3TA3D

Structure of the mouse cd1d-glc-dag-s2-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique Interplay between Sugar and Lipid in Determining the Antigenic Potency of Bacterial Antigens for NKT Cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ta3D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ta3D02
3RL2B 2BNRA 4NIKB 2BNRD 5C08D 5EO0B 2NY3B 5E6IA 1OT1A 5E03A 4J1UA 3IAPA 1CTNA 4OCRL 1FYHB 1Q1JH 2VLKA 1I9JL 3C8KB 3N9GL 2XTJD 4M6OL 4N0UB 2R2EB 3SE3A 2NTSP 1J8HA 1UJTA 2G9HA 5IESH 2XACC 4Y8DC 2VLJD 4BA8A 5EN2A 2COQA 1R3LB 2I9LB 3RVVC 5IBUB 3HC0B 4OBRA 3TJEH 2FSEA 2D7TL 3KXFB 5CBEB 3GSUB 1VERA 4HFUL 3AY4A 1DDHA 3LCYA 5FOBB 5CSZA 1HSBB 1NANH 3EYOB 4S10A 2IG2H 1KTKE 5HD8D 3REVB 5DQJB 1GJIA 4Z7UF 4FFZH 1FO0B 4MZ3A 3O6FA 5F3HB 4HS3B 3UTOA 5B3NA 5GJTH 1A7RH 4PGZA 1WWCA 4RFEA 3ORJA 1P4LB 2BVUA 5IMLB 5FO7A 3CH1A 3S98A 4YFDB 2A6DB 2YRPA 4LF3A 2EDWA 2ZWLT 4XP1H 1VA9A 2QSVA 3KPSD 3LKPB 5I8KH 3TV3L 3PP3K 4XNXL 4DKDC 1SYVB 3FHQA 4CU8A 3SE4C 4P2CG 3JWOL 3TNMB 4TUKL 1KJ2A 4WWID 1JP5A 1DBAH 3UPCA 2HFGL 4DGIH 1RULL 2J3SA 2E9WA 1F4XL 1QVOB 5HI4C 1C5BH 1HHHB 5KANG 4U1IA 3KPRB 3CK0L 3ALPA 1K85A 1BQSA 1KT2A 1UM5L 1D6EB 2J8UF 1I8MA 3VI3F 2NW2A 4NYLB 1G9MH 2W0FB 2YHGA 3FCTA 3GSVB 1HINL 4LVHC 3VXSB 4UILL 5D7SL 3WHE0 5DEZA 4P2OB 2EKJA 2DIBA 3EOAB 3MLSL 3EAKA 2RJMA 4R26H 3KLSA 4N0FA 2HRPL 1INEH 3I9GH 4WU7A 5GGRA 5E94A 3AXLA 3AS1A 2EC9U 2OQJA 3MMEA 1QQDA 3HAEG 1X9QA 4N1CA 4CVXB 4M5YH 2JB5L 2OJZH 1NCAL 3D39B 4I4WB 1KXTB 4JM4H 2I5YH 2MCPH 3C9NA 4X4ME 2R56L 3C8DA 3WD5L 5CJBA 2VLJB 4GXVH 1L7IH 4FQXC 4KXZI 5D1ZC 1AXTL 4MDJA 4Y1AA 2F54A 1INQB 3ARFB 1PEZA 1FV1A 1T1WA 4JN1H 1DCLA 1EFXB 4AIZA 2BMKA 3KS0H 2BFVH 5E6IB 1FGVH 4KKBD 2BRRL 3ZLQC 2XA8H 3ARRA 4S1QL 4U1KA 1YEIH 5CP7A 2CQVA 1A6PA 2XZQH 5IHLB 2ZSWA 4ZXBB 3KPTA 3TH2T 4U6VH 4ERSH 1CGXA 4YBQC 3QJFB 3RWIA 1NC2D 1PYWA 1GGBH 1FZJB 2P8PB 3B8SA 5DJCB 2PCPA 4PUBL 4X6CB 2GY7B 5FF6B 5ITBH 3Q5TA 4P4KB 1X5IA 4POZC 2FL5B 4XTRC 3RTQC 4GRLB 3BZ4A 3SDCB 2IWGA 4PG9A 1TMCB 3PWLB 2DJ4A 1ORQA 2P48B 4H20L 1U3HB 1DQJA 4ZOCA 3QDGA 4XP6L 1WBZA 3WE6B 4OZ4B 5HHXH 2EEBA 4MNHA 2WINA 4Z7WE 4IRZL 3KPQB 1QRNB 1AFVL 3UYRL 4CMHC 1RUPH 4LSPH 1BFVL 1MJ8L 2VQ1A 5HGHB 3EJJX 3VW3H 3ROOA 4M7ZC 3UTSA 1GL4B 2BHYA 1QRNA 3HI1A 3Q6GH 4DGYL 4JAMB 2MWCA 1U58A 5FO7B 2QHRL 1KENL 3X13A 3BN3B 4XCEB 1SBSH 4G6KH 4NKDB 3VWKA 3CSYA 3RL1B 2DF3A 4NQED 5JW4Q 3MBXH 4X6EA 4GKZB 5GRYA 5TE7L 4RIRB 1T7XA 3VH8G 5DQJA 5GRJL 6CGTA 5DTFB 4ZFGL 4LDEB 4NM4L 4U2YA 5DZNA 4PJ9B 1V3LA 3Q6FA 3BXNB 4PJ5B 3HKFA 2OR8A 3QIBC 4KI5D 4X6DE 1KB5L 3OX8B 5EU7E 4X7EC 4W4NA 2DM2A 1QPXA 4HZLA 4KK6C 1MHEB 3LEXA 3WKNA 3P73A 1F6AA 1CFBA 1NAMB 4HKJB 4MJIE 3F7RA 3QO0A 1QSVA 3F8UB 4D0DB 2I9LA 2GTZB 1R3IH 5L0QB 3BX7C 5FA4A 1NGXA 2HH0H 4FTVB 1XGRB 1DBKH 1VKXB 4LRNH 5C1MB 4AIOA 2E7HA 4B50A 2C1PB 2A73B 4GG8A 3TBYA 1NGPL 1BVLA 4KVNH 1GSMA 2VMFA 4XPBL 5HYEA 4HWEH 3IJYA 4PG2A 5JOFB 1U2HA 1VESA 4NQCA 1IGYA 3O4LE 4Q2ZA 4YHNB 5J1TC 3MCLL 1SEBB 3WV0A 2NZ9D 1JUFA 3JTSA 4S1SL 1JN6A 2QADC 4EVNA 1PX3A 3GBML 4RISH 4NKOB 2X4PA 4AT6B 4D0BB 5MERA 4ZAKD 1LEKA 4K2UH 5E1AB 2R1WB 4ELME 3VGAC 1AQDB 2IAMB 4OLUH 4CNIA 3O4LA 4NQXB 1AGEB 1PX4A 4IMKC 1L9MA 5IW1A 3VXMA 1H8NA 2O5YH 4LLUB 3MNWB 4RRPA 5C0BD 5DA0B 4Y19D 4PTTA 2ZKHL 5SWZA 5K9KB 5BRZB 3NVQA 1EV2E 4KUCD 4XC3H 3MLTB 3IAQA 5I1JH 4TVPL 4XPTL 4WUUA 3R0MA 3BKYL 3HG1B 1YEEH 3SGKA 3TN0C 1HNFA 1OM3H 2QADD 5DQDH 3QT2A 2XTJC 4PJFE 5HI5D 1FVEA 4F9PA 4NRZA 1DSFL 3S88L 4ZAKC 2R2CA 3HG1E 4BQBA 2P5WA 3MRJB 2P8MB 4MJID 1BQLH 2R8SH 4AZ8A 1MCCA 3QG6B 5J9PA 4LF3B 4RFNB 2JCCE 3TWCL 3X3GH 4YUEH 3REWA 3VFPA 3VDCA 4HS6A 4BKLB 1XGPB 3Q2CA 4WW2A 1U6AL 5IOPA 5J1AB 1QSEA 2IANA 3FB6A 3G9AB 2CKBA 1W2KT 4JM2A 3BWAA 3AS2A 1XCTA 3GM0A 2J6EL 1AQKH 3G5YB 4PJ8D 4X99B 1T3FB 1J87A 2VR5A 2GJ6B 4KDVA 5C7XH 1TPXB 5IQ7H 4DN3L 4QOKA 3DETC 3P30L 2DBLL 1G9MC 2LFGA 4YDIH 3W2DL 2AJZB 3AM8A 5SWSA 5FUOL 1S9WA 1JZ6A 2G9HB 2R69L 4BUHA 1WC7A 4PJCF 4KH2A 1UM6H 4C4KO 5GISL 2FBOJ 3C8KA 4JO4L 4KMTL 4YZFE 1X6NA 1NGYA 4HC1A 5JW5B 3PWUA 4XB8A 2VXSL 2X70A 3MJ7B 1LO3H 1FYTB 4Z8FH 5D2NC 2FGWH 1H3TA 5I15H 2P47B 3G5ZB 1XR8A 5F88B 4NPYB 1S9KC 7FABH 3O4LB 3MXVL 4MSWA 3IDJA 1NBYA 4YHKH 5F6HJ 1YYMH 2PYED 3V6FB 3EJZC 5DQ9B 4P3CH 4AT6A 1BJ1J 1NC4D 1ZXQA 1X5XA 5BZDB 5FGCE 4BZ2L 4YPGB 4HEME 3JTSB 1A6VH 3T77A 5T3XH 2VISA 4F7PB 1DQML 4AENA 4IRSA 3QIWC 5D9SB 4G7YH 1FHGA 1T0NB 5FO9A 4PJ9D 3X11A 4JCMA 3LKOB 4G6ML 4LEOB 4JFOA 2H6PA 1MVUA 1HKFA 3G04A 2AABH 3WLBB 4GFTB 2VZOA 3NCJH 1TCRA 3CPLB 3UP1A 3TJHD 5TGBB 5E2TL 2BVPA 4HZLB 5EH1A 4IRJA 3VXQB 5IVNA 4IM8A 3VXUD 5TH2B 1PFCA 4Z7QE 3BDXA 1IAOB 1U8PB 1BZ9B 2XWTA 4NDMA 4JKMA 3W5NA 1YY9D 7CGTA 2AEQH 1C7TA 5F1IA 4TTDC 4BQ6A 3L7EA 2VXTH 4X83A 2NY5H 2R1XA 4XVSH 3ARPA 1RUKL 2DKSA 3U1SL 2P43B 3W11D 4M1GH 2WP3O 1IAMA 1OF2B 1U58B 4X5XB 5KSAD 4FMFA 5ECJE 5BVPH 3IS1X 3UAJC 3IU4L 4KQ4H 1WV7T 2CLVA 4KPHL 3VFWA 2CK0L 1OGTB 4X5WB 1ETZB 3B9KC 4JY6A 3KPQA 3MV9A 1YEDA 3K80A 1YN6A 1FIGL 5T5FH 1NEZG 1WFUA 3DV4A 5C0CE 5FV2A 3SKJL 4D8PB 1F58L 1BMGA 3T2QA 3V5DA 2XWBB 