3KCPB

Crystal structure of interacting clostridium thermocellum multimodular components
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
163
structure length
163
Chain Sequence
b'SSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cellulosomal-scaffolding protein A
publication title Insights into Higher-Order Organization of the Cellulosome Revealed by a Dissect-and-Build Approach: Crystal Structure of Interacting Clostridium thermocellum Multimodular Components
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Structural protein
total genus 33
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kcpB00
2VN6A 1TYJA 3F2LA 5K39A 3BWZA 1ZV9A 2JH2A 2B59A 1G1KA 4DH2A 4WI0A 4IU2A 5G5DA 4UYPA 4UMSA 3KCPB 2Y3NA 4WKZB 1OHZA 4N2OA 3FNKA 4IU3A 4UYQA 4U3SA 2OZNA 1AOHA 5LXVA 2W1NA 2CCLA 3GHPA 2VN5A 4FL4C 4FL4B 1QZNA 3KCPA 2VO8A 2BM3A 2XDHA 2ZF9A 3UL4A 2O4EA 1ANUA 5AOZA 3L8QA
chains in the Genus database with same CATH superfamily
2YXVA 3JV6A 1IT9H 1UACL 4UTBH 3LQAL 4H8WC 3H9HA 4WUUA 4QRQA 1JDCA 1XWVA 4F8LA 4I85A 2WSDA 3BGFB 5C2BL 2VDPH 2XBDA 1MHEA 3E6FB 4J12A 3ARTA 4B27A 3O6LH 5BUGA 5D4IA 3T6VA 1KUMA 4YDLC 4FQXA 2GPZA 5CD3A 4WVRA 4LSPH 3B7TA 1AHWB 4NRZB 1TT6A 5AVXB 5ICYA 3K2KA 2LU3A 3T0AA 4CN1A 4GKLA 3LIZA 2AAAA 5FHBL 1PG7L 3ARBD 3HI6H 5DD5H 4ZYKB 5BZWA 1I9EA 2YFNA 1T04B 5EO9A 5IMKA 3MUUA 1OPGL 5JW5A 2WLIA 4TOYL 1UWEL 4LLDB 4NPYA 3TWCH 1T7WA 1Z1WA 3GSOB 2DH3A 4GW5A 3TBSB 3VFMA 2XKNB 2VQ4A 4P57A 4MZRA 2UZXB 5I6KA 2IF7A 3MQIA 4W6XB 2AK4B 1WFIA 3VXUA 4UQ3A 3P3RA 2J88L 1GKOA 4NAQA 3PABB 3ULSB 4NUGL 4ACTA 4ZTEA 1N6QL 1FO0L 2SEBB 4JFED 3L1OH 5EOTA 5CM1A 3TO4B 3SBWA 2W8CA 1MG3C 1UD2A 1ZIBA 2BERA 4XGZA 3BYYA 5DYOA 5T3ZH 3AW5A 3B2PA 4WW2B 4UB0H 4Z0BL 3WN6A 3UIYA 4QNPE 1BAGA 2P7TA 2PWDA 2CU9A 3MRQB 1LNUB 2AV7A 2GBVA 3P40A 5BUPA 1ETJA 2J8UA 3L3DB 4R90L 1CGTA 4UT6L 3RIFK 1TSRA 2O5ZH 2AP2A 3C8KA 4HD9A 2OK0H 2MJWA 1P4LB 1UT2A 3MN8A 4N25A 1S7VB 4NJAH 2ITFA 2C9QA 1A4JA 1CYWA 3LZFH 1YNLL 3GHEH 3GIVB 3HAEH 4J3OG 1PX3A 4OQ1A 4NJ9L 4F20A 4HJIA 1NH6A 4R7DA 2P47B 1OE3A 2VZOA 1GZPA 1YEDA 4DVBA 5DJDA 2ZP9A 3MTRA 4U1KA 2AABH 1NWOA 4JKPL 3D5OF 1G9NH 4GSDL 2Q3ZA 3QGVA 4OD3L 4IOSA 5BVPH 2NZ1A 1GTFA 2NY3B 1EJ8A 5EEXA 2OW6A 2WOBA 3TBBA 3FOLB 4HLZG 3VWJC 3CJJA 4CADA 3DTXB 1ONQB 2K8MA 4Q9RH 3BWSA 2N7SA 1PVHA 2GUYA 3GM8A 3CVDA 3II1A 4KQ4H 5F96H 3WJMA 2BOBB 2NYZA 1CD8A 3O2WH 5DMGD 3VMPA 1F56A 3KYMB 1NSNL 3VXUE 5JW4Q 1AVAA 1HFUA 4EF3A 4F92B 4I1RA 5EZIL 4MNQA 4Z7UF 4Z7NB 2R51A 4KJPD 1MUJA 5EORL 3T2PA 1SYVB 4DETA 1KFAH 4Y5XC 2D2OA 2H2SD 4F8NA 1AQ8A 1LO3H 3P3YA 4Q9CA 2W9DL 4BE5A 1A64A 3L48A 2KQNA 1J7VR 1AKJD 2QGEA 2VLJB 4G9FA 4PJGE 1TZOA 4TV3A 4NKMA 5IBTH 4AQAB 1KJMB 3BZFA 4P5RA 2IBZX 1WV7T 4W4OC 1S7UA 3ARGA 3ERXA 4P07A 2DAVA 3FMGH 2MOGA 4ABQA 2AJVH 2APSA 5TDPA 2BP3A 2WQXA 4H0LC 1NLBH 3VVVA 1TCMA 2JIXB 4J7RA 4OGXH 1S7QA 1L5GA 4MHHG 2HT2D 1ZANH 2ZOLB 3THMH 4WK0B 1IQDA 5DMGC 5E2TL 4TVPD 3HKFA 1BIIB 3P4OB 2W91A 2ARJA 4KMQA 1NC2B 1WS8A 4C56A 1CDJA 2DIEA 5AW6B 4XVJH 1CFSB 1BP3B 4LPCA 1MFEL 5D72H 4FQJL 2KS0A 5GSVB 1FC2D 1FNFA 1FO0B 4KJPC 4U3SB 3QEQA 2ENYA 3BCDA 2FIRT 5F0MB 1WIPA 2H2SC 3OR7B 3QIWB 4YDVA 4CGTA 3AQYA 1JCVA 3T04D 4CA4A 4Q56A 1XH1A 5FYJU 3BUBA 4BK5C 1R34A 2AITA 4Y2DB 3OL2A 2ZQKA 4PJXE 3TPKA 3VH8G 1HEJC 4Q74A 1YHPA 1IARB 2ZX8A 5CSGA 4HOWA 3MBWB 3JV0A 4JFSA 4QCIB 4XMLL 4XHQA 5HVHB 3QDJB 3FFCD 2TRYA 1MFBL 1YYML 3UACA 3V6FB 1B88A 4LMQE 6FABL 1FE8L 5I1KH 4TSBL 4AE1A 1JXKA 1U2HA 4NHUB 4G8EB 2YIHA 3TA4D 1EZVX 1TJMA 1FVCA 4KKAD 2PXYD 4N2CA 3MFFB 4IRSD 2VLLA 4G9FE 2XLLA 1F11B 1P7QD 2R1WA 4WU7A 1WC7A 2RQEA 3QSKB 1R3JA 3RI5F 5F7EH 5CBEA 3P2TA 4YHMH 4RX4D 4U4BA 3TNMB 1IEAB 1RK1A 2G75A 2PWEA 1HEHC 4YC2B 2HRGA 3MO1B 4N3UA 4CKQA 2CLZB 3QZLA 2R39A 4WO4D 1W0VA 3HC4H 5GRYA 2WXOA 4OCRH 2W60B 2EIZA 4NERA 4L3EA 4LCWB 4H8VA 4CBPA 4HUUB 4TNVK 3S5LB 5B22A 2WVSA 1PIGA 3J7HA 3CHXA 4C56E 3OKNA 4G8GB 1X44A 2CHDA 2YEVB 2QPEB 3HIZA 3VXME 3IWVA 5D1ZB 3GMOB 2HT3D 3E6HA 2B59B 1EHLH 3P2DA 3CSYA 1U8KA 2MCPH 1BZ9A 2CDFB 2PXYC 3SE4C 5HHPA 4YHIB 3C8DA 4IRSC 4EIBA 1W72H 4N8VA 1I9RH 2UZYB 5D6DA 4F7KA 1CU4H 2I7OA 1NBZA 3VSUA 1DUYB 3AWFA 3F12A 5C0BB 3IJEB 2X6MA 4WTXA 2HLAB 1AQKH 5A7BA 5IGXH 5EA0H 1H6EA 3HNSH 2ETWA 1FORH 1AGDA 1TNNA 4XVTL 3RWIB 4P4KB 9CGTA 3KYNA 2I85A 5F70A 4WO4C 4JFOA 3VXRD 4XXWA 5ESQB 4M5ZL 3ARBB 2X70B 3IJSA 3NA9H 4QOKA 1KPVA 4FAAB 4MJID 3M45A 4PWEA 3CDCA 3VFVB 5ICZB 4AVKA 5B1AB 1ZHLB 3NJNA 5JDJA 4UU9B 2EKSA 1W8OA 1YEFH 2OZ4A 1CGXA 1A1OB 2A73A 4H26B 4TVPL 4G9DB 4O00A 4O02A 1E28A 2CUIA 5FO7A 4XC1L 2JKSA 3FW6A 1VFBA 1FGNH 2ICEA 2HT3C 4QMEA 2VW6A 4WFFE 1S5HA 1ORSA 5HHOA 5KJRL 4K9EC 3MNMA 2IGFL 2XQBH 1FFRA 5CIPH 4JFEB 2ZICA 1CFTB 3OAUH 4L3EE 4MNHA 5IB4A 3PWUA 2R4SL 3GMQB 5EUOB 9PCYA 1KIPB 2CK0L 4HUNB 4NQCD 3PAYA 1ZT1B 5IWLC 4HX1B 4U6YA 4HAFA 3GO1H 4LLMA 5CJOL 1SQ2N 4PJAB 5GRUL 5IEKA 5IVNA 2GITA 3HC0A 3U4EB 4O2FB 2R69A 5DA0B 5FLUA 4FI8A 4AMKL 3T2LA 1A6AA 25C8H 2EILB 3O6FC 4JKWA 3QRBA 1E5BA 5HYQA 2DBLH 3QUYB 1RJYA 2VZ1A 1L9SA 5PAZA 1TYRA 4AKPA 2A83A 2ZF8A 4HULB 3KJ6H 3VG9C 5JYLA 1S3KL 4K15A 2CJUL 4Z9KB 4BUHA 