRYE 5T1LB 1OAUH 3J7HA 3CMOH 5EH1A 4Y4KD 3TCLB 4MHHI 1CTOA 5IVXF 3VFSA 4APQC 5I1KL 1T1YB 4BKLA 2GEEA 3LN4A 2EDLA 4MAYC 3SDCC 3ARFD 2VAJA 1YQ2A 5IB4A 1OAQH 5C0FB 5KS9F 4KJYA 3AB0B 2J6EL 2O5YL 1OSPH 2R0ZH 3DIFA 3FQNB 4U1NB 3Q6GH 3F7VB 4X6EA 4G9FE 1U2CA 1EZVX 3DROA 4EI5B 3QXAA 1FVDA 5J0BA 2EDKA 3PABB 3KLDA 4F33A 3BDBA 4MNGA 3I84A 3NABL 1AHWC 1MIEL 3A0OA 1KPVA 2EDXA 1QRND 4R0LA 4IS6A 4PJ7F 1W72L 2OMNA 3LMJH 1XGRB 4PRPB 2VDRL 4UU9B 1YJDC 4YDLB 1AGEA 1ZT1A 3FMGH 3PJSA 3NPSB 4CN4A 4HCRA 4G6FB 1UH3A 4EVNB 3JVGA 5JLZA 4MJ5A 3PWLB 1JGVH 3L1OL 2OZ4H 1BVLB 3NAAH 3RY5A 5GS3A 2CGRL 5D1QB 3W0WB 3Q2CA 4L9LC 4X5XB 3ULUH 2QQKL 2VXUL 5DRWB 1U8MA 4DZBB 4EBQH 2UZYB 2DAVA 3DYPA 2PYEB 4HWUA 1I1AB 1QO3A 4JFDA 3DMMB 5D7KD 2R0WH 3PGDA 1A9EB 4M03A 1BFVH 4XMPL 3SE3C 1ZWIB 2ZNWA 3RTQA 4DN4H 2W9LA 4QTHB 1LE9A 3FB6A 5FM8A 4FXGB 4Y88A 4TSBL 3SGKA 3WXWL 4XCYB 4NFDA 4RAVA 1MFBH 3ZDXE 3MLWH 2YSSA 3BFOA 3MLXH 2XKNA 4ZS6D 3VXMB 1HZHL 5TE6H 1S7TB 3U7AA 4KHTL 5GS1A 1SJEA 4G43A 1GHFH 1IRAY 1Y6NR 4XPGH 2RHEA 1HXMB 3MLUL 2KQMA 3ZHKA 5JW4R 5B8CB 1JTTA 1DQDH 1OWRM 1RIVH 4NGHH 1K8IA 3VGHA 2C7UB 2EXYD 3LN9A 4RGND 2FHCA 4I3RH 1V3KA 5C9JB 3V6OC 3BRDA 4FQXB 3DURB 5F6IC 2NXZB 3BH8B 1MCCA 3B2VH 3CGTA 1BVKB 4ZOAA 4HUXA 4KJQD 1VGKB 3BO8A 1EBAA 2IPKA 3VDBA 3S3JA 4D0DB 3T2QA 3QSKB 1YEGL 5HPMA 5HHXL 3STZA 3DV4B 4OZHA 3C6LA 3LN5A 1K8DB 4K7PL 4J6RL 2X5PA 3KPLA 4RZCA 4LLYB 5EZJA 5TPWH 4DVRH 1OOAA 4WNQB 3CFKA 2QKIA 2VQUA 3UPRA 4M1GL 4NN5C 4U1KB 3AXLA 3GMLB 1E6JL 4OTXL 3VFGH 1C5CH 2VDNH 1D7FA 1FNSL 1LP9A 3CSPA 3TVMC 2VKXA 2NY2D 1GOGA 4OM0H 4YUEH 2R69H 3NIFE 2AK4A 1EERB 5MENA 2QADC 3MUZ1 4L4VE 1NC4D 5BV7C 2X4OB 1RMFH 3G5XA 3BEVB 4LDEB 3RL1B 3MXVL 1QSEA 3OSKA 3OPZH 4D94A 3EYVA 3MUGB 3Q3GA 2GCYB 1J0JA 1ETZA 5T3XD 3ZLQC 4WY7L 1A9BA 1DLFL 3BXNB 4HFUH 3DSFL 1YEKH 3C60C 3UC0L 1DDHB 3P77B 1TVHB 5D2LE 1GCFA 3TFKD 2VDQL 4QRPB 5DHYA 2VH5H 4TYUA 4PJ5A 2V2WA 4YWGL 1HWGB 3WBDA 1XAUA 2HT2D 4JG0H 4JJHA 4JRXA 4XP6H 4EIZC 4M48L 2D31A 1MHPH 4NNPL 1XT5A 3FFCE 4XP1H 1U8JA 3B9VA 1J1OL 2FSEB 2A9MH 4CADB 3HE6A 4JANB 1A3QA 3MRDB 3DTXA 1EBPA 2IMNA 4TULL 3CFDA 3IFOA 4C56D 5CD3B 4LPCA 4OF0A 4H0HB 3BD3A 2X4PA 3U9PL 1YEJH 1FYHB 2NY3C 5K93A 5DMIL 1DL7L 