3TA3D

Structure of the mouse cd1d-glc-dag-s2-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Unique Interplay between Sugar and Lipid in Determining the Antigenic Potency of Bacterial Antigens for NKT Cells.
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ta3D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ta3D02
2GJZB 3L5XH 3V4UL 5ESAB 1CD1B 4LGSB 1RPQA 3BKYH 1D9KA 1MAMH 5DK2B 4L4VB 1Z9MA 5H2BB 2GTWB 2QEJA 3E6HB 4ONFH 5D7SH 3P77B 1TTFA 1EK3A 4YHNA 2ICEB 4BFBD 2GI7A 1WIPA 5DVLA 1LQSR 4LCUB 5A1AA 1CFQB 3IJYB 3MRPA 2EDQA 4AT6B 5I1DA 5HJ3A 4LCCB 4D0DA 1PG7H 3UAJC 1T03H 1RHFA 3BP6A 4G3YL 5F9OL 1G7LB 3GNMH 4RDQF 1JZ6A 1UB6A 4W4OC 1I8KA 4FNLL 2MNUA 4AG4H 4DGVL 3O4LB 1JK8B 1CXFA 1A1MA 1BVLA 1XR9A 5IHBA 2YPVL 2ZOLA 1A3RL 4K2UL 1TZIB 1PEZA 4WO4A 2WANA 1MFNA 5A2IH 1RK1A 2NY5L 2QQNL 2Z93A 3KPNB 4XHJD 3TLRA 4Q6IC 3L5JA 3VFWB 5F88B 2GCYA 2P5EE 3Q3GA 2J4WH 1A6VH 3MRRA 1GAFH 4XTRC 3AFLA 1T22B 2GJ6B 4L1HA 1CQKA 4Z7OF 5I19L 5INCB 1QRNE 1DQDH 5IBLC 3AS2A 3UBXB 2XA8L 1UENA 4HFWA 4ELMA 4JFFE 1C12B 4NRYB 2Z91B 3H9SB 5JOFA 1KJ2H 1QNZH 3HNVH 3VH8G 2F74B 2EH8L 2RJMA 4HV8B 4NDMA 4XRCA 1P84K 4L8CB 4MD4A 4E41B 4N0FB 4DUVA 2VERN 3GO1L 1IC7H 4GO6B 2VH5L 1FLRH 2HP4A 3MRGB 4IOIA 4F7MB 5BS0D 5SWZE 1KENH 3NFPB 2XXMB 3BD4A 3QAZC 1HI6A 1MCHA 5A3IC 4NQTA 5HGDB 1DDHB 1CE6B 3GUTB 3MUJA 4I3SL 5I8CB 2B1AH 4HZLB 2CPCA 4L29A 1JN6B 1UQSA 2DYPD 4OFDA 2V2TA 4LCIH 4H5SB 4Z7UF 1AO7B 4JFDB 3PDDA 1QSEA 1Q9OA 1DCLA 1ZGLM 1IGTB 4P9ML 4O4YH 4WFED 4A6YH 4IOFC 1FNHA 1GSMA 2F58L 4WWKA 5SWSA 1DLFL 1MCNA 1UVQA 4NO5B 4WU5A 1OCWH 1LE5B 1A1OA 4M1DH 5HHNB 3DURB 1T80A 3LAFA 3VXPB 2XY1A 1PX4A 3QUKB 4HQQH 2ATPA 3BZFA 5GS2D 1VFBA 1FE8L 1ZLWH 4U31A 4AY0A 3RU8H 2GHWB 2W65A 4PJFF 5J4MA 3SE8H 2ID5A 4GKNA 1ZT4B 3QO0B 5LWYH 5BV7L 4MDIA 5GGVY 1D5MA 3W2DL 4YHYC 5MI0B 3LQAL 1X5ZA 5J06A 3MMEA 3ZMRA 3QNYB 7FABH 2DQFB 3ULVC 3ME0A 3TZVD 1Q9LA 4YDVA 1VSCA 4Y1AE 1AKJB 2ZUXA 1PX3A 1IZKA 3QUMH 3S4SA 3MFFA 5FO7A 4ZFFB 4NGHL 5K33A 3DSNA 3UTSB 2GUOB 3KPPB 3IDNB 3AAZA 3VRLF 5H35A 1YY9D 1A4KB 3O6FC 3INUL 1IQDA 1NAMH 4GBXB 1KCSH 4X6BA 4HJ0D 5D2NC 1DTUA 4JY5L 4C56E 4R7NA 2B0SL 2O93L 5HBBA 1PSKL 2JK5B 4PJ7A 5HI3D 5IEKA 1QHOA 5GZOD 5E99H 2ED9A 1UG9A 5HDLA 2EDWA 1JZ4A 1N7MH 1JYWA 4CMHC 4MNGE 4FP8L 1NSNH 1SYSA 5JO5A 4GSDH 1ACYH 3FFCE 1KF9B 1V8HA 5MENE 1FFNB 3L5WA 3LV3B 1D5BB 5DVMA 5EU6A 3F7QA 4YIQA 1U8HB 1KB5A 2BCKA 1CD8A 1BMGA 3KHOA 4WI6A 5B39A 3HMXL 3DX7B 5ADPH 2HLFC 2ATKB 1FV1A 3FJTA 3GMNB 4POZD 5D6DC 4KRPC 4PTUA 4TUJA 4AL8L 2FZ3A 4KROC 5DYOB 4RMQA 3QUZA 4WTZG 4M7LT 2YEZB 4UZGA 1IEAB 2A2QT 3R06B 4PJDE 5DI8A 2AGJL 2BSRB 1MFAL 1GPOL 3PV6A 3CSYA 5FV2A 1NQBA 4LKXA 1G9NC 3MV7B 4OLYL 4IHOB 4PLJD 4YGAB 3LZFL 3MA9L 5I1GH 3BE1L 4LSPL 3ET9F 4RAUB 4EUPA 2AQ3A 1IQWL 3O6FA 3EJZC 2XNAB 5DD5H 15C8H 3GBMH 5J1AB 3O8XB 4ZFGL 4U1IB 4UT9L 1NDMB 2AS5M 4PBWD 4Z7UA 1JWMA 4U6VL 1OLZA 4OGYL 3CMOL 3MJ9L 2Q87A 3LD8C 5EOQL 2DM2A 2HT4D 4YQXL 1L9NA 1V7MH 3PWPE 1OF2A 3CUPA 1MI5B 1CXEA 4NNYB 1D5IH 1BJMA 1J8KA 4GMSL 4QRPB 3Q2CA 4QGYA 3TO2B 2FLBT 2YD3A 1DVFB 4RMUA 4Y16C 4FZEH 2PW2A 1P1ZA 1GHFL 2UVEA 3VXSE 4C54A 5FECA 4MB5A 2OXHA 5JW5B 4XMLH 4HX1A 4XP6H 4TTDD 5D6DA 1EJ6A 4PRIA 3QXAB 4HUVB 4OFVA 5EU4B 1QSFB 2A6DB 1NANI 4HGWA 3VRJA 4Z76A 4DK6A 2NX5D 2ITCB 3W81A 2R1WB 3MGTB 2VXVH 3QQ4A 3D0VB 4PJ8C 4GKZA 3QNZA 4YHMH 5EO9B 3S9DB 4I1NB 2HRLA 4S1DD 3RWIB 1AXIB 5L2KB 4JFPA 3MV11 4P0DA 3W39A 4FHBD 1YJDL 3EKCA 5KVDL 3UC0H 2NY3C 4KWUA 5F3BB 3WS3B 2VDLH 1G7HA 4JKWA 1RIUL 4DKDC 1XR8B 4RGND 3DGCR 2Y5EA 3EO9H 3K7UA 5JHLH 2DTSA 1XF3B 3OV6A 3DUUB 2CRZA 3RY6C 3WJJC 5ID1B 5F1KC 2N1KA 4FQLL 3BKML 4QOKB 4WI5A 3V5DB 3MOBH 4QRQA 5BZWA 1IEBA 2NTFA 1OW0C 2H3NA 1X5AA 3MXVH 1T5WB 3N1GC 3BZ4B 1EEYA 2XI9A 4OBSA 4JRXD 1DE4A 4HIXH 2BHUA 4NQDE 4H25B 3OXRA 3QUXA 2C1OA 3QI9D 3MR9B 4JO2H 1UYWL 1BFTA 2CDFA 3WKMH 4U1GC 4KVCL 4OUUB 1MFCH 1S3KH 2CUMA 3VXUD 3IFNL 3ZSSA 3LN4A 4FTVB 2FD6L 4JKMA 5F9JA 2ZCKH 1YQVH 3O4LE 3V4PL 4OM0L 5B4MD 1XMWA 5H37H 3PDGA 3VFOA 3F12B 1EERB 3F7YB 4BUGA 3FOMA 4YBQC 5F6HI 1N3NA 3ULSB 2BSTA 1NBVH 5IQ7L 