2BOCB 3V5DB 3GJEA 4AGQA 4FJZA 1Q0YL 1CLOH 2HYMA 3SIKA 4Z7NF 1WWCA 3SDXE 4Z6AT 4LVEA 2WQ8A 3H0TB 1RU9L 5DGQA 3HJ0A 3DXAA 2XRAH 1MCOH 2I24N 2W81C 5HI4D 3TN0A 3DOHA 4PJ9A 4M3KB 4QOKE 1JK9A 4N90D 1RUPL 2YZ1A 3UAEA 4A2HA 5I30H 4M1DH 3OXSB 2UY6A 5DS2A 32C2B 1FFPB 1F6LL 3NSFA 4XNZC 4PBDA 5LGKA 3PJSB 5SWZA 5DHXB 5ITBH 3ZHFA 2IBBA 3O4LD 4Q7DA 3KLDA 1A47A 2VSDA 4H25B 4BFBD 3W5NA 2Y2YA 3ARPA 1JZGA 2QQLL 2EDFA 2V5MA 2JTYA 1EK3A 3BN3B 2KZ1B 4N2GA 2ZXGA 1YC7A 3L3JB 4JFXB 3OHXA 4J3BA 5HHOE 3LKPB 5AAWA 3NABL 2G60H 5DJCB 4MDIB 4GO8A 1E4XI 5DEZA 1AC6A 3S36L 2X9XA 4LHUA 4AJ0A 4JK0D 3Q3GB 2MQGA 1RLBA 1D6VL 3VD7A 2AJUH 2DPKA 4KC3B 4OZFA 4WWID 1D7FA 3VFRA 4IK6A 4X4XB 1L9QA 1IAOA 4LKXB 5KN5A 2HX9A 2ZX6A 2MQ0A 4LIQE 1L0XA 3QNZA 5E6ID 5HI4C 4HF5H 5IFJA 5EF3A 4RRPG 2HMIC 2FEDC 3FB7B 1YY8A 2YWYA 4AV0A 2BNQD 1I8AA 2HMID 4YAQA 5DO2D 2XUWA 3X3FH 3C5JA 3F7RA 5F9OH 4F3FB 1RZJC 3P9LA 4X6CF 4IU2A 4FTVA 3BH8A 5MERA 2CZNA 4XT1C 2GUOB 4FKKA 4APXA 4N20A 1BGXL 2DTML 5A7EA 4H13C 3CDZB 3IVKB 4GSXA 1DVFC 1AS8A 5HHXH 5LNGA 3MRLB 1GGYA 3OKMA 1MWOA 2ZOKA 3QPQD 2NY2B 2V6HA 4NZRL 4WI9A 1PJWA 2ICWB 2CO6B 1L7IH 3GJFK 3GJFA 1TPXB 3L4XA 5SWZE 1MY7A 5IBLD 1U58B 1UXMA 1FNSH 3AM8C 3OSKA 2ZXWB 4DEPB 2JKJA 3COOA 4XH2B 3EDEA 1T22A 2QPDB 2VLRE 2AZAA 4PLNC 5L4IA 4HIJB 5BZZA 2AK1L 1JZ6A 2AEPL 3ZXAC 4JO5A 3FQ1A 5E6IC 3UADA 4DQOH 3IU4H 3RBGA 3UTSB 1F3DH 4NQVB 2OMWA 4FFZA 4HZAA 3T65B 3TA3A 5L2JB 2IQAA 3O4OB 1PZDA 3CLFL 4N0CD 4R4FH 4LDOB 1I8LA 4Z8FL 3HG4A 3W0WD 3S48A 2YPKA 1JE6A 5EUKB 4QJ4B 4M8RA 5D2LA 3MRIB 3V0GA 1P7QB 2PYEE 3DX7B 3MODH 3SKMA 1L9MA 5MEPB 4ZMOA 2H4EA 2KDYA 3P11H 2NUTA 1B6DA 1MNUH 3BDYH 1BYNA 2RH0A 1A3RL 3QPQC 3SCMD 3VXTA 3A6OA 5D7IF 1T21A 1AR1D 2BLFA 3C87A 1BMWA 1I1FA 1FPTL 3LJ3A 5IBLC 2JKNA 3MJ9H 1JXDA 3FF7A 4HZLA 4P99A 2X41A 2WKOF 1QLFA 1NGYB 3MDJA 3U0WL 5CKAA 1DQQB 4UQ2B 1S78D 2UUDH 1UURA 2YK1L 3L2NA 4PGZA 3ZE2E 3IAQA 5EIIA 1DVZA 4OCWL 2KKQA 4BZ2A 2AI0H 5IFHL 5IHZB 3D2TA 3UTZA 1ZA3B 2QQKH 2OMTA 3HZ3A 4EUPA 1IUZA 3CSGA 1TETH 4X5WB 5DLLA 1HQ4A 1KGJA 3S88L 1QSFA 3BVVA 5EZLA 4NDMB 3HFFA 2I9TB 5GGTH 3CE1A 4TN9A 3B9KD 4BYHA 5T5NG 4L4VA 1MY5A 1BG9A 3T5WA 1QEXA 1AIZA 4YBLB 1UM4H 1BQ5A 1TZAA 4R4BB 4K3JL 1A6VH 3SCMC 3DSFL 4G80A 1XZWA 1AR1C 5EUOF 4J6RH 3UG5A 2BHYA 3BC9A 4PJ5E 2VDML 5KANG 4MJIB 1FN4A 4RZCB 1WCBB 1UCBL 4ENED 1H9DA 3IGUA 3TIDA 1FHGA 5BMFH 1S78C 4J2XA 2DQ6A 3U6XA 1MCQA 5I1JL 4MWFB 4KKRA 3WNIA 2G0LA 1T0PB 3MBEB 3WMSA 3ARED 2WGXA 3B2DC 4N1HB 1YMHA 3FFOA 4YOKA 3UROR 1EDYA 5EN2A 4HJ1A 1U8MA 1KWGA 1NGZA 3KGTA 3LOWA 2PTTB 4KOCA 2YR3A 1DSYA 4LL9A 3IETA 2NNAB 2EUXA 3T0EA 3IB4A 5E1QA 4K7PX 3NTCL 2FWLB 5IV2A 3B9KC 2L8AA 3G5VA 1K2DB 2XFXA 1IGTA 2AS5M 4NQCB 3TP4A 5KVDE 4KJYB 1ADQL 3R18A 4QYAA 1DFBH 5BQ7A 1JP5A 2DIAA 3MRKB 3MUJA 2WP3T 2VL5B 4L9LA 4YSDA 5C07A 5E2VH 3P4NB 4F9LC 3EJJX 3I50L 2Y7OA 5DHEA 5JHMA 4Q9QH 2WKLA 1DVTA 4PJBA 1QSFE 5DJ0A 4Y1AA 1PSKH 4DH2A 2ZKHL 3O2DH 4ENEC 4FERA 3SKOB 3C2AL 3MR9B 1T7ZA 4MLSA 2DWSA 5DRWA 4PREB 5FGCB 5AYTA 3BH9B 4KROD 3LSOA 4UOW0 4AQZA 3AREC 3FO2A 4XWOD 2R8SL 4N8CH 3KPOB 2EH8H 5AKTA 4B9IA 4GAJL 2ADFH 4WEEA 2XXGA 4KXZI 3DBSA 2XN1A 1SHSA 4KTEL 3KLHD 2F54E 3C09B 4RAVA 2EEAA 1A7QL 3B34A 4B6ZA 2JJSA 1ECYA 1YYLL 5CFAA 2J20A 4OGAD 2Z4QA 4YGVA 3VTAA 4QWWD 5FGBA 3ZE0B 3BUDA 1SEQH 3B2XA 4PRPD 1MFCH 2DWDB 4KAQL 4LDEB 2IAND 3LRSB 3MRPA 3MMEA 2H32A 1CFQA 3RHWF 2ED8A 2X6CA 3LRHA 3QIBA 2EYSA 3BZDA 4H8PA 3QR2A 4HALA 4L1BA 1MDAA 4NC1E 5E8NA 3TIEB 4DGVH 3N1PC 3D69A 35C8H 5AAPA 2FHBA 3PGFL 3LZPA 4H5SA 4DSYA 1I8IB 2FEEL 3TX4A 4AGMA 5E1AB 4LP4A 3W11D 1KYFA 3DMMD 1EZVY 2QVMA 2QL1A 2WZ5A 3V4VL 1MCLA 4F8OA 3L4UA 1TU2A 4HQQH 2F19H 2AXFA 4KROC 1AACA 1E5AA 4F57L 1XIWD 4NP9A 4APQB 4XWOC 4NP4H 4PVBA 4EI0A 5D1QC 2VDNH 4XNUL 5EU5B 4JPIA 3PHOB 5CP3H 4MMZA 3BP4A 5DWPA 5I66B 5DWUH 3VFSB 4OGAC 2HFFA 1GGBL 1FDLH 2YD7A 4PJBE 2CK2A 4G6JL 1J1XH 2BNQB 4Y1AE 1J8SA 1BOGA 5KBNC 4OI7A 1KLGB 5CLTA 3FQTA 2YUWA 4LSSH 2E5EA 3U9PL 3WEXA 2ZWLT 3RUGB 5DMIL 1WZAA 3NSYA 3EDJA 1OAZH 3BPOC 4B5ZA 2NZ9D 1DLFL 4OM1L 4LOEA 3LPGA 2GC7C 4E9RA 3L7FB 5DU7A 4PJ8D 3PL6D 5HHVL 1IBHA 3RWFB 3K4ZA 2F53B 3OKKA 3HVNA 2ERJB 3GB7B 3LIUA 3PV7A 3LQMA 2CO2A 3Q48A 4JFHD 5DVNA 2HX7A 5E7FA 5F1SA 4HJTA 1QUNB 4MBOA 3DMMC 3W11C 4ZSOA 1I7RB 2EC8A 3MV8E 4KRNA 4X6DE 4X4YA 3VSVA 2ZG3A 1KJ2L 2B77A 4X0KB 3QG7H 1SMDA 1XIWC 5KSUA 1QPKA 2FB4L 3BX7C 1IL1A 5CWSB 1DQDL 2X2JA 3TH2T 2X4QA 1P2CA 1CXLA 2GQHA 1U3ZA 3Q13A 4L5FL 1C5CL 3AUVA 3MUY1 2YQ3A 3C08H 2WNGA 3QEGH 3L95A 3P0VH 5AB0A 1RIVL 1WFUA 3VA2C 1NIAA 4YDJA 3WENA 2QHRL 5D2NC 5I8OL 4KFZC 1A6UH 4YHNB 1CF8L 3FN3A 3NZHL 2Y1ZA 4GKNB 3GMNB 2X4RB 2ZOWA 1MQKH 3QQDB 4ORGA 4MTMA 3MHZA 4HS8H 2HVKA 3KLAB 3PL6C 4XP6L 4FQHB 1BVNT 3ZYIA 3WFBL 1YQVH 5E99L 5K33A 4R96A 3BLPX 3RGVA 3LY6A 2BSRA 3S5YA 1OL0A 3EH3B 5D96C 4ADJA 4FZ8L 1GW0A 3S3CB 5JIIA 2BHZA 2XN9A 4L4JA 3A6CL 3F7VA 4LP8A 3E9UA 4OFIA 5E6ZA 1NGQH 3BPLB 1E27B 1E4JA 2H47C 3K4DA 4WAFA 1BJMA 4C55A 3T4AB 4PGCB 2G5BA 2HN7B 2WIMA 4X9GA 2D3NA 4ETQA 4YDKL 3QCVH 4PSPA 5DJYB 4AEEA 1I7TB 1QYGH 1SBSL 2GT9A 5ELIA 1TG8A 5FIEA 3B3BA 1OF2A 3V4VB 5J0BA 4B53A 3ULUH 5CSZA 1RV6X 3B8YA 4WI3A 