3KCPB

Crystal structure of interacting clostridium thermocellum multimodular components
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
163
structure length
163
Chain Sequence
SSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into Higher-Order Organization of the Cellulosome Revealed by a Dissect-and-Build Approach: Crystal Structure of Interacting Clostridium thermocellum Multimodular Components
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Structural protein
molecule keywords Cellulosomal-scaffolding protein A
total genus 33
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kcpB00
4WKZB 1G1KA 3FNKA 2ZF9A 2VO8A 4UYPA 2Y3NA 2W1NA 5AOZA 3F2LA 4IU2A 1AOHA 2OZNA 1ANUA 1ZV9A 4WI0A 4U3SA 3BWZA 1TYJA 4N2OA 1QZNA 5G5DA 2BM3A 4FL4C 2VN5A 2CCLA 4FL4B 4UYQA 5LXVA 3GHPA 2B59A 1OHZA 3KCPA 5K39A 3UL4A 2XDHA 2VN6A 4DH2A 4UMSA 2O4EA 3KCPB 4IU3A 3L8QA 2JH2A
chains in the Genus database with same CATH superfamily
3LMJL 4GNKB 3IDMB 2P80D 4X99A 4PJ7E 3OB0K 3HN8A 2G0LA 1NTDA 2JJTC 5KYXB 2MRYA 4L3EE 5HDBE 3SODB 4DETA 5IVXA 5CILH 6CGTA 4HIJB 4JHWL 1AD9A 1P2CA 5M94B 4ZMAT 1F3DJ 2VDNH 4FJYA 1KCVL 2VRQA 3PWNA 4R97C 1PIFA 5HYEA 4MB5A 1MAKA 3WAKA 1BFVH 3A23A 4NZ8A 2MNJB 4MVBD 1S7UB 1I1FA 1KGWA 1O5PA 1J9CT 3CFKA 4DGYL 2TSBA 2FUQA 4M6OL 1OAXL 2JKNA 3LIZH 2WWMC 3T8XA 1NSNL 4OIBA 3VFMB 1KIRA 3RWFA 1A3ZA 1B88A 1RJCA 2NY7L 3JWNG 2Y7QB 2VDOH 5TTRA 4BD4A 5DZLA 4OCXH 3ZT6A 2OMTB 3QDGE 1J8KA 1GZQA 3FCGA 3VTMA 1PQZB 4JAMB 4XZ4A 5CCKH 4Z7WB 5I1GL 4NQXB 4XTRD 1B6UA 5B22A 1WBYA 5KN5B 2JB6B 3GIZH 3ARUA 3OKMB 5DJ8B 5DMJB 1IC7H 1NCJA 1AY1H 4MA1C 3RTQA 4KVPA 1JPSL 5DZAA 1HSBB 4N2BA 3GHEH 1S9YB 3BHBB 2OI9B 5AW2B 4PH8A 4U6VH 3MLZH 3GGWA 3PGFL 2QTVA 5DEGA 1FFOB 1RULL 1FH5L 2F9BT 5E95B 3UJTL 4Z7NE 5DLMH 1HCFX 2V17H 3N44B 3VMPA 5IV2B 3QNFA 4JFQB 2LU7A 4NWTL 4EN3D 1E5CA 2CDEB 5AUMA 1KCLA 2UYLB 3ES6B 1MHCA 2PCPB 3HZMA 4G1EB 4PJBE 2Y9RT 5LGYA 1NCCL 3ARTA 4KY1L 5TFSH 3SKOB 3ZRCC 1Z32X 1KLGA 3E80A 4JR9L 1MCKA 3Q13A 1BGXH 4JFZL 4JRLA 2X4SB 4CILA 1HHIB 3NABH 3B2XA 3G5ZA 3WNNA 2W9EH 4N8UA 4NNYB 2Z34A 4G80A 5GGVH 2GK2A 3VXOB 1DEDA 2GTWB 3TCTA 2J5LB 1MLBA 3FQ1A 4NO0D 4AM0A 4ODWA 4TNWF 1DN0B 5CGMA 3FUHA 4FQXC 4Y4HB 3CFJA 3RBSA 3A0OA 4BWUA 3QIUD 3S96A 2HA1A 3BO8A 1XCWA 4EJ1C 5KSAB 5KBDA 3LNIA 4M6MH 1BZEA 1JGUH 2XRAL 3NCXA 2DIEA 2G9HA 3GXUB 3CHPA 3MNVA 4JUSA 3QEGL 5CJXC 5DS1A 2LFEA 3D0AA 3KWWB 5KBKA 1ZD6A 2J55A 2VLKD 2OXGB 5DHDA 1Y1UA 3LIUA 2OMUB 4GI8A 1IAIL 4PJ9C 2K0RA 5D96B 5F6HI 4E5XB 2P49B 4XP4L 1FZMB 4XCFL 4AQOA 5T3ZD 3AY4A 1U2YA 3BSHA 2NY3B 3SJVE 2VDNB 5H94A 3TCLA 5C07D 2I9TA 3PXJA 3ARZA 5B4MC 3NUKA 3F5WA 1V54B 2JIXD 4JGJA 1ZMYA 2H7WA 2WPGA 1HH6B 4JBSA 4JG0L 3FUJA 3G5XB 4M6AA 4QLRA 5FECA 2DAVA 3WKQA 4S1DD 2WBJD 2X4OB 3ZX1A 4U6HB 1U4EA 3PUCA 5JOFB 1T2QL 3GXFA 2RR3A 3PHOA 4NXSA 4PJ7A 4J12A 3JYBA 3I3BA 4NKQB 1T80A 3HJEA 2B15A 4W81A 2VM4A 2P5EA 3IXAB 1LK3H 2FH8A 1SPDA 3D85B 1AZZC 4YLCA 3NCMA 4HOMA 3M1BB 1LO2L 4GRWF 5LBVA 1EA9C 1JNLL 4ZS7L 3ZXAC 1DQDH 3MV7B 1ZGLB 2BFVL 2Y07H 1MHHA 1MW3A 3WL9B 3TO4C 2W1NA 4JANA 3AMKA 4XNYL 1FIEA 3IN0A 4M7LH 3L4TA 4PBDA 3QYNA 1D5RA 5KSBF 2X1PA 1N64H 1ND0A 1ADQA 2BSDA 3EDJA 3VXQB 5IW1A 4H1LH 2UWEB 3H2PA 4WWNA 1HHKB 1MIEH 3HE7B 1FWXA 4OGAD 3GK8H 5C09E 2X4RA 4AG4H 5J3HD 3FRPA 3PQYD 2Y06H 1ZHKB 3DOIA 1CU4L 4PJ9B 5CJQL 3SCMC 2ERJC 2ZUQB 2VDLH 5IMMA 3PAVA 3RGVB 1VCBC 5FCUH 1T66C 1L9RA 4B5EA 4BDVA 2CO4A 4WU7B 1SHXA 2BVTA 3HRZB 2R39A 5TQ2H 3KPRE 2CKBB 1UGKA 1REIA 4KJQC 5D6CB 4ZXBC 2FX7H 4DPBX 1AXTH 1VF5C 1JG9A 1DBJL 2VLRE 3ECBB 4UOJA 2XT1B 3EYUH 3QCVL 1JFQH 2OX5A 5CP3H 5IFAH 1L7TH 5J56B 1R9FA 3FFOA 4KZEL 5D2NC 4Y8AA 5T1LA 1HWGB 1MCNA 2DH2A 3I74A 2XKNB 4IOFC 3WTYA 4UM9A 2EKSA 3L3OC 3LIZA 2C8NA 3M8OH 4EZKA 5CLTA 4AE0A 3H9SA 1J8HD 2VE6A 3F6IA 3MI6A 3OAZK 3UERA 1V3JA 2DLFL 2HT2C 4QXTB 3QNXA 3RA7L 3QIUB 4EPSA 4YUEL 4PJFB 4JGNA 2DL9A 1I1AB 2D7OA 5IT2L 2EDRA 1MFMA 4JO3H 2ICEA 4KNSA 5EIVA 2XQYG 4P46D 4KI5F 1ECYA 1I8IB 3MNWB 1YEEL 3OAWA 2ZXAA 3B9KC 1MG3C 3L16A 3C60A 2IAMC 4QJ3B 1NGZB 1CICC 4DGVH 2O5ZH 2VXQL 4KGLA 1Z9LA 4HC1L 4HUMB 5EO1A 4M4RB 2H8PA 4K8RC 3CSYB 3QAZC 4NHCH 5KBNC 5FGCB 3JV4A 1AKJB 3D25A 3KPSA 2ZOKB 3ZGIA 4LPXA 3VACA 1IC5L 3JWNH 1MEXL 2CBMA 3HPLB 3O4LA 1BDYA 2FE0A 4OFYD 3K1DA 3IBEA 4WTXA 3IDYC 3FZUC 3O41B 1M6OB 2W59A 5IJBC 5BUGA 4XN9A 3QG7H 4PY7A 3FU5A 4R7VA 5T5NF 4F2MA 4ZQKB 3OR6B 1C9SA 5LG1A 2PYED 3POHA 2A73B 4JEGB 3KCWA 2V2WB 3DROB 3QC5X 1YEDA 2H9GB 4FHBD 3HS0C 1H15A 4JCWA 3TONA 1IKFH 1JF6A 1HHKA 2GIXA 3A6CH 3BT0A 4PWHA 4X7TB 5I18H 5CR8A 5HYFA 2W0PA 4YBQD 3BJ91 5BRPA 5I5RA 3I9GL 4M7KL 3B7SA 3DPBB 4QHLA 4A7VA 1EUUA 2NR6A 3MFFA 1OAQL 2W9LA 4PJFF 5JA9A 1YHPA 4BXSV 5D2LB 2VMEA 5LJYH 1I7ZA 4X4YA 2NSMA 2CU9A 5D71H 2R0KH 3DOHA 4BZ1A 1O6SB 5E99L 3TJEL 5AG9A 1A9EA 4NYLB 1F58L 1CTMA 2GJRA 4UM9D 2H0FA 1WCBB 1NCOA 4TNFA 1NFDB 3L7FB 4JN1L 3T09A 3G5WA 3OGCB 4K2UH 3HE6A 1HEHC 3ZTJH 5HYSG 2CUIA 3V8OA 2Z8SA 1JIBA 2ITDA 3FQUA 4NRZA 1BLIA 3T4AA 1CE1L 4O58L 1K3IA 4P23B 4PJ9D 3F5WB 4NKIH 5GGQH 4JPVL 1F3JB 1QO3A 1A4CA 3GMPB 4FFWD 2YPLB 3ZE2E 3QPXH 4OIFA 3TO4A 1OP5H 3MAWA 4OZIF 