4GJTB 1BX2B 4A2MA 4R7DB 4D8PB 5ISZB 1INEH 2FATH 3MV01 4TTGA 4ETYA 5IUSA 3HI1B 5EUKB 5KSAD 1MREH 1MHCB 5BRZE 1EFXB 1KG0B 1ZVYA 4JPVH 3WBDA 5DMJB 5F8RC 3BEWB 2GJ6E 4HLJA 3ARGB 2GW5A 4JFOB 4MA8H 4N1CA 5D7IB 5HHME 5D6CA 1QRNA 2YXMA 3RVVC 3UDWC 3DO3A 1OGTB 3DVIA 4CRPA 1K8IA 3H9SE 3ZT6A 4P2QE 1KYOK 5E08H 3VXRB 1BIIA 4JFFA 3NA9H 3QZWG 5C08D 3MNWA 2AI0L 3V5KB 3EDJA 2ERJB 2DLFL 4ZAKC 4PD4K 3RY6A 4R97B 3WJJA 4XWOC 4PJDF 5DR5H 3QEQD 5EIQA 1T2QH 1OW0A 4I77H 2CGRH 3QQ3A 5D2LB 4KI1A 2P5WE 2Q86B 1MJ8L 5SWZA 1JNHB 3P0GB 2VR5A 5IG7A 4PJIB 3KLHC 3MA7B 2ADJA 2AVGA 4PBXA 2VDQL 1FSKB 3NAAL 1RUMH 1Z3GL 2RFXA 4FFWD 2FX7L 3VWJD 1AO7E 1GGIH 4JFDE 1RZFL 5JXAH 4OZHB 4EDWH 3HZYB 3LDBB 2FJHB 3VGGA 1W0VA 2ITDB 5DRNA 3RL2B 3V6BR 3KVQA 1GGYA 2AEQH 5D5MB 1HXMB 1HHJA 2XZCL 4MLIA 3RUGA 3VW3L 1GIGL 4U05A 3QIBA 4PRHB 2BOCB 3LHPH 4G42A 1JNNH 2Q76A 2IQ9H 4F33A 4QHLA 2AEIT 4CVXA 5F8QC 1J86A 3TH4T 3L3GA 2Q7YB 1JZ2A 4YNYA 4Y4KA 1RIVH 4TSAH 1TFHA 3PP3H 4NZRH 4HHAB 3FZUC 1IM3A 3E0GA 2EXYC 3P9MB 1JNLH 1YPZF 4FQ2L 1S7QB 4HJJL 2CLVB 4P48A 4ODVL 4NCC1 5SX5K 5TE4L 3UDWA 1GC1L 3K2UH 2IPTH 3MLRH 3SBWC 1INQB 3QQ9C 1OTSD 1BP3B 2GITA 5CJOL 2Z31C 4LARH 4ZAKA 1AD9B 4UNVA 4Y1AA 5BZDA 3U6RB 2C4FT 3LKSA 2DYPB 3KDMB 1OARL 4ZXBB 3SDAB 4X4YA 5I1CH 5I1KL 4OZFB 3BEVB 4JEGB 3OKNB 1EVUA 2EIZB 3QWRA 3IDIA 1CXLA 5EBWA 4D9RD 2X6MA 4YGVB 3VI3E 4BQ6A 5ALBH 1EV2E 5CWSA 3M8OL 4C56A 1RUKH 1T1WA 1RJLA 5ETUB 5HI4D 4U7MA 2PN5A 1HYSC 4PRDA 4HUXA 3SGEI 2F53B 4XP9L 4ONGH 5DT1H 3PIQB 1MIEH 3C60C 4MNGA 4S0SD 1OGAA 3W11C 2UZIL 4DCQA 1JHKL 1QSVA 3EHBD 3T4YB 1OP5K 3FFCA 2P44B 3QULB 3BSZH 2P7TA 4PRNB 5CS7A 5MENA 1CICD 2VSDA 3SJVB 4AQ1B 1EO8H 3NVQA 1ZLSH 4J3VA 2BNRB 5C7XL 32C2B 1MPAH 5H94A 4PB9H 1YY8A 2N7BA 3TZVB 1A4JB 2JJWA 5DEZA 4YX2H 3HE6D 5HHXH 1AE6L 2VC2H 3Q6GH 1P7KA 3DMMB 3NPSB 2OTWB 3O3AA 1IKFL 3G6AB 5HVHC 3LEVH 4YFEA 3RWDA 4EJ1C 4PG2A 5FF6A 5FHAL 3SDDB 4OM1L 3SBWA 1LD9A 4DWHA 3EAKA 3GJFA 2PKDA 1NGWA 2Z31A 1VEMA 4HLZG 5GIRB 4PJDA 3FQTA 4XP4L 5HGBA 4JG0L 4XX1G 3MV7E 2QADC 4OZGE 4POYA 2BRRH 3RGVC 3C2AH 4HCRA 2NY4B 5DA0B 4KC3B 4PJHE 2QHRH 4KTYA 4GKOA 4CJ0A 2Y07L 2P8MA 4H0GA 5JZ7C 4U7SA 5E94A 5FA3A 2LVEA 4I4WB 4LL9A 1OSPH 1X4ZA 1NCWL 2EE3A 2AV1A 4IRZH 3OHXA 5F71A 4N8PA 1JWSA 4JANB 2ZUQB 1MVUA 3U7YH 1YNKL 2V17H 4APQD 5BXFA 1ZHNA 3MACL 1YUHB 3WO4B 5GGTA 3MYJB 2GYSA 3VJ6B 3GGWB 4LKCB 4LVOB 2OTPA 4P2OC 4X8XA 3C60A 4OD1H 5F1IA 4CU7A 1A6TA 1IMHC 1MLCB 1MF2L 1FVEB 3PWPA 1MI5E 3NZHH 5FB8A 3RVWD 4HC1H 5L7XH 3BPOB 2EZ0D 1G6RL 3MLZL 4O51B 3V5HB 3WNLA 3ZE0F 1IAII 2IPKB 3KPSD 1F3JA 3T77B 1I9RH 1N6QH 3VXSA 2IAMD 5LGJB 3NN8B 1OAZH 1HYRC 4UQ2B 1WVZA 1I3GH 1N8ZB 5BMFL 3PWLB 3MCG1 5FYLH 3QHFL 3FB7A 5FCSH 1R24A 5A16B 3L95A 2EDFA 3FFDA 4PYGA 1HHGB 1SMOA 2VR9A 1HNFA 2FR4A 4X80L 5A2FA 4N8VA 5EU7E 3RGVA 1F2XK 4PJ9D 5IB4B 1XF2B 1M7XA 5CIPB 2B2XH 3ILPB 5KVEL 1C08A 1H3PH 5DD6B 5EOTB 5IGXH 1UM4H 5FYJD 4Y2DC 4QOKE 3DROA 4Y4HC 1KCKA 3TIEB 5F7UA 1JGEB 1JHLH 1R3KA 4KZEH 2HA1A 5DK2A 1U95A 5DVNA 4XBEL 2I07B 1PY4A 1MHEA 1MCPH 3IT8D 4JG1L 2NNAA 2PXYC 4OLVH 1E6OL 5GRXG 5IT2H 4QXGH 4QRRD 4NQDA 5D7JD 5IB1B 1T0NA 4P2OA 5GJTH 3MLTA 3NIDE 3VI3F 4L9DA 4XCYA 5IKCA 4HKXA 5JQ6L 1GVIA 3CVHB 1CTNA 2GSGA 1HXYB 4PBVC 1CIDA 4P4KD 1U8NB 3MODL 2X70B 4JQXC 4K9EH 1MCQA 3M1BB 1A6ZB 4HS6A 4LLVA 2NX5B 3B6SA 4UT7H 1NCAL 4JZOB 1MY7A 5I16A 4GAYA 2EXWC 4WNQB 1YN7A 2VLJB 1F6AB 2Y72A 4MB3A 2R0LH 3RL1B 3RWEA 5ISZE 3IVKB 3D39D 3FB6B 4HXAH 4KKCD 3IU4L 5F3HA 4F15C 4JO1H 3PWUB 1TJGH 4GAGL 3B83A 3VWKC 3CIQA 1RURL 2YK1L 4G80A 1RAMA 5BRZA 2A9MH 1KXTB 3TO4B 5GS1B 4M9OA 5CBAA 3CFBA 5GRUH 4NHUB 2QQLL 1DBAH 1L7IH 1CTOA 4KK5D 3WEXA 2HVJA 2AJZB 3QFDA 3O3BA 4BQ8A 2BNUA 2EC9U 4E5XA 5M94B 1A6UL 2XFXB 3JVGA 4EDXA 4P2QA 3MLSL 1BGXH 3V0WH 2P24A 1T3FB 3DYPA 4JRXB 4N0YH 4F7TB 1BOGB 4Z78A 4L8CA 2A0LD 3QI9B 1I85C 5CZKA 3O2DH 5D1QA 2R0WH 4MLSA 4KTDH 5CGYC 4XP1L 5D2LE 1F4YL 3MRGA 4OZGF 4XH2B 3NFPA 4X7DC 3BZEB 2P5WA 4PJIE 5HHVH 2R29H 4PJHF 5HPMB 2PXYA 1GOHA 4S1QH 5JOPD 1DBML 1PY9A 2WUCL 4H8WH 3NCYP 3CDGA 4FQPA 5ELIA 4G9DB 3WIIH 4WWID 4Y4FD 1AD0A 4LQFH 1VPOL 