1IM9A 4OUUB 4LNVA 1PAMA 5DD3H 5DJ0B 1YYML 1E0OB 1I85C 4Y19B 3KR3L 1RURL 3DPBA 5I15L 4HX1A 1FG2B 2AJSL 2GCYA 2UWEF 2LU7A 4UOJA 5TJWK 5IIEA 4W6XB 2EH7H 5BV7H 1NMCC 1CDGA 1RJYB 3OKDA 4JVPA 4QHMB 5D7IA 3VU2A 3TCLB 4XPHL 3ILQD 3RX7A 1KACB 5GISH 4EI5A 1FORL 4OD1H 3WS6A 4LCWB 3DTXA 3FKUS 3QRGL 4OJFL 2DBLH 3GJFH 5TDPB 3DI3B 5DEGB 1BBDH 3QUYB 5JTWA 3UZQA 3GSNL 4NM8L 3C9NB 4ZQKA 4N0CD 4MX7B 1TENA 1T1XA 4K8RH 4L3AA 1DUYB 1QYGH 3FT4A 1U8MA 3QNZA 1A4KB 1MOEA 3VMOA 1EH9A 4GJTB 1CICC 4FXKA 4FXKB 3IETA 5LVEA 1NLBH 1EVTC 3VJ6B 1MQKL 1QA9A 3SDAB 5DVLA 1J86A 5BRZD 3VFMA 2CLZB 1BZQK 2ZCKH 2FLRT 1CLCA 4HWZB 1TVDA 4MX7A 3ARFC 4U1MB 3SQOH 1YJDC 3TWCH 1FVCB 5LKNA 4OV5B 4QXTB 5TE6H 2A9NL 3FRPG 3KPSB 4LCWD 1MJUL 3ARDC 2R8SL 1A9EB 2X4TA 1EO8L 1ZS8A 1H0DB 1HH6A 3U6RA 1DSFH 2LTQB 1ND0A 3C6SB 4M7LH 3S88H 4IJ3B 3MBEB 4E9LA 1OSPL 5ID0A 1RIUH 1EJOL 1YEEL 3P4MB 1MCNA 3DX6B 2MQ3A 3BKYH 3A6CL 1WBYA 3U0WH 4KZDL 2BSED 2CDGB 4QLRA 4K07A 4N68A 3JV6B 4AY0A 2CUHA 2J88H 3KJ6H 4TVPH 3EOBB 2HAZA 2EYTA 2EYTB 5KVEL 1QRND 5FHBH 4M6NL 3D6GA 3JV6A 5GSVA 1CLZL 1NCCL 4I77H 3QUKA 5IM7A 3KXFD 1A7OL 4FS0A 1KJ2H 4J8RB 4YDLC 1MCOL 5HDBF 3DX6A 4OLUL 4Z77A 4ZUVB 2NY0B 4OI8A 5C09B 1I8IB 3ILQC 1ETZA 4JG0H 3HTLX 4HF5H 1GZPA 3HUJE 3GBMH 4RISL 4PJCB 2YUZA 1EZVX 1JGUH 3QPXH 5JLZB 5K9OB 1IQDA 3MLYH 1DE4A 4IHOA 1NBZB 1ONQA 4M61B 3TM6A 5EOCL 2J4WH 2A6KB 1V3KA 3ARVA 3TBTB 3V0WH 5CP3A 4ZDHB 1TCMA 1AO7B 4FQXB 3BEVB 3LS4L 3TT3L 1XIWB 1IL1A 4I18A 1QEWA 5J11B 3JWDH 4LAJH 4B0MM 1IAOA 1UEYA 3P0YL 4LCWE 3T4AB 4AK1A 4ISVB 3DETD 3FO2A 1WZLA 4OTXL 2GFBB 3CZJA 3GMNB 4HK0B 4DTGH 1FRGH 4HK3J 1RK0A 5HHME 4JGJA 1KB5H 3WLBA 4JR9L 5EBWA 4JZJA 3T1FB 1G0YR 4NM4H 3PGDB 4XCNB 2R0WL 3RWFB 5C6TL 1JGVL 1I9IH 3K7UA 4GRLD 5EC2B 1AI1L 2HTLD 5CCKH 4R8WH 3L95B 2NCMA 1AD9B 1K9TA 5CZVL 1AGCB 1MF2H 2B1HL 3WBDA 1JTPA 1JCKA 2BSRA 3P9LB 43C9A 4NJAH 1XGQA 3G6DH 4LLVB 2H3NA 4KKLD 4LKXB 4HUWB 5FGBC 5FGRA 1C16B 2HA1A 4Z7UB 4XCFL 1AD0B 4JDVB 3UTTE 5IJKC 4YDVB 3GSQA 4NN6C 3WIHA 3VW3L 4QRPB 2FECI 4YFLI 1F4AA 4KY1H 4TULH 5EC2A 4HSQA 3WO3B 4MNGA 3NFSL 1Q94A 4N9GB 1CGSH 1WZ1L 1SYSA 3WNNA 3ILPB 3VFVA 4D9RE 4NRXA 1G1YA 1PKQE 1UH3A 2YUXA 3DMMD 5ITBL 1A6ZB 2C3VB 4JFDB 4O5LL 2OI9C 1JF1A 4W6YB 4GG6A 3VXPB 1ROWA 3R1GL 4Y4FB 4ZYKB 2EE6A 4X6DA 5DEFB 3D0LB 4JRYD 3VXME 1I1YA 2NY2B 5CGTA 4GKNA 1RZ8B 4QRUA 2YWYA 1MRCH 2AXFA 3BPCA 3QFJD 1AXTH 1G7LB 3C60C 5CINH 2PN5A 4XNQA 5FYKU 2JELL 3GO1H 4UV7H 4ELMA 3MV8E 1NL0H 3LB6D 1AR1D 1Q9LB 3INUL 3QUXA 3CUPB 4M48L 4NWUH 3ROLA 1CIUA 4ZUVA 1CBVH 4OKVB 3I6KB 1TVHB 4LSUH 4A6YA 3RWJA 5HGBA 4PJBF 3DURA 4APQD 5EOCJ 3UPRA 1J12A 2FATL 4PD4J 2VXQH 3KS0J 4LEOA 2NY7L 4NZUL 5EFIA 4MNQE 3TLRA 1A2YB 2UVFA 3RWCA 4BQ9A 1Z9SA 4N8PA 2WSKA 1TQBB 3PWPA 3FT3B 1S7QB 1XF2A 3QUMH 3L3JB 4NKQB 2HJKA 3NIFE 1KTDB 3HG1A 4HHAA 4Y4FC 1KIRB 3QUYD 4PB0L 3Q5YA 4WUUB 2OTUB 3QEQE 5I0DA 4PBWD 2CIKB 2AEPL 3W0WA 1CK0L 3FO0H 3L95A 3NACL 4ZPVB 4Y7MA 2R0KH 3RRQA 3V4VL 1RULH 1YQVL 2FEEI 4OI9A 4XVJH 3WIHL 4PTTB 3SGKC 4HD9A 3H6JA 5DJXA 4JZJB 3T1FA 3STZA 4HKXB 3N1MC 1DBBL 2WUCH 4AYFA 5FUCE 4IRSD 3LRHA 2QL1A 5F96L 3HAEH 3IFLL 2F9BT 4NT6A 4Z6AT 2RCSH 4K3JL 4QTHA 2CD0A 1KTLA 2A9MH 3FFDB 5HGAB 4NKIL 5IMOB 5FA3B 1ED3A 3CFEB 4HUXA 4XCYB 1T2QH 4NUJA 4OZHA 2P5WE 2QSQA 1A3LL 3QNZB 4UDTB 3TBSA 5DRWA 2P5EE 4CU7A 4R0LA 1EHXA 2I60L 4IBLT 3C60A 5FHAL 4FNLL 3QQ4B 4QOKE 5HVHC 3UBXB 2WMPA 1PKOA 1NAKH 4QT5B 2LVEA 2ORBL 1B6UA 2KKQA 1H5BC 3O2VH 5ICZA 3BWAB 2ADFH 4JRXA 4JFDE 3E8UH 1FO0H 3ETBF 3RWEA 3BH9B 3LDBB 1CG9A 4LASH 1KLFA 3D0LA 3D18A 3TYGH 4Z77B 1JNLL 3QXDA 1JNHA 2C26A 4OCXH 4F7EA 4HCRL 4KQ3H 4HZAA 4LVNB 1DFBH 1FZOB 1MCIA 5IM7B 1K4DA 4Y2DA 5GGVL 1BFSA 2R1YA 2YC1B 4OCYL 1D9KB 4F7TA 1FVDA 1NGWB 3N85L 3H8NA 5C3LD 3UZEA 2FIKB 3D3VB 1L7TL 2XN9D 4HXAH 4DGVH 5D7JA 1RQ5A 2VDNH 4Q6IB 2OK0H 4ZD3H 4ZD3L 2OK0L 3G5XA 5IP4A 1E4JA 2ZCHH 4TNWK 2J8UB 4QRTB 5HJ3B 4MAUH 5C0AD 3KPNB 4EJ1C 3PG2A 1A4JB 4ZNEA 3UTSB 3C8HA 4GRWF 4OCYH 1GC1H 4U05A 2FJGB 1I7ZB 2MHAB 4WFHD 3V6OC 2ILLA 4LCIL 3O6FC 1R0AH 5HGDB 1N6QH 5GS0L 2DM7A 3IXAB 1U3HA 3QIWB 4YHIB 4I3RH 4EOWH 2BDNL 2XXMB 2E9BA 2W9DL 2BSRB 3IJHB 4U1JA 5J89A 4ODVH 3RKPA 1ES0A 2DDQH 4WJ5B 1NSNH 4HBQA 3EHBC 3VJ6A 3QQ3A 4ZPTA 2R9HC 3EYQC 2X5PA 4DZBA 2V2WB 4ODBD 2Z92A 2V7HA 1MCWW 4OZFH 4TOYL 3SDXB 4LU5L 3VXMD 2BVPB 3I6LE 1FG9C 4ZG1A 2BCKB 2EO9A 2Y36L 4KTYA 2E27L 4TYUA 5JOPE 5IEHA 4WY7L 5IGXH 4IS6B 2A1WL 1T03H 3SDDC 1JE6A 2P4AB 1MAJA 2A9ML 2FHFA 4P46D 5F93C 1IEAB 3MV9E 2RCSL 4OLYL 4PJ7F 3HNSL 3NCMA 1CGUA 5KSUA 2Z8VC 1A02N 1P9MA 1ZT7B 3GB7B 4YEFA 4KTDH 5IMKB 1F97A 4Z5RA 5I1AB 4S2SB 3NACH 3FO0L 1XCQB 4Y16B 4FQ1L 2DL9A 3Q6FB 4PJ5A 4PJ9A 4LLDB 4DKFL 4I1NB 3OR7A 4PGEB 1XIWD 1QFHA 4EIGB 3RKDC 1IM9B 2IFGA 3RJQB 1DL7H 3JSSA 1RUQL 4P2RB 3X14B 4PV8A 2H41A 4FHBD 5CD3A 4HUUA 5BMFH 5SX5H 4Q6IA 4JFFE 2BSTB 3L3KB 3VXUA 3WLWD 1HWHB 2XZCH 1B4RA 1HXYA 1UXSA 4BELD 4FA8A 1Z5LA 2XPGA 2OZ4H 2OZ4L 4LL9A 5F7KC 1MFCH 4CDGC 2XI9A 3OGOE 4X4ZA 4UUJB 4LSUL 5I76B 1R5IB 3RVXD 2VE6B 4F2MB 2NXZC 3ARZA 4F7EB 3BN9D 3WIFB 3INUH 4IOIB 4I8DA 3UTPE 4PY7A 1RUQH 4NC1E 