3SGDI 3US1A 1GYCA 1NLDH 2XA3A 1NMCB 4GXFA 2E9IA 1B0GA 5KSVA 1WIOA 1T7YA 3PQYD 1FYTD 4NO5B 4JLRB 1HHIB 3DX8A 2DI7A 3MOAH 4QLWA 4XBMA 5AVQB 4HPOH 3Q06A 3DV4A 4NUQA 2JK5A 1XX9C 2XYCA 3CDYA 2YJLA 3B7UX 4PJFA 1CE1H 1QMUA 3D51A 4PLJC 5CEZD 4MXVF 3QEHB 3UGEA 5FOJA 5D1XA 3U2IA 2K7QA 3VQMA 5KAQG 4A7UA 3CXHK 2KZWA 1ZS8A 4BH8A 2F8IA 5JOFB 1SN2A 4N6RA 3TJPA 2WXMA 5CNHA 5DZNA 4CSZA 5F7DA 5KSBE 5DVKA 1XAKA 4D9RD 3Q6FA 5EU6E 4RBPH 4BHUA 2BDNL 5CP7B 1VFMA 4U1HA 3UTTD 2HVBA 3NJKA 4Y4HD 3G6AA 3P69A 4XX1E 4WK4B 5DD1H 2F2HA 4I3RL 3QJSB 2DD8L 3DJSA 3KS0H 3L3HB 3RWCB 5IKCA 1KJ2B 5JXAH 3L08A 4JFPB 4WWKA 2B1AL 4BK4A 4NN5C 4IS6A 2DRUA 5K93A 2FJFA 2GI0A 1BV8A 4X7TB 4B41A 1AD9A 5DK2B 1V3MA 5D6CA 4D0BB 5I2IA 3X17A 2L0DA 1CK0L 1WWAX 2Y6SD 2AXGB 3QFDB 1UXWA 1GVIA 1R5IB 2OP4H 2DYRB 5ESVB 5EBWB 5G2NA 4ZMVA 3ZE0F 4XR8C 5ILTL 4YFEA 2BVPB 2WLHA 4KZEL 2VZ3A 3T6WA 4UWQB 2QV4A 1GIGH 4DO5A 5I0DA 3SSGA 3CLEL 2OSLB 2Q8AH 2K6YA 4PJGB 5GGUB 2P43B 5ETUB 4BE6A 1CVRA 2VABA 4CUCA 5I19H 1RULH 1WS7A 2MQ3A 4HWEH 3AY2A 1IC0A 3L1FA 2VZVA 3WJJC 1E4XH 2ODHA 4X6FA 4DK3A 1K3ZA 3HNVL 5F6HJ 1LP9A 1NCBL 1T1WA 4OLZL 4OLWL 1LEIA 4F93B 1HC1A 4BZ1H 3A4AA 1AQDB 3S97C 2IFGA 4LO9A 4LNVA 2ESVA 5D1XE 1HHJB 1BVKA 5C8JA 4ZMLA 4NFDA 3DV6A 3FXIC 1G7PA 2XQYA 3QJFA 3CVHH 3V0WH 1EEYA 3IT8D 4I9XA 4PRPB 1WAEA 4G6MH 3W9DA 1Q0XL 1J86A 1AZCA 2APTA 2LQRA 3FKUS 4KZDH 1PLGL 1WBXB 3K0WA 4PS4H 2H3NB 6PAZA 1TZ8A 3NFNB 1PDKB 1I1AC 1W15A 3RUGF 5INDB 1I4FA 5T3ZD 4ZFFA 2Z31A 2FBJL 4XPFL 2FX8L 4WJKB 4JFDB 2CQVA 3LXBA 3E1F1 3NJJA 5C0DB 1XO8A 1M2OA 3KPPA 1MRCL 2YUZA 1W91A 1X7QB 2R2EB 3NPSC 3T1WA 4PS8A 4IRZH 2UVFA 4D94A 1LE9B 3EO1A 3WE6A 4I4WB 4HJGB 3V0IA 5DA4A 1KIQA 2ED6A 4A6YB 3D08A 2ZCHL 3G6JE 2VXUL 4LBEA 1MWAH 1MFDL 5AVZB 1FFNA 2OMUA 4FGMA 4MAUH 3S98A 4BCXA 1U2YA 7FABL 1TVHA 2WNKA 3DGDA 3K1KC 4HT1L 4L8BB 5BS0D 3RX9A 1CDGA 2UYLB 1GRWA 4ZD3H 2AQPA 3BWAA 4UAOC 5CBAB 1MFAH 5B1BB 3TVMD 5K9OA 4R5XA 4K5OA 2BVOB 1UG9A 5GZNA 1VRSA 1VZHA 4PRIA 4E41B 4MX7B 4KTGA 5GGSA 1XVSA 1LP9E 2PCXA 1G7QB 4PRAA 3GIZL 4XP9L 4FNTA 5AW4B 4QGYA 2AKRB 1OK8A 3L3KA 5F89A 2HJKA 4PJ8B 4P46C 3ZHLA 3GWJA 2PNDA 1S9KC 3AG4B 1E2ZA 4ZI8A 3VI3B 4PJHF 2BIMA 1F8TL 2JJWA 2YSTA 4FFWD 1OTUD 1T0OA 4KHTH 2IXQB 1D7CA 1NL0L 4KTYA 2OZNA 3QORD 4XVUD 2XT1B 3X11B 4ODVH 4DVRL 1VFAA 3ZSTA 2EAEA 1DQVA 5FLVA 2QKSA 4XXDA 3EJRA 3B2VH 4XAWL 4RMRA 1SFHA 5C0CB 4XPBH 1EVUA 5HDQH 4DP1X 5FDWA 4UTBL 3HW7A 1R0AH 1HHGA 3BHBB 1FJ1A 4JZOA 1IBGL 4G7QB 4PWGA 2XY2A 3EYOB 5IIEB 1HH9B 3AQXA 4GT7A 1SOKA 4ODSH 4L2YA 3OWRA 4OCLC 5CLYA 3TVMC 2X10A 1GC1H 1XF3A 4H20H 1P84J 5LBGA 1P4IL 1Q94A 3DIVA 4X98B 4LF3A 1OGAD 2IPUG 1VACB 4LSPL 3EZ8A 4JN1H 4KKBD 2FK9A 2CDEA 4QR7A 1PZSA 1HOCA 3MZGB 4BH7A 4JE4B 3FB6A 4XCYB 2TSBA 4FP8L 5SV4A 5I1AB 2VR5A 3SJVE 4XPGL 4P9MH 1GZQB 2G9HA 4HD5A 5J89A 4BSVB 5DD5L 3HI6L 1JYNA 1G7HA 3AMKA 3UBXB 2WBJA 2QMKA 4FFWC 1FNLA 4JDTH 1QOKA 1OTUC 3QNYB 4XVUC 3QORC 3TWCL 4K7PY 1INQA 4MD0B 2DWXA 1F4XH 4HUWA 4PRIE 2VW4A 2NQCA 3II3A 3L54A 3CVIL 1I9IH 2WNXA 4FS0A 4IIQB 2GYSA 3M1BB 5D7KD 3OBAA 1UB6A 1BD2B 1CBVH 2FL5B 1CICA 3PPEA 1P7BA 4Y9BA 1K8DA 4NRYB 3L1OL 1U8LB 3EFDL 4LOFA 1A9BB 4PBXA 3CHQA 2Z7WA 3KPRD 4HGWA 4YXKL 2IALB 5T3ZL 4EKXA 4K3GA 1Y18A 2DJ4A 2NT0A 4HKJB 4UB0L 2OSWA 5KYNA 1ZGLA 1ZTXH 1IAKA 1NWPA 4KKBC 5D93C 4PJ7E 1E9QB 2JFCA 3PQYB 1UZGA 2VR6A 3D34A 2ZKWA 3O0RL 3G08A 6TAAA 2ZKMX 2OK0L 2OLDA 2AC0A 4UZGA 3MJGX 3NCYS 4NJAL 3QUZA 1IC1A 3LZFL 5DEJA 2XJKA 1IJ9A 3GHEL 3IJ7A 4PRHA 5CGYC 5SV3A 1SJHA 2EDKA 3T3MF 1XGUB 3H1ZA 2R1YB 1O6VA 1LMIA 2IO5A 2XWZA 4IHOB 3WLWD 1AR2A 2N3JA 3SDXB 2DKSA 2WXFA 2V3DA 4A7QA 2CR0A 1WZMA 3QHTC 3WS3B 5D9SA 2AABL 4QYOB 5EFIA 1G9NL 5H37G 1LE5B 1O6SA 4G8FB 3GSVA 1CL7I 4A2EA 5E1HB 2H26A 3FO9B 5BVPL 1J11A 1UJ3B 2FAUA 1MCFA 4HCRH 5E4EC 4AT6B 4Y4HB 3M7FB 4Q2ZB 4YDNA 3S8GB 1RUQH 2YQGA 4LVOB 4O58H 3KPMA 2EVFA 4QXUL 4Q9RL 1KCWA 1BAWA 4KQ4L 5F96L 1ACXA 3CSFA 3NK4A 4A63A 3HS0A 1ID5I 3LYRA 1PLBA 2PWFA 4G6AD 2YUVA 5HHNA 4I77H 4RISH 3BEVB 3C5XA 1U42A 5IMMA 5FYLH 1FFTB 4HK0B 5FUCC 2ZUTA 5I1DA 4WHDA 1FL6A 4PS7A 1UEMA 1CDHA 1S8DB 1ZIAA 4J2QA 2KHAA 3AS2A 4FMVA 4Z7WF 1KFAL 2VDPB 2YXWA 3DGCR 3IPEA 3KD4A 3LN5A 2HRHA 3NOIA 5F1KC 3WUWG 4B9FA 4XNDA 4ZW5A 3QPKA 5HBBA 1LO3L 3WTVA 4YHYB 3WLWC 5C2UB 5GJSH 1QQDA 3FCSB 4HFWB 4I89A 5TFSL 2VXQH 3D85D 4AXWA 4R5VA 3FT2A 4AQ8A 3ATFA 1F3RB 5JUEL 8FABA 3OV6A 5I5RA 3NFPA 2WXQA 4U2YA 3DUUA 3FMGL 4B95C 3BUYB 4JFQB 2AJVL 4ZRGA 5LKNA 1ZHKA 4G2AA 1OOAA 1W9XA 3IJHB 1OT1A 3D18B 4JANB 4RBPK 5ACMA 4PRHE 5E8EB 1NLBL 2F08A 2Z92B 3H2QA 4G59C 2AJ3A 4OGXL 1G9HA 3C5ZA 5E00B 3S2CA 1ZANL 3U7AA 5IB3A 5G4OA 4UAOB 3THML 4XNBA 1QWHA 1JHKH 4G6AC 1SMOA 2VMDA 3FYEB 4LCUB 4LKCB 1DVXA 4XVJL 4Y16B 5D72L 5T1MB 4HFUH 2J2ZA 4JZJA 1M7IB 4F9PC 1UHVA 4MCYA 5D5ME 2OMXB 4YL9A 1N0XH 3EJSA 5TDOA 4JGNA 3EJPA 3K6FA 2PO6A 1K4DA 4GRLC 5KYYB 3U6RB 2NNCA 3BLBA 1HHKB 5FR3A 2VLRB 3QYNA 2X4UB 1R33A 3EYSL 4Z77B 5EPMA 2OMNA 1OGSA 4XTRD 4F7CA 1YPZB 1JAEA 2FNBA 1NFIB 1XZ0A 5DQDH 2VDRH 4WV1B 3VI3F 3ZKMD 1YN6B 4F27A 4GKOA 5GZOC 5KSAA 5MI0B 3C5SA 5I1KL 1DN0B 5DD6B 3OR6B 3HAEB 4Y4KB 4XNMA 2VLKD 4IQHA 4N0FA 3RG1C 1HAUA 5C0AD 