3OKMB 1UXSB 4BKLA 4KZDH 5AD0B 1EDQA 4KGJA 3P4OB 2X44D 3NCEB 3RVXC 4JQXA 4OGXH 5KSAB 5M7QA 4HK3N 5D5ME 3P9WB 3Q0HA 1MRDL 3LRHA 2A6IB 3BAEH 1T7ZA 4Z7WB 2YD2A 4FZ8L 3L1OH 3S96B 3SDYL 1PZUB 2DLIA 5FDYA 2V2WB 4O9HL 2H26A 1FZOA 4NUGH 1ZA3B 4F2MB 1FZJB 2GIYA 4OT1L 4LDOB 3I6GA 3RX5A 1J8HD 5CSZB 2A1WH 2NR6C 5HYJD 3U0TB 4L9LC 4QHMB 3H7BA 4GKSB 5D7LB 3P11L 5AYUL 3VXTA 4BZ1H 4GRMA 2VL5A 4LRNL 4XI5C 4M62H 5DRXA 2PUQT 4XCEB 35C8L 2R56H 2F5AH 2ARWA 3GBLA 5I74B 3QEQB 4CNIA 5BS0E 1PDKA 1G7MB 4P5KA 4U1NB 4P9HH 4TSBH 3SGDH 3WFEH 2H2PD 3PL6D 1PGRB 3BQUC 2JE8A 4WI2A 3ECBB 1MFBL 1VFAB 1I85A 4P3CH 5F7KC 1G7IB 5D8JL 4J3TA 4JJ5B 3HA0A 3P40A 4JFXA 1F58L 2A83A 2W1NA 3ARSA 4DKAA 2CK0L 1A7OH 3MRKA 3LN5B 3TBVA 5CJXC 4LVNB 5F89B 3D5OF 1BZ7B 1JRHH 5IM7B 2XWJB 3DTXB 4WFEE 5JORA 4YC2B 4MZ2A 1U8OA 3DO7B 4OQ1A 1RUAH 1ADQL 1NGZA 4W68A 2OSLA 3GKWL 4R9HA 4M61B 1WICA 1FDLH 2HFFB 3CXHJ 1PD6A 3ZYZA 4BSJA 1H8SA 1CR9L 3DX8A 1RULL 4YZFE 2E9WA 3OR6A 4MXVE 2VLLA 1TJIL 4D9QD 1UCBH 3BWUC 4Y5VC 3QXUA 2P4AB 3NIDF 3HC0B 1JMZA 4I3GA 1Y6NR 1FFNA 1CGWA 3SCMA 3RZCD 4WY7H 3OTTA 4X9HA 3T0XA 4PR5B 3MV8D 3MRQA 3L6FA 4M5ZH 5BOPA 3SQOL 5T33H 4ONHA 4KI5C 3C6LC 2OK0L 3P73B 1QD0A 1IGIH 3VFUB 2XRAH 3G6DL 2Z8VC 1CDIA 4M6NL 1W72H 2WP3T 1K9TA 3VGAB 3VA6A 5FYKU 1K4CB 3VRIB 2JIXB 4NKOB 2QLVB 2DQHH 4JN1L 3BP4A 2C3VA 3JV5A 1A9EA 1FNFA 5E00A 4B5EA 4QHNA 2IJ0C 4K55A 4CW1A 1KBGH 1ORQA 3ZKND 4M7LH 3QHZH 1NAKH 1ZK9A 5AG9A 1GZPA 3U46B 3BGFC 3MUZ1 3R06A 3BP5A 3BQUA 3UYOD 3THML 5EA0L 4GUPB 4Y5YC 5ESVB 2HMID 4IDLA 4ZQKB 4OCNC 3MV7A 5IVZB 4OZGA 1NCBH 3DI3B 5EU7C 5E8PA 4PJHA 3VXMA 4BQ9A 5CJXA 5IB3A 4OFPA 2NZ9C 3IDMA 1A1NA 1X5YA 1XAUA 3GJFK 5A43C 1S8DA 1BBDH 1WJ3A 5C8JB 1BECA 3EOAA 2AP2A 4H26B 1R0AL 5IF0A 1K5NA 2DI8A 4HWZA 3I50H 1NDMA 5D2LF 1X7QA 5FFLA 3JTTA 4I13B 1LK3H 3RJQB 2X4UB 3FQNA 1FVCA 4PJIF 4Z7NF 4XPTH 3P0YL 4YXHH 1BHGA 3B9DA 5JPNA 3CZFB 4JPIB 4J1UA 3O2WH 5C0FB 4F9LC 4N0RA 4WHDA 2PO6B 3JZ7A 3TV3H 5C3TA 4TQEL 5TE6L 1XGUB 4CAGA 3QIWD 1W8NA 4G6JH 4NJ9H 4YPGA 1S9WB 2DJUA 1BJ1H 3MRNB 5E5UB 3TO2A 4Z18A 3DHJA 4JHAL 4CVZA 1DZBA 5D5MF 2IF7A 4JAMB 1C5DA 2BP3A 4W70A 4ODHH 2Q8AL 1JF1A 1NDGA 2COQA 2EYSA 4TUKH 1JF6A 5T1LD 3UO1H 5DZLA 3MUGB 2H1PL 4XVJH 5CEYB 4PRPB 5AUMB 1KLFA 2YD9A 3ABZA 5ALCH 1BVZA 5KJRL 2E7LA 5CEXA 2DM4A 1L0QA 4Y5YA 4Z0XB 1U58B 2YZ8A 1JI2A 3PP4H 1EA9C 4WW2C 2PYEB 4JKKA 4L5FL 4TVPD 3AU1A 4ISVA 3TYGL 1NJ9B 3GIVA 3W0WD 1XR8A 2O61A 2ED7A 3BGAA 1Z6JT 3OR7B 1KN2H 2GY5A 3F58H 1N5AB 1LK2A 4ZO9A 3CH8A 3H3PL 5HGAA 3QFJD 3GRWA 5CBEB 4PJCE 4A2LA 1FFPA 4LEXH 5J1SC 3NFSH 3BKCL 5CIPH 3U2SB 5DRZA 1I1RA 1N0LA 4K94L 1J05A 4MD5A 1NMAH 2XWTA 5DLMH 4PJAB 4OV5B 2PYFA 4I48A 1LVEA 1GZQA 3X3GH 3KPSB 4MQ7B 5IIEB 5J13C 1RZGB 1FZKA 4X6CB 2CRYA 4F9LA 3KLSA 3WIFB 1MHHA 4GS7C 3TIDA 2RIKA 2HKHL 4DN3L 1NCDH 5B38G 2EIDA 4PJEE 2R2HA 5F7MC 5GGUB 1QZ1A 2NX5E 3N50A 3MJGX 4LBEB 1O0VA 4IRSC 5KN5B 2AK1L 1CDBA 3V0VB 2Z35A 4MXVF 1UZ6E 3CVHH 5J9PB 3T2NL 4PS4L 1NGPL 1U8PA 5E2UL 3KPRB 3DETC 5KANG 1OAQH 5AZ2H 3G5XA 5B3JE 4GW4A 2OS7A 5LGKA 3DSFH 2DWEB 5I1JL 2DQJL 5JTWA 4RGNE 1KCUH 1DQQB 3VU2A 2DBLL 2CKBA 4IRJA 1N6UA 3H0TB 3ARGA 1IGFH 1M6OA 4JN2A 1VFUA 1RUQH 2DQDH 5JDSB 2RCSH 2DQGH 3X17A 1F02I 4ZPTB 5BV7B 1WK0A 5KZCD 5CKAA 4JRXE 1I1AC 1S5HB 4PUBH 3LPWA 4OD2A 4X7SH 3MJ6A 5FK9B 5D7JB 5JHDB 1B2WH 4LQ1A 1XH3A 5L0QB 5IW6A 4XBPB 1SEBA 1KB5L 3I6LD 3VXUE 4OTXH 3B3IA 3MLWH 2NY6C 4P4KB 5GRJL 3EZJB 1DL7H 1UKTA 3CFDB 3HB3C 2X89D 2BY3A 2XZAH 3L3DB 3FQXB 3T8XA 3SHSA 3TBTA 4FQIH 1QFWH 1A21A 4GQ9L 4I0KA 1R5WA 5SX4I 5LXGL 1XCQA 3WFDH 4BZYA 3QEGH 1J5OL 2WV3A 3W5MA 1VEPA 1J1XH 5LQBL 4LP4A 1HSAB 5T3XH 4QHUB 1YEEL 3VDBA 3WIHL 1MFEL 4LP5A 3KR3H 1WAAE 3VXQB 4OGZA 4Z7WE 5D5MA 5DQDL 1EEUA 2VWEE 2VAAA 1EXUB 1QPXA 4R96A 1FO0A 3ULUH 4XMKL 2BOCA 2ADFH 4LGRB 1ZGLP 3RI5F 4NQUA 3HS0A 3I75B 1FFQA 4NNPH 4OLWL 5CP7B 5TDOB 5C08E 2G5BA 1ROWA 4XHQA 3QZWB 3WFZA 4UB0L 1EAPB 2A9NL 3FB5A 3MRIA 2AERT 3NCCB 2CLVA 3UMTA 1LO4L 4U6YB 4ZDHA 3QEQE 1FVDB 5EORH 1G9MC 3B2UC 4FQXC 3TA3B 3E8UL 1NC4D 5BS0A 3HRPA 4M43L 2NW2B 1MAJA 3OKDA 2AV7A 3BKJL 3WLWC 2EDJA 