5J9PA 2CIIA 4A2FA 1T2JA 2A1WH 4LVOB 4PJCF 4EDWL 2WK2A 1KXTB 1CZ8H 1YYLL 4LDLB 3WXWL 2B20A 4MJ4A 3UG4A 3SJVB 2CNZA 5GGSB 2VDKB 1L9PA 3LN9A 1GC1C 4J7RA 4PGBB 2I25N 3GMOB 1JP5A 1XSJA 2FEDC 4HKZA 3RWGB 4FLHA 3CXFA 4AGNA 3NIFE 3QEQA 1FNGA 1FFNB 3I6GA 4YHKH 5C7XH 2AJ3B 3IGKA 1M1XB 3RWCA 4DW2L 2B5IC 4P06A 3GLEA 1YEIH 2XG5A 1L6XA 4PJGA 5D1XE 2VXSL 2YN5A 5D9SB 1UXWB 1E6JL 3GINA 4LHUD 3ML9A 4BFBD 3STLB 5DT1L 2HFGH 2APFA 5DUJA 1NCBH 3BPOC 1YJDH 3TNMB 4RLDA 4JCLA 5FYKE 1HJCA 3QARA 1HQ4A 3LS4L 2D2CC 4PRBA 1F3JA 1QO3B 2DN7A 3EJPA 3NACH 5E6SB 5IJDC 4X7DC 4RMUA 4LGRB 3ZYIA 3E1ZA 1BVKB 1IAMA 3CNKA 4Y2LA 2VZOA 1JDAA 1W0VB 3DNKA 5AZEH 1DUZB 2VAJA 3N50A 2V2XA 3AREB 2I60H 4K94C 4DKEH 3RRQA 2G75A 1DJXA 4N2CA 1YYCA 3LS5H 1ZVYA 5LBGA 2JJSC 3CSTA 2IBZY 3LPWA 1VESA 5HJDA 4EUPG 2R4RL 5FYJH 3OPUA 4AUYA 2FEDD 1DBKH 3MRDA 4RZCA 1DYZA 1CL7I 1QLEH 5LGJB 5DHEA 5I1AA 1EJOH 4JQIA 5F7YC 2Q8AH 1EMTH 4HWBA 4HJJH 4ZXBD 2WB1A 1LMIA 1INDL 3AABA 1E4XI 4WJ5A 1S46A 4PJCE 4PJGF 4CU6A 4ZXBB 4HPYH 3CU1A 3ZE1F 4D0BA 1R24A 4EEEA 1IBZA 1JBJA 4FTVE 2AITA 4ODTH 3DVGB 4QXGH 3FMGL 4QIRA 2GKIA 3SDXB 3WTUA 5GGTA 4N0UE 1VKXB 1YNTF 2VM3A 4O51A 3F12B 2YUVA 5LGHH 4NZUL 1AZNA 1RJYA 5CSGA 3SBRA 1G7JB 4GRLA 5A6IA 4V33A 4F15C 3GTVA 4AL8C 1ZTMA 3FK3A 3WS3B 4PQXA 1VGKB 4XXWA 2KLRA 3BPCA 2ATKB 4WY7L 5MENE 4XNBA 4ANXA 2EE3A 3HA0A 1PAMA 3EW3B 3X3GL 4NRYB 3GZPA 3BDXA 1FZOA 3MRMA 3QXTA 4G72B 4PRHA 2OULB 1U8NB 5BS0A 3FZUD 3TASA 4OD2A 2Y7LA 1NEPA 4E42B 1DDHA 3FMGH 3QQXA 3SKMA 2BZDA 3UCRA 1H9VA 2J25A 1Q0EA 3FFCE 3SE3C 1UYWH 3DMMA 3IK2A 4BQCA 5I74B 4TNEA 1JPFB 1G7QB 4WUUB 5IVZA 2M8XA 1C5BH 3QBTB 1FYTD 1HHGA 3IDNA 2DYPB 3OQRA 2EZ0D 4IRSB 1KTLB 5I9QB 1IAOB 4CADA 3L08A 2Y0SA 1RV6X 4I77L 5HY9A 4MB3A 1E67A 4EZMA 3FFCB 2IVFC 1FORL 3SSGA 3NZHL 4GG8A 4Q4EA 5D96C 3EFOA 3OG6B 5FYJL 3VXRE 5I8CB 1HX0A 1NBZB 3IMVA 4HVBA 1QFWI 4FXGA 2ARJQ 4FQJL 3G6DH 2J1XA 4S1QL 5D7IB 5TQ0H 3D4ZA 2AEWA 2YARA 3EUDA 5ICXB 4OKVA 1Z7JA 3C8KA 5JPNA 3PFUA 4F9PA 3BN9C 2YEVB 2AMGA 4KWUA 1HEZB 2VZSA 4I88A 2ZX6A 3DK0A 4MA7H 2Y1ZA 4F1SA 4XN2A 4HIXL 4U6YA 3LDBB 3HFMH 4DH2A 3MLPA 1FJ1A 4Z1PA 3O3EB 1BZ7B 4M43L 3AMLA 3QA3A 1RJLB 4JY4A 3FU7B 1WZKA 1YJDL 2FBRA 2MNUA 3ARBD 4HALA 4L1SA 4WFGD 3ROOB 4MRBA 3MRQA 1MIMH 4Q97A 3X1FA 3U9UA 4LOVA 4YR6B 3SPGA 3N5AA 2DLHA 5D7LE 4PJHB 3P9LB 4JANB 4ZODA 2Q8BL 4EN3A 3GT6A 2I5YH 3QQ3B 2VITA 4P9HC 1QNIA 2YOAA 4O51B 5AVUB 3FN3A 1UD2A 2WYIA 3GSXB 4U3HA 1DQJB 1DO5A 3PS6A 3WLWC 3OC8A 2F1BA 3U30C 4P57B 1BQHG 3EBIA 3OZ9L 3QUYD 2GBTA 4D0CA 4RGNC 2AKRB 1JUFA 4HT1L 5I15H 2MPVA 3PJSB 2ZWZA 4V11A 5DVMA 4WJ5B 2VZTA 1T7ZA 5D1XC 4KI5E 3PRZA 2K6WA 3FT9A 1M2VA 2G5UA 3GMMA 3VXMB 4Z0BH 4E9XA 1KDIA 3C6SB 2GJZA 4U3SA 1ZT4B 4M5YH 4P2RD 5GIRA 5JHAA 1P1ZA 1MRDH 2NQ3A 1SLVA 4QNPF 4WRLA 4XNDA 3BH4A 4E68A 3QJZA 5I8EB 3AZUA 2Z35B 1HDMA 4HWZA 4J4PD 4CMMA 2Z31D 3X1EA 4RSVA 4AEHL 4FMKA 4U1MA 5DD3H 2HB0A 3RL1B 5FDWA 1KSRA 1X5AA 4UOW0 2VO5A 4CC1A 3TH2T 4DN4L 2ICWJ 4PV1C 5F89A 2YD3A 1BG9A 4LOUC 5F3HB 3K4AA 1JCKA 3D4GA 1I8AA 4I3RH 1SJEA 1UZ8A 3OQ3B 3T0WA 1E4KA 3PF2A 5CEXB 4PRBB 3WKML 3WJLA 5A16A 5KVGH 4ZT1A 5GGRA 4OCSH 3JWOC 3RUGB 2ZKYA 3INOA 3MX0B 2Z91B 4JFPA 3G5YA 4IRJB 5FA3B 5E8PB 1GC1H 3ETBJ 3U9PL 4C83B 4DOHE 1IKNC 4H5SA 3B5GA 1KB5L 1IFHH 1AYOA 3KR3H 4NQVA 4OF0A 5E56A 5C0CA 1CDUA 4AC2A 5DC9B 5A16B 4ZFQA 4NOFA 3ZE1B 1I4FB 1KTDB 3QEQB 1OT2A 6FABL 4JY5L 1B9KA 1U3JA 1NM4A 2NX5D 2XVLA 1JWUA 3P1VA 2KYIA 4N90D 5IB5B 1B4LA 1PZSA 2Y1YA 5HI4D 2IV8A 5E9DB 4NQED 1KCWA 3UTQB 2BJMH 2I9LA 4J3OF 4BBWA 3ES6A 3HZMB 5TDNA 5I30H 5GS0H 3BD3A 2Q6WB 1A8JH 4JFWA 3BKJL 3FTGA 3KD4A 2H0PA 4GKSB 1FUNA 1MREL 4QRRA 4OCYH 4XMXA 5DD6B 1J5OH 1H9DA 4CBPA 3VXRA 3NSCA 4JRYD 5T5FL 1NCAH 1W72L 9PCYA 2IWKA 4DZ8B 1A8ZA 3HVDA 4PJDB 5IROA 5IOPB 3H6AA 1NKOA 5MEOA 2D7QA 4HJGB 4JX0A 2HFFB 3BP5B 1IGYB 2X3BA 2DQFA 3QI9B 5BS0D 3KPQA 4JN2B 3WN5B 5KN5A 3RFZB 5F88A 2EDKA 4XBMA 4MNGA 3P4MB 5ALBL 3EJQA 2UX6A 2QL1A 35C8L 1GS8A 5ACMA 1DSYA 1UB5A 4OZIA 1RZKC 5DRZA 1N19A 4HQQL 2YD4A 3W0WE 2XKSA 3OKLB 4MJID 1IVLA 1ES0B 5BO1L 2A77H 5TF1H 4D0DA 2JCCE 3B5HA 3D85D 1RIHL 1J11A 4OW6A 4U33A 5CZVH 5BNXD 3TS8A 3FNKA 2VH5H 3N0PB 3TJHC 4MDJA 3V4VA 2J4WL 4OCNC 2E7LA 3QNZB 3HOGA 2DQIH 2X4QB 4P2OC 4HWEH 4AK2A 3EYUL 3TBBA 1OGTB 4YLQT 2JKSA 3N04A 4IRSD 4H20L 5EA0L 5JORA 4J23A 5E0FA 4U6YB 3G08A 1OB1A 1HT6A 3HS0A 4P2RA 1PZDA 3GI9L 5EULV 1PIGA 1NICA 1EAPA 4YDVB 2AV7A 4H8WC 3AS2A 1J1XL 4Y9FA 5A2JH 5FCUL 3SDDD 4YE0A 2ARJA 1KJ3L 3SE4A 3W56A 3UEQA 2DTML 1CU4H 3EH3B 2ORBL 1A4JA 4WKZA 3SO3C 3J27A 3BISA 3D30A 1F1AA 2JQAA 5HDOA 2E56A 4P2QE 1P84J 1PCSA 4U7MA 1A9BB 4B6ZA 4BKLB 1CDBA 3P30H 1FSKC 2YEZB 1BBDL 1A4AA 4R4FL 2OW6A 4JKPH 5ACZB 4RMVA 1ET7A 1Q1JL 5EO1B 1DJIA 4XNYH 2VERN 3UYOD 2GIYA 4JFFB 4OTXH 2VLME 4JO2H 5I82A 2BFVH 2Y07L 3MBED 3GMQA 4KUZH 1EGJA 5GS3A 2OXHB 4JFEA 1G9NH 4P2QA 2NUTA 4P4KA 4ALAH 2GPZA 5HGBA 4GBXB 4GYBA 4PVNA 2P7TA 3GXPA 2F18A 5SWSD 3BKML 1QFWL 3NJFA 1WZ1L 3DMMB 3FBQA 3KAAA 3K71A 2BDNH 3A67L 4R0LC 1WZLA 1F8TH 4AIZB 5BXFA 3VD7A 3SKMB 4RGND 3ZIMA 5GSRA 4H8VA 5KG9A 3DTUB 3V79C 3MLYL 5HJ3B 2UXVA 2VE6B 3E3QC 3G6JB 4HUNB 4JM0A 5D1QC 