2PYEB 1EERB 1KTCA 5HGAB 3MRRA 5FW6A 3WNJA 4IU3A 5DDHA 4Q4IA 1K5NA 2QKIC 4YHML 2Z1PA 3ZK0A 4UOJA 4Z7VE 2E46A 3P30L 3ZIYA 1A3LH 1E5CA 3CFBA 4OCRL 1KXVC 4GYBA 2XZCH 1HINL 4CNIB 1FV1B 4YN3A 5EEVA 1EXHA 3WHE1 3ZE2B 3QO1B 1WBYA 3DARA 4EI5A 4H40A 1PTZA 4XTRC 3MV9D 5CD5D 1DCLA 4TNEA 5IJBC 1DJSA 2DQDH 5L0QB 3VFNB 3ZKMC 3GHPA 3V0VB 1WAAA 2ZXBA 5E94B 2ZOTA 4OJDH 1FLRH 4O02H 3O3BA 1G1OA 1G0DA 2P24A 3BWUC 1DEDA 2PW2A 4ODHH 2Q7YA 1EHLL 1ZDQA 3DHMA 2MCPL 4CW1A 3WY4A 2K78A 3T9WA 1MLCA 1W72L 4YPJA 1I9RL 1THCA 1U21A 2ZOUA 3FOMA 5HGBB 1CU4L 3VW3L 5C70A 3VGHA 1OGAB 5I8EB 1AQKL 3B83A 3KVPA 4QRUA 4MJHA 4NENA 3HNSL 3F62A 1FORL 5T33H 2XG5A 5F1IA 2R15A 4PGJA 4HGKC 1MAKA 3EBGA 1HNFA 2R69H 3QJOA 2WN2A 3Q8EA 1JZ7A 4FG2A 5JA8B 1E50A 3FO1B 1JGIA 1UM6H 3IU3A 1JZHA 1WWBX 4LSVH 1TEGA 4LLQA 5FO8B 2YMXH 1S7RA 4G7SB 4RNRB 1K3IA 2VT0A 1J1OL 5HI5C 5JPNB 3E0GA 4EOWH 5CHNB 5CD5C 1YEFL 3OLDA 3LQZB 4EIGB 1BZ7A 1JWUA 4RESB 2YMOA 3C12A 2FWOA 1FGNL 3U1SH 1NKGA 3DGGA 5C09E 2P5WA 4NYLA 2MCMA 4F58L 2MSPA 3KLKA 5K39B 3CN0A 3HZKA 3WE1A 1SVCP 2YA0A 4YSCA 1D7BA 1EGJA 4M1CD 1GOFA 2CKBL 2GIMA 2N1KA 3GO1L 3H56A 4K7PH 4YSAA 2LFGA 1HZLA 1A2YB 5AZUA 3RAJH 1A1MB 5IQNA 3OAZH 2OJZH 1E4HA 25C8L 4D0DB 1XB3A 2DBLL 2NX5A 2DMBA 4I13B 3TZVD 3BUPA 3MLYL 3L7EA 3CNKA 3ZDYE 4MNGA 4PM1A 5A1AA 1KDJA 3DYMA 2IIJA 4K94H 1F4WH 4Z3EA 3KJ6L 2YHGA 3NDZE 5C08D 1N6VA 4MJ6A 4D0CA 4P2RD 2IH9A 1RZGA 3BEWB 1OGTB 1YYCA 5ACZA 4LSRH 4LVHB 3GRWA 1KPRB 3MCKA 4J4PA 1NJ9A 3BESR 2XRAL 1MCOL 4RFEA 3VFTA 2F7RA 3RTQA 5JOPE 1YECH 2F7QA 1MCNA 5I30L 4M1DL 4U1GC 2UXTA 5IROD 1SLUA 2VCOA 2RIKA 4I0PB 4MAYB 4JFYB 1ES0A 1UZ6E 5ITBL 1WF5A 1V7NH 4M1CC 1SMAA 4FNUA 5DJ6B 1RP9A 3PRZA 4KY2A 3LPOA 5J9PB 5AWNH 1JZ3A 3TOPA 1FZJA 3RWEB 1BA9A 3V4UH 3GUTB 2P5WE 1FCGA 4J28A 4X4ME 4JDVB 3TZVC 2MTPA 4IBWA 1USZA 2TRHA 4HK3N 2C3VB 5DJZB 3ESOA 4PY7A 3DKHA 1QRKA 2H3KA 3JWNC 4PRDA 4DKAA 1W72B 2I5YH 3QC5X 4EXPX 2AJUL 5DMKA 1T83C 4LQ1A 3RZWA 3U36A 4E42A 4HDIA 2BW5A 1MW3A 2VXSH 5FO2A 4YR6B 4PJIB 1QWNA 3BSHA 5E23A 1UWGL 1IQWH 4XN9A 1U3YA 1E7VA 3GBNL 2X4TA 4K71C 4NHCH 1MRFL 4HF5L 4EN3A 1QHQA 2NX5E 4UQBA 1OQXA 5I6NA 2ZNXA 5AZ2H 2IWFA 2Y06H 4JHVA 3DVNA 4NUMA 5AZEH 1AGCB 5IROC 2I27N 1IIKA 1QO3A 4KVNL 5IK3A 3X3FL 1JN6B 4MMYB 3ABZA 1YPZF 1MI5A 4FFZH 4HIHB 5F9OL 4FD0A 1U8IB 4QTHA 4ZUSB 1CLYH 3ZL4H 2MCG1 4LSUH 1RK0B 5AW5B 3UMNA 5F88B 4ZUWA 1BQKA 4HMEA 5HHXL 3T8XA 2X88A 1LILA 4OFQA 3BO8A 5T1KD 3OG6B 5E9DB 4JFFA 3MV8B 4NQXB 1TZHB 1EEZA 1L7IL 3VRJA 4ELKA 4OFKA 2W88A 4JDZB 2FO4B 3HS9A 2J3SA 3QDAA 1FNSL 3GMLA 1HQRB 1PZBA 1ZY9A 4FI7A 4WTQA 4U33A 5CN3A 4ZQKB 5DHYB 2XKUA 2LTQB 1G1YA 2IADA 2WXLA 4MAZA 2PETA 1F58H 4HXBL 3VGBA 5DRXB 4DQOL 3IU4L 4G71B 3FCGA 3SE9H 2Q2EB 4C4BA 1DDHB 2VN5A 2X1OA 3FYIB 3GSWA 3KW7A 3C6LD 3INOA 4KU1A 4GO6B 3ZKSD 2LE9A 3I6LE 2PKDA 4X7EC 3R4DA 3AXLA 4HEPG 5F7MC 4UILL 4R4FL 5CMAB 5J12B 3WJLA 5DHVH 5CSBA 4EUPH 3SQBA 3PAUA 2P8PB 5E6RB 1QBLH 2X87A 3QB7C 2MHAA 4UIMA 4AH2A 4DN4L 4M03A 4N68A 4ADIA 2YS4A 1AYRA 1LO5A 3FB8A 4AEIH 4C83A 3MODL 2VR4A 5IMOB 1LDSA 3P11L 3QI9A 1MNUL 3ZE1F 1B4JH 1NPJA 1I1YA 4WRLA 4XWGH 5KUKA 2VRAA 2Y7MA 1O5PA 2C3GA 3D2UB 4L8CB 5IEHA 4EI6B 2X4SB 3GS7A 2VC2L 4ILDA 1CDYA 4YHKL 4FKEA 3FRPG 1TJIH 2DMHA 3MJ9L 2EEBA 1GY1A 2BRQA 3QJHA 2LLGA 5DD3H 5B39G 2DKUA 5LDSA 2Y1AA 2BNUB 2WTRB 2IH8A 3WKYA 2ADGB 1JJUA 2IEPA 3V6OE 3MV9B 5CGTA 3B2MA 3VFGH 3IDUA 1QSVA 1YLBB 2AI0L 3LKRB 5DZVA 4FZEL 2JCCF 4W4OA 3OJDA 1EJOH 2E75C 3WO3B 4FLOA 2FE0A 4B97A 1TETL 1QKZH 3EYVB 4OZGA 5GGTL 1Q9WB 5IF0A 3F84A 2X0WA 1JRHI 3VRLE 2WMPB 4XBPB 3SB3A 5FO9B 1U3HC 3WLBA 3JWDH 1UM4L 2D31B 3UZVB 3V7MA 2RQ8A 3UBGA 3K6SA 1A6VL 1QRNE 4U7KA 5GS1B 3S3BB 1T0NB 4L3AA 4J6RL 1PAZA 3WD5H 4HIEB 1RUKH 4NNXA 3T2QA 3ZZ1A 5FUZH 1IKOP 3IFNH 4J3SA 1KB5H 2SODB 4AK2A 4PVNA 1ZVSA 2Y22A 1R3LA 2WLYA 4JM2D 3BPNB 2JNZA 4G6FD 4QAMB 5I28A 2J1YA 3KPNA 4B96A 4KY1L 3WFCH 3KG5A 4V2CB 3X14B 1T2QH 3ARFD 2PPAA 1FFOA 4H8QA 1EIBA 2X2IA 5EIVA 3K46A 5IQ7L 4FCHA 3MV7B 3D39B 4QXTA 4IRJB 3CIAA 2MOVA 3W39A 3BKCH 4P5KB 3UDWA 4ZTOL 4BXVA 2IJ0C 1CL7H 4YMPA 2R1XB 1JYVA 1MCWM 1DFBL 2NR6A 2W07B 4Y5YA 3DURB 1AXIB 3SGJA 1JI1A 1M42A 3HLAB 3DOIA 2D7OA 3I75A 4H2CA 2N56A 3S37X 4PV9A 4RMSA 2O26U 4QAWA 4Q9QL 3CC1A 3NCXA 3SDDC 1FRGH 4OZGE 1PSKL 1XGYH 1N3NA 3O2DL 3S0PA 3BD4A 4M5SA 4N28A 3PXLA 3SEPA 4Y19D 4QRAA 2YEZA 1P1ZA 5EC2B 3MGTA 2ZWSA 5GGSY 1FSKB 2O5XH 5CLXA 2EH8L 5KYUA 3AITA 1H8SA 4AZUA 1RK7A 5DF0A 1HS6A 4JVWA 1R46A 4WEBH 2V17H 3ARFC 3RPIA 1ACCA 2WLLB 1BLNB 1DEEA 2PF6A 3QIUB 4YHZL 5HYSG 3ATDA 4PJIF 1G7IB 2CMRH 1NMAH 2HJLA 1SEQL 4EMZA 4PV8A 2I7SA 2ATPA 2VB5A 3IFLH 1JGEA 2E47A 5EC1A 3WNNA 1NOAA 1FZKB 3L5XL 2JVUA 2CGRL 5A40E 2JE8A 4ANWA 4M43H 4DGVL 5DUMH 4A37A 4TS6A 3U4AA 1A8ZA 2GTQA 2K7PA 3HMXH 5GIRB 4AQ1B 4D9LH 1LEGA 1AKPA 3H6JA 2HTKD 3K5RA 2W0PA 3ULUD 3EOBA 2FR4B 3BIKB 5TE4L 3TM6A 1VSCA 4IKJA 3RVUD 2BCKA 5BRZD 4NUPA 3G6JB 2FJHB 4NP4L 2ADJB 5CILH 3GEWB 4XMZA 1FQ9C 1JHTA 1Y07A 2VDNL 4L9DA 2Y3AA 4EVNA 4BFOA 3KWWA 2WB1A 3CZKA 5AW7B 2D4DA 3KXFD 2KERA 4RIRA 4DKFH 5DWUL 3HE7D 3X3GH 4F7TB 1FDLL 5F0LB 2YRLA 3LH8A 2R29A 1J1XL 2BIPA 1BVLB 4HSAC 4QEGA 5AKSA 