4PJCE 3RU8L 1FL3A 3FO1B 3ARBC 4X4XB 4WV1C 2HYMA 5DQDL 4DGVH 4GUPB 1WWCA 1EVTC 4Z7UB 1KGCD 3VXTB 3QQNA 4JVUA 3RWFA 4ISVA 4X7CC 3V5KB 1FL5B 4C4KT 4DCQA 2LQRA 3LKNB 4PJBA 4G8GB 2DL2A 5DUML 4PJXA 4HBQA 5GHWH 3P0YH 3UDWA 2E27H 4KTEH 4LK4A 2P4AB 3P73B 1OP9A 1VESA 3MRBB 1K2DB 3GRWH 4S1DC 2X4TB 2ZOKB 3I02B 2E3VA 3NOIA 5C0CD 1U8OA 3HAEG 4YDKL 4U7KA 4URTB 1L6ZA 1QFPA 4OM1H 1XGQA 3DUSB 3NPZB 5E2VL 2XZZA 3CCHB 3U79A 4ETYA 5INDB 2GUOB 1S9YA 2X4QB 3X3FL 1ZVSA 4ZUTA 4WIQA 2AJZA 1S9KC 1KJ2A 2XTJE 2F53A 5E2WH 5DWUH 3FRPA 2RQ8A 1MRFH 1OP5K 2C9AA 1PKOA 1QYGL 1KULA 3S88H 1TMCB 4I0CC 5DD6B 3GNML 4M00A 3MRLB 1NCTA 1PYWB 4V1DA 2WUBL 4RWHA 4G8IA 4PS4L 3QQ9C 1N5AA 2PO6A 4NPYA 1N7MH 5F97E 5IHUH 3UYRH 3HRZA 4LP5A 4AH2B 1P4LB 4I2XB 2R2BA 3VFVB 1U8NB 4Q2ZA 1LEGB 2HFTA 1RZJH 3RA7H 1YMHA 4QRSB 3QWOA 4QHLA 3PL6C 4NSKA 3QI9A 1RIHL 3AM8A 1RZKL 3EAKA 5JHLH 2DBLL 4NRYA 2VIRB 2A73A 3DO7A 4KI1A 2IQ9L 4RX4D 1T20B 3LEXA 3NCJL 5GRUH 1A7QL 5FYKH 2AEQH 5E1AA 3DGGA 3QHTC 3MJ8A 2G5BB 2HRPH 2HG5B 2JB6A 4Y5YC 4LRNL 3FQRB 4WW1A 2PTTB 4GMSL 1KCKA 2R1YA 1EUUA 1UQSA 2ZCLL 4PLOB 5E1HB 4JFFB 5E5MA 4RFNC 1M7IB 3ISWA 3NIGE 2CO7B 4OQ1A 2CJUH 4KI5F 1OAYH 2P49B 3PHSA 4R2GB 2ZCHL 3CUPB 1UJTA 4PYHA 3B6SA 5I74C 1CZ8H 4TVPE 3SOBH 1I4FA 5HDBE 3WFHA 1I7RA 3IDYC 1S7UA 1G9ML 5KN5B 2IGFH 4NM4L 3HCVB 4NHCH 1TJHL 5BJTB 5INCB 4HG4J 2A2QT 1R3JB 3HNTL 2Z35B 3E8UH 3VG9B 2ATPA 4U1JA 3D3VB 3DXAB 4IRJA 4XC3L 5KZCD 3OB8A 5T1DL 2Z31D 4D8PA 4I3SH 5DFVD 4Z7NE 1EHLL 2O61B 2V5YA 3CVHA 4U31A 3QHZH 4PB0H 3HFMH 3VXNA 4IOIA 3L3JB 4J8RB 3ULSB 4KKBC 4K3EH 3W81A 5ISZD 4BSWB 4DAGH 5E2UL 1KJMB 1CDBA 2WWMC 4A6YA 1DR9A 4P5MA 1ZK9A 4I77L 3LKPA 4P2OB 4G3YL 3QUMH 2H3NB 5MEOA 1J0ZA 4U6YA 1T2QH 3PHQB 1H15B 5I76B 3ALPA 1DQJA 5F89B 1CCZA 4MA1C 4P9HC 1WCBA 3OJMB 4M9PA 4WO4D 2BRRH 1SYSB 3GMNA 2XWBA 4J3TA 3KPMA 4PJHE 1O5DT 1X7QB 2YUVA 3I9GL 1BD2B 1ZEAH 5FM4A 3LIZL 4NCC2 1JNJA 2Q7NA 3OR6A 4PLJC 1NGZB 3D0LB 3M45A 3C5ZD 2BMKA 2V17H 1MRCH 1WBYA 1S3KL 4KPHL 3VE0A 2E7HA 5D72H 4LLDB 3PHOB 3W5MA 3AFLA 2WBJD 1RZFH 3ULVL 4L8CA 4PTUB 1DSFH 1NEZB 5F7YC 3VXRA 5CJ8A 1NL0L 1X5YA 1Q0YH 4L4TA 4LKXA 1U3ZA 4KK8C 3RWDA 2Q3ZA 4MJ6A 2K1MA 2BCKA 3WFDH 2HJLA 4R90H 1V8HA 3WEXB 1YEIH 