3KCPB

Crystal structure of interacting clostridium thermocellum multimodular components
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
163
structure length
163
Chain Sequence
SSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Cellulosomal-scaffolding protein A
publication title Insights into Higher-Order Organization of the Cellulosome Revealed by a Dissect-and-Build Approach: Crystal Structure of Interacting Clostridium thermocellum Multimodular Components
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
total genus 33
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kcpB00
2JH2A 2VO8A 5AOZA 1TYJA 4IU3A 3UL4A 4DH2A 5LXVA 4IU2A 4WI0A 5K39A 3F2LA 1AOHA 4FL4B 1G1KA 4UMSA 3KCPB 2W1NA 1OHZA 1ZV9A 3KCPA 2OZNA 2O4EA 3BWZA 1ANUA 4U3SA 4FL4C 5G5DA 4UYPA 2VN6A 4UYQA 2VN5A 2BM3A 2CCLA 4WKZB 2XDHA 3FNKA 1QZNA 2Y3NA 2ZF9A 3L8QA 4N2OA 3GHPA 2B59A
chains in the Genus database with same CATH superfamily
2NQDA 2AV7B 4LCYB 2BVQA 1JRHI 4HVBA 2E86A 3PAZA 3MRQA 5HPMA 3RI5F 3W5NA 1WZLA 4K3JH 3AITA 5C0GB 4IU2B 4L8BB 1FYTE 4CVZA 3HBPA 4BZYA 3B6SB 5AW4B 1BD2A 5HGDA 1R3IL 2W60A 4PWHA 3WUWB 5EV7A 2XQYG 5TE6L 4FG0A 2NR6D 5BMFH 3L48A 2BS8A 4HWBL 4IGBD 4EI5C 2G4GA 1Q1PA 3GSVA 4OV5B 4KU1A 3DX9B 4CC0A 2YD8A 3UZQA 5C08B 4LLYB 3W38A 1UYWH 1SN0A 2LU4A 3CDYA 2CNYA 2ZUSA 3LTVA 3ESVF 4JGMA 4RGNC 5CGTA 2HTLC 1IKOP 3EH2A 1FGNL 1KTBA 5I15L 2XFGB 5J1AB 3U1SH 4NO2A 1ZY9A 3OG4B 3OBAA 5KVGL 3QUKA 1IEBA 3ULUH 1TTRA 1XB3A 3FUNA 3SDCB 2CMRH 3ABMB 4NAMA 4K7PX 1H3UA 1DBML 2J71A 4WHTA 2DLTA 2OS7A 3X12B 4FG2A 4R3SA 1D9KC 5L8KB 3SE9L 1LO4H 5EEVA 2P8PB 4GY4A 1RZKC 2JLLA 1UXMA 1C5DB 2ZG3A 2XWDA 2V2WB 3O81A 3RIAK 2IMMA 3F85A 4N5EC 1FL3B 1FN4A 2X2UA 2XG4B 4LVOC 2NYYC 4F58H 5I66A 3WI9A 2BXZA 4UZGA 1C1EH 1TJIL 5EU3B 3GBNH 2IDCA 4S0SD 5GS0C 4ZTPH 1LGVA 4PCSA 1UWXH 4YXLH 3E1ZA 5AKSA 3T8XA 4ECNA 4AKOA 1WBXA 4IBZA 4UQ3B 3QNXB 3SE4C 2VAJA 4NCDA 4N25A 1KEGH 4LPWA 4QIRA 3SQRA 3KWVA 2NYZA 5CJ5A 2P46B 1QPPA 4H40A 3BLPX 3VU2A 5AOMA 1IZJA 3FRPA 5F0LB 4DGVH 1R4XA 1XMEB 1J8HE 4K7PL 1BPLB 3A5VA 3HLAB 3IJ7A 3AMKA 4BDVA 2VDLB 4EOWL 3RURA 3EYFB 4OQTH 3LZRA 3B2VH 1S5IL 1SEQH 2QQNL 4UIMA 1TYRA 4XP1H 5CUSL 4MSWA 2C1OB 4XBEL 5D8JH 1KFAL 4FNSA 3VE0A 4BE5A 5IESH 2PPCA 3RTQB 1GYAA 4UQAA 2G4EA 2H32A 1FLRH 1RVFH 4BQ8A 1IC0A 3NJKA 4IBVA 5LDSA 4PJ8D 3L3HA 3RAJL 2NLJA 4KZEL 1QTYT 2CLZB 5AW2B 1NFIA 3ULSB 1ORSB 4CMMB 3TEZA 4XXCA 4F7EA 3LKNA 2ZUQB 3P2BA 3V0HA 4Q6KA 1L3NA 3KPQB 4PB9H 2YGOA 3NA4A 2YOCA 3N44B 4YDIL 2J1ZA 3HUJE 5BV7L 4ZAKD 2HA1A 2LVCA 1LL1A 3UO1L 4NHCH 1QR4A 2X40A 2F8OA 3FKUS 2IPKA 3F7QA 3G04B 4DGYL 3HZKB 2R15A 3NZ8B 3P02A 1WAEA 3SEPA 2BJML 2HLAA 4RNRB 3VVWA 5L0QB 5GPRA 4QRUB 2QPEB 3BWSA 3K8KA 4G6MH 1S7UA 4WU5B 4IRSA 5I9QC 4UZUA 4LPCA 4G1MA 4UDUB 4YZFE 4F2ME 2EDMA 1YPZB 4LSUL 3VI4A 5I74B 1J05B 1A22B 5T5FL 5MEPB 1CFBA 4KTDH 3UTPE 2WQVA 5IVNA 4AMWA 3ZPDA 6FABH 1CS6A 4GSDL 2GHZA 4JHAH 4NRYB 5BUGA 4Y4HB 1DP0A 5BS0B 2EVHA 1U8HB 3P30L 5DJ0A 1Z9MA 2WIIB 5BXFB 5GGRY 3NIFB 1XL6A 2R1XB 1UKSA 4M1GL 1KIRB 4HF5L 3V8OA 3QWOB 1SOXA 1OPGL 4U1HA 3KWWA 1JK9A 3V4VH 2H47C 4WJ5B 5DTFA 2H2PD 1U8QB 4PR5A 1CPUA 1O6SB 1AS7A 2EDEA 2A6DA 2BNQB 1MJ7H 3UCRA 1UHVA 1MJ8H 5HHQB 2K1MA 3WIHA 2HG5A 3W39B 1F58L 2FYYA 2KDGA 3K8MA 4GP8B 4ORGB 3FBKA 3CVHH 1BGXL 3I50L 4XP6L 4RGOL 2WUBL 1GYVA 2CGRL 5B3NA 1PD0A 3D0LA 3VRLF 4C58B 1U2CA 1U58A 2EYRB 5L8LB 4MJ5A 4QKTA 4OFDA 1NEUA 3LZLA 3G5YA 4X6FB 2O5XL 4M93B 2MRYA 3TH2T 3AG4B 1YECH 2R4RH 2VXSH 5JPMB 1BFTA 4M8QA 3FSZA 5C07D 5T3ZL 3TFKC 4XPAL 1WWAX 4TOYH 4YWGL 1SDYA 4J4PD 4PTUA 2V2XB 2IF7A 3QJHB 4Y9BA 5ITFB 3THML 4KKCD 2QQQA 4K5OA 3CZNA 4L4VA 4QOKE 3FB6A 4DP6X 2ZF9A 4L9DA 3BZ4B 1I7TA 4HU8A 3KPNA 1T7VA 5I1KH 2WSKA 1UZ6F 2P45B 4HC1L 4F15C 1DQMH 2EINB 35C8L 2XFXB 4C55A 2NNFA 4G1EB 5BNXD 2OAAA 2PPAA 3BDXA 4KO6A 2BC4A 4G2AA 1JMXA 2WXLA 5T1LD 4AXWA 5A6LA 3HG1B 2DQGL 5AOKA 2M83A 2Y6SD 5DA4A 3FT9A 4OT1L 5CLWA 4OIFA 4IHBA 4Z7VE 5E2WH 2XYCA 5J6SA 3LHPL 1BYOA 1ZAGA 4XX1E 1SHWA 1M3IA 3ULUE 1RD6A 4FQCH 3W9EA 5H4YA 1EGJA 2PW2B 1VEOA 4KV5F 1PQZA 3QIBA 3QE5A 3DUUB 1NTDA 3B9AA 4GKSB 5HVWA 4WY7H 1FA4A 2Z0BA 3QDGA 3U6XA 2PPEA 1JXFA 4NHUB 3GTTA 3VG0H 2F08A 4G42B 1X5XA 2X4TB 1FIGH 1DJZA 1BWWA 3IJYB 1UWGL 1S7TB 2FBJH 4E0RB 4ZW7A 1EO8L 1YMMA 1JHKL 4BA8A 3GIVB 4ZOCA 1B2WH 1BZOA 4NZUL 4JDVA 3F00A 1IM3D 4ODBD 1T83C 5DEFA 1URLA 2HX9A 4GLRH 3ZGIA 3WN5B 5T1DL 4AV5A 5IR1B 1S3RA 1BECA 2FECI 2QSCH 4HT1H 4L8CA 4L1HA 3V0EA 2KUTA 3T04D 3TN0D 4U49A 5HHOB 5H94B 3I84A 4HPOL 3L95B 2YGQA 4LOFA 4AKQA 4EDWH 3II1A 4WK4B 1I4FA 3EG9A 3L13A 4H0HB 4YHLH 2DEXX 2YBRA 3DX2A 3V8CA 4EIUA 5IB3B 2CDGB 1KCSH 2IJ0C 2ORBH 2FEDD 3OSVA 5D6DA 3WFBL 2EH7H 3ILPA 1UC6A 2YARA 4OFKA 3K6FA 4X7FC 3HAEB 3SJVD 2GC7C 1EIBA 4IRZH 3WKML 1BQHB 3EXLA 4HJ0D 4S1DD 1GHFL 2OXHA 3Q1SH 1DSWA 3WJLC 1N2RA 2OJEA 4OD1H 1DN0B 1VPOH 5E8PB 1R5IA 4NYLA 1N19A 1E50A 1IVLA 4L3AA 4OF0A 3EADA 5F0PB 2E3VA 4X2UA 4D8OA 4K7FB 2JJTA 3KH3A 4CW1A 3DOSA 3VI3E 2V5TA 2FRGP 4N2IA 5B1AB 2R0KL 3PREA 3HE7A 4TLKA 4ZJ9A 2B5IC 2VDQL 1Q0YL 4FTVE 3Q13A 3MNVB 2BS9A 2AI0H 3DO3A 3QJTB 2F54B 2DQDL 5T33H 2OA9A 