3DYOA 1R5VA 3KWVA 4F7MB 1TQBC 3KJ4C 3RB7A 4LSSL 3AAZB 2G2PA 3ROOB 1HL5A 1A7OL 3MSPA 1OAZL 4XMXA 2B39A 3GSNH 3RFZA 5C0JA 1Q9LA 3O3EA 3D87B 3I6KA 2IH3A 4RMQA 3BWUF 1FNAA 4ZDHA 3TCTA 3HZMA 1BXVA 1OE1A 5FECB 5T1KB 3QNFA 5FGRA 2VO5A 2HTKC 3MRHB 1I1RA 4Y7OC 5IVXA 4FXGB 3OC8A 5F1NA 3R06A 2CM5A 3I2CH 1SF3A 1VAHA 1MZZA 1RPKA 3O9WB 3RVUC 2YPVA 5DQJB 2RFXA 3UTPE 4B7LA 3FUFA 2CLVA 4BDVB 2VIRB 3QG7L 1AD0B 4PTUA 4ZPVA 3ETSA 1MIEH 2P8LA 5DCCA 2R0ZL 3V55A 4Y9EA 1U92B 4ATWA 3RX7A 3I02B 5HYSA 3IAGC 3HE7C 3ULVD 4B7IA 4I18C 3C6LB 4IKNA 1SBBA 4WLCA 4H0GA 2GJ6D 5SWSB 1RZIB 4UM9A 1JZ5A 4ONHB 1ZV5A 5GRVK 2ATKB 1T6BX 5IMLA 1A6UL 4ZFOA 3RY5A 1MJ7H 4KV5E 2VQ1B 1SXBA 3SE8H 4OGZA 5IESH 1HWGB 1ASQA 3NT0A 3SJVB 4RQQB 2F61A 1MQKL 3FT1A 4HS8L 1UQSB 5T5FL 4NQDB 3REWA 4PGBA 3GKZA 4JRYA 5B3SB 4GBXA 1YQVL 4LBAA 1MIMH 5GGQH 2W9EH 1AXSA 3EH5B 3ABGA 3MJ8A 4XN7A 1A1NA 5D4HA 3PP4H 4KX7A 4OF7A 2LR4A 2G30A 4JFTA 1R3IL 3FB5B 4EDXB 5JHLH 2I9LA 4ZMAT 1ZLWK 3BVWA 2R0KH 4JPVH 4L18A 1UGKA 2VSCA 3HPLB 4L8SB 1TQCB 2ZP0T 2PW1B 4DN3H 1PQZB 2PWGA 3L3OA 3CBKB 3ULVC 2QZ5A 1D5MA 2L7UA 1T7XA 3QHZH 3AACA 1RJCA 2NW2A 3QCVL 3ALXA 2A9MH 5IVXE 4AY0A 6CGTA 4JGJA 2PR9A 4QO1B 3BMWA 2Y1VA 4QHUB 2BSED 4OSUL 3ULUL 4Y9CA 1CXIA 4PJ7B 2WXKA 2BP0A 1NLDL 5I0XA 1EPFA 3H4FA 1GCYA 4LRNH 5I73C 4Z5RB 3BOVA 4JVUA 3X1EA 2VDNB 1E8WA 3MOAL 3M8OH 1ZAGA 1HI6B 2Q0ZX 1IGIH 4FG0A 4H0HB 4GAFB 2X6AA 1ORQB 5CFHA 5ANMA 2XKSA 1CE1L 3BSZA 3H8NA 5EZJB 3DBXB 4B9ZA 2DQHL 1ASPA 3OKLA 3PNRB 1NAMA 4JHUA 4WUUD 3BFQG 4OM0H 5KVMC 4EXKA 3ZT7A 2RBLA 3DSNA 4M93B 4AYFA 2EEXA 4TUOB 3HRZA 3G3LA 4PD4J 4LRIC 1BBDH 3I9GH 4XZ4A 4CL7A 4OJCA 1QVOB 5HD8C 3KLLA 2JKRM 3L4ZA 4FQXD 3I84A 4JKLA 4GG6A 4G43B 1B3IA 1ZVHA 3A6BH 4P2OC 1CYXA 3OKEB 3DTUB 4JM2B 5EOCH 5BPPA 1WEJH 3KVQA 1OEZW 1N70A 1G94A 3RPBA 4G3YH 2FBOJ 5KBPA 5DC4B 2ZZUT 5DD1L 5E56A 4ZUTA 2EDTA 3SPGA 4K5PA 3SY0B 3VAEA 5JIDA 2ZSWA 1NFKA 5JXAL 1AP2A 2CRMA 2HSIA 4WU5A 3WSQL 5H4ZA 4OF0A 4P2YA 1KGYE 3RJDA 3PREA 2QPSA 3HG1D 4ADGA 5IQLA 1T03H 4GUOA 5CEYA 3HNTL 3OAYH 3LKQB 4K2UH 5AVRB 5MENA 3ULVL 4TLKA 2GB2A 3GS4A 1GIGL 3TJEH 5I71B 2V2WB 5TDNA 1S4IA 3FQNB 3OXRB 3S4SG 5CU9A 1Q9KA 2Q8AL 2IPKA 1U93A 4G7YL 3VB9A 5D7LB 1XR8B 1PCXA 5I19L 3EKCA 3DO7A 2IH1A 3TBVB 4HWEL 3D3VB 4Y19B 5AG9A 3T8VA 1HZHL 1E4XL 4M7LH 3HZVB 1YNTB 1JUFA 1MW2A 1J1PH 3CQQA 3LKSA 3U0TB 4BZ1L 2EXWD 1J0KA 4DKEH 5DRZA 2F1BA 2AEQH 4AIZA 5FOBB 3BH4A 2E4TA 2FX7H 1P4BL 4HWZB 5C0ND 3VQ2C 4D8PA 3CSBA 4CU7A 4BGDA 1F42A 2WVVB 1D5XB 3FFDA 4UV4H 3V0WL 2HX8A 2DQGH 3GSQB 3HJEA 1SDAB 4PP2B 1KN4H 1NIEA 2WGNB 3PDOB 3QG6B 4I5BA 3QHFH 1PEWA 4G82A 4R0LA 3JVGA 5D5MB 1K72A 2B5IC 1M53A 4PWIA 1H8OA 4OD1H 4KZDL 4PS4L 2K4AA 4M7LT 1DBBH 4IOSD 4WW1B 1KGWA 4XOBA 1BM3H 2VR9A 4TUUA 4NKDA 4KXAA 3WU1A 3SBWC 5BV7H 2OTUB 4AITA 3IJ9A 4NKQB 5J6GB 2ZUXA 4JMNA 3ABKB 2YN3A 2V2TA 5BXFB 5CU5A 1P5VA 4IRZL 5BRZB 4OTXH 5CS7A 1KYOJ 3MROB 4NB7A 2O6DA 2XG4B 3WIIH 4LASH 4Q14A 4IKKA 4C8XA 1INEH 4LNRB 2BP5M 1L0PA 4TNWF 4XMKH 4MAUL 2Y5TB 2EXWC 3L5HA 3QRLA 4YBQD 3GTTA 2CJTA 2DS4A 4MNQD 2D2CC 3W2DH 2P44B 1L6XA 4MVBD 5KAQF 3ECBA 3O41B 1ZMYA 5GGRB 3OG4B 4E9WA 2MNUA 3X1FA 1MFAL 3SBQA 3VFPB 4RA0C 4FLRA 4JJOA 4YIQA 3KHQA 4CVUA 3SKNB 3VD0A 4YSEA 1AG0A 2A1WH 4G9FD 3FUKA 4R26H 4YBHA 5DHDA 3ZT6A 3ZDZE 4Z7VB 1EVTC 4N3TA 3IFOB 2RAMA 2D9CA 3D4CA 4MZIA 3VE0B 3IDNB 3UYPB 3HRPA 1P7KB 1AGBB 4M8UA 4JCMA 4TXVB 3UO1H 4XI5D 1T1YA 3ELAT 3UG4A 1N8ZA 4KHTL 2FX9H 2Y72A 4GKSB 2FYYA 5LGJA 3IDYC 4MJ5A 4ODVL 1A14H 3EDKA 3SPVA 1CUOA 4OFVA 5EIQA 12E8H 2EADA 4JX0A 4OZ4B 3EGDA 1CTMA 3B2VL 4C56D 2WP3O 4XPBL 2HCZX 5HDQL 1R0AL 4YBQC 4KGJA 3ZN6A 1AS7A 4WO0A 4NN7B 2J5WA 1RHHA 1KLUA 2D0GA 3CFKB 3BD5A 4FQ2H 3QEQD 1T1ZB 1DL7H 1KG0B 4JCLA 4FLHA 3LEXB 3MV11 4FABL 2E59A 2ZUSA 3BP6A 1LMKA 3ARDB 2UWEF 5A16B 1GC1L 3RNKA 4H20L 2ZSVA 5IW6A 3A5VA 1K4CB 3BUQA 3FQRB 5CF3A 1BF8A 1QSEA 2HP4A 3FC8A 1JV5B 3VXSA 4JN1L 4ANXA 3MNDA 4QF1A 5FYJD 2FIKA 1N64H 3ARGC 4P9ML 1IU1A 4JQIA 3D0VA 5TD4A 4DPCX 1NDMB 4XI5C 2BSCA 2WUBL 5IW1B 1JRHH 4GAGH 4JDTL 4XRCB 5SWQB 3QXDB 3MJWA 3PIQA 1IVLA 3JUZA 1T2XA 3CVHB 1NBCA 1UUSA 4LPVA 1F4XL 3NEXA 4F2MA 3WUWB 3G6DH 3IDMB 1BQLL 5KVFE 3EFFA 1GA2A 2IAMA 2NY0D 1I9IL 3LHPH 3U7YH 4Y5VB 5C09B 1JV2A 4UOZA 4DF9A 2Q6WB 3VD4A 4XN8A 2ZXQA 4F33A 2VSKB 4J3OC 2HG5B 5D1QA 5HVWA 3N91A 3WL9A 3AJ7A 3MNVB 5B8CB 3UL4A 4HSQA 5AYUH 3C75A 4LPYA 3LMJH 3T0VA 4LCCB 1VGEH 4GIPD 2BWDA 2Z93B 1C5DB 2E7DA 3C6SA 5IOKA 2JQMA 5E08H 2VAJA 3MA7A 3VI4A 4GSUA 1ZTXL 3J2PA 4JM2F 4IW4C 4E5XA 3FBKA 5C1MB 2GEQA 3Q8CA 3HBQA 3WTYA 2DWEA 4UNTA 3ISYA 3CH1A 3KDMB 1MWAB 3ZDYB 2GTZA 1E42A 3VGGA 4Z76B 3HB3B 1UVQA 1U8HA 3JV6B 4ZFGL 2XNAB 4NIKB 4NOBA 5KYXA 4NKOA 1JPFA 1HCVA 3FO0H 1XSJA 2CHZA 2AXHA 1T4KB 1MHEB 3NESA 2V7NA 3A4FA 3PWNA 3QDGA 2X1WL 1QSEE 2IG2H 3VXSE 2NY0C 5I15H 4FQXB 1FNEA 4GFTB 3KPSB 4ZW6A 2J5LC 3CN2A 3RDTA 43C9A 2ITCB 4K0OA 5JZ7D 3H3KA 2J21A 4X6BA 1ZJBA 1NUGA 5EO1A 2NCMA 3WFZA 3EJYD 1JWSB 3L3GA 1SQMA 4HCRL 1UA7A 4AQEA 4U49A 4A1RA 2Q86B 4O58L 2O6FA 4ELDA 4O51A 1KTLB 4BUQA 4UNIA 2P5EE 2ORBH 5L2KA 1D6EB 2OYKA 3ZPDA 1YNTF 2WZ0A 5D2NA 1JPTH 4XZUA 1RL1A 4NEHB 1AXTH 4QHLB 4RISL 3V7AG 