2D31A 1I1AA 1IARB 2J5LC 4QKXB 5L8JB 1DQLH 1CU4L 1QLFA 4TRPH 4J4PD 4O58H 1XF5A 1WITA 3R0NA 5D1XD 3IU3A 4ENEC 2QSCH 1YMMD 2BY1A 2UZYB 1EUUA 3REVA 4OZFA 2X4NA 4R4BB 3ZDYF 4POUB 1KPRA 1OAKH 3QPQC 4PP2B 5HSFA 1LMKA 2J8UB 1FPTH 2Q6WA 4ZO8A 3K80A 1U3HD 4R6UA 4KKBD 5TQ0H 3KNBB 4MAUH 1A3LH 3FT4B 1FGVH 1PYWA 5JIPA 3T2QA 4PJCF 5FGBC 2VN4A 2F8VA 2FIRT 3K4AA 4NBYB 3PQYB 4LRIC 3RVUD 1WZMA 5IBTH 5DO2C 1ZLUK 3NCBB 1QYGH 4QCIA 3PHOA 4NQCD 2IPUK 1WBXB 1U8KB 2NXZD 4HXBH 5IMLB 4ONFL 1MIMH 3ARQA 4D94A 1JPSL 4LSSH 5JW4N 1T66C 2C7UA 4X4XB 1R3HB 1C16A 4BSVB 4WJ5A 3R0MA 5IFJA 5FA4B 1S7SB 5C0RL 4XP5H 3QJFA 4LSDA 2W9EL 4GG8B 1T03L 3T65B 1ZVSA 4LNVA 2HT2C 3ZYOA 5IMMA 3X11B 6FABL 5IP4A 4X8JA 1I9JL 1EEZA 2FIKA 5J3HC 3CZJA 2GTZB 3HI6H 5JA8B 5BQ7B 4I3RH 1UZ6F 4YXLH 2Y36H 4HGMA 5LKNA 3ARYA 4PLJC 4YHPA 2DQTL 4FQXA 5IEHB 4MVBD 3UJJL 4RISL 4OIIH 3MBXL 3PHSA 3IDYC 5FKPA 1CF8H 3CC5B 1ZGLA 3ARDC 3DV6B 4DVRH 4D9RE 3KPMA 1CFSA 5LAXB 1WSST 3BDXA 5IESL 4YBLB 3EO1A 4KH2A 4L8SB 2A6KB 1ZXQA 4NN5C 1FNLA 2E7HA 4KJYB 3BMWA 4OLUH 3GSUB 1B0GA 3ESUF 3LSOB 3WXVL 2YPLD 5M95B 2BVQB 2IADA 3P30H 4I0PB 4RDQG 3FRUB 1HQ4B 4IJ3C 1MUJA 1N59A 1ZWIB 1U8QB 4JZJB 4S1RL 1KNOB 5EU5B 3HI5L 4G7VH 4K3DH 1SVZA 5CUSL 3U4EA 5DJZA 4YR6B 1HHKB 3RWFB 1JTOA 5EBMB 3ALPA 1QFWM 4P5TC 2Y5TB 4YHIB 2GSIA 2YN3A 2BFVH 2P8LB 3RZCB 1DUZA 5EWIH 1D3CA 1NMBL 3O9WD 2OR7A 5CMAA 1BBJA 3ISWA 4KJQD 2X1QA 4JPWL 1OAUL 5KG9A 4RRPG 2VZOA 2CIKB 3GMMA 3V4UH 1HH9A 1Q94A 3ZDZE 1MJ7L 4NBXB 4TTDC 2PF6A 5JNYB 2VLMD 3DBXB 3RQ3A 2WBKA 4BJLA 5ADOL 1NEZA 1WAAF 3T0EC 4Z7WF 3V7AE 3EDKA 1GOGA 3IETA 4G3YH 4S1DC 5DFVD 2X4RA 5F9OH 1XCTB 3NN8A 4ZFZA 4XZUA 4XPBL 1JBJA 1H5BA 1S9YB 1EMTL 2OZ4A 5T3ZD 4FNLH 4HSQA 3IXAA 4JY6B 2BNQA 3IKKA 4DGVH 3B9KD 4LLWB 2QV2A 2PCPB 2OTUB 1CG9B 3MUY1 5I8EB 2R69L 3ARDA 3OKYA 1NGXB 3QG6A 4WHYG 2YPVH 5E6ZA 4GW1A 1A3RH 3CFJB 4AMKL 4K2UH 5EZIL 4FXGA 3D2UB 3VD7A 1NFKA 3Q48A 2NY5H 1QFOA 2QQNH 1KTDB 1KCRL 2H32A 5GSRA 5IMKB 1KJVB 1FC1A 5DD6A 3RIFF 3OMZA 4M7KL 4JREC 3BD5A 2ZSWB 3K4DA 3BWAB 1RZKL 5I19H 1EGJA 1I8LC 3WLBA 4PJCA 3TYFB 1QQDB 2VRAA 4Y5XB 2PW1A 1DEEA 3LH2L 2XA8H 1XZ0B 3N1MC 4PJAE 4L3EB 1JYNA 3FQUB 2EH8H 1CLZL 4K7PX 4ODBD 3KPSE 5DQJA 3TN0C 3RWGB 5DMGD 5EZJA 4X99B 3FONA 5C86A 3HPJA 5E8OA 1LEGB 2B20A 3T08A 3V6FA 3D3VD 1S7XA 3GO1H 4YO0B 2VH5H 3BPLB 3V6ZA 5JIIA 1G84A 1IL1B 1B0RB 4PJEA 5GGRA 2WIMA 2E8YA 2OI9C 4W6YB 3TF7C 4I3SH 3T0EA 1JPFA 4F37K 5C9KA 4PJBB 4NKDB 4P46B 3QDHA 1OM3L 1RUPL 2DDQL 5DEGA 3NTCL 3EYQD 2E3VA 1KEML 4LCYB 1A5FL 4P9MH 1ACYL 4U1JB 3WFHA 2F58H 2FECI 2ESVB 1DLFH 5FYJE 4TOYL 3L3HB 5DJXB 2OL3L 4WDIA 4A6YA 4CN1A 5AZEL 1DANU 5FO9B 3I3BA 3B43A 2V5MA 2FWOB 1FE8H 3ZDXF 4QRRE 1BOGA 1U8JB 1WC7A 9CGTA 2XACC 2ARJB 3W82A 4JDTL 4PJXB 3RA7L 2ILLA 5BV7H 3AVEA 4PP1D 3UJTL 3MRLA 3VXUA 3W2DH 1FYTB 4CMMA 4K7PL 3LQAH 3VWJC 2FGZA 3QIUB 4X4MA 3ZT7A 5H8DA 3ARED 1F3DJ 1KB9K 4MJ5A 4KY1L 1G7PB 2FJGA 3BGMA 5F70A 4P23B 4JRYA 3LS4L 1UA6L 2VO5A 4L4TD 3QO1B 3D39E 4NGHH 3VFVB 4HJGB 4JCMA 3P4OA 2B39A 3VI4E 2HJLB 4WO4D 1Q0XL 2X4SB 3GBML 2MHAA 3QUMA 3T3PF 2FECL 1AGEB 1FN4A 1WAAA 4L3CA 3RPIB 4PGDA 3INUH 3G5ZA 4NP4L 4TUOA 5KVMC 3C5ZD 2H45A 4MAYC 1V3KA 3T2OA 4JY5H 1Y18B 4HIEA 3MV9D 3EOBB 2B0SH 3ZDZF 1BFVL 4OF3A 3NBNA 1HWGB 1PSKH 3VA2C 1X5FA 4JY4B 1Z9OA 5EN2A 2O5YL 4HDIA 5C08A 4FP8H 1UWEL 3S88H 4X7FC 5DRWB 3VD5A 5E7BA 1XGTA 1A6AB 5TJWK 2FSEB 3MJ8B 1JTPA 5ICZB 2EE6A 1S7TB 2QR0B 3WL9A 3OL2A 4YDJA 1BLNA 3BX7C 4N0UE 5CEZD 5JOPE 1A6WL 1U8MA 4J3WA 4JHWL 4UI2A 4WTWA 3HMXH 1OOAA 1MSPA 4PRBB 5DGRA 5DJ2B 2R4RL 1ZLVH 2ENSA 5F7DB 3UAJD 2BHZA 3VWJA 1JIBA 3ALXA 2G5RA 5F7FA 4ZD3L 4NRZA 1I75A 1KV3A 2OQJB 1F5WA 5FOBB 2CKNA 4MGXA 2AGJH 3EYOB 2NY0B 1MFAH 5I73B 1GPOH 1P4BL 4PYHA 3EHBC 4FMFA 1Z5LB 4OLYH 5ITFB 2DJ4A 2HFFA 4RGMC 3LZFH 1J8HE 3MA9H 2CDGA 1RK0B 4F7EA 4LF3B 3BE1H 1NGYA 3D69A 5B8CB 2R23A 5C70A 4LSPH 5HYJE 3LOWA 5IVXE 5F96L 4PJAF 4XNMB 1IQWH 5K93A 5C71A 1Z0MA 2P43B 3IDXL 1T0MA 4X6CF 4MAYA 3WV0A 3FO1A 4OCWL 1ONQA 4KMTL 4NJAL 5T1KB 3D18A 2CO6B 4WI3A 4KJWD 4XTRD 2IH3A 4U6VH 1FL6A 4OGYH 1C7TA 5GGSA 4QXUL 5IBLD 