4A2GA 3TBSA 5MI0C 3L3JA 3EFDH 5EF1A 4LCIH 1G84A 1YC8A 2MMXA 4IRSC 5LUMA 3T2NH 5DLLA 3ROLB 4ODSL 1IGYA 2NRDA 4DVRH 3UAJA 3WU1A 4WDIA 1A7BA 5AW0B 3VGAC 1T22A 4DAGH 4ZMPA 1A3RL 5FYKH 4MLSA 1ILUA 1LK2B 3QEUB 1G7PB 3T9WA 2FUTA 2V37A 3MSPA 2R0LL 4PGCB 4KQ4L 2V8LA 2Z1KA 4QRRB 1PZCA 2EDOA 1ZLUH 4F33A 1MCFA 4NKDB 1Y18B 4QF1B 3SPVB 2VN3A 4XNXH 43C9A 1P4LA 5D1XA 4ODBD 4OQTL 1IM9A 1JGUL 2B16A 4X4MA 1HEJC 3O6FC 4MAYA 4OUUB 4QRPE 5C0EA 5ADPH 3E2HB 1JGVL 2X4RB 4XN1A 3X1NA 2XOTA 4PIRF 5IEKB 4HEPG 4QT5A 4KK8D 5EFIB 1OAZL 4MQXD 3VFOA 1MJUL 1Q9WB 2H3XC 4F15B 1IEAA 2MOGA 4O00A 3QH3A 1RFDL 4WHYH 4EUPA 12E8L 4N8VB 4QRPB 1AGCA 5DJAB 3EAKA 4H5SB 3RIAK 3HBZA 5HHPA 1XWVA 1BVNT 3AJ7A 5AOJA 1N0XL 5SV3A 3RQ3A 5JMOC 2FQGA 5AKVA 4YGVB 4TSAL 5GGVY 2YGQA 3HLKA 2HT4C 5F44A 3D0LB 3CCHA 4R7XA 1FAIH 3UYRH 3FO2A 1JTTA 4QEGA 1F6AA 4LE8A 2G3NA 1JZ7A 1NAMA 3TA3C 4F93B 1MNNA 3EXLA 2V2XB 5CINL 4M1CC 1UG9A 5DLML 3BP6A 3T0VA 4BKLA 4LSUH 4MFHA 4F58H 3HKFA 4NOBA 3Q5OA 3MLZL 4X6CE 1W2KT 3FSWA 4X6BB 1ID5I 4YHZH 2A4EA 3VFVB 2AV7B 4OR1A 3T65A 4X4XA 3CPUA 1LE9A 5IOKA 3UTSB 3DRQB 1RUAL 1OB1B 4OZFB 3IJHB 1QMUA 5T1KA 2Z35A 3DTXB 3HN5A 1Z66A 1OAJA 4QHMA 2CXGA 4WCYH 4Z7QE 5B8CB 1PG7X 2OJEB 2WXMA 5D9SA 2MFNA 3QIBD 3L3DB 3PWJA 4WENB 4DK5A 2BP0A 1P53A 3QYCA 1LDPL 4ATWA 3O9WC 1T5XB 2NSXA 1KLFB 1ZCRA 5HP5A 2BHZA 2VDOL 4LFHG 4H2AA 2ZG2A 3O6FB 3WDJA 4ZDHA 4XMKH 1BAFL 3MO1A 1ES0A 1BMWA 5KYUB 2J8HA 4NQDE 5DI8A 4AYFB 1WICA 4W4OC 3UZVB 5T3ZH 3GRWA 4ODWB 2NW3B 3MV9E 2GUOA 1HZHH 4QXUH 5C3LD 3SYQA 3EYFB 4EQ2A 3EYOB 3MJ7B 3L4YA 4G7RB 2NY2C 3BDYH 5DGRA 1WUNT 2DBLH 2E76C 3UROR 4ELKB 5IB3B 1E4WH 3DUSB 2YPLA 4XBPA 2LQRA 5AVYB 2BIQA 3CFMA 1AGFB 1ZV2A 2GUYA 2V3DA 4ODVL 4JFHD 2KBGA 2XJLA 3V4PA 2WBXA 2UZYB 3OGCA 3DX6A 1WRFA 1I9RL 2FQFA 3VH8B 3L1GA 4JFQA 2YXMA 4ELKA 4FHKA 4G8EB 1CTOA 1F45A 2CKNA 5GS0D 1TEFA 4I85A 2G4GA 4S1DC 5I1LB 1I7ZB 4P99A 3FCUB 3US1A 4XP1H 4YDLC 2YQGA 5DUPH 1HILA 4XB8A 4WI0A 5JQ6L 2FLMA 3FW6A 3P9MA 3AAZA 4YX2H 3S8FB 3FUKA 5KJ4A 4N2NA 5I8CA 1QA9A 1BVLB 4MKTA 4MMZB 4JFYA 3SDDC 4TN9A 1ZA3B 5DMGD 4XC1L 3LXCA 4G6AD 4MD5A 3ZRSA 1ITBB 3CMOL 2V2TA 4KNQA 1NDGA 3BP4B 4RA3A 4NDMA 3CXHK 2BOLA 3DJRA 1GR7A 3IXTB 3R1GL 4P46B 5DGQA 1C8PA 3H3BC 4P5MA 1S2EA 1D7FA 7CGTA 5IHWA 2VM9A 4X5WB 3AVEA 4ZUUA 1ETZB 2EKJA 5GGRB 4MD4A 5D1QD 1NCWL 1HU8A 1U30A 3MJ6A 4OLXL 1O6VA 4Y19D 2YLHA 2X9XA 4GUCA 4GW1B 4P5TC 5EU5A 3HPLA 4EN3C 3BH8B 1EBAA 1FL5B 1YAIA 5IIEA 1CD8A 3UZEC 3VI3A 5A7EA 4A55A 4YHPA 4D9RD 4QTHA 5ESAA 1IARB 3NFSL 3O4OB 2BNQA 3ILQD 1N9PA 2YQBA 3ZKNC 1JI2A 4KQ0A 1Z3GL 5C0GB 2ATKA 3TEZA 3T2QA 4F92B 2IDQA 4N2DA 4P3CH 3RZCC 1HDMB 5KSBE 3QRFM 2X0WA 1ETZA 1EAQA 1ZT7B 3DXAE 5AEAA 3DDFA 3O81A 2DY2A 3H9HA 4AE1A 2AV1A 5FO9A 1KTBA 4HAFA 5HHXL 4U1LB 3C60C 2J20A 3VFOB 3BP4A 1NLDH 2DM4A 1BMZA 3KPLB 2B0SL 1HKLL 3WLBA 1IE5A 5ISZD 1BZOA 1PLAA 3H9SB 3I2CL 1JUFB 2CO2A 1QD0A 4NQEA 3ARBA 4E0RB 2OMWA 2EDTA 3RPIA 4Z7OE 5I73B 1EEQA 3V6OC 2YGPA 4TULH 3F8UB 2Y1VA 3M7FB 4CSSA 3BRGC 4QRAA 4JPIB 3LRLA 5ICUA 4NZFA 1CGSL 3FCTB 3BUYA 3L3GA 2MQCA 4GIOA 4XXCC 3IE9A 4H1LB 4JFXA 2XZAH 3DO4A 4PN6A 3IGFA 4UANA 3D9AL 1CBVL 2DWTA 1GOGA 4MXWL 1GYAA 2JKRM 4APQA 1CQKA 2QGCA 4QRSA 4BGDA 1NGYB 4G7VL 5DVKA 4GT7A 5EC2A 3OPZH 4JQIH 2FR4B 3WY3A 1EFXD 2HFTA 3WLWD 1ADWA 3SHSA 4X0NA 1OOWA 1MCDA 3OKNB 2BHUA 2YPLD 4RGNE 3MU3A 3ROLA 1MFCH 4ORZC 3JZYA 4FXKC 4H0HB 4TSBH 3AU0A 4WW2F 2D73A 4R96B 4YAQB 5CP7A 5IQOA 4QTFA 2RCSL 2UWEA 4TQHA 1XH1A 3VXQA 4APQB 5IB1A 3KPRD 2WP3T 4FQXB 2A74A 2MCPH 4YHLH 3KLLA 5TH2B 4E9SA 4C4KT 3AS0A 1ODAA 3M88A 1E8XA 5C07B 5GJTL 2VXUL 3VA6A 5IY5B 1R3KA 1A47A 5E4IA 1DJSA 1IAKB 1JGEB 4KH9A 1NMBL 3MODH 3TYFB 4EF3A 4K3JH 4AI7A 1LE5A 2AQ1A 5CNHA 4ZS6D 4OVVA 1T4KA 1TZIB 1ZS8A 2V33A 4NQEB 5EOTB 4BFGA 2F19H 3RB7A 2ZXGA 3O6FA 5FC9A 3QR0A 1IAOA 4CADB 2EE6A 1BBDH 4PGZA 3B83A 4GSDH 1YEGH 1NMCC 3SCMD 3VFNA 4G5AA 1N7ML 4G6FD 4M5TA 4ZFOA 4AYEC 3KPMA 5C0FB 3WKPA 1HHJA 1GJUA 5CEYA 3RIFK 4K23H 5FK9A 3S8WA 3ZHNA 4A2LA 4JDEA 2WXFA 2CLVB 3H4FA 1PNDA 4X4XB 3SGJA 5KVGE 2BNRD 1QSZA 5ERWA 2ZCLL 1WGVA 2MTPA 1EX0A 1X9UA 4KROB 1UC6A 1YNKH 4P23A 4TUUA 2D9CA 5L6YH 1OP4A 4YHPB 3VVWA 3GBML 4YHMH 2VLLA 3OJVC 5IBTH 5C08E 3D39D 1MWAL 2BC4B 2QV4A 2G9HB 2XWDA 3S4SG 1CYWA 4LHQB 2E7HA 1NPJA 1U8HA 2IBBA 1XR8A 1E4WL 4P05A 2A0LC 2ALWA 4OJFL 1CVRA 4LSRL 2NY0C 3OKLA 5IZ7A 5C08B 3OZLA 2JKLA 4HJSA 4IJ3B 4OCRH 4PP1C 4KRLB 5DRZB 4H40A 4FQ2H 4XVSL 4L4JA 2VC2L 2VW4A 2CRMA 3JUYA 3ULSB 5IROD 3NDYE 4MCZB 2BPBA 5I5JA 5ILTL 1K4CA 1QSEE 1KJ2A 3T0EA 2X4SA 5DWUL 2NQDA 4ISVA 3L1FA 5CS7A 4CUCA 1AD0B 2AI0L 2DQFB 2DKSA 3Q2LA 1D5IL 3SE3A 3QQ4B 3WI9A 1KB3A 4FA7B 2FT8A 1YEDB 3T6WA 4NKOA 2QZQA 4K5LA 2XIDA 5AUMB 1X7SA 1TTGA 5TD4A 2AXWA 1B4JH 4AEIH 4NM4H 1KZYA 1CCZA 4KGJA 3NFPA 5JW4R 1R3HA 5FYLE 4FFZA 3VXTB 2DMKA 1RUAH 1TJXA 2EO7A 1N59A 1CFNA 2QGDA 3DETD 4LP8A 4Q56A 5D8JL 1MXDA 2VN7A 2D0HA 2G2RB 4K7PY 3OJMB 1A7RL 3SGEH 1TUPA 4PG9B 4YHZL 5HSFA 4XO5A 1LK2A 1PKQB 2FECI 3QEUA 4UOW1 3GBNL 3QNYA 1IGML 5CR1A 1V10A 6FABH 5D7HA 2DQEL 3EH1A 4YHOH 4KO6A 3LZPA 2XJKA 2DLEA 4YZWA 5EZLA 4L1BA 3R0NA 2ETWA 4UV4L 4GS7C 4LL9A 3ULSA 1KELH 2JV6A 1E3ZA 