4ZFZA 3VRJB 4FQIL 4OZGF 2ICEB 3RHWF 3VRLF 3SE8L 2L0DA 1CI5A 1R5WB 3KPMB 5MHSE 5ANME 4RNRA 5K9QG 1Y6KR 5IFAL 1AGFA 3BIAX 3RWIB 3QJFA 5C0AE 1DR9A 2VQUA 4FP8H 1VFOA 1ADQL 3QCUH 1OD7A 4B5EA 4WFGE 2PYEA 1ZHNB 1FV1B 3TO4D 2AEIT 3TO4A 4KK8D 1NC4A 1BFOB 1U0QA 4PLJD 4HUXB 5IJVA 4TPRL 4YHLH 5KSBB 4RZCB 2WIIA 5AG8A 4OB5L 2W38A 4QEGA 5E8OA 4APQC 5I74B 4U6XA 5A2KH 1T0PB 1QLRB 1IAIH 3LB6C 3GI8L 5F6IC 4TULL 1WICA 4LU5H 5F7FA 3ARDA 3HZMA 4EIZC 1KB9J 3MRGB 4PJCE 2F8VA 2CO6B 1DJSA 1MFEL 3ZKXC 3WIIH 4QXUL 3SKUD 3B9DA 4FQ2L 2J6EA 3WSQH 4UT9L 2DDQL 5LJYH 5C70A 1OB1B 2HLAA 3JV4A 1U8LB 4LVOC 2W0FA 2BSSB 2BDNH 1G6RB 3STBA 1MIEH 1WEJL 1T1YB 4X7TA 1AQDA 4PPTA 2GYSA 4D9LL 5D71H 1PZUB 2DJUA 5C6TH 4OM0L 1UA6H 4PJXB 3O3BA 1W0YT 3V6OA 3KPRA 1Y0LA 5A2IH 2WLYA 3QUYC 1QFOA 1QTYT 1V7NL 3VFRA 1GC1L 2E3VA 4FZ8L 3NFNB 5T33L 1KULA 2AJZA 5C2UB 4OD2A 1SEBA 4CN1A 1EO5A 4MAUL 4OTXH 4NFCA 1X5FA 4NP4L 5GRUL 2ZCHL 1ZV5A 4OBSA 2Z4QB 2LV4A 4B53A 3JWDL 4PD4K 4PTUA 3OPZL 3UYPA 3P9WB 1IGJB 1MAKA 5BO1H 2GSIA 2X4RA 4L4JA 4R2GD 1G7LA 1JI1A 1KELL 5IMMB 2GTZA 2B5IB 4H5SB 4JFFD 3QI9A 5CJQH 2J4WL 5K9JL 5EOCH 3QO0B 2NNAB 3HR5B 3VFNA 4F7CB 1ZT1A 4X98B 4X6DB 4AM0A 1YDPA 2CR3A 4WV1B 1Y6NR 3DGGB 4PGBA 2GK0A 3N06B 3VGHA 1S7RA 4PRID 3SDDA 3S97C 1KEMH 4YAQB 3GRWH 3D85B 2JB6A 3HMWL 1MHHA 1YMHB 1FO0L 3V5KA 3E8UL 3DYMA 3QUXD 4HLJA 1G6RL 1ZVSA 3TN0A 2PO6B 4GSDL 1KLGB 2VXUH 3KXFA 5CBEA 4TTGA 4CL7A 5TGBA 3DARA 2FEEL 3PDDA 1NAKL 4PB9L 3SOBL 4U7SA 2B8OT 1I7UB 2ZUTA 4M6NH 3UTTD 1Q94B 3IT8D 5T3ZL 1OAYH 3FRPA 4JFYB 3KJ6L 4PIRF 4JQXA 3PWPD 1LO5B 4Y16D 2RBLA 1A22B 4MD4A 5AUMB 2VISB 4FQQB 4E42A 1WFNA 4F7PA 4KJQD 4L8SA 1TNNA 1F4YH 1EA9C 2Q8AL 3MROB 3CLEL 2PW1A 4HCRA 4PG9B 1MCQA 4HT1H 2E7CA 4M6AA 1P2CA 3OJDB 5D1XC 2LVCA 3PQYB 4H8WH 4WV1C 4R6UA 2FX9L 1BFTA 4PRNA 5DMIH 2I9TA 4X6CA 1X3DA 5C8JB 2Z0BA 2BSSA 1U8JB 1S8DA 3ARYA 4K3GA 5ERWB 4PB0H 4JRYE 1VACA 3QHZL 2ARWA 2E8YA 1OAUL 3BKCH 2KUTA 4YR6B 2AI0L 3R06B 5E8NB 3VH8A 4WCYH 1AGBA 1ZSDB 4FG6D 4XB7A 4QRQB 4ODXA 2C1PA 3P0VH 4HBCL 2F54B 1U8NA 1QEWB 1WBXA 5D4QA 5D96C 1VFBA 2XWJB 1NGXB 4FTVA 2NY7H 4EZMA 4OLZH 5T3XE 2CSPA 1MCEA 3DIFB 2IMNA 5CGYD 2YWZA 5K93A 1NFDF 3L5IA 1BREA 5CJXA 4M61A 1N2RB 4XCCH 5A3IC 3KPPA 3MZGB 1UWEL 2OQJB 1BEYL 3GO1L 1BJ8A 1TTFA 4UV7L 5E94B 2VDQL 4LDOB 4HPOH 3ISWA 5EUKB 3JV0A 4WV1A 4J6RL 1C8PA 3SDXF 4R9HA 4F8TA 4Y5XB 1ZT1B 2AJSH 2ATPB 4NQCE 4WFFE 3NA4A 5CEYB 4J8RA 3B2UC 3DO7B 4JFEA 3PNWA 1FCGA 1ZK9A 5J4MA 1E6JH 3KPMA 3VMNA 1AHWB 2DQEH 2CRZA 3HNVH 1D9KD 5FIEA 2AW2A 2P5WB 3MRJA 2NZIA 4LIQH 1HHHA 2DQIH 4NRYB 3UTTB 1VFAA 5I71B 3EO0A 3OF6A 4RMVA 5IVZB 3WO4B 4GO6B 2HRLA 1U93B 4F2MA 2YEZA 3OB0K 1VEMA 3KVQA 1M7DB 3DRTA 1WZ1H 2DMKA 3RVXC 3BZ4B 2H32H 3NCFB 5TF1L 5I19L 4M1GL 4KY1L 4KTEH 3EDDA 1CGTA 2HFEB 1KN2L 4KAQL 4L3CB 1IGMH 4BSWB 3UEZA 1FNHA 5F89A 1VEPA 1KPRB 4F33B 3OL2A 3JUYA 2ZUVA 4P2QB 3W5MA 2NY4D 2GY5A 4QTIH 2H8PA 4LLDA 2Y5TA 1HQ4A 5JO5A 1OOAA 1NDGB 2EXWD 5FM5M 4M8QB 4LCUA 2DMCA 3MRQA 4IDJH 3VG0H 2A6JA 4F3FA 2DQGL 3EO9H 5KS9A 3WXVH 1XGYL 4CVXA 4LNRB 5D7KD 1CIDA 5E6YA 1RZJC 1KPVA 1RZ7L 3ULVH 4IIQB 2YN3A 1A1OB 3RFZC 4C59B 5JW3H 1MREH 5E8NA 3R06A 1DQMH 2EE9A 1IFHH 3P73B 1OP3K 1J0JA 3TYFB 2A74B 4U6YB 4WU5B 1JHLH 2AGJL 4NHUA 3V0WL 4CN4A 1YUHA 4C58B 1NJ9B 1KT2B 4IRSC 1RIVH 3L1OH 1B0RB 4UMGA 1IQWH 3QPXL 1HHGB 1TIUA 2OR9H 1RZIA 1S7VA 1YEJH 2IBBA 1J8HD 1CFQA 5JUEL 4ZFOL 3D0VA 3GGWB 2E6JA 3V5DB 3O2WH 3ZKND 5FYKE 1KGCD 1MJJA 2JJUA 1AP2A 1EEYB 2R4SL 2ZG2A 2VE6A 3QDJE 1U91A 4JO4H 4KMTH 5DI8B 1C08A 1MCOH 4PRPA 4M6ML 4ZODA 4KJPD 1RZGB 4OZHF 1YEKH 4Y5VC 1RVFH 4L4TA 3BYTA 3LKPA 3AU1B 3QZWB 5DUML 3W2DH 4PJAB 1LDSA 4PRPB 2EE3A 3P30H 5C0FA 3KPNA 4UB0H 1E6OH 4POUB 1KXQE 1DBJL 5JQ6H 2J88L 5GRWA 5IFJA 2X1WL 4FFVD 1ZAGA 4NO0A 3H9SA 5DGQA 4PRPE 2JIXA 1A21A 3SDCA 1EJOH 1RIUL 4MQ7A 3RUGF 3U46A 1S9VB 3KPLA 1FC1A 2V5TA 3C5SA 1IGFH 3GHBL 5IB4B 1H8SA 2Y72A 4OQTA 1CFVH 1U8PA 1LDPL 2VWEC 3TA3C 4NQVA 2XY2A 2A9NH 3BRGC 4J12A 2RFXA 1G7QA 5BQ7B 4YUEL 1U8KA 3BYYA 4HLZH 3SQOL 2V7NA 3I6GB 3AMLA 1QD0A 1ZLVH 4DFHA 3TGXA 4QHLA 1BQLL 1U8IB 4QY8A 3BH8B 1Z0MA 4R4BB 4I13B 2DS4A 1MQKH 3CFBB 3HI5H 1A9BA 4MB3A 1JPFA 2BRQA 4HKZB 4G9FE 3C6LA 3RX8A 3ELAT 5DUBB 1OM3L 3TZVD 5AZ2L 4K8RL 1NDGA 2DIJA 2XQYK 2PYFA 1IGIL 2BVYA 3AXLB 4OZFA 2ED9A 4UBDD 3S35X 5DQ9A 5HHNB 4NZTH 3UTZA 2NX5E 1QNZH 4P2QA 4Z7VE 4AQOA 1B88A 4XPHH 1YPZE 2EIEA 3RPIA 2K9UA 4P4RB 3FO1A 3FO1B 5E24E 5C0CD 1OB1A 1FYTA 2NY6C 1HQRA 5F44A 1DQTA 3U9PL 5L2KE 3GMLA 5D1ZA 3S5LA 1HILA 4LVOB 2X9XA 5E2JA 3RWGB 2V17H 4GKSB 3KR3H 3ZTNH 4JHAL 2YPLE 3UJIH 4UNVA 4OF7A 5ENWB 4KRPB 5HJ3A 4AH2B 4AEIH 4G6FB 5DD3L 4NFDA 1AO7D 1JK8A 1NGZA 4LBEA 4P2OD 5HTSA 4C4KT 4PG2C 2YRZA 4PJFF 4L9LB 1YC7A 1CDUA 4RX4D 1BM3L 3MR9A 4P5TD 1X5YA 5D6DC 1CVSC 1DBKL 5EFIB 3IDNA 5ESVB 4PJ7A 1LK3L 5KW9L 3DX7A 3PNWB 4PJDA 2Z8SA 4F58H 3BUYB 2UY6A 6FABH 1NMAL 1F4HA 5DR5L 4FG6C 4N1EA 4HH8A 1S5IL 4DOHE 2ARJB 4M62L 1MCWM 3RP1A 4L5FH 4OZGE 5C0AA 1H5BA 2VSCA 3RWDA 3WFBH 2VXTL 4JRXB 1J1OL 3DX7B 4P2OC 4PJDB 4PJXE 1JV5B 5C0IB 3PHOB 5TE7H 4QNPF 3IDNB 3AGVA 4RMRA 