1G6RB 3CMOH 1NKRA 4M6AA 1P5UA 1QP1A 2HJKB 3V4VL 4MJID 3I9GL 3MJ9H 1DUYB 4WV1A 5EOQH 1FL3B 2X4PB 2BVOB 4YQXH 5J12B 1AGFA 1YQ2A 3VRIA 4RSVA 4JLRA 4WFHD 2YC1A 3BFOA 5D1XB 1YMHA 3CVIL 4GMSH 1S7VA 2G75A 1YA5A 5B21A 2FEEL 4HK0B 1GHFH 1CD9B 1PKQB 2FATL 4GUPA 3GSXA 1U3HB 1IEHA 2J6EA 4BQBA 4LCCC 2FEDC 1KC5L 1ZSDA 1P7QB 4C83B 1FNGB 3JWDL 2NY7L 4QYOA 1JV5A 4HEME 5DJAA 5C0DA 2C1PB 3ARBC 4EN3B 1HSBA 4J3SA 2EDYA 4DGYH 4Z5RA 4NQCB 4D9QE 5IOPA 1VADA 4OFYD 4H26A 4I18C 1A7PL 5D1ZC 3H2WA 4IOFD 4NQSA 3L9RA 1T6VN 4X5WB 1YJDH 5KVDH 2G9HA 3TBYB 2YKLL 2IALB 43C9A 1CICA 3HAEA 2D7QA 4GAJL 3DX9A 3MV8E 1RIUH 4WW1A 3EDDA 4EXKA 2MPAL 2HTLC 4R2GD 3PGDB 1A9BB 2H2SC 5EU6D 1BF2A 3MXWL 1H3UA 3HE6A 4FQLH 3BKMH 4LLUA 4QT5A 5KSBE 1DQTA 4NZTL 4LFHG 1KOAA 2B5IB 3MFGB 3HG1D 1YYLL 2V2XB 3DUSB 1R3LA 3BI9X 4BUHA 3VI4F 1E28B 1TPXC 1UYWH 1D5ZB 4MDJA 1NFIA 4KVCH 4K7PY 4ODUB 3STLA 1GYAA 2W9LA 3ULVD 4HAFA 3IFNH 4MSWB 3RI5K 2FD6H 2P49B 4ODXA 3ARRA 3P3YA 1NGQL 3MCLL 1ORSA 3V4PH 1NANH 4OM0H 4WHCA 1DSFH 3F7VB 5DVKA 4NQVA 4ZPVB 1FQ9C 3GDBA 2H8PA 4ZUSB 1MCLA 2L4OA 3NH7L 4JQVA 3ARPA 4QTHA 4HLZH 5DUPL 5IQ7H 3N06B 1WCQA 3U7WL 3S5LB 1LEIA 4LEOA 4G8GD 4Y7MA 4APQA 2VKXA 1R3IL 3FOLB 1N5AA 3O9WB 4LIQL 4P3WA 2FYYB 5T1MB 5C0JA 12E8H 3MLRL 4K8RL 2FDBP 4ZOBA 2X9WA 4I18A 4U0RB 5D1ZA 4M1GL 1LDSA 5EO1B 3HZMA 4XAWL 4C59B 4FXLA 2Y1VA 5CD3A 4MWFA 4GG6B 1H8OA 1YEHL 3HNSL 3BP7A 2J8UF 3OAYH 4IEFB 2AI0H 1OTUC 3RY5A 2DLFH 2OCFD 4PTTB 4RNRB 5FCUL 2V9QA 2EDRA 4I5BA 2IAMA 4Y8AA 3TFKC 2FHFA 1RU9L 3WNPA 1A6PA 4XAKD 1FH5L 1MJ8H 2HLFD 2WIIB 3WXWL 2DLGA 3B9KB 4KRPD 1IFHL 4M6OL 3RJDA 1P53A 2YBRB 4NIKB 5AAWA 4XC3L 3IDGB 4PJBE 2VDQH 1QG3A 1YEDA 5EBLA 3NAAH 4ZUVA 2AXGB 3WHXA 4YHKL 1FNEA 1Z3GH 3OAZK 3SKNB 2FX7H 2HN7B 2J3SA 3BO8A 2YUZA 2GK0A 4TVPE 4FQHA 4PJ9A 5JW4R 3W0WE 3FHAA 2KBGA 1YEJL 1HH6A 3KWWA 1AR2A 1KCVL 5KVGL 3MJ7A 1IGYA 4X6DB 5L2JA 2XZCH 3QFJE 1IM9A 3VW3H 1GIGH 3PE9A 3GZKA 1ZAGA 1RZIB 2APTA 2ICWJ 1DANT 1S7RB 3EJZD 4ZSOB 1BFOA 4RAVB 4U6HA 2BOBA 1QOKA 1ZHLA 4FFYL 4G6ML 3HC3L 3VMNA 4XGZB 4QRRA 4NM8L 4C4KO 1WFUA 4PJXE 4HWNA 4FQ2H 2BX5A 2VITB 4HJJH 3BUYA 1JUFB 4Y4FC 4JKLA 3O0RL 1BQHB 3OG4B 4ODVH 3EYUL 2UY7A 4ODWB 2I27N 2J1KA 5E6IC 2X7LA 5TE4H 1GC1H 3SDXE 4QTIL 1MCSA 2VXTL 5CJOH 1QA9B 5HYEA 1HILB 2QHRL 3BVNA 5IMOA 2GT9A 4JVUA 4JM2B 4Y16D 1OARH 1TIUA 1OSPL 4LVHC 4N9GB 3QA3A 3D39A 4YAQA 2D0HA 4B7IA 4AIZA 1I1YA 1SY6L 3HUJB 5J6HA 2UYLA 4LNRB 5EC1B 3F7RA 3SEPA 3PGCB 1J9CT 1KIQB 4HUUA 1I7UA 5DUBB 1B6DA 1EUTA 4TYUA 4UNTA 5I1AB 1J0HA 3LKOA 3M8OH 1T83C 3B9VA 4PJ8D 3IFLL 1YNTB 3WUZA 3O81A 3RIAF 5FDWA 5K9KA 3VFRB 3MRFB 4LLDB 2QKIB 3GMQA 4XP9H 2LFGA 4HEPG 1NH6A 2J12B 4RZCA 1RVFL 1I7RA 1D9KB 1QSZA 4H20L 5F6IC 3CSGA 3PL6C 4ZUWA 4PJGA 2VXUL 2NY3D 2NXYB 2UZIH 1JHKH 4YHNB 1XIWC 1JPST 2LE9A 4NRXA 3F65A 3I6LE 3WNNA 3HLAA 3IAPA 3MRPB 5I1DB 5HJ3B 3IRZA 5C7XH 3C5SA 2YWZA 3BP6B 4N0UA 1BIHA 1UZ8A 1SEQL 1UB6B 2C3HA 1AE6H 1I8KB 5IROC 1IKFH 1A1MB 4Y4FA 5HY9A 4LMQE 1BVLB 3L3JA 4HIJA 4DQOL 1XR9B 2IAND 3KYOA 5FHAH 2OP4L 5J57B 3B2VL 2ZOLB 4KK8C 3FT3A 2EKSA 1SM3L 4WO4B 2O5XL 4NWUL 2K7PA 5DSCA 1RK1B 5F44A 2Z93B 1DVFC 4XP4H 4Z77A 4JG0H 3QDJA 4GT7A 2GCYB 4HMCA 3Q3GB 4WEMB 4YBQD 3MRRB 4G43A 1J8HA 1BFSA 2Y07H 3CPLA 5JW3L 5DHXB 3LPGA 4YXKL 5HYJA 3MRDA 5CKGA 5IVXA 4F3FA 1NCWH 2Y9RT 2V7HA 5I9QB 4UDTA 3TBWA 4HFWB 3S97C 4ELMB 5JOFB 4X5LA 1T83A 4JDZA 4TNWF 4BSVA 4KMQA 1NC2A 1YNKH 4LOUC 3ROOA 4NDMB 4XRCB 3MACH 3GRWL 3DLQR 4MD4B 5FEBA 3OZ9L 1YNLH 5C0EA 3RVVD 1JFQH 3PL6A 4IOIB 2MQ0A 1TCMA 4UINL 3T0WA 2WWMC 1HI6B 4PJBF 3X3FL 1MF2H 1XIWA 2DIBA 2XPGA 3A0OA 2HMIC 4K9EL 3KLAB 1VGEL 5GS0L 2DMCA 3I2CL 1KJ3L 2IC2A 1YMME 4X6EA 1HHIA 4ZAKD 3UPCA 4M3KB 2CSPA 3WD5L 3WN5A 1ND0A 4YK4C 1L9MA 4HH9A 4L29B 1G6RH 3REWA 1UQSB 2D03L 3TCLA 2E8ZA 2V2TB 3DUHA 3VFMA 4HC1A 2F8OA 1F11A 4E0RA 1TCRA 1LEKA 4F8TA 2NCMA 2GY7B 2A6KA 1QSEB 1Q9OB 2IPUG 3KLHD 3WJLC 1OP9A 5GGQL 3LSOA 4XT1C 2AXFA 5BMFH 2YUXA 2Q3AA 1UVQB 4KDWA 4KK9C 4WU5B 3QHFH 3W9DA 1G7QA 2XQBL 2ZNWA 1A1OB 2VIRA 3ZKMD 3GHEL 3P4NA 4NQCE 3M45A 3JUYA 3WKNA 5EU5A 4MCZA 2X5PA 4Q6IB 2ATPB 4PJXF 