2SEBB 1A1NA 4L48A 4DFIA 5IR1B 3O9WD 3K6NA 5GZOA 4AIZA 2NY2B 1FE8H 5BXFB 4FNSA 5KVDE 1KIRB 1XSOA 1RUQL 3RWFB 3S37H 2RH0A 4XAKD 3ZL4L 3CQFA 3NA9H 4YXHL 1ZS2A 3CSPA 3ZKSD 4EOWL 4RQQB 4JDZA 1RFDH 3N1FC 4RGMB 5JUEH 2Y22A 3DGCR 1UACL 2CDFB 5D55A 4JDTH 4Z7IA 2XQYK 1XCTB 3SQOH 1DFXA 3CJJA 2VKWA 5C8JA 2ZWSA 4UM9B 3EYSL 3LAFA 3S88H 3CZSA 4OBRA 4E2OA 4Z77B 2Q7YB 3QJXA 2XKNA 1SF5A 5TPWL 3EXJA 2YEZA 3S3BB 3EYQC 1AZRA 5D7KD 5FKPB 3T1FB 2WWKO 3SE9H 3QQDA 1L6PA 3DSFH 1FDLH 5FFLA 4U1MB 3IJ7A 2WVSA 4K8RH 1J0KA 3GSVA 5HI5D 1AVAA 2DQTL 1NC2B 3QPQD 4D3CL 1TQSA 2FYYA 4NQTA 5EUOA 4UILL 5D1ZD 5C0FA 3LZNA 4ZPVB 1NC4B 1BXVA 4I0PA 3ATAA 3BE1L 1JHLH 1QRNB 1Y1DA 3AG2B 3VFNB 4M03A 3CX2A 2NLJA 4WV1A 4XPBH 4BQ9A 4DVRL 5L2KB 2A9NL 2XYCA 5TK4A 3TWCH 2H5UA 3OJDA 3RB5A 5JHDD 5EEUA 4X7EC 1UURA 2J6EA 4W9HC 1S7VB 2X9WA 1UVQA 4U31A 2Y23A 5FHAL 3W9DB 5K9KA 3FTWA 1TKWA 1CT8A 1E9PB 1Q4NX 4HHAB 1CS6A 4PJXF 4KU1A 5EZOL 3N55A 3C8DA 1UT2A 1QYGL 3BPLC 4XVUC 4LCWB 5B3JF 5I71B 4PRHD 3BKMH 5DEFB 4DF9A 4AQ8A 1KT2A 1SOKA 1SBSL 1OM9A 5E5RB 1SJVA 3MMEA 3KS0H 4XP9L 3KNBB 5GRXG 3WNMA 1U58A 4R96A 4YAQA 2GAZB 4GAJL 1F41A 3LQMA 2WLHA 3GRBA 4NKMA 2OZ4A 4M43H 4RRPA 1BQLL 1QKZH 4R7DB 4AMKH 1WSST 3BN3B 3OKNA 3QI9A 4HIXH 4LNRB 4OCLC 3O3AA 3EH2A 5IHZA 5SWQA 3VRIA 3T8MA 4KPHH 3V5HB 1V27A 3B2VL 4N0YL 2VABA 1HL8A 1GTFA 1EWHA 1IGTB 3OXSA 4G42B 1RPUA 5C0BA 5I71C 3RJOA 4HIHA 4Y4FD 3POCA 1XT5A 1GKEA 1VA9A 3MV01 5GGSY 3QVAA 3LKNB 2XN1A 2UXGA 4HUKB 2MNWA 3S36L 5GPRA 3AGWA 2HKHH 1MUJA 1E2WA 2FJHB 4OZHF 4GXFA 4L1TA 4X6EB 2K9FB 4YDNA 2IAAC 2I9LB 4EO5A 2VOTA 3BYYA 5BPPA 1KUMA 2OMWB 1F56A 5L4JA 2XXMB 3MV9A 4LLYA 3VXPA 4AKOA 1PZ5A 1XCTA 1TSRA 4ECNA 3L95A 4OZGE 3VQLA 3WENA 4ACTA 5CZVL 1JK9B 3LNHA 2FWUA 4JPSA 3BMVA 1MJJB 1ZDQA 2OCFD 3PWLA 4WGVB 3TBVA 1QSED 3N85H 2ICEB 2VN4A 3W81A 1A0QH 2WUBL 5E7FA 1BBJB 3KL3A 2VXQA 4JHVA 4NC1E 3V52H 3HZKA 4NQDD 3RZWA 4HFUH 2XZQL 1GHFH 1XF4B 2ZJSL 5ADOL 3D69B 2VO8A 2UWEE 2FCBA 2NY1C 4BH8A 1MKFA 1UB6A 5KAQG 1ZJBA 4PLKC 4K0OA 2ZOTA 2VZUA 2EVJA 4L8BA 1OV8A 1TQBC 4LU5L 2OPCA 5AVQB 3U7YH 5T1LD 4KRPD 2R1WA 2BM3A 3TYGL 2E7LC 1I3GH 1L4IA 2D7TL 4Z76B 4OLYL 2PYFA 3DTDA 4IIQA 2YPKA 5FOBB 3GQFA 1G5GA 3L6FB 1IU1A 3WY4A 2BY0A 3DX9A 3GIVB 1KWKA 1DDTA 2NYYC 5KVDL 1QUNB 3Q8CA 4KKNA 3PHAA 4ZYKB 4MNQD 3UIYA 2IADB 3C5ZB 3D6GA 2JCWA 5I30L 2GT9B 5F9DC 5D7LD 5IFHL 2D31B 4M8RA 2IDSA 4JFYB 1MH5B 1CQYA 5EZIH 4DNLA 4ZW7A 1CFSA 2OMZA 1BCIA 3MMEB 1Z9SA 4WFGE 1IGJB 1OAUH 2ESVA 3ASOB 4NZJA 3SGDI 3WV0A 4OJDH 4X0KA 1FZKA 3VCLB 2F53A 4MKMA 2PNDA 1YEKL 3FFDA 3IRCA 4NWUH 5DJ2B 3BGFC 1AMXA 4HBQA 3EBHA 2PO6C 3HG1E 3UTTE 3B6SA 1OP9A 3NJVA 3NCCB 5C08A 4MB1A 2WQ8A 4HUUB 4JJOA 1AI1L 3D09A 2VITB 3D5OF 1AQHA 1EZVX 1KGYE 2YD0A 4FL4C 5F0JB 3PHOB 1S7RB 4LEBA 2WWKT 3P9LA 2N4IA 1SN2A 2PN5A 3QRGH 4HWNA 3IFLH 1LGVA 4PJHA 3S5LG 5BVJA 1QR4A 3JWNE 4PB9L 3PIQA 5FOBA 5AZEL 1TTUA 4JM4H 2UZYA 1G0DA 1CL7L 1JHKH 1N70A 3LQAC 5D7JC 3HG1B 3UTTB 1IRAY 1OQXA 1WIPA 2WXKA 1JHKL 4HJGA 4XMVA 2AS5M 1WWBX 4F7EB 1UM4L 1G6RL 4QY8B 1M7IA 3CX5J 5JHDE 1P7HL 3QRLA 3MJGX 1AD9B 1P2CB 4PGEB 3VXRB 2EDWA 2WAQA 5DMGC 3OHXC 5KS9A 5KJRL 1F13A 4PJBA 4XCNA 2IDCA 4K15A 1HXMA 4NC0B 1E6JH 2A6DB 5CSBA 2PPAA 4LT7A 4RX4A 2ZNXA 3E2HC 5DQJB 3FF7A 3L4CA 1HOCA 4N87A 5C8JB 1HE8A 2XG5B 5F7MC 2QJDA 4YXLL 1FA4A 4LKXA 3FUFA 1EV2E 4PS3A 4GPVA 4I1RA 4NLHA 2XTJE 4M7JL 2OI9C 4K7FB 1ZWIA 2WW8A 1A02N 5CBEB 5IMKA 1UWGL 4N0CD 4NIYE 1YAZA 4O5LH 2CIKA 4JL1A 1JF1B 4QRTB 5E6YA 2JK5A 3PWPD 3IETB 3P0VL 3TF4A 1UA3A 3N91A 1G7HA 1VB9A 3ARQA 1CDJA 3UIZA 2EXYC 2Z91A 4N8PA 4P49A 3ARXA 4WNSA 5AWNL 4NKIL 4DKFL 1HHIA 4RX4D 1H6TA 5D7JD 2WXGA 4B9YA 1MY7A 4A63A 3CVCA 3QDHA 3BJLA 2VABB 4B27A 3WTXA 3E9UA 1O5DT 4U1IA 2GHZA 4FFYA 5IHZB 4LOFA 1PKQA 1QFHA 4OKDA 5I23A 1FVDB 3BVNB 3TO2B 3R06A 3TVMD 4NHUB 2YWYA 3V95A 2EDHA 3GRWH 3UPAA 4TYUA 1I1AC 4KVNH 1F58H 1BQHA 3QCUH 3JYCA 5FS5A 4PJ5A 3GRGA 4FQQA 3WS3A 3QQNA 3ALPA 2LT9A 5BV7L 2XTJC 2PP7A 1MHEB 4YQXH 1AO7D 1OTSC 4YHYB 2WO2B 3B5TA 2BVOA 3G6AA 5EHFA 2G3MA 3GSNH 1P5VA 2NZ9C 3OVUB 3VG0L 5DCCA 1F2QA 5EEYA 1N5YH 1MHPH 2BH0A 2CMRH 5EBMA 2GSGA 2R56H 3RVVD 3UPCA 4BK5C 4UT6A 5I1EL 1BEYL 2FD6L 3HE7D 3BESR 4OUUA 2NLJB 3NG5A 4WV1B 3MROA 5DA4A 1OIOA 1DSFL 1SBBA 1TNMA 2MCAA 3RHWF 2HKHL 3WEMA 2ZAHA 2BVOB 3G6AB 2LW3A 4TL4A 4AVKA 4F2MB 2AFNA 4GOSA 1DJWA 4OT1L 3AQZA 4Y16D 1IGIL 4TQIA 1TQCB 2AEQL 5DHYB 4PJIE 3P4OB 4EMZA 1NMAL 3B2UC 1CMOA 1QZNA 3MCLL 3FQ4A 3CFBB 1WH0A 4NHCL 2ZONA 4L4TE 4GQ9H 2UVFA 4NHUA 4KVNL 2Z1PA 1JV2A 2EDYA 1BM3H 5ALCL 1KFAH 1XHHA 2NXZC 2YS4A 5DZPA 4X42A 5LN4A 4QMEA 4Y2NA 3NCFB 4IMKA 1MCHA 3WTTA 2OFQA 3HKZA 3U1PA 2BNUB 2CDFA 1EO7A 1XF4A 2KLSA 4JKMA 3EGSA 3GLAA 4RMSA 4WTZG 3NN8A 4BA8A 4GMTL 2V4LA 5EZOH 1RXLA 2NNRA 4P5MB 5EUOF 1G7HB 3NRQA 4ZX6A 4PJFA 1GGUA 3STLA 2C7UA 2CGRL 3MOAL 3JVGA 5EG6C 2E74C 1Q0YL 4Z7QB 4KC3B 2XPZA 1YZZA 3W0WB 5CEZL 4JFEB 2EYSA 1J8RA 1DSFH 1D6EA 5DJ6A 4PJGB 2F8OA 2E7BA 2EQDA 2IGFH 3VXPB 1FGVH 2IDFA 2X6BA 5HPMA 4QJ5B 4IW4C 5BJTA 3L7EB 3TYFA 4M7JH 5IREA 1V5JA 2JJUA 4PVLA 1QI5A 4LKXB 1D5XB 3T0DA 3QQ9D 4NX0A 1R3KB 4L8SC 3GPSA 3GSNL 3GMOA 5FUCC 3DBXA 1JPFA 1HILB 