3DWTA 1FNGB 1YN7B 2GTWA 2FGZA 2YMXH 4WDIA 4ESKA 3H3PL 4G6KL 1DQQA 4PY7B 1MIMH 4DUWA 1KENH 2YXFA 5IEKB 5DT1H 3O11B 3MV01 2GKIA 3IDYC 3P11H 3HRPA 4JKPH 4NQEA 2DLTA 3MLZL 3MA7A 3NCJL 5D1QA 3WJLC 4JPVH 2UZIL 1PSKH 3IDXL 5GGTL 4HUMB 3ULUC 3SGJA 4JQXC 1MFDH 3I2CL 1T1ZA 3LIZL 2CIIA 4NCC1 1OCWH 5GRVL 4QWWD 3T0EE 4WEMB 1MCPL 3PL6D 3X3FL 4KHTH 1VACB 3AVEA 2HN7A 3FMGL 3X14A 1ZHKA 2PW2B 4Z7NE 4TUOA 2Q76A 1N8ZB 4O02H 4XNYL 2WBWB 3TP4A 3DECA 4KI5E 1F6FB 2PXYA 2X05A 5HDQL 4I9WE 3WL9B 1JZ4A 1NJ9A 2WP3T 3T65A 2FD6H 4EUPA 3D69A 3KPRE 4YHKL 1IGYB 5TE4L 3ULUL 4ZUWA 3FN3A 2BXZA 4H8WC 3AM8C 4WTXA 2VXSH 3QEHA 1A9BB 1I1AA 3RY6C 2IH1A 3BP6B 3ABZA 4JHBA 3LN4A 5F7DA 3TEUA 3DUHA 4N5ED 1DANU 2P8LB 1S9YB 3KWWA 2BC4A 2JB5H 2OJZL 1C12A 2DQDH 5MEPA 9CGTA 2GFBA 4XNMA 3LEYL 1PLGH 5GS2H 1RK1A 4OLWH 1Q9LA 5C7XL 3IU3A 4E41B 5DHVB 4WW1B 2HT3C 4M7KL 3QXAB 1IC5H 4I48B 1HHJB 2MKWA 2YZ1A 4XVTL 5D1XB 1INEL 4ZPTB 2BNUB 3MLSH 4BFIB 1HYRC 4JPWH 3S7GA 1DUZA 1CXIA 4WUUD 3FQRA 3BHBA 5D7SH 4UILH 1HINH 3MLPA 3PWVA 3DRQA 1UM5H 4PRBB 4YXHH 3U7YL 3M17A 3KXFE 3OXRA 1UM4H 3H9HA 1Q72L 4WVRA 3BE1H 3STLA 5B4MD 2BJMH 1P5VA 4V1DE 4YQXL 3TESA 3GSWB 4U6TA 2AXGB 1N5YH 1F4XH 3BD4A 3VXRB 4KK9C 2HFGH 5D93B 1ZGLP 4LLYB 2E6QA 4XVUC 2XKUA 1CE6A 4V1DB 3WXWH 3H2WA 3MV7D 3NIFF 3O9WD 5CS7A 4LCYA 4L9DA 1JGLL 3WS3B 2DKMA 5ITFA 2IC2A 3VD5A 2C7UA 5JORA 2YPKA 4YQXH 1F5WA 1X4ZA 5DJ6A 3WFHB 3O3BB 5I16A 1Q72H 1UM4L 5E5UB 5E7BA 1JGDB 1YZZA 2P44B 3FHAA 4HUKB 3U7YH 2Y7QB 5ETUB 2UWEE 5H35B 3L5HA 1F3JA 4EQ2A 2WWKO 1RIHL 2HTKC 4OZIA 4FFZL 3QIBD 4PJAF 4KRPD 2H32B 5HHOA 5IWLC 5ALCL 3U6RB 1P6FA 1GHFH 1PQZA 4K8RC 4H1LH 3CXHJ 3ULUD 3I75B 4K2UL 5EO9A 4M1CC 3V52H 1PLGL 2PTUA 3WUWA 5BS0E 1S9XA 3HZYA 4HXBL 4NN5C 1V8HA 2DQDL 3F6IA 1OT2A 2W9LA 3Q3GA 1I3GL 2ZCLL 3CVHL 5AWNH 4I4WA 3EUUA 4YXKH 3W0WE 5T1KD 3VFMB 1OVZA 4Z0XA 4NC2B 1TQBC 4Y89A 2MJWA 2D0HA 1Q1JL 1NGPH 1XGUA 4KVNL 3ARBC 1W0VA 3TBWA 2QR0B 1WIUA 1ZHBA 5TE4H 4F9LA 4YR6A 4MHHI 1T7ZA 3T3ME 4NOBA 2JCCA 5IHUH 1D5MB 4O4YH 2J8OA 2WUBH 4LFHG 3MV7E 1RZJL 2DAVA 2VXVH 4KC3B 4L3EE 5T5NF 1P53A 1YYLL 2FZ3B 4M5ZH 4PJ5D 2G75A 4O2EA 5TQ2H 4XNYH 1RAMA 4PRIB 5IWLA 4XBEL 5AAMA 5IHZB 2XA3A 4NKMB 4M9PA 4KHTL 2BNQA 3OKEA 3P2TA 3FAWA 3S96B 2HJKB 1GGCH 2NW3B 3PABB 4UZGA 3F7VB 1OTSC 2I07A 1SBSL 1S7QA 3I2CH 1MFDL 1LO5A 3PUCA 1CN4A 2QHRH 1PSKL 2ZG1A 3IDXH 2EIZA 5JZ7D 3MRRA 1F3DJ 4DGYH 3HI6H 2VN7A 1MAML 4WHTA 5DT1L 1IARB 2W60A 1RUPL 4LCYB 1JWSA 1AFVH 3UYRH 1FZMA 2ZOLB 1MIML 4PJHB 4HAGA 5I71C 5C3TA 3DXAB 1P5UA 1CFNB 5DHYB 4XP6H 1YN6B 2BVQB 4XAWH 4HS3A 3O3DB 4HJ0D 5I75C 4K8RD 4MAYC 4Z7WB 2KQNA 2E6PA 4HC1H 3TPUB 1CL7I 4Z7OF 1NCWH 2EH8H 4X5XA 3WFBL 5E7FA 2PKDA 1IC7L 2GAZB 3ZKMC 4C56A 1G1CA 5DO2D 5IMKA 1TQCB 1CD1B 1E4XH 2WBKA 3OKOB 4PUBH 4C83B 4GKNB 3DRQB 1UACH 5FB8A 5I2IB 3T4YA 3GB7A 3OF6D 4PRAB 1MHCA 5DR5H 1D9KC 4X8JA 1I1CA 1A3RH 1T21A 1N7ML 1OGAE 1TZIA 1YEIL 2FNBA 4F9LC 5IMMA 1G7HA 3BDYL 2VTFA 5L8LB 2HJFB 1A6ZA 4QRQA 2OTPA 3TIEA 2WM0A 3S36X 4ZUSA 2O61B 4J1UB 3PXJA 4CU6A 4K7PL 4QCIA 4YK4C 4NN7B 2DN7A 3OHXB 1QSFE 2I5YL 3MYJB 2DLFL 3IDMA 1I3GH 1S8DB 4JHAH 3GJEA 3MGOA 3S4SA 2E7LA 4M5YL 1JYXA 3BZEA 2BK8A 3U9UB 3BP6A 4Y0GA 1LD9B 4O2CB 5GJSL 3QEHB 5IFHL 5ALBL 5EBLA 2HJLA 3T08A 4EQ3A 3KLHC 1MQ8A 4UNUA 1R3KA 3BGMA 1GHFL 1RJCA 3IFOB 1UADC 4S0SD 2HRPH 4YHIA 5HDOA 3ZMRA 4D0CB 4DEPB 1EXUA 3RU8H 3V6FA 2F53D 1FFPB 3BEWA 2F5BH 3CK0H 2WWMC 4LVNC 5J3HD 5KS9F 1C5BL 3DBXB 5FEBA 2OMBA 5DVNA 1ADQA 1JNNL 4Q7DA 2OM5A 3W9EB 5D6CB 4KRNA 1BGXH 3OKYA 4DGIL 4ETQA 3ZDZE 3CSGA 2WIIB 2V5YA 5D2LB 1TJHH 4LPTA 4PREA 4OF5A 4PGCB 5IJVB 4CDHA 5DK0A 5I8KL 3HZVB 4NOFA 4HIXL 4AQ1B 4XMKH 2DQUH 3MRHA 2X4OA 4P2RD 3TO4C 2BVOB 4YXHL 4Q0XL 3VRIA 1IM9D 4TUJA 1LDPH 1KIPB 3FQNB 3S37X 2Y07L 3ECBB 4PJFB 4LKCB 3S6CA 3GHBH 3V4UL 1A6UL 5DD5H 4MCZA 4MCZB 3G5VB 5DGRA 4KKAC 4D9QE 4NQSB 2HG5A 2J2ZA 5DWUL 1FFOB 5IBLC 5KG9A 4OFPA 2YPLB 2IG2L 5IOPB 1OAXL 3VFGH 2Z9TA 1QR1A 3JTTA 4NZRL 4FQLH 3MACL 1OTTD 3BPOB 5IHBA 4M7KH 3SCMA 4OQTH 1DBJH 2OL3H 5JQ6L 3LEYH 3SGDI 3IDGB 3B9KA 1CFSA 1OHQA 3B9KD 4HWNA 4OI7A 1YEKL 2P24A 4JFDD 4MAYD 2XPGB 2Q86A 4PJ7E 2H9GA 3VGGA 4AIXA 5FO9B 4XAKD 3RY6A 4JFXB 3O2WL 4IMLB 2NY6B 2PXYC 3V7MA 5MENB 3LH2L 1LE9A 2NX5A 1CU4H 1YEJL 1OAKL 1S3KL 1J05B 4MXQD 1IQWL 2EC8A 2F54D 2O5ZL 1VADB 2AQ3A 4PJDE 3VGFA 2FZ3A 1IC4L 3GBNH 3BO8B 5GZOC 3LQMA 2OTUA 1CYGA 3CFJA 3QWRA 1NBYB 3IDJB 3GIZH 4GG6E 4LQFL 5H2BA 1LP9F 5J6GB 1XR8B 5MEQA 1FVCA 2QKIA 1I4FA 1HZHL 4O02L 3E1F1 4GMTH 4P5MB 4U6XB 1AO7E 1NC2A 1U2CA 1NGYB 3BPNB 3BQUB 3V7AG 4O2CA 3UAJD 3SDAA 3GMQA 1OCWL 2W91A 1CLYH 3GSRA 5LQBL 5EU6A 3MV8A 5KOVC 4XGZA 4YX2H 2UZIH 3OHXA 3MV8D 2VKWA 1MWAH 3NZ8A 5EIVA 1NBQA 2R39A 1MCLA 3HFML 1QFUH 5JR1H 4GBXA 1HKLL 1OGAD 1I7RA 1BQHB 2OJEB 3IJSB 2GW5A 4QXGH 4G9DA 4NQSA 1EAJA 4WFFD 4DZBB 2N7BA 2IANB 2BZDA 2H1PL 1JRHL 5JHDB 1UKQA 3IJHA 2R29H 1BPVA 4GQ9L 5DEFA 5DD0L 4X4MA 5J8OA 5LG1A 4HIEB 1CD1A 3OKOA 4WEBH 4GRMA 1T89A 3RA7L 3U30B 2Y5EA 4NNYB 5D6DA 4ZUUB 5TF1H 5I19H 2YK1L 1JWUB 1S7UA 2V9RA 5CEZD 4OZFG 4P4KC 2XN9A 1LK3H 3FOMB 3E0GA 5KW9H 5DJ0A 