3UTZA 5CN3A 4AGMA 2YZ1A 4OCWH 2R8SL 1BYNA 3TJEH 3QQ4A 1A6WL 4LARH 2YAHA 3QDJB 2OCJA 4ONFL 2Z65C 4GIAA 5DHEA 2CLVA 1EAQA 2AJYL 3DVNB 5SX5K 3BGFB 3SN6N 2EIZA 4KFMA 2K3TA 4DFHA 1DJSA 1A6VL 3QZWA 1J9TA 3TYGH 1SY6A 2Y72A 3MACL 5I1GH 1MFUA 3QISA 1MDAA 4HKJA 1ZT4B 2NTFB 1E8YA 4EUPG 1OGPA 3H42L 2MPAL 3NRFA 2P5EE 4KNQA 1G7MA 3CVDA 3ZT5A 4C56E 4D9LL 2VZOA 3KJ6H 3KDMA 3ZHKA 2YPVH 1B4RA 3UTTB 4KQ4H 2A9CA 4PLJD 1ZSHA 1RL1A 2F7IA 4UDTB 3U46B 2JK5A 3B7UX 1KELL 1T6VN 3BP7B 4I3SL 4R0LA 4FQXB 43C9A 2QGBA 3N3EA 2ZUQC 3ZDXE 2OYMA 2J5LB 1AFVL 3UFIA 1T0MB 4JFTA 1MLCA 3NEEA 4R4FH 3ATBA 4TKWA 4OTXH 3IMWA 4AIXA 3UBXA 3EO9H 4V1DA 4E5XG 3RVVC 1A6AB 4JNXA 2JTYA 5GS0H 3EOTL 5E6IA 5E8DH 5DK2B 1MXDA 4JZJB 3MNZA 5L0QC 1GJIA 1BEYH 3U4BL 3DHJA 5EUKB 1MHHB 1E5BA 1U8PA 2NZIA 4WHDA 4G7YH 2UWEF 2I07B 4ZT1A 5GSVB 1F11B 5E6YA 5D1ZC 2N0KA 5B1CA 1FAKT 2C1PA 1EEZA 4RIRB 2APBA 3QS3A 1WK0A 4UANA 4TMPA 1DDHB 4XZUB 4UV4H 3PGDB 3ZO0A 3NESA 3IJHB 4OGYH 1EX0A 1G4RA 4OLZL 4DN3H 4ZMYA 3PS6A 4LU5H 3SGKC 1CVRA 2DQEH 2FJGB 4XOBA 2D7TH 1WS7A 2WN3A 2ZSWB 5AVYB 4AVKA 2UVEA 5IEKA 4HZLB 5FFOA 4OIAA 1T0NB 1KCUL 3ALXA 1A1MA 3I75A 4P5TD 4H0IA 1UM5H 5IBTH 2I60H 2B7DT 3U4AA 5JO5A 1CQKA 3IWVA 4PJHA 4LLAA 4X6BA 5KYXA 5C0JB 1J1PL 2Y5TA 4OLWH 1BHGA 1PEWA 2FLBT 5IJDC 1FG2B 3VFWA 4ODTH 3SBWC 5ADPH 4Z3GA 1NL0L 3FCUB 1OAUH 4P5MA 4HLEA 1I1AA 2XWRA 3C9NA 5GS1C 3ZKQD 2IXQA 5DEGB 1C7SA 1KC5L 2L7QA 3IEAA 2BM3A 2VB5A 2HLEB 3HG3A 1GCFA 2ZCZA 4FXKB 5ESAA 2BCKA 8FABB 3BZEA 5JOFB 3V0JA 2BOCB 4BKTC 2YHGA 2WZPA 3SO3B 1KLFB 1P7QD 4KBPA 4FQJL 4XOEA 5F6HI 2ADIA 5LB1A 3RWCB 2HJLA 2FIKB 4WFEE 1FFRA 2GG1A 3C5XA 5AG8A 4M6AA 5EHFA 3ISRA 5JPMC 1OP4A 2AQ3A 3U1QA 2QADD 5ECGA 1CDCA 1M4KA 4BFGA 3KM1A 1D2OA 4YHIB 2OXGA 3QHZL 1N10A 4TUKL 3GI8L 5D2NE 4P2QD 5ACZA 4ZX5A 1LP9F 3NJIA 5CD3A 1DCLA 3SBQA 3DSFL 2ITDA 2QPSA 4LAQH 4BFEA 2YQBA 4K4KA 4XCFH 3K6NA 3UPRB 2EYSB 2AJUH 4AM0Q 3RE0A 4E9XA 1A7RH 3F7LA 3BE1L 3FU7A 1U6AH 3U6RA 1C16B 4H8PA 4PB0L 1MKFA 3K1DA 1BPVA 1E5AA 3ZSSA 4F3FA 4OI7A 3HHRB 4G8EA 3MREA 1JHTA 3HC4L 1KLUA 4GRLD 4WGVB 1PEZA 3HMWH 5KYWB 4EIBA 2YD5A 3L7EA 1YAIA 2X4NA 2P8LA 1BAFH 4BQ9A 3K72A 2SODB 3LVEA 2OCFD 3BXNB 2OTWB 2EJ1A 1U8OA 3BH8B 4NQED 3WFEH 4YHZL 3TURA 4X99A 5HJ3B 1T5XA 4KRNA 2APFA 5GXBB 5DMKA 5FA4A 4KQ3H 2G5BA 1MI5E 4GUPB 4JFYB 4X4XB 1URZA 5FO8A 3DMMD 2A5UA 5T5NF 3TNNA 5KSUA 5TQ0L 4BFOA 1R19A 4APQB 4Q89A 4WKZB 3RG1C 1E90A 3FFDB 3QUZB 1ZA6B 2VXVH 3U9PH 1JWMB 5C0FB 2HKAA 2DKSA 4GP4B 3ZTDC 1NICA 4F24A 1NGWA 2ITFA 3BHBB 1MN4A 4PWJA 4N90E 4ONHA 4PREA 2J88H 2RQEA 4ISVA 4JFEA 2I27N 1ORQA 5EUOA 1U8CA 1U95B 4HBCH 2RCSL 3HI6L 3OMAB 3KWUA 2VAAA 1Q72L 1ZS8B 2BSTA 4RGNE 2N7SA 1N6QL 4TTDC 2AP2A 4JEGB 2OSLB 3Q9PA 2AJXL 1U8NA 3WIHL 1Q0XL 2X1PA 4ACTA 1IJNA 4WWKD 2MOQA 2MIZA 4EN2A 5DD0L 2CO6B 3IFLH 1R3HA 1X5HA 1TNNA 2X28A 1K8DB 1DEDA 4JHWL 3L3JA 2Q6WB 5HYIA 2J1KA 2A6JA 3EGSA 2VLKB 3HZYB 1OHQA 1QWHA 3ARRA 3OHXC 2XN9E 3P77A 4P2RD 1QBLH 2BFGA 1M9WA 4QRRD 3O11A 4RFEB 1H8SA 4N0YH 5DS8A 2IPUG 4PIRF 1AD0B 1VACA 3FO0H 4WRLA 4DPRA 4PY8J 4AC4A 3KBPA 3L17A 4K5NA 2BSDA 3IDJB 4GRWF 1IC4H 4LSTL 5I73B 4DVBB 4A7GF 2UZXB 5IHUH 1G7LA 1M05B 4PI0A 1V55B 1KN2L 1WZMA 4CC4C 3FCTA 1PDKA 1BX2A 1NIDA 1JFHA 4QHUA 5A3IC 1UADC 3HRZC 4KO7A 4KRLB 4PG9A 2R4SH 3NZHL 4OZIE 1T3FA 2R0ZL 4LP8A 1KCBA 1ZPLA 4UTAA 1LEIA 2IH8A 2RD0A 4L3ED 4WKXA 2H3NB 1E3XA 3NBNA 3VSVA 3RFZA 4E41E 3CD4A 3QJSB 4K23L 4K9EL 2BIHA 1UD8A 5DWPA 5F8QC 2QR0A 2WOYA 2IANE 3A6CL 3VXUE 1YLBB 5EDXA 3F64A 1C08B 4HCGA 2RFXA 2NXZB 5E5UB 2ENQA 2KHAA 3DUHA 4OGQC 3KPOA 4MVBD 4TUJB 3SKMB 4DP2X 2QZ5A 5IHZA 1EGJL 5IMLB 3OJDB 4PCKA 1KNOA 3PQYA 5JXEA 4X42A 1UB6B 2WXOA 1T1ZA 3RVXD 2RR3A 3K6SA 3K6OA 2ZUWA 4PAZA 4BSWA 2B4CH 4C54A 2Q9OA 4UT6L 3W0WD 4J3WA 1DLFH 1PZ5A 2LU7A 5C1MB 2SEBA 3GS7A 3WE6A 2VLME 3G08B 4ABUA 2EUWA 1FE8H 2WINB 4P46B 4W9DC 2VIRB 4IMLB 4M61A 1ZLVK 1MFDH 1JPFA 3ZDWA 2ZZUT 1AS8A 3LNDA 2FGZA 3AGWA 4PJ5B 1IGTA 1MCPH 4DKAA 4QRPD 4WNSA 5B3JE 1S7QA 4Z7UF 1J18A 1PZ3A 3ZE0F 2EDRA 4L8SA 4FN0A 2CHZA 3NQIA 5DZVA 3QW9A 2FEEI 3D08A 4YSRA 3PXJA 4AEFA 3OHMB 3F62A 1INQA 3KPSB 2IQAA 3MRJA 2J55A 3W11C 3VVVA 2VDLH 3A6BL 4YHMH 4I3RL 4YPGB 3QORC 1UT9A 5CILL 4NUJB 1MFCH 4YAQA 4W9CC 3UABA 4J3BA 1FFQA 1GA2A 3BPCB 4LHUG 4C4UA 3KL5A 1CL7L 2VXTL 3BVTA 1KJ3L 4IJ3B 3SHSA 4IIQB 1FUNA 4O2EA 1XZWA 3UXFA 1WSST 1KIUA 4GAYA 2M8XA 2R29H 1W9XA 3HI5L 2UZIL 3IGFA 4CADB 1CBVH 3MRMA 1GIGL 5GS3A 1D5MB 1CTOA 4R90H 1AHKA 1ITCA 1FZKA 5TF0A 1CDJA 4D8PB 3EIFA 4XI5D 5M94B 5F7BA 2WXHA 4YE0A 3UDWC 3VTAA 1ZHNA 3KPRD 4FXKC 2VLJE 1F4YL 15C8H 1JTOA 4JRYE 1LO2H 2BSED 5CJOL 3RGBA 1HVXA 3O6FD 1SVBA 3CZSA 3QAQA 3G7TA 2DWYA 3RWGB 5E5RB 3TV3L 4NQTA 1FZMB 2RH0A 3CZUB 2DLFH 3F5WB 1WWBX 2IALA 4GBXC 4YFLF 4ELME 3MLVL 3OXRB 3VFRA 3GLEA 2VDOB 5CZVH 2EVJA 1C12A 5IREA 1MEXH 3SOTA 3E2HC 2X4UB 2AQNA 1CURA 4HGWB 4O2FA 4UUJA 4DGIH 5E94A 3IT8D 4RDQG 5BQ7A 2AJVL 4FKEA 4P2OC 2XZQL 3MO1B 3VD2A 5DR5L 1LP9B 5E03A 1FNGB 2ARJB 5HGBA 1WHOA 2OCCB 4ZW8A 4TLUA 4DO6A 2LHAA 4WO4B 1ND0B 1OP3H 3SYPA 4MHHG 1UWFA 1ERNA 1QRNA 2ZCLH 2Y7QA 3BWZA 3V9CA 3IXAA 3ULVL 1DQLL 2ATPB 1S9XA 3QPKA 4A2LA 5L2JB 3HFMH 1OCWL 