1OWWA 1J10A 2OQJA 3CLWA 4FCHA 4Z7AA 1RLBA 3LPFA 2G2RA 1FDLL 2C34A 4E42A 4JPWL 3QEHA 2XN2A 2SODB 3UABA 4Z78B 3BOVA 1QTYT 3N1GC 1VERA 4XN8A 3H55A 3ILEA 5D6CA 3UPRB 3H7LA 4ODXA 5IVOA 5DVLA 2XICA 2QT6A 3EYSH 4Q9BA 1BQLH 1RERA 2I60L 4ZMQA 4NRYA 2CM5A 3GK8L 4WWPA 1DVFC 3RVXD 5IBLD 2HT3D 4A66A 1XF3B 1EPFA 3QP3A 4ZSOE 4GS7B 2PPCA 1M56B 3HPJB 4RWHA 3MR9A 3SYCA 1SBSH 5ES4B 3D0VA 1N8ZA 3HJ0A 4Y16A 2VW7A 4A2DA 1GGCH 1I3RB 1OSEA 3UJIL 2A6KB 3WCYA 1O7SA 3TESA 3DVNB 2DIAA 2BS9A 4BH7A 4GRLB 3KLHC 1URLA 2FTAA 4H1LA 1BOYA 2C5DC 3MV7A 3I3DA 2NY5C 3AT9A 1VKXA 2NY4C 4MQSB 1WT5A 4H0LC 1SY6H 5JO5B 4JZNB 1KYOJ 3ARDA 4HJUA 4LCCA 5GISH 1R24B 1OALA 3TWCL 4F8LA 5JTWA 1EVTC 3MNMA 4AMXA 3VU1A 1NL0L 1UWGH 3QYMA 3BDBA 3SN6N 2NT0A 4R97B 2EUVA 3BVVA 3LEXB 1OAUL 4MNQE 1JHLL 4EI5D 4TV3A 4YSTA 4LASL 5CWSB 2VMJA 4Z3EA 5IOPA 2UZXB 4X2UA 4D3CH 3P3YA 2N1KA 3LHAA 5AW3B 2CBTA 4QYAA 4LSVL 4JM2C 2VLJD 1WJ3A 2R4SL 3SE9L 5FHBL 2DM3A 3MV8E 1AYRA 4ES8A 3DX9B 5KVDH 2RALA 1KYUA 4MYPA 1M6OA 2LV4A 2M83A 1ZXKA 2Z3FA 3S97C 4F3FB 3GTTA 4TQEL 1OTTC 2R0WH 1MLCA 3NSJA 1LHZA 3BZEA 3C5JA 1G6RH 4L18A 2F53D 1TDQA 2MQ0A 4OLYH 4WTWA 5E2TL 5AVTB 4DEWA 4CGTA 5K1NA 1HI6B 2EXYD 1SFHA 1A21A 3QUZD 1I53A 3CFCL 3EO1B 3MA9L 4G43A 2VQ4A 1L3WA 4MASA 5BJTB 3HS9A 4DP6X 4JDZB 3FO2B 3DRTB 3D52A 1A7QH 1UB6B 2BVYA 4KKAD 3ZKMC 1J88A 4F91B 1GOHA 1WBXA 2JMRA 4NPYB 4FQ2L 5HXMA 3Q0HA 3T0XA 1U9KA 4PP2B 1E5UI 2X05A 5I6LA 3CN1A 4RCAA 5HHOB 7TAAA 2JI1A 3TA4D 25C8L 4HFUL 5HJBA 4HKJA 2AVFA 5LQBL 3NJXA 3SDXF 1RP8A 3HR6A 3CZFA 3SIKA 4BZ2H 1BGXL 5JDSA 1RZFH 3O6KL 4GBXD 5D70L 1QA9B 4N4YB 2FH6A 1F4HA 1YA5A 3WHE0 1E3FA 2APWA 1OLLA 3LZOA 3CLEH 5CUSL 1ROWA 4QLWA 3A6CL 4MCYA 4YSPA 1BHGA 1T03H 4IBVA 3FAXA 4HV8A 5IFHH 3B34A 3KPSD 2GK0A 4YO0B 5HHNA 1W72A 2WXLA 5D1XB 5AW5B 3UG5A 4HIQA 4DGIL 2DYRB 1AGBA 4CL7A 3PU7A 4I9XA 5HVWA 1MY5A 4K23L 4Q0XH 3F00A 3ULUL 3L45A 4MNHB 2ZX5A 3TBWB 4WEUD 1A1MA 2FBJH 3SDAB 4HKBA 3DX6B 3R4RA 2CKBA 4ONOA 4ZFZA 4FX5A 2BVPB 4LCWE 2OAAA 2AJSH 1LO3H 3T6VA 3VXMA 2ED8A 2WB7A 4JJ5A 5CN1A 4B5ZA 1JS4A 1BP3B 1TJIH 4OH2A 4FHJA 4Y2DC 4IGBD 2DQ6A 3HE7A 2QPUA 1HYSD 1AS6A 4GQZA 1UOWA 3RYMA 2YC1B 4P57A 3BWUF 3IDGA 4FFWC 4Y1AD 3ELQA 4U1LA 4LSTL 1NSNH 4OJFH 4N5ED 1OAXH 2F53B 3V4VL 1OSPL 1T7XA 4BH7B 4IIQC 1KJVB 1TJGL 4WFHD 5HGBB 2K3HA 1ETB1 1IIIA 2P5WD 1IGJA 3Q8BA 3CFKB 1KLFA 4TVPD 3HPJA 2IGLA 4MAUH 4YFDB 3ROOA 4Y1SA 1OO2A 1NAKH 1FPTL 4G3YH 5L6YL 4YLBA 1TSHA 5L4FA 4UQ2B 1ZLVH 2ID5A 4HH9A 2HSIA 4JHWH 1TVBA 3MCYA 3NCWA 1T5KA 4JRYA 3IJHA 4I0PB 1WO2A 1JI1A 2F5AH 4UIKH 5IQ9A 5EU5B 3GIVA 1LNUA 1KGCD 1X4YA 4XMLL 3QEHB 3OL2A 1ITCA 2DB8A 4LRIA 1CBVH 1A6VH 1NM9A 1OTUC 5BW7A 1UOVA 4KKCD 5KW9H 4Z7UA 1RAMA 1GRWA 1KPVA 1CE6A 2XV6B 1U8MA 3Q2VA 3W11D 3HG5A 3BUTA 2LLLA 4OF5A 1PJWA 4U1HA 1AXTL 3CVBA 4FXTA 4E9VA 4AYBA 1OQOA 5I75B 3IETA 3X12B 3JV4B 5BV7C 4JG5A 4JRYB 1NBCA 3GJEB 3UGXA 5T1DH 5I1DA 3CDGA 4OU3A 3LKOB 4MS6A 4ZMWA 5CCGE 1JYXA 2W92A 2F19L 3VQMA 5IMKB 1F6AB 1Z9NA 1QKZL 5CZXC 3SYAA 4PRPA 4X5XA 1T0MA 2W95A 3CCHB 4GAJH 1FSKB 3UZEA 3MNWA 5F0LB 1CICB 3WN5C 4EN2A 2LVCA 4Z3JA 4NO5B 3O3DA 5D2NA 4BFNA 3LZRA 1GGTA 3RX8A 4GRMA 4XCEB 1MCJA 4KMTL 1MJJA 1Q9WA 3PWLB 4PLOB 4OM1L 1IB5A 1LO2H 3MRCA 1UB5B 2CAKA 2UV3A 3C09C 4LLQB 4U1GC 3V0AC 1Y7VA 1EDYA 2YLKA 5DYOB 3IE4A 2YBGA 4J5VA 1H3TA 1PG7H 5BW7C 2DMBA 1ZHLA 2WOYA 3B9AA 1IBBA 2B3RA 4K9JA 3RFZA 5F7KC 5I6XC 3X3FL 4FGMA 1M7IB 5HJGA 5FB8A 2QSTA 1BIIB 2PKDA 3ZU8A 2DQJH 4ZNEA 4KJPD 2HKFH 4G9FE 5L8KB 3WO3B 1WT5C 3NIDB 3KW8A 4OQTA 1VGKA 3ZKND 1KJMA 4G83A 3QDJE 3KYNB 5IK3A 4ZX5A 1CPUA 1BFTA 3L4XA 3MLTB 3OLDA 3PPEA 5EUKA 2ZUWA 4PJEE 3H56A 4JFXB 1PYWA 3D18B 3D2UD 4ZO6A 1TZAA 2KT6A 5DRXB 4HUUA 5E8DH 1USQA 3EOTL 2BSCA 5E4EC 5HGDB 1MVUA 1C08B 2BSTB 3I75B 5TE6L 3DVGA 5DI8B 5ID1A 4HV8B 5LO7A 4IKLA 1T1WB 1TO5A 1T20B 2NZIA 4J3OC 4AGPA 2AJZA 5I1CL 5IMOA 2ESVB 4ADJA 2LAAA 1RUML 4M1DH 4NI6A 2ITFA 3CMGA 3QE5A 1E5AA 4DTGH 3LV3A 2C9AA 5JDJA 4BFKA 5AOZA 3FB5A 1W0YT 2ZP0T 1YMME 3TIEB 4GKZB 1UACH 1MSPA 5DWUH 3B2DC 5DUPL 1WK0A 1QVOB 1HHHB 3MRRA 4NP4L 4PBXA 3ZTDC 1E42A 2IADA 3B1UA 3C5ZA 4ZMYA 3FUEA 2X3CA 5T1MB 1OHZA 3KCPA 4XVSH 1CGYA 3FSOA 3M86A 3QUMH 4KMLB 3ULUE 4P2QB 1DE4A 1FE8L 1JPEA 1NPUA 3DV4A 4N2HA 5K39B 1NFDE 3PY9A 2EECA 1OF2B 3AXHA 5I16A 3FQWB 5JW5A 1L7IH 4LCYB 4NZTL 4W9JC 3TO2A 2Y5TA 4O02L 1SJEB 4J8RA 3PAYA 3TN0A 4KQ3L 1FGNH 1OOAA 2V9UA 4XX5A 4JR9H 1JVOA 4WQOA 3ERXA 1FLTX 4LVHC 4APQD 5KVEE 5HYQB 2DBLL 1UD6A 2DJUA 3BRDA 3T3ME 2FK9A 3M07A 3Q48A 1XD0A 4NWTH 4OLWH 4QWWC 3V5DB 1G7IB 3R1GH 4FP8H 4NNPL 4X99B 3VWJB 2D3VA 2D8KA 1IV8A 3IXTA 4HWZB 1KXVC 3IFNH 5FK9B 3S3CB 4ESKA 2CRIA 3RY6A 4NM4L 1OWRM 4L9DA 5BQ7B 1MELA 2W9DH 2BHYA 3ARGB 5CP3A 2Q5BA 3D06A 4FXKA 1EERB 4U4BA 3MV8D 1BQRA 4GXVH 3RL2B 3V4VB 4PW4A 4H26A 4N2IA 5G5DA 4Z3FA 3FB5B 4QTIL 1PZAA 1D5IH 1AHKA 4YX2L 1C5CL 3MVSA 3MRIB 3V2AR 3ZO0A 3K3QA 4MZIA 5I0XA 4KITB 2JJVA 5J57B 2NNCA 3V0WL 4K3JL 4FQCH 3MTRA 4OZIB 3LHPH 1Y18A 2X2JA 3FSZA 4X6FA 5KYNA 1T0OA 1QX1A 2CIIB 3NGBB 5E9DD 1JPTH 5GJTH 3OKDA 1Z9OA 3TOPA 4OUOA 3KYNA 5IK3B 2HVBA 3RIFF 3VH8A 1HWWA 2BY3A 3Q2NA 5GGRY 2ZKXA 2DM2A 1QBMH 2GITA 2OP4L 1ASPA 