1F02I 4G8FB 4ZS7H 2C3HA 4HMCA 3RPKA 3OJVC 1XF4B 2VLMD 5L2JB 3MO1A 1I9RL 3HNVL 1PKQB 1TJIL 4X5WA 4ZS6D 5GS2D 1OP5H 3S5LG 3UC0L 3QFJA 3OZ9L 4M9OA 3RGVC 3AB0C 3MYZA 4N8CL 5DRXA 5HI4D 3K1DA 3QHFL 3MNWA 4XMLL 3L5WA 5E00B 5F3BB 4XWOC 1LWRA 2X4UB 4PP1D 5DC9B 4E41E 5L6YL 1R3KB 3BGMB 1CG9B 3BHBB 5MERB 4ZOAA 3NIDF 1HE7A 1DVFB 1BQUA 1H15A 4GUPA 3SE9H 1CDHA 5DJAB 4I48A 3QIBB 1PYWB 2P8PA 4RMSA 3IJSA 1DLFL 3CLFH 5DVKA 3O8XC 4YHNA 4E41A 3IU3B 1KEGL 5HYJD 2XT1B 3HA0A 2A74A 4U6YA 2D3VA 1OSZB 4HJJL 3C5JB 5SWZD 4KJWC 1MHPL 5E99L 3TVMA 3ARBA 1UZ6E 5C0EB 1IKFH 2V2XB 4XCYA 5B8CB 4JFOB 3O6ML 4U0RB 4NZDA 4ZSOE 2IF7A 1ES0B 3TBTA 4HWBL 3RVWC 3MRQB 1FNFA 2FX9H 4JFHE 5IROC 3EJYC 3OX8A 3L3GB 3MA9L 5H37G 3CFJB 4MGXA 4NHCH 4MNQD 2N7AA 4HT1L 1QFWL 3L3IB 4XXDA 3HRZB 3ARTA 5J13B 2ZUWA 5BOZG 2Q6WB 2UWEA 2Q8AH 3PDOB 4X6EB 5I18L 5C09A 1YNLH 1OARH 3DXAA 4U49A 5D5MB 1FZMB 3NZHH 5FCSH 5C9JB 1F3JB 5D5MF 3GBLA 2FX8L 3RIAF 4IRJD 1FFRA 2EKSA 2R0LH 3LMJL 3OQ3B 4PRPD 5T3ZH 1E6OL 4KJYA 1CLOH 1QLEL 3EOBA 3MJ8B 2F8XC 1SMAA 2YC1A 1RVFL 2AXJA 4Y4HD 5ITFB 1TZHB 3I84A 4YWGH 5SWSB 4NNYA 5EZOL 3W9DB 3ZT5A 2XRAL 2DWEB 3LPWA 4O58H 4QOKB 4GSDH 3GSXB 3L9RB 1CGVA 4YIQA 3RDTC 1DQQB 4L3EA 4APQA 1XR9A 1ND0B 3QUZD 1ZLWK 3QUZA 5KSAB 5FCUL 2ESVD 3PQYE 5DJCA 5SX4H 3QYCA 3O41A 4KK5C 3QPQC 4X7SH 4H0IA 3MV9D 1MFAH 1EBPA 2ATPA 3MV7A 1GRWA 5A1AA 5TDOA 4U1KB 3CFCH 1CT8B 3CFCL 1HHKB 1JHLL 1IJ9A 1YNTB 2AGJH 2FIRT 3FT2A 3MXWH 5DURD 3MV8B 2G60L 1FLRL 1GH7A 3MRBA 4Y5VA 1J8KA 2F5AH 3IETB 1VGEL 4FQCH 4O2FB 5D7LA 1A4KA 1N26A 3SEPA 4LSTL 2X89D 2QQNL 3KPPB 3BQUA 4TVPD 5FCUH 5E9DB 5FGSA 4JHWL 1PD6A 2AJUL 3GSUA 4QTHB 2OXGA 4LSQH 2JF1A 4FZ8H 1U3HD 2BC4B 2X44D 4O00A 2DQGH 3EO9L 2QQKH 3LKQB 5D96B 2C1OA 2X09A 3AMKA 2V5SA 1RZKL 4UI2A 1UA6L 3NA9L 5D71L 3ZKNC 3FRUA 5DJZA 5GS0C 2MPAL 4PJIF 1CE1L 1J18A 2XYCA 3MLTA 3QRFM 3BT2H 3FO9A 5CKGA 1FDLL 1AD0A 4JDVA 4EI6B 1A7QH 2PNDA 4QTIL 1J88A 1SY6A 1LP9E 3SKNA 5ERWA 3WFEL 2IMMA 4UT9H 1HWGB 3DX9B 4QRSA 4WUKL 5KVGL 5ETUA 3B2VH 5HHMB 1AH1A 1U95A 1YNLL 5IV2A 4NO3A 4H0HB 3UTPD 1TFHA 2A2QT 3WN5A 5KSVA 4KKCC 3JBG7 1OAQH 3ARFD 1KN2H 5EPMA 1QR4A 5F70A 4FXGA 1ACZA 3GI8H 1M4KA 1U8HA 4MAYB 1A1NB 3ESUF 5EBWB 2JTDA 4XHQA 4ODTH 1F90H 1A7NL 1Q0YH 3B6SA 1EGJH 2CLVB 4POZD 1N6UA 3OKLA 4MB4A 1XGRA 2AERT 2D7OA 3G08B 4XZUA 1PW3A 4X6BA 3E3QE 1F45A 5M94B 1BECA 1RU9H 1I1YB 4YDKL 1MHEA 5D7JC 5IFAH 1MCHA 5DF0A 4Y4FA 4J6RH 4HUVA 4RQQB 5FYKH 3CSPA 1U36A 3SCMC 4ZFFB 4KJQC 3BXNA 4Q6YA 3B8YA 3ARGA 3DMMB 1N64H 3ULUF 4PJCA 3U7AA 1PG7L 4U4BA 2AK1H 1H5BB 3RWDB 5CSZB 5T1MB 3DGGA 2JKXA 3O3DA 4XCCL 5DS8B 4BH8B 5FM8A 2GJ6E 1IEHA 2ITDB 1R3LA 5HDLA 1KLUB 4Z78B 1VFMA 5F7EH 2DD8L 4XMLH 3U4EA 4RDQG 5D70L 4N8CH 4QRPD 5DC4B 1T0NA 4PJEE 5CILH 3VD7A 4FFWD 4MNHB 4P99A 2D0FA 5DI8A 4GXUN 5C07E 5JW4N 4KK6D 4L9LA 4BZ1H 4K3EL 4OZ4A 1HSAA 3CXDH 3A6BL 5IF0B 2P1YA 3GK8L 5CZKA 5ENWA 4HW6A 1RZKC 2B4CC 1RMFL 1T04A 4YC2C 4HS8L 5EBLB 5E2UH 4GRWE 5DMIL 4FQHA 1BIIB 3MUY1 3ESVF 3HE7D 3V5HB 3IDMB 1P9MC 3ZE1E 3EYFA 3QXUA 3RA7H 2HLAB 1AR2A 1F4YL 1DZBA 3I3DA 4GQ9H 3EFFB 2VLRD 5HYQB 1JRHH 1ZEAH 2VDKL 4ODUB 5FK9B 5GRVK 25C8H 4P23B 3KPOA 4JZNA 2AVGA 2Y36H 5EZLB 1XF3A 4YGVB 4H88L 1UH2A 4QXGL 3PHQB 5L2KA 2OX5A 1IVLA 4PJBA 3SOBH 4F8QA 4F3FB 4R4NC 3E2HB 3HFMH 3SY0A 4NNXA 3C2SA 4YNYB 3MC0A 1T83C 4JM2B 3MV11 1MY5A 3KYMA 4KJWD 4Z7WA 1B2WL 2W9DH 4YC2B 5ICXB 3O6FD 4OGYH 4BK5A 4EUPG 4EOWL 3MNZB 3NIGE 4P0DA 3SKOB 2HTKD 4NSKA 5EWIL 2QSCL 3LVEA 2VKXA 3NGBC 4NQVB 1OAZL 3FCTB 3U36A 4A2MA 1I8MB 1G7MB 1RZFL 4CW1B 1KELH 3H7LA 2HFTA 4PV9A 3QDMA 2DIAA 4R7NB 2VITB 2NMSA 3QDMD 5HPOA 4Y16C 2CK2A 1QVOA 2O5ZH 3D25A 1UZ8B 5GPRA 1G7IB 3WLWC 4FQXD 1OAKH 5LCVL 3ULVD 3N1PC 2A38A 3LH2H 4JRYA 1JK8B 5GRUH 1JL8A 4HXAL 4NP4H 3EO0B 5CJXC 3F58L 3F65A 2XG4A 1IEBA 3N85H 3MV9B 4Y5YC 1ULVA 4PJIE 1HXYB 3IS0X 5AZEH 3U48A 4OM0H 4JFEB 1DEEA 2VLME 5JHDE 2NY3C 1UFUA 5AD0A 5I1KH 2OXHA 1JFQL 3SO3C 4XI5D 2DL2A 3Q48A 5DZLA 2VC2H 3TBVB 2ADJB 1L6ZA 4OQTL 2BX5A 1DUZB 1CFQB 1MFBL 3MACH 3U30C 2IBZX 4U7KA 5HHOD 4NZRH 5K33A 1EFXD 4J3SA 3RVTD 3A67L 3WIIL 4LLWA 5E08H 2JJTA 2FJFB 3B5GA 4CUCA 3VD9A 2XOTA 5FYLD 2O5XH 3QJHB 1NMCB 4IRJB 5FHAH 3VXQA 4MJ4A 2Y07H 5T1KB 4RBPH 2DWDA 3FN0H 2NX5D 1J0YA 3HZYB 3QUYA 5DUPL 1SJHB 5CP3H 3V8CA 1XF3B 4YGVA 5EZLA 3UJJH 4XMKL 2ICCA 2AV1A 4HK3N 5EZJB 5EZJA 4TPRH 1UJ3A 2NLJB 2IPTL 3HE7C 5I17B 1CFTA 3C87A 2B0SH 4BM7A 3B3IA 5T3ZE 2WUCL 1W72H 2UUDK 3LKNB 1KYOJ 5JIKA 4YHYB 4XBPA 1RJYA 3UJTH 1Z6JT 1L0XA 3LSOA 3VXTA 1YEGH 4M8QA 4CADA 2V2WA 3ULVF 4FFVC 4YPGA 3LQAC 1BIIA 5DD1H 3I50L 1H9VA 3IFNH 4S11A 5DJ2B 4YHZH 5ILTH 3HC3H 3QUML 3W39B 3G5ZA 5F88A 2H26A 1KN4H 3UBXG 4WI6A 3HAEB 1IBGL 4DCQB 2UV3A 4MA7H 4M43H 5DRXB 1H3GA 3PHSA 3GIVB 3BP4B 2V9QA 2UYLA 1P4BL 1MCKA 2EZ0D 5ALBH 5KTEL 5MP6L 2B1AL 4OIIL 4PYGA 3RDTA 1IEBB 1DVFD 4YHPB 3MO1B 3IDYB 3VWJC 2D7QA 4CJ1A 2B5IC 4G43A 5T1DL 3HC4H 1U93A 3MRKB 3DYOA 1SY6L 2VZ3A 3CMOL 5JNYB 3UTTA 4XPFH 4U1NA 1ZANH 3C2AH 1NFDE 4Y4HB 2JELH 3HB3C 1LP9B 2FL5A 3PIQA 4GRLC 5EU3B 1HI6B 1JV5A 2IFFL 4PJIB 4ENED 3ARXA 1WK0A 1HHJA 4BZYA 3MJ9A 