4J8RA 1DQKA 1WZ1L 4GG8B 4JFZL 4PJEF 4IBYA 4WTQA 1NINA 1SXSA 3N1FC 5CS7A 5EA0H 4DP8X 1JWUB 3BN3B 1QOKA 1SJEA 1WS8A 1MNNA 2GITB 4XR8C 1BBJA 3NEOA 1VADB 2FH6A 4XPHL 2O93L 2AEQH 1OZUA 3UTSB 4AGNA 5FW7A 3BH9A 4XMKH 4F92B 3NTCH 2JCCF 2G2RB 2YZ8A 3FO2B 3PIQB 3D07A 3P1VA 3FB5A 2FT7A 2YPLD 1WFJA 5DD1H 4O4YH 3BYYA 3PWUB 3PWPB 5I16A 5L2KB 5D1XB 4YIQB 2VR3A 4JL2A 3VH8A 1IIKA 5AVZB 1L0YA 3F6LA 5BV7B 4JKPL 3F83A 2EE0A 3CUPA 4PS8A 2C9SA 1HZHH 2H0JA 1X44A 1MCNA 3FTXA 4MJ6B 1SXBA 4JFPA 1MHEA 4LB8A 2Y69B 4UB0L 4UIKL 3AREB 1IC5L 2F19H 3HE6A 3MN8A 4OM0H 2OMNA 4FF9A 4GH7B 5GGSY 5I5MA 5ITBL 5DHVA 4X5LA 3WKYA 4P8QA 3II2A 1ECZA 5KN5A 1GR7A 3U0WL 1PYWB 4KKNA 3Q8BA 3PL6C 5ICZA 5KVDL 3RGHA 4XTRC 5FUZH 1IEAA 5FXCH 3JTBA 5B1KA 2EDFA 1MVUA 2JIXD 2O30A 2V9TA 2YXVA 3QFDB 3KDPB 3CHXA 2WO3B 5F9OL 1JD7A 3RDTC 5SX4H 4AH2B 5CM1A 3G3LA 1QSEA 1X6LA 5JORB 3D8MA 4ZUVB 3IFNL 2VMFA 5HD8C 3BGAA 5GISL 3VWJD 4AG4H 3HKZA 4WI7A 3CDZB 2FDBP 2PETA 5DHYA 3RY6C 3MXWL 3UJIH 2I9LB 1OL0A 2GY7B 2VUKA 3QI9A 2P3YA 3WD5H 2JH2A 4FQ2H 1W0VB 3B34A 1PZDA 3KLAB 5D7JB 4GRWB 4AYEC 2ZTBA 4I18B 1A1NA 5I73C 5A6MA 2W94A 3JVFC 2EACA 3BUYA 4IHOA 5DO2D 2YJLA 4TSCL 5D7IB 2AVFA 3WTWA 1PKQB 4D9QD 2DQHH 4M03A 3ARFA 1A4JA 1NUFA 3L1EA 3CLEL 2O1AA 5MI0C 2J43A 4PJBB 5IFHL 3T5WA 4GW4B 5GGSA 1DANT 1HNFA 1ZT1B 3ILDA 4HIXL 1KG0B 4KRPC 3KG5A 1QHPA 3KPMA 1KLGA 3HAEH 3MBED 3O3EB 4MXQC 5T1KB 2Z31B 3QRGL 1NM9A 2BVUA 3KXFA 3K2UL 1IGIL 4IBSA 4KDVA 1LLAA 4NGHL 2CBQA 3DC0A 1RMFL 1X5ZA 3POHA 4AENA 3APCA 4P99A 4A2HA 2FB4H 2N1KA 3SY6A 4OD3H 4JO2L 1UXLA 2VSMB 4QD2E 4Z23A 2VR9A 3RU8H 3GSNL 3LCYA 3OQ3B 5CWSB 3IU4H 1JGLH 2V3DA 4ANVA 1P4LB 1RUKH 5DZNA 4WI6A 3LKPA 3P2TA 3S88H 4LL9A 3I02A 4NI3A 1PLGL 1CE1H 1E5CA 3WHXA 4P46C 2W80C 3BDYL 3MOQA 1CDBA 3N1MC 1E4WH 3O2WL 1OGTA 5CHNA 2EZ0C 3C09C 4PJ9B 4FL4B 4YBLC 3LAFA 1ZGLB 4PW3A 4H8WC 2WNKA 3T2OA 4TXVB 2C9RA 2L7EA 1XAKA 1FF5A 3RB5A 2A77H 4PGBB 32C2B 1UTDA 2OZ4H 5KEZA 1EAOA 5BJTA 3KM2A 4N8VG 5E5LA 2FLRT 2B9BA 1FL6B 2HYMA 2WGNB 4X5XA 2C4XA 1YPZE 3FYEB 4JGUA 4ZUUB 4AGLA 4AUJA 4ZQKB 1E2WA 1A5FL 3HPJA 4ATWA 4GAJL 5F3BB 2VXQA 3LN4A 4F57L 1A25A 4GT7A 4O58H 1AXSB 4NWTH 4FQ1H 3Q1EA 5BS0E 1LO0H 2FX9H 2V5MA 4IJ3C 4IIQC 2BOBA 3EGDB 5HHNB 4QTHB 4EMZA 5L6YH 5D7KD 4DAGH 2VDML 3GS4A 3CHOA 4K3HA 4ZXBA 1FZJB 4TTGA 4OQ1A 1AHMA 1IKFH 3NIDF 4OCYH 4B96A 1RQ5A 4QF1A 4OBRA 3IRCA 3QJFB 4WNQB 5HY9A 3CJJA 3WO3B 3N5AA 2BNQE 2OMWA 3HHSA 4N9GB 5HHVH 3B2UD 1GZPB 4WWOA 3SDAC 4LCWD 2DQJH 2VRAA 4PJCE 3ECUA 4GXFA 3W1ZA 3SGDH 3NJLA 2OK0L 4EAEA 4KUCD 2C3WA 1E28B 1S3KH 4G9DB 4U1NA 1Y6NR 2W92A 4LHUD 3C5ZA 2FCBA 4FG6C 5C09A 3MZTA 3UJJH 4KUZL 1FWXA 4JZOA 1J1XL 4QRTA 3V0AC 3D7PA 4G9FA 1Z9PA 4Y19E 4IDLA 2B3RA 4H88L 3PWNA 1PKOA 3VMPA 1M2OA 3O2VL 1RHHB 4NKDA 3ES6A 3QPQC 3FO1B 4A67A 1R5WB 4G3YL 4XBPB 1QUPA 3QEQB 3R19A 2CO7A 1QSFB 2IGTA 3LSOA 3PGFH 4KNTA 4LVHB 5FYLH 3QULB 2GAZA 1QA9B 4HKZA 4PJXA 1KIQA 3POCA 4HIHA 5HJBA 4FS0A 5C0CE 3EFDH 5CLZA 1HYSD 3T4AB 4BK8A 4HAFA 2NY4B 3B7YA 2PXYD 3GI9L 1OGAA 4F8OA 5BZDB 1JFQL 1EFXB 1XSIA 2MNJB 5ISZA 3SDXF 2DYPA 3L4TA 2YQGA 3CZFB 4FD0A 2BSBA 1NLBH 1H6TA 4XPBH 4I2XA 5HDQH 2GTWB 4G7VH 4IU3A 1HHJB 3HG1E 3NJVA 1WLHA 3CQQA 1XIWA 3H4HA 1X7QB 2BY1A 3T0ED 4J1UB 1E4HA 2A0LD 4XPFL 5AW7B 3S2CA 3BUDA 2WNXA 1G9NH 4PSPA 1A7OH 1CGWA 1VZHA 1CGXA 2EE3A 4GKOA 2EC9U 4HV8A 2EC9T 1K4CA 3LXBA 5EC1A 3PHOA 2P24B 1R3JA 4Z7WB 1GKOA 2QLVB 2ZCHH 2HFEB 5K33A 2MQGA 3L9YA 2VR7A 4Y1SA 2G60H 1RY7B 2BVQB 1DBKL 3MRQB 4R2GB 1QO3A 5HPMB 5KUKA 4CVZB 2BRQA 2WKGA 3DETD 4YBHA 1BD2B 5HGDB 2W60B 2WXIA 2XC8A 2ZSVB 2ATKA 1PY4A 4QCIA 4XP9L 3AREC 3JWDH 3GSVB 1AI1L 3I6KA 2BVEA 3EXJA 1A7BA 3MRHA 3UZQB 1Y6MR 4F8TA 1SGKA 2CO1A 2D4FA 1CDHA 2DY2A 1M7XA 5AW3B 1BMZA 1TQBC 2X70A 3AACA 1S5HA 3BAIA 3F8UB 4L1BA 4QHNA 5HHOE 2YN3A 5CSZA 5BRZD 5D1QD 5E8EA 2IGLA 4KKAD 5DRWA 4NO2B 3NAAH 3RPIA 3HFFA 1KFGA 4A38A 4ZI8A 4BFKA 1NCTA 3ARSA 3QUKB 3UROR 4YSPA 1IEBB 1PCSA 1XB6A 3D6GA 3PY9A 3ARGA 4PRPD 1JZHA 3P69A 2A7BA 3AJ7A 3VW3H 1AKJD 4YUEH 4WHTB 3TZVA 4R3SB 2XKNA 1BF8A 3V9FA 1FCGA 4ATTA 5GRYA 3UAJA 3DRQA 4ZYKA 3R06A 1SLXA 5DJ2A 1SUJA 1SOSA 1FN4B 3TFBA 1RUAL 5J56B 2F2HA 3H9HB 3UGEA 4XNZC 4RMUA 3SE8L 3FDWA 3NCJH 3DXAD 3G5VA 3PV7A 3QRBA 3RTLA 1XGZA 2P5WD 3JV6A 3AU0A 3NPSC 3LNFA 4XAWL 4JG0L 5D9SA 3QQ3A 5DO8A 3U2SA 2NUPA 4GLRI 3C08H 1WBXB 2KQMA 1KCRL 5IB1A 3FNKA 3VRJB 1NMBL 2K70A 2PYED 4RAUA 4FMFA 4Y1AA 4GW5A 4JREC 5LG1A 2TAAA 1NGQL 3QDJE 5FC9A 4EPSA 1K5WA 3W2DL 4N2NA 4PJDA 3AXLA 5D7LA 3FRPB 4DUWA 4MAYD 5TQ2L 4BDVB 4RAHA 3IKKA 4UIMB 2IDUA 3NJNA 4MSWB 3VE0B 1DUYA 2VJ8A 4HD9A 1OM3L 4AEIH 2OPCA 2Z31C 5FGRA 1FNSL 2H32B 4NZRL 2Z93A 1X9QA 1KYFA 3SKOA 2QVTA 3U7WL 2F5BL 4EBQL 5DC0A 4ES8A 4LCUA 2JJSC 3UTTE 1ZXKA 3GDBA 2A74C 1JGEA 1V10A 3L3HB 2NLJB 3O4OC 1AQKL 3QG7H 2GI7A 3S5ZA 3HBZA 3UYRL 5IJKA 1NFIB 4N5UA 2IDTA 4F7EB 5FYKD 3LKNB 3L3OA 3LB6D 2EQDA 3AZUA 4E68A 4FZ8L 4PJ8A 4HS8H 2WZ5A 5A2LH 5LCVA 2UZYA 1I8IA 2PP8A 3MUJA 4AUUA 2F8XC 4ZFGH 3Q2CA 2QSQA 2IPKB 3WMSA 1BZ7A 4PUBL 4ZAKA 4M7LH 2HLAB 4Y5YC 1YEEL 2BIPA 1S7UB 1JZ8A 2QJDA 4L5FH 4IRSB 5E7FA 5TE4H 3ZE2B 5MEOA 2WAQA 4G1MB 4MQ7A 2EDNA 1BG9A 1L6PA 