3GLZA 3SZ6A 2HFFA 1KV3A 4P4RA 3VWKA 3SEPA 4JY4B 2DMCA 5I5MA 3MGOA 1IQWL 1KTRL 1PZ3A 3O2DL 3JTBA 4X6DF 1YEJH 2AEPL 2UYLA 1OGAA 4RDQG 4I5BB 3OMIB 1C5DA 2WXJA 2PO6D 4X9YA 4LKCB 2GAZA 3GXIA 4MVBC 4ZBJA 3TBSB 3UPRA 4X4ZA 3G6JA 3K80A 4JQIL 5GSRB 1YVLA 4G7VH 3FQNB 1JWSA 3CN3A 3LMJH 3UZVA 4NKOB 3BAWA 4KK5D 5E9DA 4S11A 4NBZB 1P5UC 2P7TB 2ODIA 2QKIA 3FU3A 2IAMA 3LKRA 5ECJE 3U82B 4K5PA 1ODUA 4J6RL 1WQVT 4NUQA 4BCXA 1ZXQA 2D7NA 1WBYB 1YEGL 2ZE0A 2GEEA 3P4LA 3P54A 4N86A 3NIGF 5KTEH 4PJEA 3OB0H 1M9WA 1X5XA 3SPJA 4GJTB 4GO9A 2GT9A 1ZLSH 3QK0A 1GZQB 1HWHB 2DYSB 4KOCA 4F57L 3NP4A 2AW2A 4Y2DA 4XE0A 4R84A 2DEXX 2IQAA 4M7ZB 1NMBH 2B39A 1OPOA 3EF4A 2HUHA 2QLYA 4U1HB 5DFVC 1XIWB 1G7IA 4HHGA 5HYJB 3SGDH 1FIGH 1MRFL 2DI8A 4HS3A 3OMNB 5CZXD 4OD3H 2YSTA 3B9KB 4YPGB 1DDHB 4HEME 1EAPB 4YDVA 1YLBB 1A3RH 2QHLA 2YPKB 3CLFL 5D93C 1KIUA 5FYKL 5IBUB 1F00I 3DMMC 4D9LH 4S1RH 2C1OB 4FEMA 2ZOKA 3TH4T 1ZGLP 2J21A 1AKJA 4N0UA 4JFFD 2WCPA 5GGUB 3SDXE 4DWHA 1TVBB 2E47A 1MFCL 3N1PC 3EFDL 3UYRL 5J89A 1GW0A 1IBYA 2YK1H 3R8QA 4WI8A 2VZ1A 5BZWB 3UAAA 3FTXA 1ZKAA 4KX9A 1VLXA 2WLKA 2ZICA 4XCYB 4D9LL 2DDQH 4CMMB 3RAJH 1MG2C 1U93A 4NBXB 1RUKL 4A6YH 5I8EA 12E8H 2RQEA 1ED3B 4LRIC 1XVSA 4PV8A 5I24A 1ORQB 1X6NA 5CAYB 2ZXWB 1OAZH 4B9PA 3MRKB 5E08H 5BS0E 4XCCH 4K3DL 4Y9BA 4JS7A 4PJEF 3UP6A 4L2YA 3O4OC 4TULL 6PCYA 2F08A 1ZLSL 3CMOH 5HI5C 1A7NL 2GSGB 3PQYB 3UMNA 2UZIL 4LLYB 1ASOA 3R19A 3VDCA 4Z7UE 3C09B 4BFOA 1R75A 1KCBA 2B59B 3I2CH 4LQFL 4W4NA 5F0MB 2BSTA 5AL0A 4P5TB 4N6QA 1E90A 3QIWA 3RDTD 3NCYP 4CC4C 2CPCA 1KYDA 1WFTA 4X4ME 5AYTA 3EYQD 2LU3A 2B4CL 2X38A 2QR0A 1A6VL 2WQSA 2R0LH 2JELL 4XP1L 2VZVA 4UIKL 1JYNA 2YSSB 4H13C 4B0MB 3DIVA 2ZPKL 1Z3GH 3KBEA 3HI5H 1WPCA 1JZ4A 2VXTH 2DIBA 2R1YB 4ODHL 5FO8B 4OSUL 3JWDH 5IVXF 4ETQB 3RGVA 4Y5XA 5JIQA 1FVDA 2FWSA 4LLVA 1IQWH 2E9IA 4NKMB 2VLRA 4NJAH 4Y4HC 1JDCA 2NDGA 1JWUB 4OGXL 9CGTA 3EGDA 4FI8A 4EXPX 3KNBA 1R17A 2ADFL 4PGDB 3DUSA 1OSPH 2NXZB 3T0EB 1DANU 3KWXA 1UD8A 2OR8A 4HCGA 5DHVH 2EIMB 4YSCA 4LSTH 1S78D 4BGLA 2Y5EA 1QNZH 4FG2A 4NO5A 1TITA 2Z8VC 4IMLB 2IFFL 3QFJD 4N8VG 4P4KB 5J12C 1QAWA 1FL3A 3OZKA 4QHNB 3WDIA 2I26N 4XXCA 1II4E 4DP9X 1QACA 3G6JE 4BINA 4WHDA 4AYMC 3M1OA 4L9LC 5DK0A 1YQVL 2FBOJ 2X1XR 3WFDH 2H41A 2KZ1B 3LSOB 4QTIH 1C12B 4X98A 1LDPH 3DA0A 2Q2LA 1U8MB 4M8UA 1EJ8A 4FRWA 1GZPB 2XV3A 3ZTCC 3BAKA 3N41B 2FJFA 4WCYL 1YMHB 3GI9H 2Q20A 4DZBA 3DRQA 1HL9A 5LXGL 3S35H 3GJFA 4OD2B 4XX1E 4E9YA 4Z23A 5I0VA 3B9DA 3CN4A 1CF8H 4B96A 1YUHA 5JIHA 2PWEA 4ZQTA 2A6IA 1JZDC 2BNQB 2Y72A 1PSKH 1R5IB 1TMCB 2MOQA 2QADB 5E6IA 2R15A 3NEOA 3O4LE 4IRJC 5IWLA 1WLHA 3BVTA 3TC9A 4ZMLA 5A3IC 2BHFA 3AW5A 2HN7B 3EDEA 3TN0B 4FQIH 1NGXB 1FC2D 2IF7A 1OW0A 3Q7JA 4YFLF 1NFDA 5GRJH 3S6CA 2YFOA 2XBZA 4KUCF 4O02H 5CINH 3SKJL 1NWOA 1NEUA 2NMSA 5IQ7H 5DXWA 3QPKA 1GGIL 4ZUUB 1L7IL 5J11C 2WIIB 1DE4B 3DV4B 1KJ2L 1W15A 1ZANL 4RIRA 2BVQA 4HAKA 4PLNC 1YYML 3FHAA 5D2LA 1TEYA 1N0XH 3NQIA 5DMYA 2R69L 2ZTBA 4LESA 1G7LA 5ALBH 1QRND 3VWJC 4EUPB 2QPEB 2Z7ZA 3JVGC 1HFUA 3QH3B 4BQBA 1XF5A 1K8IB 2X6MA 1E43A 3G5ZB 1DBAL 3PNWB 3WFHB 2P5EE 1P7QA 2UX7A 2NYYD 2YAEA 5KANI 2E0PA 4LVHB 3GUTB 1H0DB 2FNWA 2D31A 1XF3A 3JWNC 1RUMH 4M1DL 1EZSA 5I1CH 3MRDB 3I75A 5ID1B 4MXVF 3U6XA 3H1ZA 1IM9B 4OCYL 3T0AA 4ZTPH 1EZUA 3TEWA 4OQTH 1G94A 1MJ8L 1KCUH 1JZHA 3HIZA 4AWJC 4CVZA 2EH8L 5JPNB 4LL1A 3AG1B 4JRYE 5TDNB 3BWSA 3OBAA 1XEDA 2KQMA 1GZHA 1XGUB 2VJ0A 1NFDF 1KTJA 2ENSA 3PL6C 2Y25A 5KVFE 2WYTA 4F7KA 2EDQA 1E0OB 2K4AA 4ZO7A 5AKTA 5FOJA 2CJTA 4M02A 3ZKXC 2XA3A 1UT9A 3OZ9H 4YBQC 3WJMB 3MN8A 4JM2B 4UUJB 3L3OB 2J2ZA 3QXAB 1F4WH 4OY9A 3P11L 5T3XE 2DWDA 3RWDB 4GUPA 1IC0A 3CVDA 2OL3L 5F7AA 1J05B 4DJMA 4R8WL 1WE5A 5DSCA 2GQHA 4JFPB 3QULB 4AYID 3O3DB 2C7FA 1WZ1H 4XTRC 1NGQH 5D2NB 5KYUA 2HPTA 3IDIB 3GXNA 4XP6H 2WBJA 1S7UA 3VXSD 2QVMA 1MJUH 3GXTA 4Q52A 4XI5C 3KBHE 2JKIS 5A2FA 2XG4A 3B8SA 4OFYA 3QHFL 2X89A 3BZEB 4X80L 2ADYA 4PJ5D 2F15A 3U7AA 1OE1A 4AYGA 1M4KA 5AVVB 5GGUA 4IU2B 4KKBD 4KV5E 4P3WA 4ZD3H 4S1SH 3DTXA 2QVIA 2R0ZL 5ACZA 4NLAA 5F9AC 5ERWB 2X1OA 4FQLL 4AGOA 2K7QA 3B1TA 1X7QB 4Z7UF 2XY2A 3T65B 3OWEA 4DZBB 2BRRL 3FQXA 3UJJH 1VEPA 1FFPA 2JIXB 3ARFB 5DR5L 2VN5A 5DHYA 1FNEB 1GZPA 1JNHB 2PWGA 2EIDA 1FNAA 1LNUB 3PE9A 1J1XH 3CDFA 1A6UH 1J18A 3OB8A 4KQ4H 4S1QH 1KBGH 4TF4A 3QWRA 1Y6NR 1EGJL 1KBBA 4BDVB 4FYQA 4JUTA 5E2VL 1AKPA 1NIEA 4TPRH 5FO2A 2NY6B 4G7YH 2N0MA 4BKTC 1NAMB 2GC4C 5SX5H 4HJ1A 1RSYA 1ZGLM 1S9XA 1WCBA 4KMQA 4AJ0A 1JGDB 2C9QA 3DXAA 4YDIH 2J4WH 1FPTH 3MLUL 1YY9C 1TF4A 5H35B 2OYLA 3VGGA 2HH0L 3KWUA 2P5PA 1C5BL 3UAJD 4WZ9A 4PTTA 1P5VB 1W91A 4GT0A 4JVUA 3PG2A 3P9MB 1UYWL 2ZSWB 2APTA 5FLUA 3FO1A 1S5IL 2ZUYA 3KYMA 3NZ8B 4UAOB 3RNKA 2CRZA 4Y4HD 4C54A 4Y5YB 2I85A 5EORH 5DMIH 4LGPB 5HYJD 4FQQB 2DEYX 4KK5C 1XF1A 2WJ5A 3AQDA 5F7DB 3ET9F 5TDOA 3B9KD 4MDIB 5C6TH 4A7UA 1C5DB 1KENH 2HRHA 3HFML 4ETQA 1JXJA 1SHMA 1QFUL 2EDMA 4FLSA 1JZEA 5JR1L 2P43B 5DYFA 3G5XA 4DPAX 2CLZA 2CO6B 5E23A 1GAFL 1HCZA 1YRKA 3Q2CA 4QF1A 3SPVA 3ZHKA 4G6AC 2Z31A 1FNEA 4TTGA 1QBAA 2ORBH 3H9ZA 2IBZX 3GZOA 4HF5L 3QZMA 4NZUH 5B1CA 3S2CA 1E3XA 4IEFB 2WTRB 5CFAA 4X6FB 1FZMA 3U79A 3WUZA 