1MELA 1QEWA 4H88H 3SBWC 2K9UA 4O00A 5IHLB 1UA6L 1MCOH 1VKXA 3GO1L 2VABA 3MFGB 3WE6B 2AJVL 1IKNC 3F7PC 2YD5A 3PV6B 2X09A 2NLJB 3O0RL 3QH3A 4UIKH 3T0ED 4Z7WF 4QY8B 4O5LL 5KTEH 1EMTH 1PG7L 1SQ2N 2PXYD 3IAGC 1SBSH 2XN9E 3DUUB 3VFRA 4P3CH 3LH2H 5HYSA 5ID1B 1IE5A 1ADQA 1JRHH 2IPUK 4CDHA 3S37L 1HEZB 5E99L 1NBVL 1T1ZA 5DC0A 2DIBA 4JZJA 1KIRA 1MVUB 1ZLWH 3SCMA 5HYQA 4M93B 3GMRB 3V4PH 3VWJC 2B1AL 1T22B 5FYJH 3N85H 1DVFA 5GGSY 3W11D 1AY1L 4U2ZA 3UJTH 5JA8B 3WKNA 4WEUD 4JN1H 4M7JH 2ZSVB 2MKWA 4KY1L 2D7TL 5I9QC 3IXTA 1AGFA 1EVUA 4NRZA 1GGYA 3G6JF 1JWMB 2A77H 4H20L 2B7DT 1RUPH 1AI1L 1H5BB 1J05A 4P46C 4U1IA 4KUCD 3LPFA 4YEEA 3S36H 3B9KB 3OKNA 1TQCB 3ZKXC 5J89A 3VGAC 3KJ4B 4NM8H 5JTWA 3TYGL 4Z7OF 2R2EB 1YZZA 1MQKL 2DI8A 1J8HE 1KELH 2Q7YB 4QHUB 5HHNB 3O3DA 2NY0B 4OLUL 3AC0A 3HI5L 1KENL 1WWBX 4Y4FA 1AH1A 3LRHA 4JFDD 5I1JH 1OLLA 1DCLA 3RVWD 1BREA 1VADB 5IJVB 4H1LB 1CGUA 4XB8A 4J1UB 1S9XA 3PWVB 1OTTC 5BMFH 5DVLA 4HULB 3OKOB 5C0AE 1A6ZB 4F15B 2XIDA 4KRPC 3TT1H 2YA2A 4P2QA 3MBXH 1HQRB 4JFHD 2J88H 1UYWL 5AYUL 1DUYB 4GG6E 1NGWB 2R1WA 4KVCL 2ORBH 3S36X 1EHAA 4ZPTB 3BVNB 1Q9KB 1C8PA 4MS8D 4FFVC 5GRVL 4UT7H 3UZQA 4JJ5B 1NMBL 1SY6H 3UTSB 1GIGL 1QPPA 3RAJL 2C3GA 1A6VH 4PJ9D 4PGZA 5SX4H 3TF7C 3C6LD 3HPJA 5L2KB 1W8NA 2YD3A 5HVHC 5IVXA 5FGSA 4WTWA 4BQ9A 4NDMA 5GS0D 1NJ9B 4K9EH 4S1QH 3D39B 3BGAA 1OW0C 3MLSH 5F7WC 3L7FA 4RGOH 4OKDA 2Q87A 1D5MA 5CD5D 1NUFA 3O6KL 2R0LH 3LB6D 2JJSC 1AKJB 4YK4C 1TJGH 3O4LA 5I1EL 3BE1H 5EO0B 1WCQA 2IAMC 5MEND 2XA8L 4YHZH 1NGYA 2D7MA 3INUL 5I30L 5LWYL 1T7VA 3MRFB 3LS5H 1FH5L 5FKPB 1FL6B 3SDXF 5I15H 1QSED 5D7JA 5F9WB 4JFOA 3CMGA 3IYLW 3ULUF 3WMSA 2EIZA 1CTNA 2ADGB 3O4OB 5I75C 4BFEA 1QR1B 3HE7C 2HTLC 4PJIF 3MZGB 2BNQD 1NAKH 5AUMB 3TA3C 3BKJL 4GS7C 2NPLX 4PJ5D 1OVZA 5F9DC 2C5DC 4XNQB 2UUDH 3NFNB 4JRXD 5KSBF 1JF5A 1I8LA 2MJWA 3RVUD 5CJBA 1FLRH 1CDYA 5CUSL 3GSXB 1I8IB 2NXYB 5EBLB 4IEFB 1R3LB 5B39G 1XF1A 2VZ1A 5JXAL 3QIBD 2EC9T 1MOEA 2VDLH 4O02H 3MJGX 1DZBA 4QXGL 4F58H 3QPXH 4JFYB 5DMKB 2MCG1 5ECJE 1JZ6A 5IGXH 5I73B 5IKCB 4IIQA 4WJ5A 2W1NA 3WLWD 1WEJH 3WN5B 3GJEA 3BH9B 1CVRA 4Y16C 5BRZE 1HK6A 5E70A 2IBBA 1FG2A 1C5BH 4KKLC 3TBWA 1EHXA 3L3IA 1CFTA 5DZNA 1MAJA 3DI3B 4FFWC 