4BHUI 3VD9A 3LRMA 5IKCA 1FFPA 3VI4B 3ZTJH 3MLWH 4U6YA 4FFZH 3U30C 5CCHE 3TS8A 1F6LL 4ODHL 5JW4N 4OFQA 2AXGA 4JFFD 5FYLE 4HEPA 2KZ1B 2NY1B 5F7MC 5DJ0B 3MKGA 4JO3L 3VCLA 4MWFA 4Y88A 3EF4A 5C0BA 2KL6A 5L4JA 4HAGA 3IMRA 4RISH 1QFPA 3R1GL 3KWWB 4U1HB 1JK9B 4EN3D 5A6IA 4IRJA 5DTFB 2W5PA 4PR5B 2A6DB 4M5YL 3TTSA 4J3TA 5EC2A 2VSDA 2BMKA 1TT6A 2FYYB 3UBFA 5DUMH 4ZZFA 2O72A 3MOAL 4K8RH 4AX3A 1UD3A 4AYBA 3WS3A 4W4OC 3D0LB 1CXKA 3A22A 2K7QA 4OM1H 3VRLE 1U58B 1P4IL 4UAOB 1B3IA 4MJ5B 3KLKA 3RNQA 4BM7A 3G5YB 3GPSA 4XN7A 3KVQA 3RJDA 3NMEA 4A39A 4AMKH 3ZHNA 5B1JC 4BWTA 3EYQC 5KBPA 2WVVA 4PGDA 4YGVA 4M8QB 3CVBA 4WV1A 2E7CA 1CN4A 1I7RA 2AK4E 4NZ8A 1AOHA 5DVNA 3T3MF 4XZ4A 1MFNA 1KGUA 4PTUB 3WNOA 4MNQD 5TE6H 4YSCA 1T6WA 3HC0A 4WQOA 4HWBH 3CK0H 3QWQB 5KBNC 1CLZL 3P3UA 4IKIA 4NFBA 2BVYA 4L4VB 5T3XD 3FB6B 4FLOA 1CK0L 1AZUA 3R4RA 5IW1A 4MA7H 1F4WL 5F6IC 4P57A 4Q58C 1S7SA 1I7TB 5FO2A 3KPNB 3VWKA 2K8MA 4BFRA 1A7QL 1TG8A 1XCWA 3L6FA 2BIOA 3F84A 1D5RA 5AOJA 2E56A 2EE9A 4Z0BH 3OXSA 4A68A 5I15H 2BC4B 2WZ0A 2X12A 4WI0A 4XX1G 1JCKA 4AXWB 1N5YL 1NIFA 2PO6C 2VITA 3CFQA 5KVEH 5KVGH 1J8HA 3SPHA 2CBPA 4AVIA 2X4QA 5TF1H 1A3RL 5IB2A 4YL4A 4IMKA 1J87A 3W9EB 1SLWA 3CHSA 4I0PC 3VRIA 3CHPA 1R3KA 1BZ9A 1PQZB 1DQQA 1WF5A 3QIBB 1DBMH 3CGTA 4QPEA 1HH9A 4FKHA 4UT7L 1ZOXA 1B6UA 4OBSA 5ABAA 3SE9H 3TCLA 3QDGB 3EUDA 4FQLH 3TTYA 5JR1L 4IOFC 1TKWA 3L16A 3QCVH 1FG9C 5SWZE 3ESMA 3DO7A 1NC2D 2VDOH 4NUQA 3GKWL 5H2BA 5MHSD 4ERSL 1JF1A 4FRWA 1TXKA 3EJTA 1YMMB 2PR4L 1DSFL 4XC1L 4TYUA 2VXQL 3H3PL 1TJIH 4JKKA 3KJ4C 4LIQE 2EECA 4JDVB 3IPBA 5DEFB 1YG9A 3RJOA 4P23A 1Z1WA 2FT8A 1RZJC 4GIPD 2OMTA 4L8CB 5CR8A 2KLTA 3C5SA 3NPZB 2V17L 5HP5A 5EUOF 3TV8A 1XGRA 1TQUA 4KK8C 2HFGH 1EHLH 4AKPA 2MPVA 5IROC 1I4FB 3DA0A 3EG9B 5CD5C 2JKRM 2YBRB 1AE6L 4ICWA 1CDYA 4K7PH 1RPKA 5KJ4A 3MNMA 3ILPB 3ZRSA 4RDBA 4P4RA 4EOWH 1S5IH 5I18L 2QQNH 3K6IA 5CUSH 1CGTA 1KFAH 3GHEH 4YSAA 3QC5X 1M7UA 4P3CL 1ZLWK 1HHKA 4MS8D 4NUMA 2OXHB 1C8PA 1AJ7L 3HZMA 1N2RB 2OJEB 12E8L 2KYIA 1YY9C 3NCYP 5JW4R 4RGMB 1J5OL 3SJVA 5M95B 1R5IB 4NYLB 2X2JA 5MP6L 3IAGC 4KZEH 4UQIM 2VW6A 2VLKE 3LRKA 4R26H 4DVRH 3TVMD 5DFVC 3QA3A 4M7LT 4YDIH 3V4UH 4CW1B 4RX4D 4YS4A 5BV7H 3DOSB 2YKKA 2XXGA 5DZ9A 2WZ6A 2C3GA 1TZ8A 8PAZA 3QEGL 4TN9A 4F5CE 1FP5A 1DL7L 5CINL 3HE7B 1LTXA 4QKXB 1F4XL 3ZZ1A 4DGYH 3I9GL 3S5YA 3JZ7A 4EZJA 4MJID 5I8KL 2H4EA 3VAEA 4M4PA 2NZ9D 1VA9A 1N64L 1GJWA 3WKMH 3UTZB 5BO1H 3KLHC 3EHBB 4L5FE 3O9WA 3QQ4B 3MLUL 3Q5OA 4Y2DA 5AAWA 3MLTA 3EJYC 2CLVB 3T08A 4N2EA 2XRAL 4DZBA 1IGCL 1PF3A 2EIZB 5T5FH 2MTAA 3QZWB 2A4ZA 4JM2D 4MX7B 4FCAA 1SVZA 4YHYC 5J1TC 3QWRD 4W1TA 1OCZB 4GSDH 5FYKL 1BBDL 4HKJB 3I6SA 3AUVA 1CT8A 1Y1UA 1G7MB 1PAMA 4PV8A 3VFPA 3KDMB 4M1GH 4Z7OF 2VDPL 4HF5H 5TK4A 1BQUA 4YLQT 1SVCP 2K4AA 5CCKL 1OPGH 5ALBL 2JK5B 4JFOA 3KGSA 1YCSA 2X7LA 1ACXA 4R0LB 5LLIC 4TQPA 43C9B 4OB5L 1EFQA 3E8VA 1UJ3C 4BCZA 4UWQB 5ABZA 1MLCB 3OJ2C 2IV9A 3NFSL 4U3XA 1F58H 3V7AG 5DA0B 4XP5L 2XIDA 2UY7A 3UBXB 3MGAA 4U4BA 1CICC 1UJTA 4V1DB 4ANXA 1MHCA 3I50H 1A6UL 4GRWH 4XP6H 5E6IB 2IAMA 2WUBH 3VFNA 5J06A 2CGRH 2OBGA 3P9MA 1MFAL 1PBYA 1SXZA 1DVFA 3MNZB 4I48A 4KZ0A 4FQIL 4MMXC 4PJ5E 1U8PB 1U2YA 4HH8A 2XWCA 2UWEE 5GIRA 3WXWL 1AZRA 3OB0K 4J3VA 4EE2A 5DJYA 2YA1A 2A9DA 2C1PB 1EEZB 5AOLA 3EH1A 4IYKA 5B7EA 5A2JH 1MREH 2WWNA 3KLDA 1ZGLM 3PFQA 1MXGA 2E8YA 3KPSE 3JTSA 2O4EA 4HP5A 1AZCA 1ZLUH 1KYDA 1BAGA 4GW1A 1U4EA 2DWSA 4HUKB 4JG5A 2NY1C 3THMH 5ESQA 5IEKB 3ZQ9A 2P43B 4D7BA 4HOXA 4RFNB 5G4OA 3CLWA 1A1MB 3I75B 4W6WB 3PABA 4PJHB 3IPFA 4X6BB 2JELH 5AYQA 2Y5TB 4NLHA 1INEL 1H3GA 3VFWB 5EO9A 4AQ8C 3IFPA 35C8H 2VMJA 5AW0B 1KTLA 4P5MB 1I1AB 3C9NB 5DD6A 3P4MA 2IXQB 1TR7A 4U3SA 1IGJA 3B5GA 4MA3A 4NNPL 4P4KD 3QUGA 5KVGE 5KVEE 3QYMA 3QIUA 1MVFA 5ESAB 2BCKB 3BZEB 5ES4B 4DO5A 2X2HA 3QC6X 3X3FH 3B83A 3OKLA 5C7XH 2B39A 1UEYA 2ADIB 2HJLB 5AKRA 3FC8A 3DECA 3P4NA 3RIKA 4YLBA 1QBML 4UTBA 2OYKA 1A6PA 1CU4H 5T3XL 2CRYA 3EFOA 3LIZH 5BW7C 1LVEA 2AVGA 1UWGH 2W9EL 1H9DA 2JJVA 1NLDL 1OCRB 4HLJA 4I89A 1EO8H 3T3MB 2WUCL 2OXGB 4ESKA 3GMPA 3VXQA 2MHAA 4MQSB 5ACZB 2AJSL 4NZUH 4U1GB 5C70A 5CD3B 1LP9E 1DQIA 1KDIA 4QO1A 3SE3A 5DLLA 3ZDYF 1JGIA 4OF6A 4WW2C 5E8NA 3RWHA 1CDGA 5EORL 3CXDH 1CWVA 3CIAA 2VLRE 3FU7B 2EO7A 4LPYA 3U6RB 3CV5A 4NQCD 5BRQA 3ZQXA 2NY0D 3QQXA 4E9VA 4F3FB 1WGOA 1GC1H 1AG6A 1EDQA 1FNEA 1RLBA 1JHTB 3AQXA 1KLUB 3MREB 1EBAA 4G8EB 5IVXF 2NY6D 5E2VH 5ETUA 3SPVA 1Z5LA 3SE6A 2Z7UA 3WFBH 5LCVL 3CFEA 3RA7L 5EN3A 1G6VK 4LVNC 4MQXD 2Y36H 4QOKD 3L7EB 2XXCB 1RH8A 1ACZA 2X4NB 3CFDA 4TSBL 2ADGA 1MCCA 2P8LB 1MH5A 3PDDA 4NXKA 3K72B 4YOKA 3L5XL 1U8OB 4OV6F 5FYJE 4X99B 5TD4A 1T5XB 4WUKL 4MMYA 5HPOA 2Y24A 3WTVA 2XPYA 2EEXA 4P2YA 3GXFA 4PCYA 5DMKB 5FA4B 2G5BB 3D3VD 1NUNB 3GSNB 4WTWA 5FO8B 2KZWA 3K1KC 5L2KE 3TNNB 1ZHBA 5KSUB 5D1XE 1A6ZA 5EFIA 2DWDA 4RRPG 3F05A 2OTUA 4B9ZA 5DZLA 4PGCA 2OI9C 2R0KH 3NSXA 4K71B 3DMMA 2AGJL 2VYRE 3MCKA 1Q0YH 1NBVL 1NGWB 1FCCA 5D71H 4BUHA 3QUXD 1V7ML 5F1NA 4LRIA 3TLRA 4ONHB 4PREB 4ISVB 4JFEB 5GZND 1ORQB 2R8SH 5E2UL 5EUOB 5FIEA 1U8CB 1A6WH 3TXAA 2UXFA 4G5ZL 2VAAB 5LUMA 5JZ7C 3WNLA 3TH4T 3TX4A 2BSTB 4XN4A 3VYPA 4Q9QH 