3ULUH 3ARBC 1J5OL 3VW3H 2F68X 3EYFA 4FQJH 4JY6B 2BY1A 1A5FH 1JYWA 4A7QA 5FFGA 3OM3B 1NEZB 4H20H 4J3OG 2CIKB 4HPYL 1NFIA 4MJ6B 1GYWA 1U3HC 3F83A 4G5ZL 5FDYA 4I77H 2B77A 1M57B 1T03L 3VG0H 3RGVC 1A7PH 4WGWB 4HETA 4I0PC 1SMOA 4IRSA 1IILE 3PL6B 4HAGA 4QHUA 3LRGA 3HE7C 3VI4F 2I24N 3VGDA 5FO9B 3K71B 2GSIA 4I7ZC 5IQLA 1BPLB 1P4UA 2HTLC 1FBIH 1NCGA 4HA1A 1H3GA 2FT6A 1D5ZA 5E8EA 2O5XH 4JZJB 2DTSA 1R5VB 2WJ7A 1DVXA 4O9HH 1GZHC 4PR5A 3QCUL 4AQ1B 1WIUA 2YPVH 1WBXB 3QZBA 4N3UA 1QI4A 5FAAA 1HN1A 1NFAA 1T7VA 1THAA 4WGKA 4QD2E 4Q14A 2HZHA 3PWPB 2F7QA 4CN1A 4G43B 1D7BA 2GW5A 1KN2L 4OFKA 1T89C 4URKA 2C1PB 3DJZA 2OV0A 3CFCH 3MRGB 1CIUA 5KBLA 2C1OA 1FL5A 2YXFA 1RJZB 4JRWA 4LL4A 5JW4Q 3ZRFC 2R0WL 4WKZB 3FU9A 4G8GA 3KH4A 4LHUA 5G4MA 4RMRA 2OMVA 4PJDF 3RU8L 3RIKA 2D7PA 4DN4H 4YDLB 2IPKA 3APNA 5LGHL 4M5ZL 5DT1H 2NQCA 4NYLA 2GYSA 4CA4A 3NFPB 4M29A 4Y5VC 4ZAKC 5FHBH 4YBHA 3OKOA 1LVEA 3N1MC 2FZ3A 4G8IB 1G4RA 5GS0L 4U6TA 1NIFA 4XNMB 3T0BA 5H37A 5SWZE 4YDJB 4AIOA 4YHKL 3CHQA 1A66A 3GMRB 1EQWA 4JQXA 2VDKL 4KKLD 1B90A 2K45A 2DQMA 2IAND 4NQCD 5FA4A 2JKJA 5AZ2H 2LGNA 3EYVB 3QGVA 4Y88A 5IEKA 3ULUF 3H4HA 5IMOB 3RPKA 3AAZB 1F4XL 4R4ND 1KZQA 4DO5A 2FB4L 2AQ3A 4JFUA 2FZ3B 4YSOA 2ZD0A 2C3GA 1DQJA 4Y7MA 1O7DC 5AW8B 1QBLH 3ECWA 3REWB 2IAMD 4FQHA 3MQIA 4GRWB 3RLSA 1CN4A 1PYWB 3U2JA 4KXBA 4PJCB 4G8EA 2VMCA 4Z95H 3B56A 1BQHB 1QTPA 3W0WD 1MAJA 1E8YA 2A6KA 4TS6A 3KPSE 1R6VA 3UJIH 1KN4L 1G7PA 1NGXA 2BIHA 2BC4A 1IBHA 4GMSL 4HIEA 3WBDA 1YY8A 5I0WA 4HOWA 1CL7H 1OCWH 3CD4A 5FB8B 3RNQA 4KUCD 3VSTA 1B0GB 4S2SB 4FQXD 2XN9D 3GF8A 4B0MM 2NCMA 4ANUA 1OW0C 2NYKA 4PIBA 3G6JF 4ZUWB 1TCRA 5KYXA 3OKDB 4RBPK 5D71L 4Z78A 3V0VA 1EDQA 2R29A 4MA7L 1PMYA 3MUHL 4JJHA 1IBGH 2AJVL 4PPTA 5EWIL 2WINA 4U0RB 5B3SB 2V7NB 4JQVA 1LO4H 3UTQA 3WD5H 4HMDA 4DIXA 1U4FA 5KSUB 2EYRB 4K7FA 1WAAE 3EBGA 4FULA 4JE4B 3X2QB 2XUWA 3D8MA 5IMLB 3EUUA 1H8SA 2VERA 1T5XA 2EXSA 4FL4B 5C0JB 3FFCA 5IHHA 1OARH 3GHBL 1UJTA 1U95B 5KWYC 3MBEA 2BCKB 4V1DD 1M05A 3K6DA 2AQNA 4C83A 2A6DA 2BNRB 1A9BA 4FZ8L 3RILA 2NDFA 3FUDA 3UACA 4DPCX 1A14L 1JMZA 2AAAA 3EJRA 4FYSA 2I5YL 1UADC 4BQ6A 4XBGB 4DQOH 4Q2ZA 3T6ZA 1JZ5A 4ZUTA 4YXKL 5IB4A 3SDDA 5DQ9A 2GJ6D 3JTTA 1U8NA 5F7UA 3O45A 4OFVA 5C6WH 4MZ2A 4QYOA 4ZMOA 4MX7B 4OZHA 1JV2B 4XVUD 4AXWA 3Q8FA 3RU8H 3U1SL 4FA8A 4W6XB 5ALCH 1BM3L 1J8HB 5IV2A 1J87A 4PJIA 4MDJB 4PYHA 4LO9A 4UNUA 5DZVA 3VD9A 3WEXA 1BZ9A 5ADOH 1KIQA 5E1AA 3LNDA 5LWYH 2X70A 1OF2A 3BPCB 2XZQH 3DX8A 4QRSB 5EIIG 4KNUA 3KM1A 1I85A 4FNLL 3V52L 3INUL 1MFDH 3L3IB 4XN7A 1NMAH 2QR0B 1A0QL 2WUBH 4R5TA 1AFVL 1GCYA 4ZG1A 5FPIA 1BOGB 3BAJA 3BGAA 4HMEA 4JHAH 1U8CA 5EEXA 5CGTA 2CCLA 3QIWB 3V8CA 3E8VA 4GKZA 4O9HL 3MROB 4DO6A 2DMHA 5F7BA 1V8HA 1RQ5A 1EDHA 4PS8A 2AC0A 1VFAB 3DARA 2P24A 1ONQB 2VGLM 4H8WL 3K8MA 2A83B 4PJAE 3PJSA 4WEEA 3P4MA 2C3HA 2AKRA 3FU6A 5GZND 2PMZA 3MRLB 4TNGA 1S9XB 5AALA 1I7UB 2CMRL 5L2KA 4TOYH 1AXIB 2OR7A 1NINA 1SJHB 1AGEA 4IYKA 3QJSB 4WUKH 4KX8A 5C07E 4YSUA 5FECB 3NP3A 1KGXA 1U8CB 3VG9B 3GSNB 1HH6A 2DLIA 3FF8A 2OTWB 4WU5B 4AUUA 2F74A 3EOBB 1JNHA 2YR3A 3OF6A 4FS0A 3MRJA 1D2OA 1R3LB 4HS6A 4UIMA 2CM6A 1I3UA 3MLTA 4CJ0A 3PWVA 1I1FB 3ZE0B 1AR1D 4NQEE 3LH9A 3APMA 2KDYA 2VN6A 1XIWC 1BZ9B 2RTTA 5DWPA 1BJ1H 4MYWB 3T04D 1Q38A 4HF5H 4HC1H 3A5VA 3KHQA 2YIHA 4QTHB 4WV1C 4L8BB 4WO0A 1SZNA 4MCYB 3BUPA 5T1JA 2HLAB 3HEIB 3LKQA 2YAOA 5AB0A 5KSBB 3VXSE 1JZ2A 3FUIA 1T3FB 2WBJB 3D3VD 4XO8A 4P07A 3EJSA 2KHAA 5LNGA 2D3NA 3D48R 3V4PH 4UQEA 4ZS7H 3TNMA 5LCVA 1JXGA 4BK8A 1OGPA 1FHNA 1A6AA 3SDAD 3I6KB 5B21A 5D72L 2XTSA 2YRLA 4GUPB 2NUTB 2IGTA 4QXTA 4F7TA 1U8IA 2E59A 1ORSA 2VB5A 3HRZC 2AXFA 1NCTA 5CBEA 1S5IH 3L54A 3V9CA 4AC4A 3IRPX 4PJ5E 3MA7A 2VXSH 1RK7A 4KHXH 1FO0H 5ITFB 5M7QA 3LKOA 5K93A 3FT4B 1UZ8B 2YD2A 1PDKA 1QPKA 2HH0H 3P4NB 4UT9H 5C7ZA 4EZJA 5AAMA 5GRUH 5IMLA 3X12A 3D2UB 2HTKD 1MUJB 1ZK5A 2Q8AL 5I19L 4I0KA 1EHNA 1O9VA 2CDEA 1KC5H 1DQQB 4IHBA 5ETUA 1EHLH 1K85A 2EABA 3HB3C 3L8QA 5E2VH 3ZGHA 4OLEA 2C3XA 3CFUA 4PBVC 5KS9F 4MA8L 2VR6A 3AQYA 4LLDA 1KBGL 5L0QC 3V5HA 5DZ9A 1S7XB 1BREA 1XSIA 4PRHE 1MNUL 4ZUWA 1QSFE 5LBSL 1A3QA 4G6KH 3QNZA 4JPVH 3U83A 1DHKA 3LOWA 1CDHA 4UF7C 2GJZB 4M61A 3HG1A 3UTTA 1SF3A 2W07B 1MPAH 4Y2OA 3JWOL 4RAVB 1EXUA 1RU9L 4L8SA 1JERA 1ZHBB 4KRMB 3V6ZA 1I8KB 3X14B 1PZUB 3VVVA 1RP9A 3NACL 3A4FA 3TFBA 1QEWB 1UA6H 5BUPA 5IB3A 1RUQH 4MCZA 2KZWA 3IFLL 3VH8G 5JOPE 3SE8H 1G7JA 1MHHB 1SQ2N 2QDVA 2WNWA 1HH9A 3GFUA 3TN0D 3F84A 2BINA 1BJMA 5K9KB 1DR9A 4CDHA 1HYRC 1T2QH 5DC4B 4ZXBA 3DVNA 4LLMA 2B8OT 3X14A 4PWFA 2O26U 3V6ZB 3CAFA 4OCWL 3UG3A 5CN3A 5HDQL 3KPQB 2EXWC 3WN5A 3F7VA 5C7XL 1BF8A 3RKDD 5E7BA 3WYRA 3M46A 1RURH 5KVFH 3GXDA 5MEOB 1MCEA 1MW2A 3B7UX 5D7JB 3HB3D 4FFTA 1JE6A 3LZFL 5JMRA 3H9YA 3IMBA 2D3LA 4Q7DA 4HZLA 1DCEA 5T5NG 4LLDB 3V6BR 3U48A 4E5XG 2HWZL 3VSVA 4BUQA 2CLVA 4L5FE 4AEIL 2JQZA 1H8NA 3CVHH 3FONB 1RZ8B 5DK2A 3QG7L 3QUXA 2XBDA 3N40P 1TETH 2FDBP 4I18B 1KNOA 2EUZA 4GH7B 4Z76A 3HI1A 4L3EB 3BP6B 3ZT7A 2WUCL 4JLRA 4UZUA 4ZMXA 5GGTL 3ARGC 5EDSA 4JRXE 3TZVA 1SOQA 3TN0C 3VM7A 2H0EA 3BIKB 5L4MA 2QQNH 1ESOA 3WGUB 1UHVA 3T2PA 1DN0A 1I8IA 3IDNB 4AGLA 3BLBA 3LRMA 