2IALB 2WLZA 3MUHL 2F58H 2H2SC 1WAAE 2CLVB 3QDHA 1BJ8A 3PWUA 3D9AH 3GMPA 3MV9D 1YPZA 4RAHA 3RKDD 1TLKA 4MJIB 3OBAA 2YHGA 2QSQA 3VMNA 2NY1B 4ZTPL 4HKZB 2C1OA 4S0TD 3JV6A 4JKPL 2AJ3A 1FE8H 2L7UA 3L5WB 4KAQL 2XFXB 5C3TA 3P0VH 4GLRI 4NQED 2F53D 1U2HA 5DD3H 2EYRB 1YQVL 1LK2A 4LCYA 3B9DA 5DA4A 2XTJC 2PKDA 2V2TA 1NGQL 4JGUA 1B6UA 1UB5A 2EDNA 3FO0L 25C8H 3DYOA 3BPCB 2BNRD 3CLEH 3O9WA 4LEOB 2BOCB 2VERN 4WRLA 5FKAB 1I7UA 4X7EC 5EBWA 4GOSA 5I1IH 4NUJB 4NC2B 5F9JB 2PO6D 4XNYL 1VERA 4GKNA 5DVMA 2J5LB 3EKCA 5H2BB 4GBXA 5FA3A 4PJFE 4LSPL 3H9SE 4ZAKC 2JCCA 2P24B 1J0IA 2CK0H 4GRLB 4K2UH 5GGQH 3G5YA 3M8OL 2FCBA 4M7LT 3IU3A 3HC0B 3KPQA 5GSRA 4Z5RB 5CMAB 2NY4C 2H2PD 4UNVA 3CPLB 4M61A 2NNAA 4HWZB 1MI5A 4LHUB 3S4SB 1ZAGA 4LVEA 1T2XA 3QIWA 1ES0B 2ZUVA 3HZYA 3VFNA 5E6IC 1YY9C 1RZ7H 4X7SH 4FQ2L 3RVVC 1QKZL 2NX5D 5A2IH 5IQ9A 4UT6L 2C4FU 3VI3E 2H9GA 4F7EA 5DD0H 2QV2A 4NRXA 4XH2A 3MRJA 3TGXA 2A74B 5FYLD 1RZGA 1YC7A 3F8UB 3O3AB 5LJYH 3SDCB 2GJJA 2I07B 3HMXL 3FOMB 4NUGL 5JQHC 2CH8A 4FZ8H 1X3DA 4TTGA 1KCRL 4LRIA 5IW1B 3O11A 4CGTA 1F4HA 1NFIB 2Y23A 4Q6IC 4HWEH 2FJGB 4RRPG 1S8DA 3JUZA 4XZUB 5JW4Q 5FUOL 4YDVA 1FNLA 5IJKA 2K3TA 3KR3L 5JDSB 2VLKB 3BT2L 5ID0B 4X99B 7FABL 1EV2E 3OKMB 3PDOA 1K85A 4K7FB 2CIKA 4HXBH 4JFQB 5KOVC 1UXWB 4ZDHB 4J3UA 2FBJL 5GISH 4D3CH 1T04B 2Q8BH 4KZEL 3HS0A 5C09A 4POUB 4PG2C 2IBGA 5T3XL 1LO3L 4M62L 1ZHNB 3EFFB 5EUOA 3SJVA 3CFIC 3WUWB 3C6SA 1CICD 3IDGB 3MODH 5E08L 5EOTB 4JB9H 1MFEL 3KLSA 4PV9B 3GJFB 4L9LB 5DA0B 2IH1B 3BESR 2HA1A 2V7HA 4N0YH 4DK3A 5IB1B 1EFXD 4RMVA 5EB9A 3DVGA 5GRXG 2OK0L 4AZ8A 1NSNH 2P47B 3CJJA 3JTSB 1Q9OA 2O5XL 2Q6WB 3IDIB 2Y4SA 4XHJD 3U48A 5JXED 3HB3D 1LWRA 4NN7C 4OAWB 3ZDYF 4L4TD 4P5TC 1TQBC 2AP2A 2HLFC 2GK0A 1KSRA 3U4BL 5C0DA 3R1GH 4DJMA 1C1EL 1BBDL 5DHVH 5B3NA 1J11A 3CXDL 4KGJA 5CGYC 5DK3A 4ZQKB 4TQEL 4KZDH 4NO0A 2FO4B 3QDGB 4KHXH 4X6BA 2NTFA 1BIIB 4PRAB 4OLZH 3IJHB 1QBLL 4S1SH 2AABL 3GSUB 3IGAA 1HDMB 1KUMA 1M1SA 1JWUA 1IC5H 4YHYC 1FVCB 1HHKB 5DURB 3U30C 2H45A 1NLBL 4MNQA 5KAQF 2W0FA 3RRQA 1JPTH 4GAFB 3SDYH 3BI9X 3A6CL 2FIKA 1ED3B 3KJ6L 1YEEL 1QRNE 5E94B 2JIXB 4X83A 5C8JA 4ELMB 5IQ7H 2OJZH 1MFDH 3X14A 5DHVA 1KXVC 5GGTL 5ESQB 1B4RA 5C0BA 2MMXA 4NN5B 1V7ML 