4G7QB 4BV1A 1U8NB 1VZGA 2J6EH 2FEEL 3MACH 1S7VA 1JNHA 1IAOA 1JZ4A 2WGXA 3DV6A 4KKPA 5EH1A 1XGQA 1MWAH 1BV8A 1R3HB 3ML9A 2RJMA 1E3FA 3H42H 1ZIAA 4D9LH 2HFFB 3GGWA 3E3QC 2COQA 2WWMD 3FTYA 3GBLA 3FPXA 3OAZK 4NB7A 4NX0A 3WKPA 3MRNA 4Y5VC 4RGMC 4DCQA 5C97A 3L3JB 2WQXA 3BD4A 3MV11 2A6JB 3EGSB 2O61A 1KELH 5ANME 3SD5A 4KOCA 3DHMA 3P77B 4DKEL 3QBTB 5MENA 5E24E 3O11B 4KDTA 5GRJH 2H6PA 5CN1A 3QCTL 5DS8B 4ZMTA 2HTKC 1RUPL 1VACB 2XVLA 4MAUL 3AY4A 1M3JA 3WNMA 5AENA 2QGCA 5ID1A 3HE7C 4XPTH 3JXAA 4P06A 1M71A 3EOTH 4GRWE 2DIAA 1LO3L 3S36X 4RMQA 2QFRA 1G7LB 1LK3L 5F93C 1J8SA 3FCTB 1PDKB 4HUCA 1BX2B 2NSMA 4NRZA 4QHUB 1RZJH 5D7IE 3HZVA 1PKQE 1WFNA 3B37A 4FXGA 3I9PA 3NT0A 1DN2A 4O2CA 4PG9B 1NAKH 1T3FB 3BQUD 1DBJL 5AVSB 2YBGA 3LEYL 1EDYA 2QVIA 3HS0A 1JF6A 1KBGH 1YNTA 4OLUL 1LEIB 3LXAA 3O3DA 4PJBE 5KYUA 4YZWA 3RFZB 5AKTA 3QXTA 4ELDA 3A47A 4OLZH 5IB5A 2QR0B 5I5IA 2J12B 1S9WA 5IBLC 4D0CA 3IVKA 2RFXB 2ZXWB 3GM0A 4FTVD 4N2HA 1FPTH 3KPOB 4O5LL 1DQDL 5IHZB 1P6AB 3ELAT 4FZEL 1KNOB 3PQYB 5FHBL 5SX4I 4ACPA 2COVD 3KLLA 3BCDA 1J1PH 2R0WH 3F7PC 5EZOH 1S78C 1NAMA 1T1ZB 5CP3H 2WLYA 1AR1D 5A2IH 3K6SB 4BSWB 4Q0XL 1NL0H 1OTTC 1D7FA 3ARDC 3VGEA 3APMA 5IQ9A 3GXNA 1PZ5B 3S36L 1QSZA 1UCBL 2X9XA 1G9MC 2SEBB 2Y22A 3WE6B 5I1EL 1BZQK 2Y06H 5KSAA 4LVEA 4M6OL 4M00A 3ML8A 4YSEA 3P0YL 2P5ED 4X4MA 4FDWA 2DL2A 2Q8BL 4M61B 4Y16A 1JPFB 2OKMA 1U8IA 3GTVA 1RUML 1Y0LA 2VDNL 4K07A 1IGTB 1CIUA 4U6VH 1Y6KR 1MELA 2GBUA 4JLRA 1S7QB 3GS0A 3QZNA 4L8SB 2Z64C 3ZE0E 4EUPA 4TPRH 4JR9L 1MAJA 1CVSC 1AC0A 4QRPA 4JE0A 4ABVA 4CILA 1INQB 5G5DA 2IQAB 3GZPA 3CN1A 4ONGL 3MRJB 4R7LA 2YGNA 4X80L 3GI8H 4B5EA 1CFNA 2VXUL 3U0PA 2VQTA 4YAQB 1BVKA 4AE0A 1CFVL 3AS0A 1G0XA 2H32H 3CAFA 3QCUL 2IBGA 3ZHDA 3BN9D 1Z7JA 1EUUA 2A9AA 3CQPA 4JKLA 3U36B 5I0DA 4O2EB 4UILL 5EZLA 1KIUB 2VABA 4GAYB 2A6IA 3BE1H 4EI5A 3D9AL 1E27A 3MRMB 1JZ5A 4XNQA 2OR7A 1WA2X 1FZKB 1ICTA 3NCEB 4X7EC 1I1AC 2Y1ZA 5I71C 2Z6FA 2MH4A 3QDMD 2G2PA 5SV3A 3DPBA 2QDVA 3FQUA 4QWWC 5FECA 4NBXB 4XCYB 1S4IA 2RGSA 2LAGB 1YEGL 1ZHNB 5I28A 1TJGL 2OL3A 2WQ8A 2WHVA 3MRLA 1LXMA 2E9GA 4YHZH 1XT5A 3AC0A 1HIML 2DMKA 2PWFA 3APNA 3S3JA 3CSTA 2IALB 2AQ2A 3F58H 4B9YA 3LOWA 3B3IA 2ROYA 3VFRB 1LD9A 4Z6AT 2FYVA 1C12B 1D9KA 3Q8FA 1MUJA 1ZLSL 4BFFA 2XN9A 5TQ0H 2I7OA 4O2FB 3K8LA 4PD4J 4UUJB 1MJJA 5LGYA 2FWSA 5E94B 3TJHC 1P0SE 5BQ7B 2B1OA 1OK0A 1L9SA 3QEQE 4XVTH 4ZNEA 1TTAA 3NP3A 1KZYA 4K3JL 3RBGA 3ILQC 5DK3A 1ZDSA 4QRQA 4XMPL 4ZFOL 4U0QB 5HGBB 3ZDYB 1HEZA 4OH2A 1L7IH 1P7KA 3LYRA 1JPGA 1QRNB 1X3DA 2BHYA 1YEIH 2Y7QB 3MRIA 1C8QA 3J07A 3IXAB 5DS2A 2RCSH 4LGRB 1S9XB 1Q72H 4J8RB 2X2YA 3SE4A 5ERWA 3VU1A 2OM5A 1ET5A 2AJXH 3WIHH 4YDMA 1S7WA 1DTUA 3HTLX 1ZHKA 1Q9KA 4EXKA 1DSYA 4ILDA 2MCG1 5HSFA 3DPDA 1J0ZA 2I85A 4OGAD 2GPZA 2ED8A 1SJEB 4UU9A 2X05A 2OR8A 1BBJB 3O2DA 3SGDI 2NY2D 2VQ4A 2Y0SA 2IWGA 4UBDD 5AVRB 3ULUL 1SYSA 4WW1B 2XKUA 3BH9B 4JHWH 4AYID 2JCCE 4UOQA 2H6UA 1JWSA 1E4XL 3FB5B 4Z7QF 1P4BH 1CDUA 1LO4L 3Q43A 1NDGA 1V3LA 4Z7WE 1JIBA 2QV4A 5I16B 5HI4C 3VH8B 1ILUA 3O3BA 3WUWG 4FA6A 1X4ZA 3QG6A 2MQ3A 4DEUA 2HVBA 4BGLA 4NM8L 3CUPB 3N43B 3RKDC 1BD2E 4KX9A 3M1BA 4BFIA 3EJPA 4NNYA 1M53A 4HBQA 1MRCH 4JFPB 1MHEB 4PJIF 4AWJC 1KN2H 4HJGA 3HE6B 3GBNL 2ZOOA 4ZTPL 1Z9LA 3PFUA 4OFVA 5DHVB 4PVBA 3FU6A 3S3SA 3IAQA 2RMNA 5D93B 5KN5B 2BW5A 3IAPA 2R0ZH 4DK6A 5HGHA 1NZRA 5ICZB 2X6BA 4GG6A 4EZMA 5F9DC 1KEGL 1AXIB 2CR3A 2FL5A 3E8UH 3LJ3A 4G8FA 4K23H 3QHTC 3S34H 1IEAB 3O6LL 3PP3H 4HMCA 1MVUB 2YUWA 4DGVL 3M86A 4YL9A 5JTWA 3L3IA 4ODVH 4JCLA 4N90D 2M26A 5L88L 1B4JL 4NIYE 3E6HA 3WNNA 5LQBH 3L3KA 1BIIA 4OQTL 3B2VL 1SEQL 1YDPA 4R96A 4XP1L 3PHQB 1M2VA 2IH9A 5KSBF 1QSEB 5IESL 3FFOA 1IGFL 4U7MA 4BRVA 4PWEA 4L4JA 5F1OB 5KBDA 2AFNA 1V5JA 1KJ2A 5DHYB 4XOCA 1E9QA 4DK3A 1KF9B 1U42A 3ARPA 1CFTA 2A2QT 3GHPA 2VERA 3QI9B 5F0MB 1NEZA 4U33A 5B38A 3BPOB 5E99L 4A04A 5LAXA 2ZONA 1A1NB 2DYRB 1Z3GH 3Q0HA 5E6UB 2GIYA 3BUYB 3QIWD 4IHOB 4QRBA 4YGAB 1PMYA 2Z7WA 4X6DA 2X6VA 4FAAB 3ARFB 2IVFC 1A4JB 2H0PA 1II4E 2HN7A 3S4SG 4LXFA 4FMVA 5EOQL 3TONA 4C4KT 3BC9A 3OLEA 4G6ML 3NSCA 5GGSB 4DEPC 4M3JA 3BKJH 3NCWA 3A6BH 4I3RH 5JIIA 1IT9L 2XWTA 3N2JA 4M7ZB 4H8QA 4OF3A 3KPMB 5CILH 1KLGB 4X6EA 3WENA 2ZICA 3SPJA 2QKSA 4KTDL 4Q74A 2YEQA 4K9JA 3WKQA 4HOMA 3KXFB 2VN3A 6FABL 2XT1B 1CL7H 5IQ7L 4W9FC 3ASWA 1X4XA 2BO0A 4Y4KD 4ZUWA 2D3JA 2VQ1A 4AENB 3HB3B 1LEGA 3D69A 4KKQA 4XVOA 1X5IA 1GIGH 2G5RA 2QHRH 2XWXA 4E41D 2QQLH 4ZS6D 3CDGA 4W9EC 2BINA 5LBSA 1YA5A 3BKCL 3B9KC 2Y3NA 1V54B 2N0MA 2IAND 4XNXL 3V4PA 3VXUD 4W70A 1RI8A 3LKPB 1HKLH 2Q3XA 3C6LC 1TLKA 5FB8A 3I02B 3QEHA 1FSKB 3WEXA 4AE1A 1MJ7L 2EIBA 1TTBA 3CBJB 3I3DA 4FJYA 1F4YH 4TQIA 2J4WL 2NSXA 1MJ8L 5CJOH 5CHNB 1OGTB 3RVWD 3IXTA 1SQMA 2B08A 4BFJA 3CVHL 5C3TA 1I3GL 1T03H 3FH7A 1NGXA 4G6AC 3QUYD 5EO1A 5BJTB 4JPVH 2DQFA 3ZE2E 3LPWA 3V79C 2VLMD 4X5XB 4GXUN 3HJ0A 2AQSA 4XGZA 1KACB 1SY6H 4GT0A 2VXSL 3HPJB 4KJPD 3LQZA 3L2NA 3LN4B 3O8XC 1IM9A 1HTYA 1KGXA 2IIJA 4Q9CA 1W80A 4JO8A 3T77A 3RX8A 1Q94A 4TOYL 3UH8A 3TWCL 1A0QH 4ZDHA 2C9PA 3C2AH 4XNUL 4F33A 2BOBB 1UWEH 1XH1A 4A7SA 4ZXBB 1Z3RA 3VXRE 1T83A 2XXMB 3NIDE 2R1YA 1NCGA 4QF1B 3FN3A 1WZ1H 