4OZHA 4QLRA 1RP8A 1HL9A 3DPBB 3LDBC 3ZOAA 3GBML 4EBQL 3HG1B 4OFDA 5FYLL 3F5WB 1R24B 3W82A 3CC5A 3BZEB 1VADB 2PWHA 1KN2H 3CDGB 1LVEA 2C9SA 4JM0A 5HHOD 3P02A 3MRCA 5KG9B 2XQ0A 4FNPA 4YLCA 4KBPA 5GHWH 3RKDC 1OV8A 4P9HH 1I1CA 4OLYH 1WWWX 5D6DC 5KVGH 2IDCA 5D7JB 1ADWA 4AJVA 4DGYH 1U8JB 4DHLA 2FDBP 2GW5A 5JZ7C 3PHSA 1HTYA 3AXIA 5AUMA 4GUPB 5JPMB 3CMOH 3EJYC 4NUJB 5FYJL 5I76A 3ULUF 5BZDB 4XXWC 1HCZA 5C86A 1KYAA 3JVFC 3NJXA 1MH5A 4CMHB 2N59A 1DTUA 5LLIC 1WA0X 3WEOA 2J55A 4WI8A 2F8VA 1JHKL 4N0UA 2ZJSH 2GJRA 3UEZA 2E6JA 2F5AH 1MKFA 1DBJH 4XMWA 4BFJA 1U41A 2FT6A 5ES4B 4HHAA 3OGCB 3V6ZA 3MKGA 1N59B 4GRMA 4U1LA 2VN6A 4FXLA 4NQUA 4DVBB 3LS4H 2KDGA 2ICEC 4XHJD 3DXAD 2K4WA 1N0XL 3TN0D 1H0DA 1MHCB 4PJ9D 2EE0A 3AY4A 2X40A 1KOAA 2V9UA 1N7MH 1WZLA 3KH4A 3OAYK 3RA7H 1M1SA 1YJDC 5DC9B 5L2KE 2YAFA 3MLXH 3P3UA 3U30B 1KIRB 1H3PH 4CADB 2WBWB 5JIKA 1NCTA 2CNZA 8CGTA 3P9MA 1T6VN 3H6AA 3EAKA 4X7FC 5DJAB 3VGAC 3WJMB 2XWJB 3K6OA 5DQDL 2VDRL 2AXJA 4ODTH 2BSBA 1A9EA 1TENA 3IRPX 2DQMA 1OP9A 4DK6A 1WITA 1SJMA 1XXDC 2CIKA 4W9LC 4HHGA 3GSUA 1JZ4A 2GHWB 4LHUD 1NAKL 1L7TH 5IG7A 2X2HA 3BZ4A 2UX6A 3GRBA 4RDQG 3EUDA 4W81A 4UDUB 2AMUA 2YGQA 4BXSV 4ATTA 4IMLB 1A6PA 3ULVF 1OAKH 5I82A 4NT6B 5K9KA 4L05A 2J6EA 1UKQA 4FXKB 2R2HA 1A22B 2DM3A 4RGMC 4WWPA 5CAYB 4XHJC 4IJ3B 2XDHA 4I9WE 2WLJA 4RGNE 3GMPA 3TN0C 3U2SA 4PJ9C 3IMTA 2K70A 2NPLX 1A3LL 2FECL 5IR1A 2OR9H 1H5BB 2DMGA 2P4AB 2HUHA 1HXYB 3HBZA 5EF1A 1JF6A 4DP9X 5H8DA 1HDMA 2OYMA 5FA4B 1FG2B 4HKZA 3CGTA 1S7QB 4FTVD 4M9OA 5C0RH 4P04A 2ZP8A 3NSCA 4O2EB 2X0VA 2DQDL 4U6TA 1F13A 2ADIA 3OHXC 4N8PA 3QXVA 2IFFL 3EJZD 3TPUA 1FLRL 4NM8H 1YUHB 2EDEA 3I6SA 4JZNA 4O02L 1NFDF 4RSYA 4U3CA 4WWNA 3VCLB 3OMZA 5FHBH 3MRBB 4ZMQA 5ESAA 2OMVB 4A68A 2JJVA 4PRNA 2VM3A 3NIGF 1YJDL 1TEYA 4YDMA 3SGKC 1YY9D 3LEVH 3I3BA 3PP3K 3KYAA 1CBJA 4OZIF 2J1WA 3D7PA 1OB0A 4X8JA 3B1UA 5T33L 5B1KA 4N9OB 4JRXA 4TUJB 4IOFD 1LM8V 2R69L 5FA3B 4LARH 4IGBA 1ILSA 2NLJA 4WF7A 3ALWA 2UV3A 3KNBA 3TA3D 1I82A 1T4WA 4LSVL 1I1AA 2YMXL 2QJDA 3CPUA 1AQMA 1EUUA 2KMWA 4Z78B 1UWXH 1Q9OB 1X3DA 2ADYA 4PJEB 1CXKA 1AC0A 2OW7A 4QHNA 4Z0BH 4FYSA 3VWKA 1WC7B 2GTWB 1MJJA 1T0MB 1X5HA 1R3JB 4H0IA 3Q2CA 2FZ3A 3U1SL 2G75B 4NRXB 4UT6H 3T1FB 5I6OA 3QXAA 4QRRA 4HV8A 4QXVA 2DEYX 4H8WH 5K1JA 1M7DB 1YY9C 5KWYC 2BXZA 2QT6A 4ELMA 4K7PL 2DQFA 3U46B 1HHHA 4TVSa 2BH0A 2HFTA 3RAJL 4FYRA 2VDRB 4K8RC 2OJZL 4AENB 3ES6B 3ZDXB 1RZ8A 2XBZA 1CLVA 2GFBA 3SDAA 4BQCA 5AVSB 2F7OA 4PG9A 1D5IH 3TA3C 4MXWH 2BMKA 2E6PA 4P46A 4XP5H 5I17A 4DESA 4K94L 3WFHA 1I8LC 3CSYB 3S37H 5IQMA 3RWJA 5GRZA 1QSFD 2VM9A 5FM5M 1MFMA 4IEFA 2GCYA 5BZXA 1MLBA 4D9QE 2HG0A 3PYCA 2YD4A 4LSRL 5E4EB 4WWOA 2FSDA 1N5AA 1D2OA 3UPRB 3EGSA 2W80C 4L4VD 4LOUD 4U6HB 4ZFZB 3ZT5A 5HPOA 4OU3A 1YECL 2C34A 2OS7A 2XX1A 1GOHA 2YBGA 3NIDB 4NI3A 1AZZC 3GGWA 2IDQA 5BJTB 2Z0BA 1BG1A 1N2RA 1RXLA 1UA6H 2XPGA 2XTSA 1V7NL 3MLUL 4UQAA 2D3JA 1FYHB 4IK7A 4AGLA 3MLPA 4HWBH 1N0LA 5B3JF 1DSWA 2J8UF 4CJ0A 5AWNL 1JF1B 4NZTL 5EU7E 2X2UA 4O02B 1E28B 4JO1H 4GS7B 2PYFB 4TULH 1N8OE 2OTWB 1S5HB 1NOFA 1ND0B 4DKDC 5B1CA 1BZQK 4QRRE 3ME0B 2I5YL 3T0ED 3TBWB 3V79C 4YHPB 3FRPB 4M4RB 4ZW8A 2VXSL 3MLWL 2GK0B 3FUEA 5L6YL 5LXVA 2CXGA 2ROXA 2C3XA 3NJGA 4V1DA 1PPIA 3FQWB 4UQCA 3O3DA 3SO5A 3WXVH 4Z7UE 4U1JB 1IQWL 4YL4A 4NHCL 3RGHA 1IX2A 4OCSH 3AG2B 4NQEA 3JWOC 1A6AB 1MFEH 2JLLA 2WCGA 5AZEL 4U1SA 5C07D 4FQJH 3STLA 5GS2H 5HYQB 1ZLVH 3TNNB 1J9TA 4BFIB 3VNZA 3ZSSA 1QG3A 2Y0SA 3LD8C 4FFZL 2NY7L 4Y1AD 4PBWD 2A83B 3RI5K 1CLYL 3ESVF 3ZL4L 2JTDA 2UXGA 2C5DC 4LSUL 3WN5B 3GJEB 3SE3A 5DS8A 1Z2KA 5H2BB 3S3DB 3HE6C 5DSCA 5AOMA 4XMLH 3ZZQA 4NC1C 2DB8A 4K3DL 3N85H 4HK3J 4GG8A 1AHWA 1SM3L 4NRZA 6FABH 4U0RB 2BNRB 3EJTA 3L9RB 4TSBH 1W2KT 3T0EC 3MOQA 4R3SA 4ETYA 4FA7B 4BQ8A 4DUVA 3JWDC 2EDJA 4ZQTA 2C1OB 4UYPA 4ZYKA 4NFBA 4KMTH 4PJDB 1T04A 1F58L 2JKLA 3FT4B 4OUUB 3QDHA 3BSGA 3QIBD 4LLDA 3SE9L 2VZSA 2AJZB 3GSOA 4I0CC 5CCKL 3GKWL 4L9LC 4K07A 4OCXH 2NY6D 4I1NB 2Y69B 4E0RA 2NY4B 2UZXA 4BGLA 1CDBA 5I24A 1IGYA 2AK4A 4LHUB 4Y2NA 5T8IA 4W6WB 3PABA 4IBYA 3ULSA 2SEBA 4UQIM 4AEIL 3TO4A 2F0CA 4NNPH 4K55A 1WBZB 3WIHH 1FBIH 4XWGL 5GGVY 2Q3AA 4WW2A 3QNZB 3A3YB 3PWLA 4ZXBB 5IFJB 2JJSC 1TSHA 1EDHA 1JG9A 1TJIL 3KL0A 3JWOL 3MRFB 5DD3L 2CBMA 3MRQA 1LNUA 5L7XH 5I9QB 1RJLA 4M1GH 5FGBC 4Z0XB 3C5JB 1ZA6B 3P9LB 4PRBB 1P4LA 4A2DA 5MERB 1UD4A 1S7VA 4P5TD 3U48A 4A2MA 1UADC 3GIVA 5I23A 2ZUYA 2EE3A 3VFGL 5FYKE 4KRMB 4QRPE 1IAIM 3OB0H 1ZLSL 1EJOL 1N6UA 4HIPA 3H9SB 2NY6C 1IKFH 1GJWA 3OKMB 4XAKD 3OKOA 1QKZL 4PJEF 3ILPB 1KB9J 1ZCRA 2IV8A 4QHMB 3EGXB 3DUSA 5J1TC 2JQAA 3ZHNA 4HUXB 1P6FA 2CGYA 4N24A 1YSOA 2DYPB 3N3EA 3SY6A 3FOLA 1QTSA 3JWDL 1JYXA 3DTXA 5CEXA 4WI7A 1DQLH 1XCTA 4GT0A 4MMZC 1V27A 4I2XE 4GQ9H 1ACZA 5J3HD 2AJXH 2BOBA 2CO3A 3ISRA 1RUKL 5F7LB 3CFEB 4DP2X 5FUZL 3BAYA 3HC3H 3KYMA 2OMWB 5TH2A 5KJRH 1KB5L 2OI9C 1UH3A 1B2YA 5J6HB 4N2EA 1LK2B 1BF5A 3PGDB 1ID2A 2DEXX 4O2CA 1QBMH 1Z3GH 1GHFH 2XWXA 3ZDXF 4HKXA 1PU0A 2CK0H 1SYVA 1U4FA 5D2LB 4I48A 3D07A 5CJOH 5F71A 1A21A 3WFCL 2MNJB 2NUTB 5GZOA 2VLJA 2BIIA 3IMUA 2FT7A 3BQUB 1T21B 3RGVD 4AQAA 5I0WA 1TZIB 3DJZA 3NN8B 3SZKC 3IKCB 3BKCL 