2WWKT 4X80H 3BZFB 3O3DA 5DDHB 1BREA 2CKBL 4NHCL 1OGAD 1WBYA 2VJXA 3MRCA 4EVNA 1AGCA 2W65B 5KVEH 3O2DL 3MV8A 5A2JH 4GKNB 2YD1A 3KYMA 3O6KL 4MDIB 1D5MB 1CN4A 3MMEB 3SE3A 1RIHL 1UM6L 1YC7A 4OLZL 5KBNC 1Q9LB 2ADGA 4H8WL 4PV8A 5KSBA 4FABL 3FZUD 4XBEH 1TZHA 4YDVB 3ZKXC 2EXYD 2ZG1A 4JG1H 1E6OH 1D6EA 5JLZA 2QL1A 3CDFA 1X5IA 3S4SB 3MFFB 5FO7B 4KZDL 3SKMA 5GRWA 5I6XC 2ZUWA 3L5HA 4DVBA 5JQ6H 2RB8A 3AAZB 5GHWL 3QAZB 5ERWA 4H8WC 3AS0A 2ERJC 2Z31D 5H35B 2YPLE 1UGNA 3MODH 4KDTC 1IQDB 5A2LH 3K1DA 4X6BB 1ZA6A 1N0XL 4DZ8A 1CG9A 4R7NB 4M7JL 5I8OL 1NCAH 2FH6A 1HEZA 1KULA 4TULL 4PJ7B 3FRPA 3J8F7 5IEKB 2Q1EA 1GGCL 1PG7W 2I9TA 2XT1B 4U3CA 5CHNA 5CSBA 3WJLA 4WUKL 4URTB 3IU4H 1SYSB 1RURH 1X5GA 2LVCA 2VDPL 5JO5B 3S37X 3GHBL 3QXWA 1F45A 1QBLL 5DJCA 5IR1A 2HG5B 3LDBC 3L5WB 4NC0B 1DBKL 1E4KC 2QQLH 4NNXA 4HF5L 1HYSD 4GRLD 5EU6B 4PY7A 4YIQB 1KB5B 2BCKB 1XFPA 1A6UH 4GG6E 3W11D 3HG1B 2VLME 3MLSH 5LBSL 5B39B 3L3KA 5JUEL 3QIWA 1FV1B 2V7NA 5I17A 5I8KL 4E42A 3RWGA 4O2EA 4PTUB 4YHYB 4TUJB 2FZ3B 4P9HC 4XP1H 1JRHL 1AR1C 3C2SA 3GSNA 1F4YH 3QUZB 3GSWA 4J12A 4TPRL 5T1LA 3QEHA 5T3ZE 5DI8B 1KTKE 3MLVL 4IS6A 4HW6A 5C2UB 1I4FA 3PV6B 3CSYB 5J6GA 2WUCH 4P5MA 4LKXB 3BISA 4OKVA 4JO4L 5I1LA 3AXLA 4DN4L 1VPOH 1T21A 3GIZL 4EUPB 2DLHA 1QFPA 3H3KA 2MQCA 5SV3A 3O6FB 4UILL 1UADC 4ZXBC 3SDAC 2QADD 3W0WA 1MRDH 2CK2A 3RGVD 5CAYB 4Z7UB 4FZ8H 3SDYH 5CZVL 1JWMB 3QFJA 2XTJB 3L3HA 5DJXA 5JZ7D 4O9HH 5D96C 2XXCB 3S37L 4HWEL 4HUWA 4CMHB 2I60L 1DJSA 4OT1H 3UTOA 4ZSOE 1AXSA 1MFDL 1F90L 3RKDC 3HMWL 1OF2B 3P11H 3CUPB 5AYUH 4S1SL 4N5UA 4LRNH 1T1XA 5CZXC 3X12A 5I75C 3D3VE 35C8H 1DLHA 1KPUA 2PW2B 1P1ZB 4RA0C 4PJ5D 5KTEH 5JPMA 3SDXA 5FECB 1AC6A 2P42B 4HX1B 1IC4L 1NLBL 4KRPB 4PRIB 1TXKA 1MFBH 1AQKL 3T0VA 2Q20A 5D8JH 1WWBX 4HGWB 3VRJB 4Z76B 4KROB 5HTSA 3PWJA 2JJVA 1CDUA 1U3ZA 4FFZL 1F58H 4K71C 5EOCH 2CK0H 4GKZB 2HAZA 3DMMC 3QNZB 5FYKD 3ZL4L 5F7NC 4JFPB 2VYRE 3SDDC 1HINL 4YPJA 3W39B 1CFVL 1ADQH 1HWHB 3BH8A 1NCCL 3GKWH 1G7HB 1W0WA 1LO0L 4KVNL 2Z92A 4ZOEA 3TM6A 5AEAA 2VQ1A 1FHGA 3O2WL 5I71C 3UCRA 1HNGA 2R2EA 2NY4C 3HNTL 4QRQB 1IEBB 1RULH 2NTFB 4GRWB 4ZO7A 5BZWB 2H3NB 4KGLA 5JQHC 5EH1A 4X98A 3VFPA 1P9MC 1TJIH 2UWEA 2W0KA 4HPOL 5DHVA 4LHUA 3C8DA 1DE4B 2I5YL 3OXRB 3QUXB 2C1OB 1WZLA 4LPTA 2DLEA 4Y2DD 5L88L 4I2XE 4Y4HD 5E8DL 3LD8B 2CDFB 2JKXA 4ODHL 2AJSL 3RWJA 5KOMC 2X89A 3WHE1 3LN4B 2OK0H 3G6DH 2DI9A 1U36A 1WIOA 4M6NH 2AJVL 1J0IA 3QEUA 2HVKA 2PXYD 4GXUM 5KVFL 3VFOB 3BESR 4WUUA 1YN6A 3L3OA 4L4TE 3UTZA 1I8MB 4JN1H 4BM7A 3FOMB 3ES6A 1N3NB 1W72A 4JM4L 2BSTB 3DVGA 3VFGL 3N85L 1YYML 4TNVF 5T1DL 5IHZA 4ZYKA 3K0WA 2OZ4L 3BPOC 2DQUL 2VZSA 2NXZC 3THMH 5EA0H 4OFKA 1OSZA 1DN0A 1SJEA 2YSSA 3MV9E 1HE7A 1KN2L 3G08A 2EXWD 4EI5C 4GG6F 1TJHL 2K9UA 5HGHA 5D6CB 5BW7C 1I7TA 1QRNB 4WI4A 5IK3A 3VWKD 1K8IB 4PB0L 1EPFA 1BIIB 3LEXA 1CXKA 4WU7A 4JFFB 5GQBA 1MWAA 4RWYL 1R0AH 3MNWB 4HBCL 4BFGA 4J2XA 4AJ0A 4Q9QL 3EJJX 3I02A 1I7ZA 5L9DL 3J7HA 3LY6A 1EGJL 1NC4A 4LLQA 5TH2A 3AMLA 4MXQD 4NFDA 5CEZE 3P0YH 3QQ3B 3RDTC 5EO0A 1P9MA 5SWZB 5TE6H 2ADJB 3D0LA 3PABA 2R15A 4HZAA 1YMMA 1UACL 2HT3C 1RJYA 5CGYD 4U1GB 1WT5C 3IS1X 4JHAH 1QUNA 2CUHA 2DTML 2OXGA 4RMRA 4OZFG 3ZHDA 3EYVA 2YHGA 2RFXB 4X6DF 4X9GA 2ZNXA 1QSEE 2Q8AH 5I76A 1W0VB 1A3QA 5DRNB 2W07A 4OCXL 2H1PH 4C83A 2DRUA 3FN3A 1HHJB 4MJ4A 5DEFA 1HZHL 3RUGB 3QIBB 1FJ1A 3SOBL 4G42B 1FRGL 1G7JA 1U92A 4YDIL 5KJRH 2Q76B 2VDKH 4UOW0 4W6WB 4F33B 4QHLB 3H8NA 4CVXB 3RVXD 3FO0L 2CRMA 3L3GB 2VLRD 4YNYB 4Y4KB 4L5FH 3QCVL 1IM3B 3TYGH 5DTFA 4EI5A 4F7CA 3OB0K 3H3PH 1ZHBA 5SX5H 3S34L 5BW7A 4MJIE 4V1DD 4D0BA 2NYYC 1FAIL 2QSTA 1DL7L 3TO4C 4RBPK 2GITB 4JM2F 3DOSA 4O2CA 3BKCH 4WFHE 3ALWA 4ZAKB 1EO7A 4QRSA 4Y1AB 5HHQA 3HUJF 5GRVK 1T7VA 3UEZA 5BZDB 1Y6KR 3BIKA 3LKSB 4X4YB 4LLMA 4MHHI 1JZ7A 2RBLA 2HKHH 1AXTL 3DVFA 3BQUD 3IDIB 4DN3H 5EBWB 2YPLA 4WHTA 5EB9A 4NO2A 5CWSB 3AS3A 4C56B 4PJ7E 4NQED 3L7EA 2AK1H 1T1WB 1RJLB 3VXMD 1RZ8A 1SBBA 3MLUL 4PRDB 3T2NH 2DBJA 4HUXB 4PS4H 5FGRA 1NGPH 1N2RA 5E2UH 3LKNA 4MNGB 1OGAB 3GSVA 3ULUC 2DQJH 5E5MA 1OP5H 4DCQB 2NY2B 4YEFA 2DBLH 3FFCB 5EORL 2P7TB 5MENB 