4N2KA 1UT1A 4UBDD 3UTSD 5JLZB 4APQC 3RTQD 3GS4A 4F1ZA 2R69H 3DRTA 1QABA 5DD0L 1ZY9A 3ZOAA 4FQXA 5TH2A 4EI5C 3QUXD 5SV4A 5IB1B 2YXWA 4RETB 1V7NL 4LSDA 3VI3F 1KJ2H 1ZANH 1TZ8A 2WD0A 3L95B 4PEEA 5EU4B 4J3BA 3ARYA 2VRAA 5DFWH 1KACB 3QNYB 5J06A 3VD1A 4Q6IA 3LXAA 3M8OL 1DEEB 3QDAA 4HUVB 1E4HA 1NA8A 5IW6B 2BCMA 2Z31C 4AMWA 2EYTB 4PP1D 1WG3A 1W16A 4DEUA 2OR9L 1KOAA 1XZ0B 1V7MH 5TDPB 2WTRA 3GDBA 4QUOA 1CURA 5JOEA 1NGYA 3U6XS 3NIDE 1MFNA 4PRNB 3VFWA 5HGGS 2JH2A 5GZNC 3QCVH 2E7CA 1HNYA 1WITA 1ET8A 3NIGE 5LLIC 4WU7A 4XMZA 4N0YH 2EE2A 3HC4L 3HE6B 4UU9B 4YJZL 3ALWA 4F5CA 4C4KO 3HZYA 1L0PA 1GYCA 2CA4A 4E0RA 2V8MA 4MCMA 4JB9H 5ANME 3L3JB 2QADC 5I5IA 2VDRH 1VACA 4D0CB 1ACXA 1AR1C 1LILA 5HHOD 3S7GA 1RH8A 2FAUA 2D03H 2PYEB 1FFRA 5JO5A 1H19A 2H6PB 3GSXA 1CFQB 4PVMA 4ZPTA 3DOSA 5AVSB 5K1JA 2R1XB 2X4NB 1OCOB 5J6GA 4PV8B 4BCYA 2ILLA 2Y2WA 1N18A 3D3VE 4FTDA 4PTTB 1ANUA 2IWGA 4C56E 1MAMH 4Y16B 3ESPA 3U9UB 5C0GA 2O30A 3BKCL 1LK3L 1T89A 3DJTA 1AOZA 2LAGB 1IM3D 2EEXA 1AXSB 1FNSH 3QORB 4WW2A 3RDJA 5FYJD 3E3QE 5D1QE 2A73A 2FWOA 1BQSA 4UQBA 3BKYH 2WVVA 5PCYA 3IS1X 3U1QA 3VGEA 1KIUB 2HT2D 1A4JB 4JG0H 5J8OA 4Q9QH 1J0JA 3ZQWA 4CRPA 1N12A 3JV5A 4J27A 5CEYB 5CCJA 4LNVA 2VXTL 1ZRUA 3VWKD 4OKVB 4LSPH 1X7QA 2V9RA 4AYDC 1G5AA 4EVNA 3MJ8B 3PJNA 4E5XA 3VFRB 1UCTA 3QUYB 4XP4H 4DT2A 2G2NA 2QSQA 3HC3L 1RIUH 2WP3O 5F8QC 1AZVA 1H3XA 2V2TB 4ZK8A 4FKHA 3MBEB 2DICA 1JPST 2APBA 2VDLL 4PLKD 5C0BE 2XG4B 4EBQL 1OCZB 2BK8A 5FR3A 2AJ3A 3MBXL 4N3TA 1FFNA 3VI4A 4F24A 4L8DB 2BIMA 1TZGH 3A22A 4L1DA 5MHSE 2X4TB 5DVOA 2P8PB 1KDJA 3OHMB 4JDTL 1K6QH 3SBQA 5CD3A 2E9JA 2WCSA 2AJUL 3Q44A 5KSUA 3TXAA 2DJ4A 3BZFA 1PVHA 2XHNA 4EOWH 2X9ZA 3ESMA 4HK3N 4P3CL 3NN8B 5E6RB 2W60B 2YC1A 2ZOLB 5B1JC 1ICTA 3L3OA 2ICEC 3QXAA 1PAZA 4OZGA 4XRCB 2ZOUA 5J9PB 2GCYA 1UUNA 2FX9H 2WAHA 2J44A 3AROA 3QHZH 4LKCA 4Y9GA 5F0PB 4LRNH 4ZNCD 2J71A 4JFEE 4BUGA 3KLAA 4Y5YC 4GXUM 2ZF9A 1QSFB 1DO6A 1PS3A 5AB2A 1L9SA 2IQ9L 1UEYA 4LPCA 1TJHH 2FR4A 1YY8B 4NEHB 4PJDA 2APXA 4TRPL 2UY7B 2J8UF 3GEFA 1SEQL 1XTMA 2B2XL 3CFTA 4K3HA 1C16A 1S7RA 4PJ8C 4M8QB 5JPMA 2PXYC 4UNVA 5EO0A 5A3ID 1R3HB 1D5MB 2NXYD 3VMOA 2EDFA 3UJTH 1L3NA 4B97A 5J3HC 2EDLA 4V1DA 3UP1A 3CSBA 2IIJA 5EBLB 1Q94B 1FZKB 1IGCL 1KEMH 3GZQA 3CGTA 3MRPA 3QIBC 4JO4L 4JM2D 1A6PA 1CR9H 2XVBA 1NDTA 2DYPD 2EEBA 2F54A 3DGGB 3IGUA 1IC7L 3OMZA 4ICWA 3Q6FA 2AI0H 4LAJH 2EEFA 3F04A 5B39B 1BEXA 5GQBA 4X8XA 5ILTH 2OJEA 2CUAA 1EO8L 3TIDA 3IDUA 3V5KB 1CLZL 5T1KB 3FS9A 1AJ7H 5J6SA 4NN7C 2XSKA 4RVBA 5HDBB 4BSVA 2XU9A 2DPKA 1IBDA 4OCRL 4H88L 2XXCB 5EEWA 1G6RA 2ZUUA 5EN2B 3GKWH 4X5PA 5JOFA 1JNNL 3RWIB 4NXKA 4J8QA 5G55A 1WAPA 4RMBA 3IDXH 3FL7A 4N26A 5IIEB 3TEYA 4EDXB 4NB7A 5LNEA 3UBHA 4Y19E 1FNSL 1N4XH 4GW1A 4M4PA 4QOKE 1THCA 4PJ8D 4UT7H 5CD5D 3BDYL 2WLNA 3Q8EA 2PLTA 3EZ8A 3DKHA 2NXYC 3TCLB 2ZUVA 2A5UA 5J1AA 4AQ1A 2VMFA 4BSVB 5CU9A 4XWGL 1QLFA 2COQA 3TV8A 4NZRL 2OXGA 5D1QA 1QI3A 5B7EA 1YDPB 3CG8A 1BBJA 4OF6A 4XMKL 1X5GA 1LQSR 3LB6C 2HLFD 4GAAA 4TQPA 1ZA3A 1ZT4A 2IANA 4NQCA 2VR4A 1TCMA 2DWEB 3WS6C 4GKNA 3WN6A 4BA0A 2ZX7A 4PCSA 3CZUB 3UCQA 5HYSA 4YSAA 3L1OH 1XD1A 1G87A 2NXYB 1HOCB 1T21A 1G9MH 4N25A 5MP6L 4TNVF 1C5CH 2X4PA 4UYPA 3DX7B 3P69A 5T33H 3EDDA 3NGBC 3FQRB 4IMLA 1CR9L 2CDGA 1HXMB 5I1LA 1XGRA 3QJUB 1MCOL 3JT2A 4MZ3A 4YDKH 4NKDA 1QSEA 3T0EE 2G3ZA 1N10A 4R2GC 3VXME 5JPMB 4PJBB 3IGLA 3TA3D 2VXUH 5FV1L 3WFCH 5CBAA 3PHQA 4A6YB 1N8ZB 4DGYH 1FVEB 2ITCB 3AGVA 5EIIA 1WZAA 1NLBL 4PJHF 3MUGA 3EHBB 5F7EL 5LAXA 5SWQB 2XN9B 2KZKA 3O3AB 2Y1AA 1G7MA 2W8CA 3LEVH 1RJLA 1JZ3A 4HCRA 4L29B 1TTFA 1KCVH 4R7DA 3BSZH 3NEEA 1MFVA 1TQWA 1TZOA 2Y7MA 1U92B 4G9FD 4G6ML 4NM8L 5DYOA 1TYJA 3DUUA 3KPPA 4L3FA 4AENB 5DFTA 5F6HJ 5DEGB 2PTTA 2H32H 2YPLE 3E38A 2NW3A 5C0BD 2K4WA 4FD0A 4LVEA 4NZTH 4PGJA 1WBZB 3OR7B 1PY4A 2HRGA 2OQJB 3AS3A 4K73A 3K0YA 3ZTJG 4DK3A 5DJ2A 2BS8A 3BUYB 4KTGA 4UTAA 4UT6L 1WF5A 1YC7A 3KH3A 5ANMB 1JCVA 5BUAA 1N0LA 3OKMA 5DJ8A 4PD4K 4JGMA 5DO8A 1W6WA 3N06B 1DVFB 4L3CB 1NPNA 5L88H 5HPMB 5IF0A 3BUBA 5HHVH 2OCCB 1S9VA 1A25A 2YA0A 1A6WH 2EIKB 1J48A 2FIKB 2N0KA 3FYEB 3PXLA 1XB8A 4H0GA 3GM8A 4ICXA 5MHSD 3N40F 4OFIA 3QUMA 1EHXA 1JZ6A 2AJYL 1HHGB 2NY5H 4AV5A 2VXVL 1PF3A 4G1MB 4LCUB 2ADIB 4IGBA 4LPWA 1T83C 4JO4H 5IEHB 1RY7B 4B9JA 1BLNA 1KEML 2CCVA 3MJ9L 1P6FA 5B38A 3HS8A 1KPVB 2IOIA 1SYVA 3HFFA 4RNRB 2K78A 3QJFA 1MFAH 1TYEB 4OGYH 2DWXA 4DP8X 1HINH 3GC3A 4Z3HA 4F2FA 2YRBA 1BV8A 3HS0B 4GG6B 1P6AB 2Z8WC 4Q74A 1XGZA 4NUPA 1IKOP 4IOIA 4Y4FC 6PAZA 3KDMB 4WW2B 2QQKH 5C0RH 4UDTB 4K4KA 1ZV5A 2E7MA 4ZW3A 1NGZA 4F7MB 4DO4A 4IKKA 2PXYB 2AQ2A 3IDMA 1NGPL 5GS2H 4BZ1L 1MDAA 2UWEF 5FWRA 3MACH 4ZJ9A 2YBRB 2QSVA 3BO8B 5KSAA 5H2BB 4OFPA 2XWRA 4X5WA 3NYKA 1T04A 3BGMA 4BUHA 1PGRB 2ZX9A 3LVTA 3IDGB 5AENA 5ABAA 5GRVK 3RZCB 2Y36H 4N90E 1NGWB 2H3NB 5L2JB 2EACA 4TTDD 1ACYH 2EE0A 1PLGH 4ZS6C 4XI5D 2EIZA 3JWOH 5F88B 4JKPL 5C0EB 2C9PA 4XR8C 2P28B 1A6ZB 3O8XC 4TUKH 4TVPE 4PI2A 3BP5A 2Q7AA 3AITA 2FJHA 2VQ1B 4BKSC 5I1AB 2DWSA 3ECQA 3N44F 4OF8A 5D6DA 1JPGA 1I1YB 3BLKA 1QLEB 4KZCA 3H85A 3TU6A 5L7XL 3CZNA 1M7DB 3HC4H 5KSAD 1EAOA 3AM8C 4ATTA 4OV5A 3ENEA 4FJZA 4E36A 4QRFA 5TDPA