4B3EA 2DIJA 1C1EL 4P23C 2JXMB 2XTJD 3DLQR 2XN9D 1R3KA 3QVAA 3UP1A 4JG0H 4KKPA 2JIXA 3NIDF 1OTSD 1UXLA 4W9KC 2QKIA 2D3VA 1ODAA 2X42A 3ZTJH 2ZOLA 1SXCA 5C92A 4H1LH 1BIIA 2AQTA 4ZK8A 1KGCE 1NC2A 5DHVB 4HLEA 2OMTB 3PPSA 2M2DA 1CFSA 1QASA 3DX0A 3LH9A 2FRGP 5GSVA 1FO0A 4U3SA 3LXAA 2O5XL 2ALAA 3OR7A 2EP6A 2QQLH 4L4VB 1S7SA 4WEBL 1SY6H 2V17L 4YX2L 1LD9B 4AEFA 3P2BA 5IHWA 3RGVC 4TL4A 4Y2DA 3TLRA 4G80B 1ASOA 3QFJE 5DMJB 2CMRL 1NMAL 1AY1H 1QLEB 3BI9X 5D1XD 1AHKA 2R29H 1HSAB 3QDJA 1J0ZA 2XXFA 1CYGA 2X6UA 4Z7NE 1YDPB 4K9EH 3LTVA 3V6FA 4DAGH 5CLZA 3TIDB 5IREA 3MJ7B 3FT3A 3NA4A 1MQ8A 4NHUA 4G8EA 2LABA 4J3WA 5J4MA 1JBJA 2L7EA 4PMEA 3N42B 4YSSA 5DUML 1B90A 4E68A 4QXWA 3PF2A 4D9LL 1O5DT 5D4QA 1F11A 1O9VA 1U8MB 4XNQB 3VDBA 1MCHA 4KVCH 4P59L 2PR4H 1IEAA 3TNMA 4OVUA 4OQTA 4AGPA 1KXQE 5I75C 3T71A 4LHQB 4CSTA 3PWPD 4WWKD 1WZ1H 3MO1A 4C57C 2CLZA 1NCCL 5E4AA 3N43B 5CILL 1OZTG 5F21B 3ZRFC 1QP1A 5F6HI 5HHQB 3VFUB 1JTOA 4ZJ9A 1HCFX 3OLGA 4LCWA 3R7QA 4CVXB 4HUUA 1BQHG 4DKFL 5FF6A 3S5LA 3X3GL 5LNEA 4DGIL 3UCQA 3M17A 5C07B 4M7ZB 2GG1A 1KB5B 2YPLE 5D1XC 1QHPA 4NZRH 4PJDF 2R0WH 4CGUB 2GI7A 3L4CA 3B9DA 3ZDZB 3WTSA 4MA1B 1BFTA 4B9PA 3O45B 4AMWA 2B59A 5I6XB 4FADA 3CV5A 2CDFA 5F6IB 2FJGA 4YHIA 4BIKA 1NMBH 1E6JL 2UZYA 2FTAA 2J57A 4N5UA 1AI1H 1M9WA 3I3EA 3S9DB 3O8XD 4I7ZC 4X6CE 5JQ6H 1DUYA 2JKTM 3RWHB 5IVZB 1CT8B 2ESVD 2WKOA 3IJEA 5C0BA 2A0LC 2HLAA 3ZQ9A 3I2CL 1TFPA 1PMYA 2R2BB 4G7VH 2EIDA 3RWIA 3IPFA 3CLFH 4P4KA 5ENWB 3P77B 5EB9A 4YFDB 4TKWA 5ESQA 5LUMA 3ARBA 1OPOA 2X70A 5AB2A 3MRPB 5ID0B 4L4TB 1CFQB 4L2LA 3DTDA 3VACA 3ZGIA 2X38A 3OLEA 3QIBB 1ZHLA 3QK0A 1MELA 3NCJL 2O61B 3CXHJ 4UU9A 3KBFA 1NBVH 3B2UC 3D69B 1A1OA 4H26A 4H5SB 1F45A 4G9DA 1XQ4A 2Z31D 2EH7H 3SE8L 1IGMH 2D03H 3V0AC 5L8LB 1QA9B 2BJMH 1ESOA 3IF1B 2KPNA 1TU2B 5MHSE 2X9WA 3U0WH 2AXFB 4DTGL 1RZJH 4LCWE 3GMQA 5EUOA 2YARA 1MIML 1XH0A 5C0FB 2NUPB 3HR5A 4G8GE 4HX1A 3PP4L 5AOKA 1R19A 4PJAA 5HYJB 5DT1L 3U4EA 3L4VA 4O2FA 1OWRM 1AJ7H 1NAMH 5JHLL 1JYWA 1XSIA 2CNYA 5B21A 1NA8A 4XO3A 2R0KL 1KZYA 4UTAH 1CN4A 2NY1D 3QUYA 4ODBD 3K72A 4YSOA 4W9HC 1T83A 2VH5H 3BVDB 3M6DA 5GZND 3S4SB 1VA9A 3BKJH 3VXOA 4P5TB 5D7IE 4GMSH 1Z9NA 3F2LA 3QHZL 2NYKA 3BWZA 1E90A 4WFED 4NNYA 3DSFH 3OKKB 5E5UB 1T5XA 5SX5H 3H0TA 5D2LF 4ZS7L 4JB9H 4G1MB 2XACC 4UDTB 2BY3A 2VDOH 1MHHA 2FQDA 3S34H 4BFNA 1NDTA 4OW6A 3NGBC 3U9UA 3VU2A 5KSUB 3M8OL 2WSKA 32C2A 3QULB 1N10A 1IL1B 5I1JH 2B9AA 1WK0A 3PJSA 1IGIL 4MA3B 4P2QB 4BA0A 3ZY7A 3UMTA 3ARRA 4FEMA 4H25A 1E3FA 1WG3A 1KY7A 4PR5A 2EACA 4GEJA 2VYRE 3UC2A 3UTOA 2N1TE 4GB9A 4JFXA 3L3JA 4X9BA 1W8EA 2Q2LA 3LKPA 4YHLH 1IM9D 1BBDL 2NY1C 5DJCA 1AE6H 2OJEB 3VTMA 3ZTJG 2ZWNA 5GZNC 4MDIA 4JFEE 3GSNB 5AD0B 2GAZB 5E70A 1X6NA 3B1TA 1X5IA 4H1LG 3A6BL 2UY7B 3E9TA 4L0PB 5EUOE 4AIEA 3Q3GA 1ADQH 1WEJL 2HVKB 5IHHA 1XR9B 4G3YL 2DM7A 5FFLA 2P5EB 1TNMA 5CGBA 4X4XA 2PTUA 2WBJD 4LKXA 4R96B 3I50H 2V7HB 4F15C 2BSRB 2NSMA 2OXGA 3U79A 3MRJA 2ALWA 3PAZA 3RHWK 2ZKHH 2A9AA 3FB7A 3D06A 3ZIMA 4Z3JA 2XTJB 3H9YA 4XMPH 3CFCL 4NSKB 2TSAA 4Q6YA 5D71L 3F7VB 1T03L 1R5WB 4F3FA 5MEQB 2B1HH 2F6AA 1CICD 4F24A 4ETQB 3TTSA 4U4IA 3TJEL 3KPQB 2CPUA 3KR3L 2PP7A 3CDZA 4LEXL 1N19A 4M6ML 4M00A 3MRLA 2YMTA 3N42F 5C7ZA 4EN2A 5EF0A 2AANA 1IAMA 2CO6A 1GMIA 1UYWH 1B0GB 2QVTA 1EEUA 2B2XH 3MRNA 1HOEA 1U58A 1J1PL 1A25A 2EIEA 3VWJB 4MB4A 4DKEL 5FPIA 3IN0A 2WBJC 3QUZD 4PJFB 2FX7L 3DX6B 1OAJA 4HIJA 5CO1A 4PRHD 1A7RH 1E5UI 2KL6A 5ADOL 4FNLH 4MJ4A 4UV4L 3FTSA 2XIBA 2EC9U 3QCTH 3UTSA 2DQGL 1KN4L 3HCVB 3QHFL 4NQVA 1ZS8B 5GISL 4ZZKA 1KWKA 5L2JA 4AYEC 2ROYA 2HPOA 2QSCL 1XF5B 1X7TA 3KVDD 1U3HA 3MXVH 4X42A 5FDYA 1X5GA 3OC5A 3RL2B 1DBBL 1CICC 1BM3L 3ARWA 2V5RA 2V2XB 2IOMA 3DX7A 1FZOA 3G6AB 5KBMA 1PEZA 5HJDA 5BV7L 1CIDA 2WD0A 1EFXB 3QQ9D 3LS5H 3UH8A 1UTDA 3PWPB 4WWKB 4G5ZL 4OTXL 4QT5A 2H0JA 3U9PH 4X6EA 1N4XH 4X9FA 5F44A 5DMIH 3ZMEA 3OWEA 4ZMNA 3B56A 1INEL 4LLWB 1L9OA 3B7SA 3F04A 3WDJA 1NGYA 1EXUA 1DQQA 2VQUA 4TVPE 3TF7C 4UQ2A 3QUZC 5HHVH 5A3IC 1ODUA 5AW8B 3KL3A 1USQA 1GSMA 3SYOA 2FSEB 3B3IB 2P5PA 1MHPH 5IHZA 5JA9A 4EAEA 4M5YH 1ZA3A 4M8QA 2QSVA 2E76C 2A1WL 3DETD 4N8UA 4R26L 3WY1A 3KPLB 5K1VA 1BPLB 4MS8D 4NDMA 4RMTA 4X6FB 4JJ5B 4KKLD 3E2HB 4CRPA 1X5YA 2YWZA 3O8XB 3UO1L 4JQIH 1DANU 1JPGB 4NI6A 3GDCA 1C5CH 3BXNA 5HI3D 3SDDA 3UTSE 5I1LB 3FQ2A 3C5ZD 4S2SA 3QQ9C 1TTBA 2X44D 2F74A 2L04A 2CCLA 2EABA 3HS0C 4AKQA 1A14L 1PY0A 1FFQA 1MCWW 12E8L 4RFNC 4K9JA 3SDCB 1TKWB 3F83A 4RZCA 3NDYE 1WCBA 5AL8A 4JG1H 2QADD 1G7MB 3WKML 4YSUA 1C08A 4FQ2L 4XP6H 3QXUA 2VERA 2WKGA 3WFBH 3LPFA 4WSJA 1DL7L 1LDPH 1FVEB 1HT6A 1ET5A 3MBEA 2PO6D 3VSTA 1FAKT 3TONA 1WHOA 2Z31B 1RUAL 3A23A 1LQSR 1QLRB 2XWDA 4FEIA 3DETC 4FZ8H 2PTTA 4E9TA 1PCSA 5DVMA 2A6JB 4AQ8C 4MS8C 5C0GB 3EO1B 1N64L 5B1JA 1MF2H 4LLVB 1MRDH 2HTLC 3EF7A 1JF5A 3F8UB 3ZRCC 1K2DA 2IV9A 5KSAD 4NQCA 5EEZA 3CFMA 1JRHL 2C26A 3O3AB 4GAGL 4KJYA 5HI3C 1XF2B 4YDKH 3QO0A 1KBVA 2EDHA 3MRKA 4E9YA 1F1DA 4GP5B 5KTEH 1SBSH 2YD3A 3BWAB 2WZPA 2VL5A 2BS71 3G6DL 2HXAA 3KZ8A 1BX2A 5KOVC 3U7YL 5ID1B 2X2YA 1NEZG 2NY5C 3H7BB 4JPSA 4ACPA 3ECWA 4H8HA 1MVYA 1CTNA 3U1QA 2GIYA 4PRAB 4EZLA 3SKOA 3MR9A 4JZJC 