2CDEB 4DKFH 3BDYH 4WW1A 1A3RL 3OR6B 4X6CE 3T2OA 4Y5XA 2CKBL 1C12B 1I3VA 1BD2E 4NQUA 4CAGA 4QRRE 3VI4F 1CQYA 4U3HA 3E6HA 4IEFB 4O5LH 4Y19E 1T22A 4NNPL 2NYYC 5EU7C 4M7ZB 4WW2C 4C57C 2H6PB 4KDWA 1P7KB 5EBGA 4Y2OA 1SJXA 4ZXBC 5HGGS 1I3RB 1T03L 2P8MA 5IQ9A 5BV7B 4NRZB 2HT4C 4FTVE 4JFZH 3VFSA 2UY7A 1U92A 1SJEB 3NFSH 1K2DB 1W8OA 1WJ3A 2VQTA 5F21B 1D6VH 2FJFA 1VFBB 4BJLA 4LMQI 5BS0A 4GAYA 5GGSB 3VFRB 1QHPA 4UOW1 5J6HA 4ODXB 3UO1H 4XCFH 1TVBB 3QG7H 3ARSA 4U0RC 1BZ7B 5D7KE 1FNEB 5E5MB 3G6DL 2KQMA 4NJAL 3DX9A 4L8DA 4QRSB 5HYSG 4MA3B 1GGCL 4OCWH 5E5MA 4Z0BH 2DQCH 5DDHB 5CCKL 4Y5XC 3UTZB 1QACA 5CUSL 1T1ZB 3K3QA 1TVBA 4BUGA 4LCIH 3PQYA 4WI9A 4IOFC 4XPGH 4D0BA 1K3IA 3CDGA 1XH3A 4JR9H 5I1DB 4KMLB 4EVNB 3MRNB 2Q7NA 1DN0B 4OIAA 2F19H 4HJ0C 1MI5B 1LE9B 5IG7A 1CL7H 4FQQA 2NXYD 2GIYA 1RZJH 1AJ7H 4L4VA 3O4OB 2EE2A 4X6FB 3WFDH 3P77A 1XF2B 3S4SG 4X99A 2YD1A 3GMMA 5CJ5A 2X4SB 4NWTH 5D93C 1FFNB 5DJYA 1A64A 4DGVL 4LP4A 5IUSA 3TT3H 1A6WL 2B7DT 2J8UE 4MJ6A 3UPRB 1K5NA 1X6LA 3F7QA 2P46B 1ZVHA 3QH3A 4CMHB 5IVXE 5CEYA 3E6HB 1XEDA 4L4VE 1UVQB 3FT2B 1YNTA 5FDWB 4YH6A 2NXYB 4BH8A 3CDCA 4XX1E 1LEIA 5TDOB 4RRPG 4R4FH 4WHYG 1Q0XL 4LLQB 3FN9A 4KKNA 1NKRA 2ZCLH 3CVHH 3RKDD 3TYGL 1QSED 2HLFD 1KCKA 5ADOL 4ELMB 3BUYA 2NYYD 3UTQB 1NKOA 1YMHA 4HXBH 4BQ8A 4RNRB 2VRAA 1K5NB 4YAQA 4Q9RL 4J3OC 5DJYB 1TQCC 3MGTB 3U46B 1E4KC 3FFCE 3FZUD 4Y4HA 5JMRA 1YDPB 5ALCH 3ZHDA 4PJ9C 1FVEB 3GHEL 2QADB 4LOUD 4QOKD 5I1HH 1H3UA 1RD6A 1LO2H 3HC0A 3DVIA 4D94A 4KUCF 4FNLH 4ZOBA 2I60H 4L3ED 2ED8A 1RV6X 4P23A 4K3DL 3VA6A 1MH5B 3HI1B 1Z9MA 4M4PA 1OPGH 2C3VA 4JFDA 4ODUA 4WHDA 3OWEA 4L4TB 3B5TA 1Q9KB 3VH8B 3A6CH 3JZ7A 3RVVD 1UWXH 4NKIH 3VFTA 2P5EB 2XV6B 3QDGB 1KUMA 3MLVH 2FR4B 1FN4B 4M7LL 3O3AB 4LPYA 3PDOA 5J7CC 5F7WC 4ODHH 3OR7B 5TE6L 3V4VH 1N5YL 4ZO8A 1MJ7L 1GAFL 3CGTA 3TT1L 1RHHA 1YNKH 2QQLL 3RNQB 1K2DA 1ZOXA 4JN2B 1ACYL 3HZKB 2A6IB 1HOCA 4HKZA 1I1AD 1A7PL 2EDDA 4GG8B 4I3SL 4FMKA 3CFKB 4WHCA 4PJGE 3HZMB 3O81A 1JHKL 1RI8A 2VLJA 5L2KD 1IAKA 3TFKC 1PJ9A 4NM8H 3GSNH 5ADPL 4YFLF 3F5WA 4MLSA 5CKAA 4U1SB 4PJHE 1GOGA 5BXFA 4QCIB 4OJFH 1CBVL 1N5AA 4ZUSB 4U7MA 3QAZB 3KLAA 4NWUL 4M48H 1K6QH 1KCLA 4LPWA 1K6QL 1KIQB 1GGIL 1HQ4B 1NL0L 5JO5B 4GUPB 4P3WA 3SDDB 4WU7B 4IIQC 5E5RB 4OIBA 3BZFB 1HHKA 1KV3A 4IOSD 3M8OH 4ZDHA 5ADPH 3BVNB 2JIXB 3T0EA 5H94A 3O45B 4PGDA 4ACPA 4P2YA 1ZT4A 3H9SB 3HR5A 4K9EL 4EI5C 4QF1B 4U1LB 3GSOB 4MS8C 5FB8B 5I9QC 1Z3GL 4F15B 5HSFA 1XT5A 4RX4A 1Y18B 2Z31A 1TNMA 4I3SH 4OCSH 2GQHA 3CXHK 4GT7A 4DUXA 4BH7A 2X1PA 3NGBB 3BP4A 4Z95L 2E8ZA 4QWWC 2Y06L 5B38B 1J7VR 4IOIA 4I9WD 4RGNE 3ES6A 1XGTA 1J10A 5T5FL 3O9WA 4PR5B 3S36L 1CICD 1DQJB 3V0VB 2AV7B 3V95A 1CICA 3BP7A 3FMGH 2CLRA 1ORQB 4JFHD 4NRYA 2BY3A 3X3FH 3MREB 4ODHL 1CF8H 4Y1AE 1RZIB 4KKAD 3QEUB 5I1LA 5IV2B 2C3WA 2EYRA 2AK4A 3MLVL 3VG9C 2F74B 3M45A 2NY5L 5C9JA 2YOCA 2EDLA 3S96A 5DJ8A 1T20B 4HIIB 4NQCD 5D5MA 4K7PY 4PJAE 1JHTA 3MNZA 1F2QA 4WI7A 3TA3A 1OPGL 1H0DA 2OR7A 1OTUC 4Y2DC 5DZOA 3TA3D 3L3IA 4YLQT 3TNNB 2R4RH 5ICZB 4R8WL 1AI1H 1NAML 4Z5RB 5I1AA 1J1OH 1NEZA 3SY0B 2R0WH 3IAGC 2GUOA 4PJBB 4P2RE 5T1KA 4L5FL 4G6AD 5A2FA 3TCXA 3CCHB 4M62H 4KUZL 1DBMH 3LS5H 4DTGL 4IRJC 1G9NH 1Q9WB 3O6KH 5DRZA 4MJ5A 4F58L 3GJFA 4AL8H 3P0YH 4G7YL 5BJTB 3GKZA 5KVDH 3UX9B 4J4PC 4L29A 4QYOB 3MJ9L 1WCBA 2EEDA 4KKBC 4JZOB 1CWVA 5T3XL 3DUUA 4QO1A 2D0GA 2IQ9L 1KTRL 3VDAA 2YD3A 4R7DB 4K94L 2VH5H 1DLHB 4FXLA 3O41B 5F9JA 4FRWA 4HAFA 5BZWA 4HGKC 1J9CT 2VO5A 3NTCL 3EZ8A 1BD2B 4NWTL 5CJOH 43CAB 3UJIL 1JGUL 3MXVH 3MLWH 3TCLA 1BF8A 3VRJA 3MJ6A 4YIQB 1ZWIA 5EB9A 4JG0L 1KTDA 3EOYG 3U9PH 5FECA 4L8BB 2OLDA 1R5IA 1AIFA 1IAIM 1KJ2L 2X1XR 1A7OH 5CUSH 3SBWC 2XNAA 2R69H 3B83A 1JPST 4ORGA 2DQCL 1PY9A 3LHPH 2WANA 3VXOA 3VWJA 3GI9H 3QCTH 4JDZB 1N3NB 5FYLE 1KLUA 1Y18A 1CICB 2AP2A 1JJUA 4RFEB 4KZDH 4ETYA 4U1LA 4PR5A 3I6KA 5CD5D 1CE6B 3QG7L 1P84K 2C4FU 2R2BB 1CGYA 4WI3A 1OGTA 3I02B 2UZXB 3HLAB 4LCCB 3UO1L 3BP5A 5HXMA 3AB0B 3VFUB 3LKSA 3G5VA 4Y16A 1FL6B 1EO8H 2Z93B 2QTEA 5DMKA 4ZUUA 3T1WA 2V2TA 3T3PF 3FQNA 3GSOA 3LY6A 5HHPA 2EEAA 3VXSE 1E4WL 3H9YA 4KRMB 2DKUA 2EDQA 1J0IA 1G0XA 3D2UB 2AKRB 1I85A 2DOCA 3RWEB 2ZCKL 4RDQF 3HZVA 1FZKB 2OS7A 4U31A 3RGVD 2Z35A 5DFVC 1IGJA 1UQSB 3B6SB 5F6IB 5DQDL 2VAJA 1P69B 2VLLA 2BNQE 4HGWB 4RWHA 1IAKB 4YEEA 2CGRL 1NFDA 4XP5L 3IFPA 3WKML 3NFNA 4XP4L 1L6XA 4OKDA 4KZEL 4M7JH 1BBDL 1AXSB 4XX1G 1VDGA 4JLRA 1ZANL 3C2AL 5DUMH 4NC1C 4H1LB 3HZKA 5ISZB 4ELMF 1G6RA 3HNTH 5IF0A 3L3DA 4MQSB 4ZFOA 4ZTPL 3EDKA 5EUOE 5A43C 1P4BH 5KTEH 3FO9B 2Q1EA 3RNKA 1RURH 3JWOC 3MLWL 2GT9B 3U9UA 4C55A 2ZUSA 1IBGH 1EHNA 2PO6C 4BK4A 3BOVA 2HP4A 4PLNC 5MENA 3IKKA 5JPMA 2HN7B 1U3JA 5CD5C 3G5XB 4WWKC 5JXEC 4HWEL 1D5IH 5JXAH 3MJ7A 3BW9B 2P49B 3HMXL 2IQ9H 1PG7W 3PWPB 3O0RL 4PLOB 4J7RA 1ZVSB 1RUML 3RWCB 4URTB 5DD1L 2XXCB 5D7LB 1KFAL 4R90L 3EHBD 5E8EA 4KPHH 4AL8L 3MA7B 4I18B 4MA1C 3OG4B 2G5RA 2K3TA 4KJPC 2EECA 5LXGL 3M07A 3CAFA 5CZXC 5BV7C 4X6BB 4N8VB 3SKMA 4K94C 3FOLB 4IDJL 2IAND 2AEQL 4G9DB 3MBXL 4OCLC 3SKMB 4XNZC 1R24B 4Z7UE 5JDSA 1KIPA 1D5ZB 1E4KA 3BN9C 4QRPE 1CFNA 1NCDH 