4PJGE 3RIAK 1INQB 3NACH 5HBBA 3SY0A 3TVMB 1IM3A 4AENB 1MF2L 3OKEB 3DVIA 5KVMC 2XY2A 1DVFD 5C6TH 3GKWH 1QFOA 3U2SB 2QADB 1NCCL 3DPBA 1BBJA 5BV7B 3EDKA 4GAYA 4LCWB 3QCUL 1MJJB 2UWEA 1BQHG 5D7KE 3D0VB 2ATKB 2DN7A 3LOWA 3MGTB 4Z7UF 4XAWL 4PGCA 5D7SH 1Z9OA 2Z93B 1ZT7A 5L0QC 4G6JL 1MJ7L 3LD8C 3HN3A 2ZUYA 3G5ZB 3C60B 3UPAA 2ICWA 3VJ6B 4JM2C 2FH8A 3HI6L 4MDJB 1EUTA 4ODXA 1FDLH 2VDML 2VQ1B 1GGIH 3GB7B 3X3GH 4GRWE 2X1PA 4PGBB 3VG0H 2PTUA 2XRAH 1T7YA 2IAND 3N1FC 4X7FC 1AP2A 2V5TA 3OKKB 5F3BB 3OJDB 4RGNE 1L0YA 1KJ3H 3KXFA 5I1DB 5FCSH 3OAYK 1CXEA 3O8XA 5SWSB 4F37F 3V7MA 1INDH 2ZPKL 4N0FB 2DJUA 2MHAB 4O4YL 2NY3B 1BQUA 3ARBB 1ZE3C 1KB5A 5HI4D 1A7RH 4WV1B 1D6VH 3QZWB 3MRGA 3HAEH 2ZZUT 2J8UB 2XZAH 1JPFA 1OB1A 3T3PE 3BQUB 2N1KA 2QHRH 5C08D 4HIIA 1YJDH 1QBMH 2VDKL 2J7LA 2Z92B 4FQQA 4JFXA 1QFWM 1SYVB 4RWYL 5IW6B 1A1OB 1BFTA 1MPAL 5CJ5A 4M43L 3EHBC 4ORGA 4LPWA 3QR2A 3GM8A 2YR3A 2JJTC 1LO4L 4XI5C 1PSKL 3GJFH 2BVTA 4N0CC 1P2CA 4FABL 3G9AB 1WK0A 4NO3A 2FZ3B 5DJ8B 1ZHLA 5J13C 1TVBB 1BQLH 3VXPA 4KQ4H 1QNZH 4XP5H 1Q38A 5FIEA 5IWLA 1QBAA 2FECI 2VLRB 3CIQA 3P4LA 3T8XA 4ZOBA 1I8KB 5F1NB 2PF6A 4OFVA 5D93C 3WO3B 4LLQA 1ZLUK 1UWEL 3FT3A 4OCYL 3MJ9H 4L8BA 1FNEA 2C3VA 4L8SC 3RZWA 5E8NB 3HG1E 4MHHG 1YYLL 3ZT6A 2KKQA 1C12B 3HUJF 1XGPA 5K9KA 3U7YL 3TPKA 1MCLA 4HS6B 4FQJL 5EC1A 1H3GA 5EZOL 4C56E 4ESKA 4PGDA 3MLRH 1D5IH 4HZLA 1P7KA 5AAWA 1U95B 3UTZB 2GITA 2XT1B 2OS7A 2P44B 5DFTA 1EJ6A 3PDGA 4LFHG 5DD1H 1KCSH 1KGCE 3LCYA 5IFJA 2ADJB 3VCLB 3ECBB 1AD9B 1I1FA 4WW2A 4CDGC 5IMMB 1L7IL 5EU6D 4HUVA 4FN0A 2YKLH 1IFHL 2AI0L 3F7RA 1U8QB 3DLQR 5E9DA 5F1SA 1JGEB 1Q1JH 3NIDF 1J1XH 1IQDB 2ZCKH 3O45A 5D2NB 1A3RH 2ZUUA 5D7IB 3MJ7A 4MSWB 3L3KB 5C0CE 4CVXB 4U6HB 4NQDD 3FRUB 2YZ1A 5BV7H 4P23B 3JWOL 1X4ZA 3PGCA 1JNHB 3VFWB 1I8MB 2FD6H 3OX8B 2AEPL 1T89A 2YPLB 3IDYB 1HSAB 2WBWB 2EYSA 4XWGH 4YHOH 5TDOA 1KTDA 1T80A 4OCSL 3LKOB 4QRTB 5ILTL 4IOFD 5ETUB 2DD8L 3DX9A 2HLAB 1KEGH 2EDJA 4Y1AD 5D4QA 5E8DL 2B4CL 4Z7VB 5FK9A 4P59L 5SWQA 3PWJA 2PTVA 1CGSL 1N4XL 4XXCA 4X6CE 3TBTA 1BAFL 4JY5L 3UTTB 2FX9H 4EUPB 4JQXC 4NCC1 4OLVL 5HGDA 4NKDA 4P4KC 1MCDA 4LPXA 3UAJC 5DQJB 4CU8A 2ENSA 4LCCA 1RK0B 1CXKA 1EAPA 1UM5L 3DV6A 3GIZL 4HIJB 2EKJA 