4TQHA 3LVEA 4ECNA 4AUUA 1IGJB 2EVJA 1Q1JL 4QHKJ 5DFWH 3UX9B 3L3KB 4ES8A 3JTBA 3DRQB 4PREA 5E8PA 2HJKB 3LMJL 1TMQA 3BH9A 3TBTB 4ANUA 5BV7B 2PO6C 1VGEL 5FUOH 3CXFA 5HGHB 3KPOA 1Z5HA 2MPAL 4ONGH 1JXGA 5E08L 1LEKA 3QJTB 2WWMD 2FEJA 2W0FB 4EI5D 4JHBA 4UNUA 2OMBA 3IDJA 4MJIE 5BOJA 1LWJA 2P26A 4ZO7A 3PHQB 1Q72L 5KW9H 1FZMB 5FDWB 2DWDA 2G3MA 1MEXH 2NXZB 5I0VA 5KSAC 3LRSA 2H8PB 1DYZA 1ZE3C 3FO0L 1UXSA 3RY6A 2C9AA 1Q90A 4I3RH 4JREC 3TIEA 1OE2A 2IG2L 2AQSA 1IM9B 3U2JA 1M71B 5I15L 5GXBB 2B1AH 1I8IA 1Q94B 5KVEH 2C9VA 2ZXEB 5I0ZA 2CALA 1U2CA 5E1IA 2PCFB 1A66A 5E1AA 1PLAA 2EIKB 4MXVE 1IB5A 3OKYA 4WHYH 1CD1A 3DX3A 4BH7B 1LK3H 4RSVA 1X5ZA 4JS7A 2ZWYA 4NQCE 2EIMB 2G9HB 1ZLEA 4APQA 3L6FB 1U6AL 2G5RA 2ORBL 3PHOA 3OMNB 2WWMC 3ARSA 2APWA 3CLEH 4WFGD 1I8UA 4WI0B 1JPTL 4EI5C 2K3HA 5I66A 3VFSA 1AXTL 2AQ3A 2FH8A 4NC0B 5J1AB 5DEFB 3P1VA 5DZJA 5AKVA 3PDGA 4ZAKB 4PJFF 4ALAC 4FA6A 2Y07H 4EZKA 3QUGA 5DK3A 3HNVH 1KN2L 5FGCE 1N68A 3NCFB 3RUGA 2P5WD 1UH4A 1I7ZA 4ENZA 1DJHA 4OJEH 5LBSA 4IBLT 5I1IL 4EE2A 5ADPH 1UD6A 2VXVH 3L7FA 4OLYL 3RVTD 2BK8A 3RWFA 5KVGL 4GQQA 2Q76B 4KOBA 4Z7UB 5A6IA 2F53A 2F8XC 2LFEA 1JZDC 3EADA 3FU8A 3GB7A 4N90E 3HI1B 3QW9A 1JNLL 3M07A 4DGYL 4Y4FB 3V9FA 3KWXA 2DTSA 3K8MA 1OTTD 5E8DH 3ZE0E 5B3NA 1I7RA 3CMOL 4UINL 3SD2A 1L3NA 3O4LE 4X0KA 3L1EA 2NX5D 3HN3A 3G08B 3NZUA 1E3XA 5F93C 2C9RA 5J11C 2Z3FA 1SJHB 5DC0A 2NXYD 2ZJSL 4XPFH 2FX8H 3KCPA 1G5GA 2F5AL 1J8HB 2L4OA 1ICTA 1DBJL 3HMWL 3IXAB 2EZ0C 3CX2A 1MRCH 3UTQB 3VTTA 4J4PD 3IGAA 1PZ5A 5GS0C 2JH2A 4YHNA 1RLWA 2ZCHH 1X9RA 3GSVB 1MFDH 3Q5YA 2Q5BA 2NQ3A 1N7ML 4GKNA 4YQXH 3GMNA 2X4RA 2Z91B 3GLZA 3QQDA 1BFVL 3T2OA 3KLAA 5CEZH 4FQHA 1KCKA 3IAPA 5CZVH 3EZJB 1BBJB 3AB0C 1F4YH 2BNQE 3FCTB 5FXCH 2ZD0A 4XCEB 2HVJB 3STZB 1QR1B 3WTWA 4RFNB 2P80D 4ODTL 3L5IA 3VM7A 2EVIA 3RUGE 3D1MC 4QKXB 3QJUB 5FWRA 2YBRA 4W4NA 1TXKA 2APXA 4ALAL 5I1DB 1T80A 1Z5LB 4N2DA 1D9KB 1A3ZA 1E27A 1V3KA 2H1PL 3T4AA 4PGCA 1L7TL 3I6LD 5KS9B 2HN7A 2NXYC 4LGSB 4RZKA 1F8TH 4NN6B 3MFGB 1AGEA 1AZVA 3OQRA 1NL0H 1VDGA 2C3HA 4MQ7B 5DJYA 1OAKL 2VMFA 1GJUA 2O6CA 3RL1A 4N5EC 5CJBA 3BQVA 5HHMD 2CO7B 2Z35B 3V4VA 4MSWB 2BVQB 8FABB 1PFCA 2ZCZA 4XAWH 2BSSB 5HDRA 3RTQC 2GVYA 2OR9L 2JCWA 2AV1B 2DY2A 4BRJA 4NO5A 1IBGH 1LJMA 5ISZB 1HHIA 5E4IA 2P45B 3ESUF 4NZ8A 1BDYA 1MI5D 1QNIA 4TYUA 4ICWA 1MCIA 3C5ZB 1F97A 3PXJA 5C0RL 3DX9B 5IB3B 2YRPA 4HIIB 3KCWA 3QEHA 4QRPB 1P4IH 1TJXA 2FHFA 4NQQA 5TGBB 4YJZL 5BO0D 5E51A 3W0WE 4DJMA 4UV7L 4CC4A 4NM8L 3M7OA 1IE5A 4FP8H 2QADB 4PJHE 1R75A 4RAHA 2J2ZB 3L2MA 3EFOA 4JFFD 4XPGH 5F97E 3CG8A 5JOFA 3NSXA 1P5UB 3N0AA 1U8PB 2X9ZA 1GZHA 3LEVL 4GI6A 2B15A 1HYSD 4PP1D 1Z7JA 4I2XB 4ZOBA 4HC1H 2DQEH 4HVBA 3L3HA 3RWCA 3CVIH 4EN3C 1KJ2A 2EDBA 4JFPA 2E9WA 5FM8A 5GS2D 3TURA 2BWIA 5IFAL 4FJ6A 3N06B 4LARL 1JXJA 4X7TA 5DK2A 4L8DA 1IEHA 5FKPB 1V7MH 4ZUUB 2FLMA 5T1LB 5LG6A 1UM5L 2AQQA 2AXGA 3EFDH 3QFDA 5AOLA 3UFIA 1HE7A 1R5IA 4YUEH 1HU8A 3L5WB 2H6OA 2OX5A 3QQ3A 4MS6A 4YXKH 3MRRB 2BVPA 5T1DH 3EBHA 4NQSB 4LCYB 4OB5H 1K5NB 1Y0LA 2OSLA 2A74B 4PJGA 5ETUA 2VDQH 1EAPB 2X89A 1KJVB 2YAHA 4JQXC 3O0RH 4ODWB 5H4YA 5J06A 1OM9A 3D8MA 4FL4C 3UGUA 4ES9A 5IOPB 3IDGB 4H8WL 1E9PB 3QUXC 4F1SA 3WO4C 2K45A 1HYSC 4N9GA 3ECVA 4PP1C 1ITCA 1HHJA 4XPTL 3BD3A 4GRWH 2X28A 1XFPA 4XNAA 5CCHE 2KC0A 3QARA 1FNGA 1D5IL 2NOYA 1JGLH 3O3BB 3PJLA 1KPUA 3MKKA 3A21A 4MXWL 4XP5L 3WJLC 3G7TA 5J13B 3S37L 4RDQF 4DFHA 1FIEA 1U0QA 1WBXA 3QZPA 2H3NA 4QXUH 1E7UA 4HUVB 4NZJA 3F58H 1E9OB 3NFNA 1PDKA 4HGMA 5LO7A 1IEBB 1B6UA 5INDA 3Q6GH 4LSQL 2A6IB 3QI9C 4PJXA 4QRUB 4JFDA 5TK2A 3IDIA 2QR0A 3QFJB 3T3ME 3UBXG 1IBFA 2R2EA 2G5UA 3PY9A 2AQNA 5EZOH 3G5ZB 1LE9A 4I4WA 2L3BA 2O1AA 4HJGA 1UA6L 5AAMC 4L5FE 4JG5A 4A6YA 2Y23A 2PPEA 2O5NA 4GAYB 4LLQB 1JGDB 5C0EB 4HWBL 1OVZA 4LVNC 4L8BA 4J3VA 1CGSH 1A6ZA 2UYLA 4IMKA 2FGZA 1IZKA 5TFSH 2LVEA 2Z1KA 1XGRB 2DYSB 1BZ7B 4HAKA 2LVCA 4JO1L 3GPSA 2J7LA 2AGJH 3RZCC 5JUEH 4TULL 1FH5H 1KYUA 1M3JA 2BVOA 4E41A 1YNKH 2W95A 1G7QA 3EH4B 4JN2A 4MDJB 3GPEA 1HH6B 3D09A 2AKRA 1SXAA 5DRNA 4PJ8A 4DOHB 5CJ8A 1G7LA 2JJTA 1Y7VA 5IUCA 1WZKA 3CIQA 1WA2X 2FQFA 4LP5A 3OB8A 3VI3A 3WXVL 2NR6D 3Q2VA 1JFHA 3RNQA 4UT9A 5GQBA 4Z7WE 4OCSL 1ANUA 1XD0A 4PRPE 3SBRA 2C1PA 2YPLB 3X11A 1IAII 1TOXA 3AT9A 3EUUA 4XB7A 3VXMA 1FWXA 4JR9H 3L7EB 4G6KL 1H8NA 5ALCH 5C0CA 2VUKA 3HC2A 4AE0A 1KEGL 3BHBA 5INCA 3EYSH 3EYOA 5IIEA 3X1GA 1J10A 4OIAA 1HH9A 4AVIA 3VDAA 4JFDE 3X13B 4PUBL 3UJJH 3V8OA 2C4FU 3MCKB 4X6CB 5JW3H 1KV3A 1N12A 3Q5TA 1EMTL 1C16A 5KS9F 4X98A 4TVUA 1SJXA 1PD1A 1VACA 3N85L 1ZEAH 5EH1A 4XCYA 2ISDA 4TPRH 4ZBJA 4LPUA 4YDZA 4XC3L 1JNHB 3UDWC 4N26A 1GZQA 4BSVA 1CE6A 3D6GA 3ALPA 4KMTL 3V9EA 2XA8L 5A6LA 2NR6C 4Y5YC 1J9RA 3SGJC 4YDLB 1VKXB 3FJTA 1FHNA 3OLIA 1FZJB 4MD0A 4DZ8A 4E41E 4ZO6A 4OCXL 1X5KA 3FH5A 3MRMA 3P30H 3NSJA 4IIQA 3M1BA 3SODB 1HINH 2XIDA 4I88A 1BD2A 1I3VA 2FLRT 2FL5A 3HKZA 4U1IA 2YD2A 3U36B 4HUMB 1EBAA 3RRQA 1BREA 3VI3E 1K6QH 4E42B 2CRYA 1U8LA 2FH6A 1A9BA 4NNPL 2YD9A 3WIHL 3ULAB 1FBIL 2IALA 5HHMB 5HP5A 2BW4A 4HKJA 5DFAA 2X4TB 3LB6D 5DFVD 1YN7A 3QYCA 3DVNB 5C0CE 1E9QA 3C8HA 5L7XL 4M1GL 4CBZA 1QO3B 3MREB 1S9VB 3SO3C 1C5BL 4R2GD