3C60B 5BW7A 3GSXA 1FIEA 3MRHB 3VGAB 5E08L 3BMWA 4GRWH 3RIFF 2AQ2A 1U8HB 4MAYA 3FQWB 4NUJB 4FXGB 4KAQH 3MJ8A 4IRZH 1KC5H 3MRRB 2OBGA 4KTEL 3I3EA 4HWUA 2VC2L 1U95B 3Q1SL 1CF8L 4G6MH 1JFQH 1WBYB 5I1KL 1JZ5A 4MA3A 3F62A 1MRFL 3TH4T 2ADGA 5E9DD 4N9GA 3C5ZB 4GOSA 1JZ2A 1BZ7A 1KXVC 3MRNA 4WO4D 5KSBE 1A6VL 4OFIA 1HCFX 4XNUH 2FX7H 4GKSA 3KYNB 3KYNA 4BZ2H 3QWOB 3NCCB 5JXEA 3ARQA 4U2ZA 4P3CL 3FQXA 1T7YA 3K0WA 5DRNA 3S3SA 5IW1B 2BRRH 2XY1A 2XIDA 2FRGP 4XBGB 3AUVA 5E6ID 3HCVB 3KYAA 4Z8FL 4RGOL 1AGCA 2QR0A 1TZGL 1LD9A 1C1EH 4O2FA 3DGCR 4H26A 2KDGA 3ZT6A 1KJMB 1BEYH 4DK3A 2JJVA 3CDFA 1GGIH 1UM6L 5EWIH 1UWEH 3K8LA 2BNRE 3T0DA 1RK0B 2LU4A 5E1HB 1WT5A 1BP3B 5IR1A 4OGAD 1TLKA 4ZQKB 4DN3H 3CUPA 4U3CA 2OCFD 2Y6SD 2CDEA 1UB5A 5DEGA 5DJAA 4K9EC 3RUGA 4HIHB 1J5OL 1R5WA 1DVFA 4R26L 1AHWC 3PIQB 1T22B 4HBCH 2Q8BH 32C2A 2IPUK 4FQJL 5DURB 4ZFZB 3MLRL 3SDYH 4I2XB 4N1HB 2OI9B 1EPFA 2H2PD 2AI0H 2BVOA 1VGKB 4RAUA 2JIXD 4H88H 5I8EB 2V2TB 2P7TA 1GGYA 1QZ1A 4HV8A 2QQLH 2VDKH 1P7QA 1ZEAL 1GAFH 3VFUA 3GNMH 4PGJA 5D2LA 1U8OB 5DJ6B 4R3SB 1I1FA 2APFA 3H3BC 4GKZA 2C3GA 2R15A 2W9EH 4LARL 4MVBC 2WQ8A 3BW9A 1RJZB 3EGSA 1Y6MR 3ILPA 2DJSA 3CFDA 4NN5B 3IXTA 2ESVE 4NO0B 3O4OC 5HYSA 4PJHA 3DV4B 4OLEA 1RJZA 3EGSB 4GBXC 4RAVB 3S8WA 1DEDA 4Q9CA 3H42L 1IILE 3WNOA 4XP1L 3VXRA 5HVWA 1E28B 2F53E 2BHUA 3HUJF 3D5OF 1RMFH 2PYEE 5FUCC 2D4DA 4NJ9H 2CDGA 1V3JA 3A6BH 1XCQA 5HHQA 2ZKHH 3DVFA 2O5YL 1EO7A 1LO2L 1EVUA 1A6AB 4KXZH 3GHEH 4XAKE 4F15C 4JANA 2VXUL 5L8JB 2ATKA 4PJEA 1UJ3B 2HFFA 2NLJA 5ANMB 1G6RH 2EDYA 3BAEH 1QG3A 5GGSY 3VMPA 2XWTB 4NDMB 4P46B 2QLVB 4H25B 3PGDA 4XCNA 4HFUH 3MZTA 3TH3T 3TVMB 1T80A 3GRWL 3OXSB 5ACLA 2IPKB 4XMPH 3H9SE 3QHTC 1MUJA 2W1NA 3GMNA 2DI8A 1A1MB 2IBZY 3QAZC 3V7AE 1PG7H 1T5XA 1MCRA 4HPYH 3AY4C 1P1ZA 1Z0NA 1T1WB 3LDBC 1I9JH 1T2JA 3N9GH 2ARJQ 3LN4B 5F7DB 5F7NC 4P46A 3UXFA 4DQOH 4Y1AB 4H26B 2EDFA 2GSGB 5DVMA 1OW0C 1IMHC 3PGCB 4LRNL 4N8VG 3SGDH 2FECL 4BSVB 1RU9L 1MHCB 3HE6A 4OGZA 4UQ2B 1UGNA 4UOW0 2OTWA 3LN5B 1LO0H 5EA0L 3IXAA 1ONQB 2LABA 4GQPH 5HGDA 2YRLA 5E8DH 3DTXB 2F19L 1I7ZA 2FJGA 4K23L 1EEQA 2ED7A 4Y4KD 2CRIA 1ITCA 1Q0YL 4R97B 4EN3B 5EU6D 4HHAB 3FB5A 4LHUD 1MIEL 1WEJH 5C0GB 3LZFL 5IIEB 1JF6A 4F37K 1KPRA 4F33A 4CVZB 4R4ND 5CBAB 3IRZA 2BERA 3QO1A 2EYRB 1I1FB 5I16B 1EX0A 2N1KA 4WENB 3BD3A 2C7UB 4ONOA 3L5XL 2Y23A 4R96A 1AE6L 3K2UH 4JKLA 3WFEH 3T0EC 2CJUH 1OQOA 1A7QL 4OD3L 4HG4J 1FNLA 5DHXB 5CEZL 1IAIL 4OT1L 5ISZE 4RA3A 3EDFA 4LLYA 1YEDB 1W0WA 1FQ9C 3G5YA 4H20H 4S1DD 1FNGA 1YN7A 2GTWB 3O3UN 4Q9BA 5D1QC 3WJLA 4OB5H 3GSWA 3MUHL 3RBGA 3EYSL 4DK6A 2ZOKB 2JCCF 5IB5A 3NFPA 4B41A 4ZSOA 5DD6B 4TUJB 3S3PA 5E8PA 1CXLA 3UBXA 5F9OH 1X4XA 4MCYB 4O51A 4X9IA 1ADQH 1QHOA 1EBAA 4FP8L 2WBJA 1WCBB 3QCUL 1IKNA 5AYUL 3UCRA 2XZQL 4ZYKA 3PGCA 5ICXA 3RGHA 3OAUH 1JTTA 4FQCL 3VFPB 4UDTA 3TBSB 3ZE0E 5BJTA 5I73C 1GOFA 1FGVL 5I8CB 1XGUB 2EYSA 3MXWL 3QA3A 5F9WB 2Q3AA 1AKJB 1VHPA 1P1ZB 4P5TB 5GGRY 4NBXB 3MR9B 3SE8H 1MFAL 1C5DA 5JMOC 5F7YC 5C6WH 2R56H 2FSEB 4X7SL 3CMOH 1U3ZA 5F8QC 1S9XB 4JM4L 2FLBT 3HC4L 5DRNB 4UU9A 3SO3B 1VADA 3NIGF 2HKFL 3RNKB 4J3UA 1KBGL 2VDML 3FFCD 4POYA 5D7IB 4QHMA 2J1KA 4O58L 2GJ6D 4WO4C 2NX5B 3EFDH 4UBDC 4HUWA 1QUNA 5EZOH 3BESR 5GHWH 3V4PH 1KN4L 4B7LA 4LLVA 4JM2C 1QFWM 1H3PH 3RIFK 1KPUB 1NPUA 1BLNB 2NR6D 4YHZL 1LEKB 4L1DA 1FJ1A 5L9DH 4ELKA 1ZA3A 3U4EB 1PG7X 3U4AA 2NY1C 3BGFB 1ZVYA 3MODH 4MSWB 4LPXA 5IJKA 5F7HA 1FN4A 2XN9E 2AJ3A 3ARGC 1R5VA 3F7YB 1FPTH 1YEGL 2AS5M 3T0XA 4J2XA 3V6BR 1XGTB 3D48R 3G6JA 4M4RA 3QCVL 4OZHE 3JWOH 3U4BH 2EDKA 4OLYH 3D85D 2VABA 3MRPA 4MNQA 5EC1A 4RAHA 3OB0H 1MH5A 4XNXH 3DJ9A 3TV3H 1CD9B 1OF2A 2P7TB 4LKCA 4PJFA 4PRBA 1FL5B 3D2UA 1SHMA 1IGTB 4X6CF 4JY4A 1BJMA 4X8JB 2N4IA 1UC6A 5A40E 1NGQL 1OY3B 3MOBH 3QEQA 2NXZB 2O5XL 2YSSB 4P59H 2ZZUT 3VXPA 4I5BB 3ARGD 3BRDA 3V2AR 1MHPH 2DLIA 2AK4D 5DYOB 3A67H 3IB4A 4HUVB 3KPLB 5C0BB 5I1CL 3AAZA 1MRDL 4AEHH 1HK6A 4ODVL 2MQ0A 1XGPA 2IANE 1S9YA 2ZOLA 4U1GC 1LGVA 3G08A 3H0TA 1MLBB 1UH4A 4EBQH 5D1QD 4QHNB 1S7TB 5CHNB 2W07A 1JYVA 4WHYH 3VGEA 4ZUWB 1UCBH 2X10A 5E4EC 4MYWB 5FECB 5FYKD 4LBEB 5INCA 1P4IL 1ZWIB 1FNSL 3HG1D 4JY5H 4EXPX 4Q9QH 4EUPH 2FCBA 1X5KA 3TIDA 2YR3A 1DN2A 1WUNT 2VZSA 5GGVH 4P4RA 4HQQH 1DFBL 2ZSWB 3PP3H 4ZXBA 3AS0A 2DQJL 3ZL4L 1D5MA 1R3JA 1U3HC 4Y4HC 1QKZH 2LAAA 3DSFH 5JDJA 2Q87A 4RA0C 1AY1L 5MENE 2CLZA 1MI5E 3THMH 1ZGLB 4LASL 3SDCC 2OL3A 3MCKB 4EDXA 5IB1A 1U42A 2FHBA 4MDJB 4WEBL 3LKQA 1F8TL 2XZAL 4UTBL 2YD6A 4Q2ZB 3BIKB 4W4OC 1URLA 4UV4L 5IEKA 4OZIE 1U92B 3OKMA 2VDPH 3QDAA 2IALA 1MWAA 2AJYL 5HHPB 4ZSOB 4LCUB 4QRRD 5KSBA 4R0LC 3O6LH 4JB9L 4TSAL 1X7QB 4QY8B 1A3LH 5EU4B 4DZ8B 3LEVH 1BVKA 3BP5B 1T2QL 1HKLH 1PQZB 1KJ3L 2XQYG 1JHTB 1SM3H 3PGFL 2BHZA 5DHYA 2IGFL 2VOTA 3IFLH 4HULB 5DJ8B 2YD4A 1M7XA 1M05A 4L3CA 1D6EA 3KAAA 1YMMA 5IB4A 4A6YL 5KSAA 2XG5A 4W81A 2R23B 3S9DB 2R0KL 2IH3B 4OLVL 5E2UL 5BRZE 5HY9A 2XFXA 2XWBA 3L9RA 3I3BA 5EOQL 4D8PA 5JPMB 2DWEA 5IG7B 1YMME 4G6AC 4CVWA 3RDTB 3M1BB 5F7UA 5DK2B 3MRFB 5CILL 2KZ1B 3DHJA 4PJ5E 1JIBA 1UT9A 3ZYZA 1QBLL 2BSTA 3L3KA 3VXUB 4UDUA 5CSGA 