2GHWB 3SKOB 3O3EA 3U46A 2R2HB 2AJSH 2DTML 2PN5A 3EUUA 1ZS8A 3QO0B 2APVA 1UACH 1RUKH 1YNTA 4R7DA 4MA8L 1PKQE 4MA1B 1TFHA 4DW2H 4QXTA 4TUKH 4OGAC 2XQBH 4NNYB 3D18A 2Q8AL 2YRPA 5C07D 4EZMA 1YY8B 4EOWL 3HR6A 3TBYA 2MPAL 4N0UB 3RI5F 1CK0H 2DQDH 3SDXA 1CFNB 1TCMA 3KPRB 3NMEA 3VGDA 4HX1A 1ONQA 1AGDA 4FNLH 4J4PA 1EA9C 5D71L 2L0DA 4X0KA 4DKDC 1EH9A 1UVQB 2DQCL 4JFEE 5DD5H 1FV1A 1V7NH 2VUYA 4ZTOH 4XXDB 3QUXB 1BHGA 4DQOH 1R3IH 5IFAL 3MRRB 4LASH 3C2AL 2YC1A 1R24B 5HHVL 1MI5D 3QIWD 1U6AH 1GGTA 1U0QA 4NWTL 2OJEA 4O9HH 3ZE1E 5GRJL 3GGWB 3WSQH 4TNVF 3W39A 4NKIH 2FECL 2N7BA 1KEMH 2OR9L 2A6IA 4QHNB 1KT2B 1LO2L 3CC5A 5J57B 2NW3B 3MBEC 5ELIA 2H6PB 3QEQE 3ARGA 5D9SB 1B88A 5GGSB 4BQBA 4OF3A 5ISZE 3UPCA 3MRPB 2EDQA 5LKNA 3ILQC 2Q86B 3OV6A 5C0JA 1KIPA 1U91B 2Y7QB 3DWTA 2C4XA 2DYPB 4H8WC 3F7YB 3NN8B 2M2DA 5ITBH 3H0TB 3I6KA 5TH2A 5E6YA 5IFHH 3JWNC 1MIML 4HKBB 4G80A 5DK2A 1F3RB 3VWJB 2GTZB 1RFDH 3ARTA 2VQTA 4U1LB 3ZMRA 1T0MA 1J10A 3GSQA 4S2SB 1S9VA 5HTSA 1QFWH 2VB5A 5CEZL 3PWPD 4XNZC 2ARJB 3WD5H 4JPIB 5I9QB 4LGSB 2NMSA 1HYSC 4DEPC 4TSAH 4XVJH 3OR7B 4HXAH 4L3CA 5KVEL 4G6ML 1IEBB 5C09D 2EH8L 4FQIH 3ZKXB 1BECA 1F6AA 2M26A 1T5WA 2IH3A 2F8VA 2CIIB 5CS7A 5ENWB 2HH0H 1AFVH 4HPYL 1V3LA 2QSCH 1IM9A 5JIIA 1H8SA 2N7AA 4WHCA 2X70A 1MHCA 4KUZH 5CJOL 4AMKL 1EEZA 2Q76B 4LSTH 4TRPH 5CP7A 4UDUA 5JORB 3OAUL 1RIUL 3OF6D 1IAIL 4K3HA 3EYQC 5T1LA 1BJ1J 5JHDB 1DBKL 3STBA 5EFIB 2HAZA 1RK1B 3TCLA 4X6DB 3RX8A 4WUUD 1WTGT 4OCWH 4C59B 3LEVL 5IF0A 2FR4B 2D7OA 4KFZC 1ODAA 2V5SA 1NUNB 4ODWA 5C0FA 1UGNA 2VAAB 3F6IA 2IFFL 4BZYA 5F8RC 3BPOB 3F7VA 1QACA 3HC4H 4UB0L 4KRPB 3V4UH 3OZ9H 4G9DA 4Y4KC 1L0QA 4EI5A 4DTGL 4NO0D 4N5UA 32C2B 3OJVC 1O7VA 4GMTL 4B41A 4XNXH 3VD4A 4OZFB 5H8DA 5KVFH 3KPPB 4N8VG 4YC2B 4I48B 4RMWA 1CU4H 4MNQD 4PRPA 4NQCA 4CBPA 1MH5B 4UU9A 4YHKL 4MNGE 4P9HH 3T1WA 3ALXA 4KI5D 2P48B 1HHIB 3DECA 4XP9L 4EVNA 2FLBT 4NZUL 2Q1EA 4D0BA 4GH7B 4PJDB 1U8HA 1BVLA 4BELD 4K94C 3W0WA 1MWAA 1XGYL 2F8XC 3LEYL 4X5XA 5C0BD 5TDPB 1CGYA 4DZBA 1MNUL 2X89A 3F7QA 2PYEA 4D0CB 1I1AA 1MREH 3DMMA 5D5MB 1ZWIA 4QTHA 4R4FH 4IOSD 5KVDH 4L8DB 3MREB 1F5WA 1BF8A 1OCWL 4JFDE 4YXHH 3ZYJA 2CLZA 5IMKB 1N64H 1S7TA 5E8OA 4EN3C 1G7MB 2H1PH 1FFNA 