5HY9B 5I1KL 2FHBA 5IT2L 2WYTA 2E46A 2FTAA 1CF1A 3FQNA 3HHSB 3TL5A 1QG3A 2YKLL 2ILLA 3CE1A 1KPVA 4JPSA 2V6HA 3LV3A 1A8JH 4HKXA 5L4IA 1YRKA 5E4EB 2QQKL 1CD0A 1OTSC 3CN2A 3MGOA 4U1NB 4XPHH 4B3VA 2HRGA 3C5ZB 5C09B 4FQCL 4LCWA 4HWZA 5JIMA 4JZOB 3ZR5A 4QRTB 3ZKMC 4G9FB 4JPIA 1I9JL 3PWNB 2ZWYA 4WY7L 3WJLA 2JJUA 5DUPH 3LDBB 4L1TA 3VG0L 1K3IA 4NKDB 3ES6B 4J3SA 1BJ8A 4Q14A 2YD7A 1COBA 2VLJD 5K1NA 3C5JA 3ME0A 4JRYD 1KGWA 1K5NA 2GTQA 3MV8A 3OGOE 4U6XA 2CO7B 3LSOB 2QVKA 2X1XR 5FO9A 2GAZB 2FBJL 4HKZB 3Q2VA 1KIQB 3NRQA 4PJXB 4HIHB 5FFGA 2AKRA 2GYSA 3L5JA 2R27A 5ABDE 1R75A 4R4BA 4UB0H 4UIKH 1HJBC 5J3HC 5CO1A 2EILB 1B2WL 1IILE 4P0DA 4ENED 4ZMOA 1B4TA 3ARTA 4L4VE 5ITBH 1OGAB 3RZCC 3VNZA 1UXWA 1U8JA 5ISZB 1NAML 2DYPB 4JO4L 1VEMA 4HT1L 1MCOL 4POUB 2CRZA 1GCYA 1BF5A 2PXYA 4L2LA 5I6XB 4B9CA 5KVDH 4I2XB 4IU3B 1KBWA 1XIWB 4ZX4A 4NWUH 4LBAA 4A6YA 3RWEA 1KCSL 4XB3A 5I0ZA 2ORBL 3M8OL 4UF7C 2IV8A 2EH7L 1PZAA 4G6JL 2ROXA 2WBWB 4M02A 1M42A 5AAPA 5F9OH 2BRRH 2QPFA 5H37A 1ASQA 4HV8B 3DV4A 1DVYA 4XWOC 4V2BA 2B2XL 1K4CB 3VFSA 3AY2A 1KZQA 3MFGB 3PHOB 5EC1B 1JS4A 5GISH 3QDGE 4APXA 3CIQA 1H3XA 3Q1SL 4H8UA 4Z7QB 1R3JB 3LVTA 3D39A 3V6FA 1FC1A 1VPOL 3QYCA 1MZYA 4Y0GA 2J21A 3IE9A 3MXWH 1QO3B 1UXSA 3KYNA 2QMJA 3L9RA 2O5NA 1JZJA 1XGPA 4Z78A 4ZK8A 5I75C 3LXCA 2N1TE 2ATKB 3N0AA 4QCIB 1JPTL 2OW7A 5FX3A 5JHMA 4KMLB 4TSCH 3I6KB 4UQ2A 5GSRA 3MRHB 1T2XA 3EJZC 4QHLA 2F7OA 2BERA 2X70B 4QHNB 1S5HB 2AI0L 5CGBA 5CSZB 5C9JA 1JP5A 5T33L 1KDJA 5E8EB 4WF7A 3ABZA 5DRWB 3WJMA 1P5VA 5D1ZA 4IW4C 3RPIB 3LKOA 4GIOA 1X4YA 1BQHG 2EE2A 2JVUA 2BY2A 2WQSA 3A67L 3HNVL 3I6LE 3HLKA 5IJCC 2ICCA 2QHLA 3I3EA 5EOCL 3ZRFC 3ARGB 4W68A 3K46A 3HG4A 3QRGH 3SGKA 5I1GL 3ECBA 2KBGA 3S48A 4RSVA 2EYTA 2FNWA 5C08D 3TZVB 3VGGA 3E3QE 2XKNB 2Z0UA 1PZSA 3VDCA 3KJ6L 3DRQB 4L8DB 5HGAA 3TWYA 1EJ6A 3TO4D 4ZYKB 4N24A 1JPSL 3R06B 4KQ4L 5DJ2B 2G3ZA 1RZKL 2PCPA 1G1YA 1M7DA 3GRBA 3FJTA 4JB9H 3SBWA 4JJ5A 3BPOC 3OTTA 3RPBA 3SDCD 2Q2EB 3F12A 3G5VB 3O2WH 3P9WB 1LE9A 3JV6B 2E27L 5GS1A 3AROA 3QQ3B 2LFGA 4KZCA 1TQVA 4PJCA 2NUPB 3H2PA 3U2SB 2YD9A 5LAPA 5IB1B 5GS0L 1F0LA 4QLWA 2P52A 5L7XL 2H1LM 5HI3C 5D96C 4RAUB 4Y1AB 3MXVL 2Y3AA 2BVOA 3QZOA 4GW5B 1G1OA 4BZ2A 2XICA 2KC0A 5AZUA 4Y19A 1YUHA 4KRMB 1XSOA 4PJDB 3AXLB 4WK2B 5D7LB 5C6TH 2WXJA 1MIEL 3MRCA 4JM4H 2EABA 2PYEA 5HYQA 4M7KL 2N7BA 4GAJH 4M7ZC 3VUAA 1MPAH 1DJYA 1J5IA 3F2LA 4F57H 2CNZA 1DUYB 4DN3L 3V5KA 2QSVA 2DQEL 3CN3A 1FL5A 3O2DL 3P11L 2Z93B 4Q8BA 3BRDA 2D7TL 2VMCA 5C0CA 5EU7C 3SKOB 3SDDC 4OZHA 2EVFA 1F00I 1OTUD 3HN3A 3QQ9C 4LCUB 1JGEB 5IBTL 2I60L 3NCBB 2X6UA 4NN6B 2WNGA 4QDGA 2OTPA 3C60C 3L3OB 4OLWL 5AB1A 1LE5A 2XZAH 4PJ8B 4Q2ZA 5TGBA 5CR1A 4HIPA 1NGYA 1BSIA 3I2CH 1FSKC 4ODTL 5ADPL 4LLMA 2UZYB 1I8IB 1OAUL 4RA3A 3RTQD 3ZGHA 4B9PA 2Q0ZX 4V1DE 1Q0EA 1WYJA 1BZ7B 2GUYA 4YC2B 4BSJA 4DZ8A 5HVHC 4ZAKB 1AQHA 2IG2H 2FH8A 3UEQA 4M43L 4JRXA 4KUZH 1HU8A 4WI3A 3PAVA 4PM1A 2ZG1A 4ZODA 5MEOB 2XBDA 2Q7YA 3GJEA 4H88H 4MQ7B 4HCRA 1X5GA 5IKCB 3AB0B 4FXLA 1H3TA 4UTAH 2FIRT 1A2YA 3MAWA 1BA9A 1J8KA 5I1AA 2YAFA 4B7LA 3CPLA 2ZXAA 4U6YB 4G3YH 3X3GH 1PG7W 1EXHA 3ATFA 2AXGB 3WEOA 4ELKA 5F21B 2DDQH 4P9HC 2IWFA 3VCLB 5JW5A 4MWFB 2O6CA 3GI9H 4XO3A 5C0BB 4IKNA 4KROB 4PJHE 1EZUA 4LAQL 1JFQH 1SMAA 4MZ3A 3OVUB 1ETZA 4IRJB 1OAYH 5EOCJ 3MOBH 1IBGH 1MRFL 4AYMC 3EYSL 1U6AL 1ZV5A 3C8KA 3IS1X 5EC2B 4BUGA 5FWQA 5IG7A 5E9DE 1AGCA 3DGDA 4OFYD 2WLZA 5A2BA 2BMKB 3SBRA 4UQEA 4LCIL 1PS3A 4Y4HD 5D7HA 3T8MA 1V7NL 3VGFA 5BS0D 4XPFH 4LOVA 3ET9F 3ARBC 3HMWL 3NK3A 2YQ2A 3WS3B 5E4EC 3DJTA 1BFOA 3U9WA 2EEAA 4Y1TA 5JOPE 1RPUA 3CH8A 1YJDH 4AJYV 3RNQB 3WNKA 1GTNA 4PJ7F 1YNLH 3QJRB 2YEVB 2HWZL 2WXNA 1IBDA 2BNQD 5IQNA 3LDBC 5F70A 4LSPH 2WVVB 3O4LD 4L3CA 4PGDB 4YGVB 4GO9A 4WV1B 4KQ3L 1I7RB 3OHXA 3QO1A 5K69A 2XBTA 3JUZA 4KDWA 3S3DB 3T3ME 1KUMA 2B20A 2YAPA 1SF3A 4C59B 3RL2A 2EDTA 1A1OA 5I1HH 3HC0B 3JWNG 4JANA 3Q8CA 3U9PL 5IW1B 5CN2A 4YDZA 1SLUA 4P57B 4ZW6A 1S7SB 3U79A 4EQ3A 4MNQA 4WK0B 5JIDA 3VWKB 4G6KH 2XBZA 1PZ2A 3L2LA 4CC4A 2CHXA 3L6FB 2X9ZA 1ZV2A 4GMTL 4H0GA 4LEXH 5LBSL 3HRZA 3GT6A 3OXSB 3GWJA 1EO5A 3GUFA 4PJAF 5DC2A 3V4PL 3WS6C 4WI0B 2HT2C 1USQA 2MKWA 1ESOA 4PWIA 2VITB 4XMVA 4AYGA 4IDJH 1J8HB 2LU3A 2X4QB 4YEEA 1RIVL 5IB2B 1TFHA 2UYLA 3EYVA 4WUUE 5G2NA 5E1AA 3VRIB 1R3KB 1BZ9B 2VMDA 1DQQB 4QJ3B 2WLJA 1HH9B 4BH8A 4W6YB 3TCLB 4DK5A 3Q44A 1TKWB 1T2QL 4YDNA 4FADA 2G2NA 3LPFA 4U7SA 2HRHA 3HG1D 4JL1A 5H2BB 3VXTB 1YQVL 5DDHA 4B9FA 1RUAH 2NX5D 3KWXA 2ED7A 4JDZA 5DU7A 5HHXL 5E0FA 2D31A 3SE8H 2X3AA 1IAIM 3OPUA 1KXQE 4FMKA 2ZXGA 3DSNA 4OJFH 4XAWH 3GSXA 1JG9A 2DQIL 1L9TA 2CCLA 4P23B 2VDNB 3IK2A 1KCRH 1IC4L 2V5RA 3WEMA 2OMTB 2J5WA 4LASL 3C5SB 1NMBH 4MDRA 2NR6C 4IGBC 2WYIA 1NDTA 1XGRB 1BJ1H 5EUOE 3OSKA 2LU5A 4ICXA 2J2ZA 2CUMA 2OX5B 3IKCA 3W2DH 1AYOA 2E8ZA 5F7LB 4FNQA 1AS6A 2VNCA 4OF7A 2ESVE 2A9ML 4P4RB 4CGUB 1C5CL 3PJNA 5ID0A 1TPXC 5IW6A 3KLSA 2YR3A 1JI1A 1KYAA 1FNSH 1HHKB 1XV8A 2OYPA 1HHIA 4OZGA 1F6AA 3QORA 3TZVC 5K9OA 4YHPA 1F6FB 3K71A 2F5BH 2E5EA 3HZMB 3K80A 1EUTA 3SJVB 3BT0A 1T1YA 4G8GE 4PP1D 1IAIH 3UAJC 4YFLI 1TU2A 2Y2TA 3NIGF 5BZXA 4P59L 3CXFA 4FZ8H 3QA3B 4HGMA 2Z9TA 