1WWWX 1YEHH 1DLHA 2H26B 3NN8A 2J8HA 3DSNA 4G7VL 2ENYA 4G9FA 5H94B 5ABDE 2EIBA 4LVEA 4G9FD 3C5ZC 2MTPA 4EN3D 3U83A 5CIPH 3RUGE 4M03A 2AK1L 4EBQL 4P4KA 1N64L 3E3QC 3ARBB 1HYSD 3L3GA 3WO4C 2QQQA 1DUYA 1RK1B 1A1MA 3OV6A 1QO3A 1R3HB 1T0MB 5KZCD 4Q58C 4YHMH 5GGVY 4YDKH 4UT6L 1FAIH 3RY5A 2X4NB 2V5RA 4GAJH 4YJZL 1A6UH 1REIA 3MPCA 2F53A 2F53B 4I3GA 5HI3C 4RBPK 1SJHA 1I1AB 3MOBL 5DLMH 5C07D 3BUTA 4Q0XH 1EAPA 5MEND 3C5JA 3C5ZD 1NLDH 1O5DT 1EGJL 4MD0A 1CR9L 5CLTA 4OZIB 1A7NH 4G8GE 1F90L 2VL5B 1YY8B 5DMKB 1A47A 3CNKA 1EUTA 1V05A 4KGLA 1W72A 2LE9A 3LKSB 2I9TB 3QQ3B 1JGDA 3NCYP 2AJXH 4MQXC 3WFHA 2EC9T 2ZUYA 3NOIA 4N0FB 1BGXL 1M71A 1YPZB 3O8XA 3PDGA 4RAVA 1FPTL 3QR2A 1L9NA 3B2VL 4TUOB 4F37F 2YKLL 4ONFH 4XWGH 1OP5K 4Y4FD 2VIRB 3CX2A 3VFTB 3RU8L 2BOCB 1FDLH 5EIIB 3FOMA 3EYUL 1MF2L 4PLJC 4P9ML 4RFNC 1A6TB 1S7UB 1NQBA 4GMSH 1NMBH 1S9WB 5KJRL 3QWQB 1AIFB 1II4E 4X4XB 1JGVH 3GSNA 3IGAB 1S7XB 1JF5A 5HVHB 3CX5K 4JZJC 3MQIA 4WWKD 3HN3A 3OKKA 4MS8D 3D25B 1T3FA 3QIWD 2HKFH 1KLGA 2VLRE 5D7JB 1LO4L 5C0ND 2EICA 5IB2B 5JW4R 5KVFL 1B0GB 1JZ8A 1B0RA 5LGJB 4ONGH 2DLFH 1ZA6A 5SWQB 4ONHA 1FZJA 2F5AL 5J1AA 5DHVA 3U82B 2G60H 1AC0A 3LS4H 4WU5A 2KL6A 5IR1B 3QDGE 3F6LA 3NCEB 1FO0A 3BH9A 2VDOH 2JK5A 3MLYL 1B4JH 1XZ0A 2OMNA 2EDXA 2VL4A 2X4NA 2FJHB 3X11B 1N2RA 1WQVT 5F9OL 4HF5L 2ITCB 3K46A 4OM1H 3LKRB 1UACL 3MJGX 4IRSB 3ZDXE 3PL6B 3SJVA 3EYQD 4LHUB 3T77B 5C0RL 4JQVC 1NGZB 4UIKH 2C5DC 5EU6B 1NCWL 2EH8L 2VAAA 4PJBE 1DQDH 1SEQL 4JO3L 4Y4KB 2BVEA 5C07B 2EXYC 1EHLL 5FA3A 4H0GA 4JPKH 5TPWL 3KYKL 1MSPA 3TA3B 5I30H 5BVJA 3GMLB 4K7FA 4XXCC 3GZKA 1NC2B 4JO2L 4GW1A 1F11B 2CJUL 3G6AA 3BPLC 3BDBA 5C86A 2FR4A 4G42A 4HKXA 3STZB 1KOAA 4AG4H 3TIDB 4NYLA 3L7FB 5FDYA 1NCUA 4WEUD 3QUMA 4FQHB 2PTTB 1OSPH 5EORL 3ARBD 2DQHL 4QXWA 4Y1AD 3BPLB 4LEXL 5J6HB 2P24B 5D1QB 2D03L 4HDIB 4NHCL 3ZE2F 4GLRH 3B9KB 3K4DA 4ORZC 3BKML 5IROA 1HSAB 3CSBA 1BX2A 2X6MA 5F1OB 2ZPKL 5EIQA 4XBEH 4JFED 3CU7A 1SYVA 3IJYB 1NDMB 1T6WA 4M5ZL 4WDIB 5E8DL 3PL6C 3U0TA 2R9HD 5GRXG 3O6MH 3TO4B 3MGAA 1FH5H 2VXVL 1NLBL 4Z78A 4QHLB 5FA4B 1CFSB 2WUBL 4O9HL 4O4YL 1BOYA 1WLHA 5ICYB 1TVHA 3IYLW 4A6YB 5L7XH 2YA1A 4OGAC 1CZ8H 1KB5B 1KB5A 2YD7A 4QHKJ 4XXCA 3JTTB 1QR1B 5ICYA 1FL3A 1A0QL 1B3JA 2ID5A 1F4WH 4OFYD 1FFOA 5D1XD 3KYMB 5HHVL 4ONHB 1MHHB 3SDDD 4PJ7B 4YNYA 4RFOH 1HI6A 2NXZD 4HPYL 4RMTA 2PUQT 3L6FB 5C09E 3VE0B 3QRGH 3DXAE 5IK3A 3X12B 5AEAA 2GITA 1G9EA 4MWFA 2ICEA 1FORH 4OD1L 5AWNL 1HIML 4AM0B 3CDYA 4X6FA 1U3YA 3LPGA 1MCDA 3C09B 3RY4A 3VFNB 5D6CA 5F8RC 3WIFA 1SBBA 1TITA 3LOWA 4LFHD 4G43B 5B3JF 5I6XB 3QI9B 5F71A 3CVHB 4NZJA 4GKOA 3BQUC 5BV7L 4KDTA 4HKBB 2J5LC 3BAEL 4RGMC 1A14L 1DQLH 1TJGH 5CFHA 1J8HB 4EDXB 3TJHC 4IJ3C 2FB4L 2R0ZL 1AGDA 3S5LB 3OG6B 3UC0H 2EDNA 5SWZB 1OP9A 3UROR 1TJIH 1U91B 4C54A 1AP2B 3NABH 5CMAB 5D8JL 4NJ9L 1G6VK 2IAMA 4CNIB 4RWYH 1WIOA 2RIKA 4OGXL 2IAMD 4P3DB 3BPNC 4ELKB 3AREB 3AREA 1NCBH 3MUGA 1P2CB 3OJDA 4XI5C 5FF6A 5JXED 4GAYB 5GGSA 3IU4H 2LTQC 3BQUD 1G7JB 3MBEC 1U8LA 5ESAA 5TDNB 5C0CB 3R8QA 4MXVE 4XBPB 2P5EA 1EUUA 1RUKH 5B38G 4XVSL 3U1SH 2P5ED 1UEMA 1OWWA 5DD0H 4K55A 4XPAH 3ZYJA 2QBWA 4KK9D 4OF0A 3GNML 3C08H 1UCTA 2BJML 3CFBA 3A0OA 2VDRH 3VA2C 4LSSL 1VKXA 5KS9E 3WDJA 5LBSH 4IS6A 5EZIL 2AKRA 5CZXD 3FFCA 2KH2B 4HGMA 3O4LD 3SDYL 1C5CH 4EXKA 4YDLB 5BQ7A 5E2WL 5KS9B 3SQBA 5JR1L 4ZO6A 3V9FA 4GW5A 3SDXA 1YECH 5SWSE 2GITB 1FYTD 5I2IA 5C0BA 4XVTH 1WZMA 5J11C 2GAZA 4YX2L 5LQBH 3JUZA 1CLYL 4U1GB 4D3CH 4DAGL 4UINH 3SHSA 5IB2A 2YS4A 4WO4B 2NR6C 4G9FB 1BAFL 4Y8AA 3MV7B 4P2OA 1WVZA 1LEIB 3OKKB 3MRKA 1JPSL 5DD6A 5I74C 2ERJC 2M8XA 4F57H 1UVQA 1IQDB 5IFJB 4H5SA 3X13B 1HZHH 5IB5B 1LEGA 2J7LA 1BD2D 3VWJB 2VZTA 1TZGH 3OAYH 4K71C 4G8EB 1M6OA 4RGOH 4ORGB 1GZPB 3GIVA 1RZGA 3MRFA 1EEZB 3GMMB 4OCNC 4LPVA 4XVUD 4FN0A 4NGHH 1C08B 1F3DH 2F15A 2F8OA 4X9GA 3HAEA 4FZEL 4FZEH 4JRYB 1CXHA 1CU4L 4L8BA 4KKLC 4NGHL 4I0CC 1N59A 2ICWJ 4HWBA 3T2PA 4D2NA 4DVRL 1MI5A 3D0VB 3GGWA 2ICWB 2RQ8A 1MI5D 4UQ3A 1NUGA 1LO3L 1T4KA 2EDJA 2OSLB 3HUJB 4N9OB 1Y0LB 5DMYA 4XNUL 5CIPB 1MELA 1AHWA 5E2VL 2B4CH 2D7NA 5HI5C 2YPVH 2A6DA 3KG5A 1F00I 1JPSH 2I07B 2W65A 5T1LB 4JHZA 5CBAA 1B0WA 3ZE1F 3SKNB 4YDIL 2D7PA 3G6AB 3Q1SH 2FBJL 2BNQB 3OKEB 1J11A 4DWHA 1CGWA 3MLUH 2FEDD 4K7FB 1FNAA 3ME0A 5EO1B 4EN3A 3QDJA 1KC5L 1WAAF 2FYYB 2UWEB 5FYJL 5SWSD 3VRLE 4JGUA 4G6JH 2ERJB 1OAXH 1A9EA 3MLZH 4TSCL 3P11L 4JKPL 1YECL 4MDIB 2OZ4A 5DD5L 4Z0XB 5E2WH 3CC5A 3V4UH 1SJEA 3RVUD 1U6AH 3HE6B 3LKRA 5KSUB 2YMXL 3CC5B 4R0LB 4LSSH 3CFIC 2XQBH 4RZCA 1IEAA 1QA9B 3QA3B 3X3GL 1U8NB 1WBXB 4HIXH 4FABL 1N0LA 5MHSD 5B21A 3NPZB 5FK9A 5JPNB 4OLXL 5LXGH 4YFEA 1TJHL 2WBJB 1QSFD 5INDB 1J0ZA 3D39D 5DMGD 2XTJE 3ALWA 2BP3A 3QXVA 4MMXC 2EXYD 6FABL 3KLDA 4NN6B 1JNNH 4P49A 1HH9A 3N1GC 1G7PB 2NW2B 5DO2C 5DC0A 1M1SA 5B8CC 1RUMH 5D7LE 1AKJD 1YJDL 2BOBA 4XTRD 3RTQD 2VJXA 3HMXH 4WFEE 2YPKB 5D8JH 4XPTH 4L3EB 4YBHA 1FYTE 4JQIL 4G8GD 4XC3L 1N59B 1IT9L 1WT5C 4AEIL 1HHIB 5F3BA 3L5WB 5E00A 5D5ME 3L3JA 5I8OL 1E27A 2Y6SC 1X5JA 4YHPA 3FT3A 2V17L 1EEZA 2X2YA 1A14H 1DQLL 1M6OB 5EIIA 3GMOB 1KIUA 3GRWA 4OAWA