5EU6E 5DMGC 4LSTL 2YD4A 1EIBA 3L3IA 1VKXA 3IFPA 3FCTA 1T20A 4WFFD 1TVBA 5H94B 1YY8B 1WZKA 3HG1E 3IYLW 4JPKL 4GG6A 2VR4A 1LO2L 4HG4K 1C5CL 1P7KB 3O3AB 4RIRA 3RX8A 4QWWC 2R1YA 3RWDB 4LCWD 5FF6B 1D5XA 1LD9B 1KB5H 3ULVE 1TNMA 1QFHA 3C6LD 4EIZC 2R0ZL 5ABDE 3GJFB 3SE4C 1NGWB 1UT9A 2Z31B 3C8KA 3KJ4B 1SJHA 5GRJH 4PJDB 3FQTB 2VLKD 3K4ZA 2XA3A 5HGBB 2B7DT 2D7MA 4PLKD 1FGVL 4RQQA 1F13A 4KV5E 1KLUA 2Q7NA 4GQ9H 4F80A 5LXGH 2P8MB 5FA3B 1J5OH 1OD7A 1RQ5A 2HN7A 5MEQA 3AS1A 3UPRA 1JZ5A 5LQBH 2AV1B 1KPVA 2BVTA 4G8GE 3QDGA 2QQKL 5D2NE 1YEEH 3OHXB 3WIHH 1MFEH 1JWSB 5TF0A 4NUJA 1MVUB 4OLEA 2W0LA 5DQDH 5DMKA 4LVNC 2X4QA 4KQ4L 5BXFB 1ZHNB 3WFCL 4WHYH 3ARWA 4XMKH 3SGJA 4XNZB 3RKPA 2NZ9D 2ORBL 4ZG1A 4OLWH 5F1IB 3C60B 1CDYA 3HHRB 3SGKC 4NM4L 4U1SA 1A6TB 1G6VK 1MH5A 4QF1A 3P9LA 5FB8B 2Y36L 3A6CL 4UB0H 2IMNA 2A9NH 4ODTL 1LO4H 2FX8L 4ODWA 3QBTB 3D3VA 3TESA 1F3JB 3GMLA 4N0CD 3IB4A 4XAKE 4M43H 3ZYIA 3VXSB 4V2CB 3ZHKA 3BKJH 1JNJA 3M17A 1WTGT 5HVHB 1KIRA 4E9LA 3D25A 5C1MB 2F54A 3C5ZC 1H15A 5HHPA 1CU4H 5MEOA 3MBEC 3FB7B 4R0LC 3CH1A 1R24B 3SE4A 3BZDA 1UWXK 1N4XL 3L95B 3FFDB 3Q6FA 4ELKA 2WBWB 1E27A 4OZIA 1YDPA 4DW2L 2FR4B 2A38A 5IWLC 2DIAA 3O2VL 4M8VA 4N8VB 5CD5C 1K3IA 3RGVB 4R90L 3FO2A 3VFTA 1IAKA 1C08B 3OB8A 2FH8A 3RNQA 4Z7QE 3QXTA 4NN6B 4OQTA 2BRQA 2XZZA 3DROB 4GRWE 1R3KB 2B4CL 5AG8A 3ARTA 1AP2A 1U95B 4G6FB 4KDVA 1JPSH 1MHEB 2NNAB 3MC0A 4X9BA 5EZOL 1BJ1J 4NQDB 3ARFC 1T0NB 4P2OB 5C0RH 3MLTB 5K9OB 2W9EH 3SGKA 4I2XA 2GFBA 1E4JA 3MZTA 4XCYB 1TQCC 5IKCB 4HKXB 5D93B 4U6XA 5HI5C 1UH3A 1FGNL 2MKWA 2GSGB 3QH3A 4NCDA 6FABH 1J7VR 4PJ7F 4DFIA 2ENYA 1I9JH 3AREA 4JFYA 3N0PB 4HIIA 3GB7A 4LLVB 4HS6B 3BOVA 4L4TA 3TPUA 3B6SB 4Y8DC 2W0FA 1G1YA 4NO0D 2DQTH 5I16B 3UJJH 4GAYB 4RISH 2X2YA 1YN7B 3MBXH 4UT6L 3RWEB 5FOJA 4JHBA 4Z0BL 5BJTA 5F3HB 5B22A 5IESH 3C5ZA 1Y6MR 4G80B 3CX5J 1NKOA 3MBEA 5TE7L 5BRZB 3MV9A 5E4EB 4IRSD 3WXVH 4R0LA 3JBG7 4KJWC 5CBAB 1X6LA 3CFBB 2WLYA 4RFOL 3QDMD 3WEXB 2HVJB 3QFDB 3O3BB 2NY5C 3EO0A 5IWLA 2QSVA 5HHMB 4S1RH 4X4ZA 3ZO0A 3CLFL 5HPOA 2BNUB 1OT2A 3DETD 4E5XB 3JV0A 4RFNB 3HI5H 5CUSH 5E9DD 4P2QB 4EDXB 3HKFA 4R8WH 1TETL 2P24B 2YOCA 4JDVA 4YFLI 3ULVF 2Z8SA 4Z78B 1U2CA 5DZNA 5D1QB 1NMBH 3FN0L 1ZEAL 4JPWH 5DK3A 3L7FA 1OAUH 2YD6A 2P5WB 1I1AD 1MJ7H 2PXYB 3KLAA 4NWTL 4IIQC 3ARFA 3CDGB 2IANE 5HD8C 4MQXC 4N8CL 3ETBF 5ADOH 5GXBB 1AD0B 3A6BL 4Q97A 1F4WL 4BKLB 4J6RL 3RHWK 2NY6D 4W4OA 3VGHA 1OTTC 3HB3D 1DBBL 2APWA 3KXFD 4XPBH 1EMTH 4EOWL 4Z95L 3RUGE 4JFQA 3PNWA 4UBDC 2H26B 2ZUSA 1FZOB 2R69H 4JFEA 4R2GC 3I6GB 3W5NA 1NEUA 1ZHKA 4AMKH 4Q6IA 3LKPA 3VWKB 3FQRA 5EZIH 4F15B 5HVFB 5DDHA 3H7BB 4YFDB 3VXTB 2WLZA 1KCRH 4KUZL 2RHEA 2VL5B 4GRMB 4WTZA 5FYJL 4H1LA 3I6KA 5DRXB 1S5IL 4EKXA 2ZZUT 4M7KH 1LWRA 1MRFL 4YEEA 4CNIB 4MJIA 1RZKH 4NKMA 4P5KB 2Z9TA 3WDIA 5ID0A 3F6IA 1HIML 3LH2H 1MCJA 3QPXL 3GSQA 3WUWA 1FBIH 5BV7C 3EFFA 1CLZH 2C4FU 5HGGS 5GJSL 1NBYA 3B2UD 3LQAC 4JFXB 3WCYA 4FQXD 2A83B 1CDCA 1U41A 1PVHA 4NT6A 3MRKB 2FGWL 3TBVB 3DECA 3WLWD 1X6NA 3W9EA 5JORB 5L0QC 1U8OB 4IIQA 4YHOL 5BVJA 1NGZB 5HVWA 4HS3A 2OSLB 3QWQB 4UUJA 4ENED 2JCCB 4GRWF 3SDCC 4XNUL 5BVPL 1IAOA 4I9WD 3QPQD 4OFYA 1OM3H 1RUPH 2DDQH 3DARA 3DX8B 3NTCH 1OGAE 2ICES 2J2ZA 3K2MC 3S88L 3OR6B 2VLLB 1KEMH 1A5FH 1CFNA 4FN0A 1MHPL 4NZUL 4RWHA 2HG5A 1EZVX 5EPMA 4XWGL 3SCMB 4TOYH 3STBA 5DO2D 5TGBA 2OL3H 3MRQB 4MA1C 3L6FB 4P4RA 4WI8A 1KJMA 4P2CG 5E4IA 4ONHB 3K8KA 5AZEH 1WWWX 3X14A 4DOHB 1UEMA 1JGVL 3KPQA 4XNXL 3HG1A 1ES0A 2FJFA 3IXTA 4U2YA 2MCPL 1T66D 4TNVK 2EO9A 5ENWA 3OJ2C 2W60A 3CXDL 5BOZG 4AH2A 3GMPA 3CMGA 1RY7B 3BP4B 4H88L 2C3VB 2E9JA 1A9EB 2APVA 5E00B 5L6YL 4JDTH 4QHNB 1T6WA 3RA7H 4CW1B 2HT2D 1ORQB 3UJTH 1IVLA 3QCUL 3V7AG 1GZPB 4K7PH 1URLA 3BP5B 1L0YA 3BQUB 5J3HD 4LPCA 4NO3A 1JWUA 1UXWA 3TA3C 3JWOL 4OZGB 2NMSA 2BNQD 1H3TA 4IOSD 4KY1H 2NY1D 5E8PB 4PJHB 3VXMB 3LS4H 1UA6H 1DEDA 5L8KB 5IB3B 1FP5A 3ARDD 3IDMB 1MCOL 1A1NB 3GSRA 1E0OB 1S8DB 2CLZA 2I24N 3EOAB 4G8GA 1Q0XH 5D2NA 5IF0B 2L7UA 1K5NB 2AW2A 4HWZB 2AKRA 1X7QB 2VAJA 4NP4H 3SDCA 3JTTB 1N5YL 5K9JL 1CLOL 3FQNB 1FVCB 1BFVH 4OIBA 2ZG2A 