4Q4EA 4GQ9H 4M9OA 5AYUH 2E4TA 4NEHB 1J9SA 1LWRA 1CI5A 3NQKA 4YMPA 3BUBA 2P80A 1AACA 4W9KC 4HWUA 3UDWA 1RJZA 1FE8L 2RQ8A 1CTNA 3TBVA 4N0UA 1ROCA 2XZCH 5C0ND 3EBHA 4K94C 1YEEH 5DHVH 1MFDL 1DJGA 3N9GL 5E1QA 4AQ1C 4MD5A 2XKSA 3ZTJG 3LKSB 3O9WB 3UBGA 1MCPL 4KK9D 4GKLA 4Y2DB 4HWEL 3MLTB 4ENZA 5HDBF 5BOJA 2GEQA 4GSUA 4X8XA 3CHQA 4DZBB 3H7LA 4GBXA 4MRBA 2HXAA 4R83A 5INDA 4TQ8A 4J3UA 1H5BC 1RK1A 3EUUA 3CLFL 2R59A 4JN2A 4A55A 4ODHH 1DBAH 2VR5A 2NT1A 3BJLA 2AK4A 1F1DA 2J7LA 7PAZA 3ZIMA 5D7SH 3S37H 4X4KA 4ZO9A 1SN2A 2NMSA 2YLHA 4YHML 4Z7NB 1CT8B 4P2OA 3TH3T 3DTDA 4H5SA 3QWRA 2F54D 4PV8B 3SCMC 3VFPB 2CAKA 1RZIA 2DKMA 4Z7OE 3QR2A 4OZFA 2XQBL 1CXLA 3QDJD 3W9DA 4JFOB 2JF1A 2X7LB 4HEME 4AV0A 1KGIA 1KXTA 3LNHA 1F4HA 2XNAA 2R29L 4PJ8C 3Q9QA 3BWAA 1BFVL 1HKFA 4JY4A 2EDHA 4P49A 2GSGA 2UY7B 1UVQA 1MHCB 1UH3A 2G9HA 4UQ9A 3MOAH 4L05A 4N26A 4TUUA 2IAMB 3VFNB 2YD2A 1TJHL 4ZAKC 3P9MB 4L1LA 3UTTD 15C8L 2YXFA 2MCPH 1LO2L 1DVFB 4I48B 3RIAF 3U83A 5JXAH 2DM7A 5F9WB 2PWDA 1G87A 4MD0A 4FQXD 5GIRB 3LN5A 1EZVX 5JNYA 2V4LA 3SPIA 3VGBA 5DJYB 5EEWA 2NY7H 5SWZA 5DYFA 1JBJA 5F8RC 3BEWA 3HBQA 3JTSB 4L2YA 2NCEA 4GW1B 4JFXA 1QYGL 5ESQB 4PBDA 5GGQH 1OM9A 3WY3A 4DGIL 4OW6A 2DIBA 4B5ZA 1I3VA 1B2YA 1CK0H 3T2NL 2YO3A 3PABB 4P5SA 4QJ5B 3EBAA 2PLTA 3T71A 2BFVH 4OFPA 1TEFA 5LNEA 4LKCA 5DFTA 5EO9B 3IFPB 3SCMD 2ZCLL 4JQXA 3LZNA 1KTLB 4PRNA 2YMXH 4H8HA 5DD6B 1N5YH 3P4MB 3IDGA 3PGCA 5ALCL 1HHGA 5FYLD 4N0CD 3ESUF 3HFML 1IGJB 4HHWA 2H2PC 4MA3B 5GS2H 3PL6A 4KKZA 5D4HA 1A3RH 2DD8L 2VRKA 2FJUB 3QIUB 4HISA 5IF0A 1GTFA 3A21A 3KBEA 5DJXA 4WWNA 4E2OA 1JZ7A 4QHKJ 3PNWA 3SPCA 1A9EA 3OKLB 4PCTA 5AUMA 4UT7H 4P4KA 1TTUA 1PY9A 1OWRM 4CNIA 3W57A 4UNTA 1ASPA 1IGMH 4QMEA 1BMWA 3P4NB 3BSHA 4I9WE 2BNRA 4DKTA 3X1GA 4PY8I 5ILTL 3RDTA 1Z6JT 2AEQL 3EFOB 2MQCA 4BZ2L 1HWGB 4KTEL 3GKWH 4NC0B 3BESR 1MIML 1JDAA 4WV1C 1IC7L 1MFEH 2YWZA 4F8PA 2JV6A 3KGUA 2GABA 4WTZA 3GMPB 1DSFH 5DD1L 3VXQB 2MHAB 2VXQH 3H3PH 4P3DA 5DC4B 3RY6A 4LGPB 5DJDA 5FO7A 2VM9A 2DH3A 2JKWA 2A3TA 4P9HH 3ZBMA 4F5CA 5I2IA 2DLIA 2J3SA 4AM0A 4J4PC 3ZDYE 3EW3B 3IDYB 4OCNC 5E8NB 3RWHB 4KKCC 2V17H 1QRNE 4M3KB 5HHME 4OM0L 2VC2L 1J0YA 4JPQA 3D05A 2PNDA 3K4DA 3CZJA 1OLZA 3ARYA 2XN1A 1YYLH 4ZFQA 1JD9A 2B9AA 4N85A 1FNEB 2HRLA 3GMRA 1NMAL 2XCMC 3FB7A 2H8PA 3PYCA 3SPVB 5EPMA 5ETUB 1Z5LB 3P0GB 4EI0A 2DLHA 3CFEB 3U25A 2XLLA 5I18H 2X89D 4FFZA 3RL1A 3BW9A 4P3CH 3SOBL 3CFDB 2ADGB 3EGXA 4ZO6A 1MH5B 2HKFH 2Y6SC 2UUDH 4ES9A 4POZD 1BEXA 1J5OH 1RSFA 4GUQA 4C56B 4MMYB 1BW8A 1JMZA 5F7AA 2WLIA 4KKRA 2MNWA 1F5WA 5FA3A 5MP6H 1E40A 4HCRL 2MNUA 3V5DA 1ZHBB 2WCGA 1A6ZB 2OFQA 1H15A 5EFIB 1OAZL 2DWDB 3FT3B 2OTUB 3QFJA 5EU5A 4PGCB 3PXHA 5CZXD 3J7HA 4GINA 3UZVA 1R17A 2WSDA 1DL7H 5CINH 1A3QA 3DMMB 2DMBA 4KTGA 1SOKA 1IGYA 3MCKB 2WZAA 5BOZG 4AITA 4FQ2L 5J13B 1JZ2A 5F1NB 4HX1A 3BZDA 5DFAA 1MOEA 3OLDA 2ZX5A 1N64H 3B2XA 2WB7A 4GUCA 3W56A 2ZYHA 4R4ND 5ADOH 3K2IA 4LBEA 3K0YA 4WHCA 2DQHL 2W0FA 2YEZA 4WI2A 1F4AA 2XV6B 2JB5H 2UWEA 2IADB 2XRAH 1IGCH 4GG6F 1BLNA 4APQD 2NNRA 3TN0C 2KERA 1I1RA 4MB4A 1FNAA 2QBWA 3QUZD 2YSTA 1S7VB 1JNHB 1IAOB 3DV6B 4XRCA 4BQCA 1BBDH 1XGQB 4HGKC 3ZKSD 4AYFA 2XV3A 1FDLL 4DF9A 1NSNL 5FLUA 5JDJA 3GGWB 5JO5B 1N68A 5F9JA 1JVLA 4DCQB 3MRNB 3ZUNC 1CTMA 1QSEE 3R7RA 2C3VA 5CCKH 5ALBH 2O61B 4M3HA 1KV7A 4HJ0C 4S1DC 5IMMA 3N04A 1FRGL 2YOAA 3NIGB 4X6CF 3FYIB 4K7PY 5MENB 2FB4L 4OLVL 1NBQA 4OD3L 4FKKA 4NXSA 5E2TL 4XTRD 5CKAA 2H6PB 2N01B 1L9RA 3RU8L 3O3UN 4JO5A 2XTJB 1KPUA 4NP4L 5ID1B 5HBBA 1QTPA 2R83A 4PS4H 1M71B 2EDDA 1TSHA 5I8CA 3DJSA 1E5ZA 1MFAH 1WUNT 2AEPL 4NRZB 3RQ3A 1E4WL 2AITA 4X6DF 3SDAA 1L0PA 1O75A 4LF3A 2VLKD 3HZVB 4FXGB 1QAWA 4O2CB 5JYLA 3WHE0 2AJ3A 5HDBB 5LWYL 1IE4A 2A77L 1WT5C 1YNTB 3HS0B 2OZ4L 3O3DB 5KYUB 3OAYK 3DIFA 5IB5B 4FNTA 5I26A 1S9WB 2DTSA 4D0CB 4E9YA 3IVKB 4DKDC 1TQWA 3VXSD 4GO8A 4IS6A 2D9QB 5EZIH 3B9DA 4GMSL 4J12A 1WD9A 4OR1A 3SGJA 1JYXA 1I31A 4NWTL 5FS5A 4BK4A 4FQ1L 1HDMA 3BUPA 3EOAA 1NAMB 4H1LA 3DX6A 3GRWA 1L9MA 1HYRC 4I1NB 5C71A 1GL4B 2VLRA 1I8LC 1JXGA 5IQ9B 1IKFL 4PLJC 1U41A 2BNUA 2NXZD 4NNPH 5KSAB 1ED3A 1OAQH 4D0BA 5EMYA 5J5EA 2R2EA 3NACH 3T65A 3AMLA 1GKEA 3BP5A 2XQYK 4Y16B 5AVXB 1U8IB 4ABQA 1DVFC 3PHAA 4LNRA 1Y0LB 4N8UA 1Q38A 2KPNA 1S6NA 1OARL 3D0VA 4K94H 4JLRB 1XXDC 1QBMH 1S3KL 3OZ9H 3ZTEA 1D5XA 4B9GA 3PWJA 4EUPB 4R84A 1H6FA 3UJJL 4QRPB 3WAKA 5G5DB 1WBYA 4RBPK 3BGMA 1J1OL 1PJ9A 1YC8A 3UZEA 2Z8VC 3EAKA 3TM6A 5CLYA 4FFVD 4RFOL 4K8RD 1CFNB 2AJSH 4X9FA 3HR6A 3U0PB 1BVKB 1XHHA 1TETH 4PJ5D 3PGFL 1EJ8A 3D4CA 1HK6A 1CL7I 4LFHG 1RZQA 5EORH 4KKLD 5EZLB 2JQZA 2VABB 2A6IB 4EI5B 3KCWA 1E27B 4P5TC 4XNQB 2CRMA 4P2CG 2DJMA 3WNIA 2YAMA 4DQOL 2YQ3A 5CEZH 5IVXB 3DPBB 5LG6A 3RB7A 1AZVA 5FECB 5LCVH 3RA7H 1KY6A 1EVUA 1CG9A 5CCJA 5JHDA 2OL3B 2Z1PA 3VXME 5HDQL 4G7VL 2ERJB 1G7JB 4N8CL 3EH3B 4TSBH 1HL9A 3MRLB 1RJLA 5CAYB 1HSBA 3L5XH 1NCWH 1A14H 2YN5A 3AG3B 5EF3A 1I8KA 3BAYA 4OCRH 4YR6A 3VGDA 1J86A 3B3IB 1G6RA 1LD9B 4ZMPA 25C8H 3VGAC 1D9KB 3U7YL 5ANMA 1MUJB 2XN9B 3TBBA 5BVJA 3BFWA 3WYRA 3HIZA 4BH7A 4BA0A 1V05A 5C8JB 3WG7B 1MJJB 5J11B 3BEVA 1Z9NA 4K3EH 5FR3A 5AL0A 3DBXA 1T66D 2K6ZA 2QADC 2BZCA 2AGJH 