2JK5B 3P0GB 4LL9A 4EJ1C 5JW4M 4K07A 4LSDA 4U6VH 3HE7B 1RURL 2YPVL 3K46A 5CHNB 1B0RB 4L29A 2GY7B 1HHJB 2UY6A 4RNRB 5F7FA 1UM6H 4M6NH 4ZS6C 1F2XK 2C7UA 4H5SA 4JPWL 3RX7A 1BLNA 5LAXB 5DJZB 4FQXA 3AU1B 2ZUTA 2EO1A 4AL8H 3BH8A 2YZ8A 2X6MA 4FQCH 1BVKA 3L6FB 1R5WB 5BVPL 2OM5A 4F7MB 1IQWL 1U8IB 2N4IA 4ALAH 4ENED 4LSUL 3QJFA 1G7IA 2WBJB 3KNBB 4D0DA 1ZSDB 1QFHA 3KXFD 5I8CA 3DV4A 3O8XD 4FZEH 2BZDA 1K8DA 3DRQA 4RGNC 3RZCB 2VDOL 4WNQA 1E4XI 2RGSA 1IKFH 4FRWA 4KJQC 5B39A 5BS0B 4M6MH 3GMLA 2W59A 4OZHE 4HDIB 2F5BL 1WGOA 4FTVB 5FF6B 1CLYH 1B3JA 3QT2A 1DBMH 4Y16B 4XTRC 1IC7L 3BUYB 3F65A 5EOCJ 2ZOLA 3F62A 4GAGH 2X4OA 1NAML 1A21A 1LP9E 2CLRA 4NYLB 1WFUA 3BP5B 2B0SL 1XF5A 2AK4E 5MENE 1KCUL 5IMOB 2BC4B 5EBGA 1AR1C 1FRGL 1T0NB 4K3JL 3NA9L 3UX9B 1X6NA 3ARDB 3DRTA 4ODUB 3RPIB 2R4SH 1CQKA 1LO5A 2QSTA 5I8KL 1QSEE 4G6KH 4OLYL 5F6HI 4OJFH 2ITCB 4QRPA 4WWKA 4ZXBA 2IC2A 3KYNB 5AYQA 3ZE0E 3QEHA 4KRLB 1D5ZA 2PW1B 4NO5B 4X4YB 3VH8G 5IROC 2RBLA 4P46A 5IK3B 1IC4L 1NCWL 2WK2A 4PJ5E 2FSEA 4PBVC 4CADA 4F7CA 3MRDA 4JRXE 5B21A 5KW9L 4TPRH 2D03L 3A6BH 4RFEB 5CD3A 4YR6B 4AIZA 3ALWA 2HT2C 4JO3L 4MGXA 1G9NL 3AUVA 2VL4A 3X11B 3T4AA 1C08B 3FO1A 5J11C 2DQHL 4X4XA 2ZJSH 3IFLL 3MO1B 4PD4K 5TE4L 2UZIL 4XPTH 4GUPA 1TCRB 3LKRB 3TIDB 2Z8SA 1R3KA 2DJSA 1TZGH 5HYJB 3IJSB 3UJJH 3SQBA 1FL5A 3LKNA 4KJPD 3BP6B 1U42A 3EDEA 3X12B 5J12B 2E9JA 4M7ZC 5LVEA 3MRBA 15C8H 1CWVA 5ALCL 2X4TA 3I02A 1S5IL 3ZZ1A 4PJBE 1NGXB 4U1GC 4MQTB 5E9DD 3O2DA 3I6GB 4PJXE 1KG0B 2X40A 2AXGB 4I13B 4O2EB 3DUSA 4F37K 5E6IB 3CCHA 43CAB 2GUOA 2X4QA 4KWUA 2VR9A 5EOCL 4O51B 3MV9E 1KC5H 4FQLH 2P8LA 4LEXL 4LSQL 2VDPH 4P2RB 1F13A 2P5ED 4WTZA 3REWB 4U0RC 1H3XA 4W4NA 5DD6A 5F6HJ 3MUY1 2F53E 1JHKH 3MRLA 4LQFL 3T04D 4MQ7B 2GY5A 4LDLB 1KYOK 3CX5J 3RWCB 2WWKO 4Q6IB 1X4YA 3RWHB 3LAFA 2X41A 2G5RA 3MACL 3CH8A 2NY5C 4I2XA 2VLJB 1U8NA 4LCIL 1SM3H 4V1DE 3V0WH 1A4KA 5I18L 3SO3C 4QRSA 5IMLB 3UO1L 4RRPA 3B2UD 1BX2B 1RUQH 2R4RL 4PRHD 2VIRA 3SGEH 3HZMB 4L5FL 1G9EA 4ODSH 1T20A 4HC1L 2YXFA 3QUZB 3KPNA 4M8QB 5KVGL 4NBYB 5GZOD 4PYGA 4XCFH 4NJ9H 3ZT5A 1ZXQA 1HHHB 2G5BA 4RGMC 2HG5A 3WS6C 1CS6A 5I1HL 3UBXG 3RWEB 3DYMA 4IRSD 2PTTA 5ERWB 2DRUA 4I5BA 1Z0NA 5CLTA 3BKYL 2GYSA 1Q94B 4JFFA 