4LVOB 4PJXE 3BAKA 4QRQB 4PU2A 3IFOA 5E7BA 4HG4K 1NCDH 4LEOA 1HEZB 1P7KB 4JG9A 3IDYC 2ISDA 3K7UA 4J3OH 2HH0L 1JPGB 2UXGA 4A7GA 2OSXA 4CKQA 3T6QC 3S35X 1JTTA 1YVLA 1OGAE 3MRIB 3HS8A 4Q6IA 5ISZE 2Z1KA 5E70A 3QPXL 3UTQA 5ERWB 4G6FD 4NERA 1OAKL 4CL7A 1S7WB 2ZD0A 5B21A 1ZHKB 1Q9KB 1UG9A 5MEQA 3VG9C 3UBXI 1GSKA 4U1JA 4G7SB 4A66A 3NAAL 4UU9B 4GRLC 1CR9H 4PJGF 4WO4D 2F61A 1XQ4A 1OCOB 1SYSB 2ZIDA 2NCMA 5DI8B 4RDQF 1KEML 3BVNA 1HC1A 1JWSB 1YZZA 2E9WA 4Z3JA 4Z7QE 3ZHFA 3FQ4A 1NDGB 1HINL 3B7SA 2JJSA 3GDCA 3HOGA 2A74A 1UH4A 2GB2A 3DX7A 3O3BB 3QCTH 4KJWD 4WHYG 5CP7A 2E74C 5TE7H 3QG6B 4MAUH 2CQVA 3TEYA 3S35L 1F45A 4W9ZA 2ADYA 3DMMC 3NZSA 3FT2A 3M1BB 4BFIB 4NNYB 3VA6A 1J48A 1LO3H 4B9KC 4FNLH 1K2DA 2J1XA 1LK3H 4LIQL 3UTSD 3NCJL 4XNAA 1NPNA 2PKDA 4PJIE 1OIOA 5F0JB 2R23A 3MV01 2HLFD 1U33A 1KGCE 3DTXA 3GEWB 1BZDA 3VFUA 4RWYH 3C08L 3LQAC 5B8CC 4FXTA 3PWPD 5HGHB 5D1XD 4OLUH 4Y5YA 1E65A 4Z7UA 3A4EA 3V5HA 4GG6B 1BFSA 5EOTA 1ZK5A 1IBHA 5C0AA 2VZSA 4G8FB 2FL5B 1RZFL 4XN9A 3ARZA 2ZWSA 3FCGA 4JKNA 3BMVA 1U21A 1MY5A 1QI4A 4XVUC 3L3IB 4O5LH 2X9WA 1DQDH 4LPTA 4KXDA 3OV6A 5J57B 3E6HB 2N56A 3L3KB 1BIIB 4R96B 3GXDA 2P47B 1YDPB 5JMRA 4WWKC 5KAQG 4FZEH 1M2VB 3I6GA 4MJJA 3CSPA 5KSBE 4YDJA 3UYPA 1HAUA 1KJMA 4W93A 2ENJA 3KCPA 4FHJA 1KJ2B 1IO4C 4UOW0 5JW4M 2ID5A 2XA8H 1CGSL 1E9QB 3QG7L 1J10A 4EEEA 3N1QC 4X5WA 5BQDA 5I82A 2CHWA 4FX5A 1NEZB 3AY4C 4N3UA 4L0PB 5B38B 2ZYRA 4GKNA 4JG1H 3P0YH 4TNEA 2Z7YA 2XWEA 4HS8L 5LAXB 4N87A 2RTTA 2Q8BH 2DZEA 1RUMH 1CGVA 1NUGA 2LGNA 2VDNH 1XF3A 4X6DB 4KO9A 4KHXL 2FVNA 3BFOA 2HN7B 3CFKA 4L0ZA 3BFQG 1NFDA 3F04A 4W4OA 3FRPG 4N2FA 1WIPA 2QGDA 5I17A 4JR9H 4L5FL 5TE4L 2AF2A 2ZOTA 1O9WA 4K2UH 4PJDE 2HG0A 2WP3T 4HYTB 1JCVA 4ONGH 5D7LE 2ZKWA 3FSWA 5EN2A 2XWTB 5D7JD 4X80H 5B1JA 4DH2A 3MLWL 4LK4A 4X6EB 2VXUH 4FFZL 5IBUB 4Z77A 2B0SH 4LCCC 4ZOAA 3L7FA 1CFVH 1XGYH 3QCUH 4WEBH 4ZUWB 3RWFA 4ZW3A 4UILH 4RETB 2VQ1B 4OZHF 1LEGB 3D69B 3QDAA 2Q3AA 3D9AH 5I5RA 4J8QA 2ZOLB 3ZU8A 4QHMA 3CDGB 4Y4KA 3V4PB 5I24A 4F15B 4HKBA 3V0DA 3RVXC 3ASOB 3VYOA 5FB8B 1EQWA 5CEZE 3QEHB 3WEXB 3S96A 4PJEA 2ITEA 1YEGH 3HEIB 3L1GA 2FQEA 4FGMA 5T1KD 3RBSA 3FQRA 5IM7A 1BCIA 2Z31D 2ZT9C 2J6EA 1Z5HA 1FC2D 4HMDA 2ICWA 3E7JA 2PO6A 4LCVA 3N42F 5DQDL 2NUTA 3IXTB 3ECQA 1BM7A 3H6JA 1EHKB 4DKFH 4RMTA 1MWAA 5DUML 5IP4A 1NGXB 5EEZA 1HIMH 2K6YA 3UCQA 4I0PA 1NMCC 5EO1B 5GJSH 3FF7A 4H8WL 2DQFB 1FGVH 3GJFK 3HBGA 2JCCA 3OR7A 4ZS7H 2EUXA 4Y5XC 4UQDA 1NIAA 1IE5A 2V5YA 2CJTA 3MA9H 4XGZB 2BDNH 4B95C 1ITBB 4N2GA 1K72A 3LQZB 1ZMYA 1IM9B 3T77B 5FKAA 4NQSA 4PJ9D 4HLZG 4MXVE 4L23A 1Q94B 5T1MA 1NIEA 4XMPH 3WKNA 1ZANL 4TV3A 2AXFA 3BKMH 4ZDHB 4F33B 3BD5A 4BELD 4UT9A 3V52L 1NOAA 4Z76A 2J73A 3CK0L 5C0BE 3D1MC 3NH7H 1LDSA 4MA7L 2R1YB 5HDOA 3MGTA 3MHZA 1ZK9A 1F42A 1Q9WA 5C8JA 1QSVA 1RJYA 1Q9OA 3FQNB 4CA4A 3FF8A 4AIOA 2CO3A 4N1HB 2ZWZA 4Z0BL 3R7QA 3LNEA 5IROA 1SJMA 3AT9A 4ZMLA 2ERJC 1KPVB 4KOBA 4PJFF 4XI5C 4X7SL 3LV3B 1G7HA 4HKXB 5KVEL 4L4TD 4MBRA 4EZKA 5TF1L 3MRPB 3N6YA 3WY2A 5JYMA 3FUKA 2Z3FA 1AQMA 3MGOB 5IIEA 5E95B 2E75C 4JO1L 4LCWB 4R9HA 3O6FC 4HWZB 1TQCC 4NO5A 1NGPH 4AZ8A 2PP9A 2XPGA 4X5RA 4LFHD 4JPIB 3VTTA 1E4XH 5E2JA 5TDOA 4FQLL 4KI5D 1HWWA 4XCCH 1QHQA 1W8OA 1F3DJ 1XH3A 5I8OH 1Q9LA 2NTSP 1Y07A 3QCVL 4OKVA 4XB8A 2YD3A 5CP3A 3APFA 5J11C 3C5JB 3ME0B 2VDOL 3MV8B 1K5NB 4XNYL 4U6XB 4A2EA 3AWFA 4E9QA 5FO9B 4NM8H 1WD8A 4HU2A 5IHLB 1J9QA 2AKRB 3I9AA 1EZSA 1WWWX 3K6DA 4R4BB 1OT1A 4RMBA 4UI2A 3IMVA 2Y7MA 5C07E 4JFQA 2B5IB 1UXWB 1U8JB 5JA8B 5AOIA 1AY1H 3S8WA 3VQMA 1P7BA 3KYKH 5E08H 1VFAA 2WJ5A 1QZNA 1L5GA 3GD1C 1DJWA 3E9TA 2PXYB 4YHNA 4GO6B 4CVXA 3QEQD 3VD5A 2YUZA 1QSFD 2HFGL 4DJMA 2DKUA 1EHLL 3O6LH 4PYGA 3M46A 4A6YB 1HAWA 3I74A 3RWEB 1QPKA 1GGBH 4JGJA 3ZK0A 3MZGB 2BP8A 4U1MA 1J0HA 1VERA 2IOIA 5L88H 1B4JH 4RH4A 4KXAA 1D6EA 5CGYD 2NY4D 2FQDA 5HYJA 4RAVA 3DV4B 3FHEA 3I3BA 4AYDC 3GHEL 4MGXA 3VFSB 1EFXD 1YSOA 1IGFH 2PMZA 2DQTH 3VD0A 2Q7NA 4UTBH 5FYJL 4APXB 4U1IA 3NA9L 3V6FB 3GC3A 3D39B 3P40A 4L37A 3CMGA 5LKNA 2J8UF 1HSAA 2Y7SA 3DJRA 1ASOA 1UUNA 4S2SA 2Y9RT 3U4EA 3ZKND 4XN8A 1IJ9A 2BX5A 4R26L 4DVRL 5KZCB 4LSQH 2A73B 3HG5A 1UXSB 3KYNB 5E99H 3T2PA 1UCTA 3L9RB 3SQBA 3ALPA 2EKJA 3KYOA 3TJPA 1UJ3A 2PTTA 2GJ6A 3ECWA 1XGPB 3V4UL 4Z78B 3NEXA 3ZUCA 1BVZA 2NNXA 3L4CA 1BZEA 4OFIA 5AZ2L 4OLEA 1CICA 1D5IL 4UQ2B 3SYCA 4QHLB 3FS9A 1BREA 1LMKA 4YLCA 5EOQH 1PGRB 2C9AA 1ZT7A 4MJ2A 3R8BB 4NAQA 3IBOA 4MMXA 5C9JB 4MCZA 4R2GD 5BO1L 1I1FA 2D03L 1OT4A 3Q3GA 1CLOH 3QJXA 4JMNA 3WJMB 1TZOA 1P5VB 4ZOBA 5D1ZB 1BD2D 4O00A 2Z92A 2H9GA 3LKOB 5DUBA 1IT9H 3VGHA 5IK3A 3EDJA 5FLVA 2DQCL 5K9KA 1WA1X 3BVDB 2W88A 2F9BT 3GZQA 4OZGF 5KOMC 5K93A 5IQ7H 3ECBB 2DOCA 1R47A 2YXMA 2EYTB 3FT4A 5ICUA 1QNZH 1U8MA 2CZNA 4BZ1A 2L3BA 5JHLA 1BVNT 3BCFA 1NCUA 2C4FU 4PRAA 5HGAB 3SJVE 3VXRA 1CFQA 1SBSH 4KI1A 3BIKA 4BJLA 3BKCH 3H3KA 4XNXH 1T5KA 4LLYA 2PCPB 2X4SA 3VWJC 1M7DB 7CGTA 2BIQA 4AQ8A 1BXXA 2W65A 4PVMA 4JJ5B 3DJ9A 3T2NH 3UADA 1IFRA 1QFOA 3E38A 4I5BA 4YNYA 3F12B 2J4WH 3TO4A 3VFGH 2AW2A 3MJ9A 1LE9B 1Z9OA 3FAWA 3D2UD 3U2JA 5GS1B 4YSSA 5K9QI 4PJCB 3L4YA 2MOGA 2PWGA 5C6PB 1OSZA 1I3GH 4X9BA 9PCYA 4DEWA