4HQQL 1M7IA 3V52H 4YHNB 2EKSA 3BP4B 3MOBH 1QTYT 2I26N 2G2RA 3CUPA 5F96H 4DGIL 4ELMF 4GFTB 4ERSL 4N8CH 1GGBL 2FEEL 3TH3T 2WP3O 1TZIB 2NX5E 4JPVL 4OD3L 2VZVA 1CLOL 1CT8B 4RFOL 1F8TL 5KN5A 4HGMA 1A1MB 4J4PD 5BJTA 1TQBB 5EUKB 1R3JA 5FYLE 3EYSH 2Z35A 3NCMA 3PGFH 1W72H 3D3VA 3DXAA 3CDYA 2DLIA 4JM4H 5FYKE 5JOFA 4UV7L 3VWKB 1CDUA 3CK0H 2V9RA 2OTUA 5DJ0A 5HY9B 2J6EA 2VITB 3L3JA 3ULSA 1G0YR 3TNMB 6FABL 4HAFA 5ADOL 3VA2C 3IXAB 4Y5VC 4Y19A 4H8WL 1XGUA 2FGZA 3HI1B 5E00A 3QEGL 3V8OA 1IAOB 1QZ1A 5LG1A 2Y6SC 2HT3D 2XN9B 2H3NA 1PBYA 3HMWL 3PHQA 1YEHH 3K8MA 1U8LB 4AYFA 1H15A 5GGRY 1W72A 3RBGA 5I76A 5E2TL 5F89A 2DQGL 3TNNB 2VLLB 1SYSA 1MQ8A 1Z5LB 4ZYKA 4YPGA 1UFUA 1X7QA 5TDNA 1IL1B 2GJ6D 3ARED 1GC1C 1NGZA 4PJEB 1JHLH 1F58H 3D0LA 1GAFL 3EJZC 1EJOH 4YHPB 4LLDA 1A5FH 3R06B 1NEZA 4PTUA 5CKAA 4Y2DA 3PE9A 3U1SL 4BSVB 4L9DA 5CCKL 1R6VA 4ZUSA 3WEXA 4D9LH 2XWJA 4NC1E 5L0QB 1E4KA 1AXTL 4HWBL 3C5ZC 4JZNB 2BNRB 4YDJA 5ADPH 3VXRE 1I1YA 4L4TE 5IG7A 4ZAKA 5K9JL 12E8L 3OG6B 4JR9L 2DLTA 3W5NA 3WE6A 1RULL 2V2XA 5MEPB 3PV6A 2NLJA 1Y0LB 2DQTH 4QY8A 4TVPH 4HUKB 4F7TA 1IGCH 5T1LD 5ICZB 1MCFA 1E6JH 4I18A 3DUUA 2UYLB 5C92A 1SJXA 4U1MB 1XR8B 5ID1A 4XVUC 4KDTA 4GXUN 1S7XB 2F19L 3M1BA 4PRDB 2DI9A 5EN2A 1HEZA 3BOVA 3BDYL 2MNUA 3Q5TA 2O93L 3CZFA 3C08H 1L7TH 1UZ8B 3KPOB 3NCCB 3LZFH 2FB4L 5HGAB 1DBJL 2CPCA 3VXUB 5JNYB 1OPGL 4EI5D 3FT2B 3TESA 5LGJA 5FDWB 1Y18B 1AO7B 4MA7L 4MD4A 1L9MA 4M1DL 5DUPL 4JO1H 2HJFA 1FFOB 2MCPH 2ZSVA 3MRNA 1OAKH 4RISL 4C55A 5T1KB 1EZVY 4PRPD 5JIPA 1CL7H 1JWMA 5D7LA 5JOEA 2EXWD 5MERB 1H5BA 1A7NH 3E1F1 1IT9L 1KN4L 3NBNA 2EH7H 4PB9H 4G6FD 3VD9A 3B9KA 3FQXB 4GKSA 1NAMB 3F5WB 4UILH 2EIEA 1W0VB 4R0LC 3QHFH 3CLFH 3NH7H 4HJGA 5D1QD 3W0WD 2H32B 4DKFL 4I9WD 5HHNA 1DN0B 2WINA 4U6TA 5ALBL 4NJAL 3ELAT 1U3HB 1HCFX 2I24N 2FLRT 3QXDA 2X89D 1FCCA 4AQOA 1JV5A 4U1SB 5DYOB 3RU8H 1I1AD 3ZKNC 3JVGC 3WS3B 1U36A 3DMMD 1VADA 4PJAB 4PUBH 3UTPD 5IJVA 1QVOB 3QWRA 5D7IF 1KJVA 3OMZA 4J1UA 2GI7A 5DRNA 5J9PA 1LGVA 3MTRA 5CSZA 5GJSH 3PWVA 2GJZB 1PEWA 1WBXA 4MX7B 4ODTH 1DQQA 3VXMD 4AG4H 1K5NB 3OKOA 2B2XL 5GGUB 5T3ZL 1JK8B 2WNGA 5F9OL 4XVTL 3RVWC 4K8RD 2ADIA 3RTQC 1N59B 4Z95H 4EI6B 5HHOB 1VFUA 4F80A 3O6FB 3SGKC 1MJUH