5F9WB 4CL7A 4KQ3L 1NMCB 4U1HA 5JPNB 4J1UB 3D85A 2O5YH 1WZ1L 3HFML 4OF7A 1U91A 4NPYA 1UWEH 4P5TD 3JUZA 5EC2A 4O02L 1QBAA 2VZ3A 4KPHL 5DJ0A 4YPGB 4DK3A 3MPCA 2F15A 3B9EA 4CVZB 3HZKA 1AH1A 1C5DB 1JP5A 3RUGF 4HWBA 4XVTL 1DR9A 1JF1B 1FL5A 1A6WH 1NDGB 3GM0A 2EYSB 4YLQT 4LSVL 4PIRF 4JHWH 2DLTA 3KG5A 2RR3A 1OQXA 1IJ9A 5DURB 2R4RH 4P2RD 2DMKA 3RTQC 4DGYL 3T0ED 3HMXA 4BSWA 4ZD3H 5CEXB 4P57A 3MO1A 3DNKA 4Y5YB 3IGAA 3ROLA 5K9QI 1CXIA 2KZ1B 1CE1L 1QR4A 3AU1B 4ISVB 3GIVB 1P4BH 2O61B 1VCAA 4OI7A 4JKPL 5HGAB 1LK2B 3VXOA 5F7LB 3RBSA 1WF5A 4L8SC 3BIBX 1CIUA 3ZLQC 2EDTA 1F6FB 5F96H 1FFPB 1YJDC 2EEBA 2F8XC 3IDXH 4I0PC 5DRZB 1J05B 4MD5B 5GRVL 4OCWH 5KS9E 2XWTB 1A0QL 4KMTH 4NJAH 2SEBB 2PYFB 1RSFA 4I48B 1GZQB 4PJ5E 1MNUL 3MREA 4M5YL 2QBWA 1FZKB 3VFNA 4QXUH 2DM7A 1B90A 4OB5H 2VDML 1MHHB 3D9AL 2NW3A 3V4VH 3TIDB 4LSQL 3VD4A 3I9GH 2ARJQ 2EDNA 4CVUA 1DSFL 2HJFA 5A40E 2R2HB 5C0AA 1I8MA 5IV2A 3TN0D 5EFIA 4Y16A 1OD9A 5C0GA 3CVIH 5FYKE 4JRYD 2E9IA 2Q3ZA 2Z35B 4ZOCA 1M05A 4JQIL 5J89A 3G5YA 4RAHA 3QXVA 3G6JE 4DTGL 1U8PB 1QR1A 4S2SA 3G5XB 4GW4B 2BC4A 3GJEA 8FABA 4XPAL 4OV6F 1KC5H 2CKBB 4PJ8A 4IRJB 4GXVL 4XVUC 2CRIA 3RTQA 3JWDH 2NY7H 3OBAA 12E8L 1NUGA 1M6OB 1Q1JL 4JN2B 3H9YA 1AY1L 4U2ZA 4XXDA 4MNQD 1L6XA 1A7PH 4KRLB 1BWMA 1RFDL 4OD2B 2YKLH 3PWVA 5IFHH 3P4MA 4GAJH 1XH3B 2XKNA 5IW6B 4L3AA 2MPAH 1SEBB 4MD0A 3K74B 1T7WA 4JHZA 3B3IB 2ZCLL 3MXWH 3UTQA 4BH7A 1YECL 2MCG1 2HWZH 2GK2A 4N1HB 3NGBB 4UV7L 4ZS7L 2E6QA 4NZTH 3TWCL 1X9QA 3KJ6L 5KSUA 1YYLH 3T8XB 4R4FL 3TBTB 4MCYA 1EH9A 5EULV 2IANA 5J13B 1R5WB 3O3UN 3GSNL 2C3WA 1XCQB 3GK8L 4Y5XC 2EEAA 3X13A 3HE7D 1HN1A 3OXSA 3ZKMC 1A7QH 3S36L 3LRGA 4CGTA 4YE4L 1FFOA 4UU9A 1KCLA 4BELD 2C9AA 3B5HA 5EZLA 3U36B 8CGTA 4O5LL 2KQNA 1NGQH 3MCLH 3PHQA 4O2FA 4X9IA 2MSPA 2VAAB 4X0KB 3IKCA 2CLRA 3EOTL 4HKBA 4R96B 1FO0B 4ZTPL 4WEUD 3BPLC 1FNAA 1VA9A 2Q8BL 3HS0B 3NH7H 5TF1L 4HIHA 3ZSTA 3TNNA 1WWAX 4P2YA 4TVPL 1KTLB 2BJML 1J10A 5DUPH 4OBRA 4M8QA 3U7WH 4F9PC 2G5BB 4P46C 1RHHA 5FIEA 3G5VA 4MAYD 4FQJL 1R3IH 5I15L 3FB5B 3MRIB 3T1FA 5FKAA 4ZDHB 4LIQH 1J1OL 1X5HA 4PG9A 3OKOA 3K8MA 4K8RH 1BD2D 5BS0B 1EZVY 2MKLC 1AGDA 4M1GH 2NTSP 3OKDB 1X5LA 2AV7B 3AROA 2D31B 1I1AB 1J0ZA 4XAWH 4JGMA 4Y19D 4LPVA 1YEHH 3HNSH 5FUCC 5IW1A 1QLFB 3U0PA 5JXEC 3CCHA 1XF5B 2FO4A 1GC1C 3IU3B 3BHBA 5FCUH 3REVB 3VD3A 2EDXA 4G9FD 2X4NB 3LIZH 1KPRB 4PGCA 5KAQF 2W9DL 3ZKSD 2Q6WB 1RU9H 5I0ZA 5AYQA 4RMVA 2MMXA 1FH5H 1C1EL 3WXWH 4OD3L 4AM0A 5F9AC 2JCCE 1PYWB 2OLDA 1IFHH 4M6OH 4LMQI 3QIUC 4XC3H 4UOW1 3CFCL 5I30L 3TGXA 2X1WL 4GRLC 4YHKH 3BW9A 4XC1L 4QCIB 2VLRE 3PHOB 5FAAA 4P23C 3MRBA 3IS0X 1YEJH 3ZHLA 1KCVH 2C7UB 5KVGH 1C16B 5TDPA 1W8OA 3CFEA 4WJ5B 5IFJB 3UZQA 3QJFB 3FB8A 3NACL 5F9DC 1BZQK 1ZVSB 1YC8A 4DOHE 1A7NL 5I1EL 5IMMB 1A64A 1L7TL 4HS8L 3P4LA 1I9EA 4X8JB 1S9XA 1EEZB 2FIKB 1MCEA 5E1AA 4FFYH 4G6MH 3HC3H 4NBZB 3NFNA 4NM8H 1A47A 3G6JF 3VG9C 4YHPB 4FQXB 1U8LA 5ICYA 3O0RH 4FQCL 2DKUA 5JIHA 5LG1A 3EYUH 1J0JA 5FKPB 2CXGA 1ZGLB 1HOCA 1VFMA 5DMYA 3C6SA 3KPMB 1CFSB 2P8PA 4QTIH 1CD0A 2G60L 4Z7VE 3EO1B 2VXTH 1B0GB 4NQEE 2PTTA 2AXHA 1S7WA 4RX4D 4KKAC 3VXME 2IADB 3RWHA 3U79A 1D7FA 1HQRA 4L4VD 4X83A 43CAA 2V6HA 1VACA 1MUJB 1N59B 1PJ9A 1AGBA 1SY6H 4LDEB 3U4EB 3ARVA 5DJZB 4NOFA 4MXWL 4EI6A 2FEDD 5JA9A 4CN4A 2GSIB 6CGTA 3U4BL 3MCKA 2ZKHH 4GRLA 1DUZB 1YNLL 1BVKA 3ARBD 1T04A 4WFFE 3IFLH 5CMAB 1BBJB 1I3UA 2EE9A 1JFQL 2NY0C 2VXQL 5KG9B 2Z8RA 1JGDA 3PWNA 3GMMB 1MWAL 4HKJA 1HH9B 5D1ZD 1Q94B 1K8DA 1RVFH 1P6AB 5E8NA 4H20H 4S0TD 5B8CC 4JR9L 2VXUH 2V5YA 4LCWE 2D3VA 5I2IA 3U9UA 5EBGA 2HTLD 4KI5E 3MRMA 1I3RA 3BJ91 1AHWC 1NEZB 1T1ZA 2H2SD 2WQ8A 1S9VA 1L0XA 3NCJH 4WGWB 3R1GL 2VLKE 3IETB 2X4RB 3Q1SL 4ZFZB 5C2BL 4XZUB 3WE6A 2GJ6D 5F1SA 5HDQL 1H5BB 1SEQH 4FA8A 3IXAB 4Q2ZA 2BNQB 2D2OA 1BM3L 2OJEA 3IDYB 3STZB 4DQOH 3ARDB 1WUNT 1WFNA 2OP4H 3QG6B 3B2VH 4KK6C 4GW1B 3CX2A 1MRCL 4FXGB 1SM3H 2O5XH 1UH2A 4NWUH 3HCVA 4E41D 5FGSA 1UJ3C 4L8DA 2H32B 1FORL 3DVNA 4MZ3A 4WRLA 5GSRB 1C7SA 2XOTA 1LE9A 4IJ3B 4HBQA 4KMLB 4WCYL 4UTBL 1H8NA 1IM9D 5IVOA 3FL7A 2ZCHL 5JW3H 4YXKH 3WLBB 4PJCB 5CP3A 3QUYC 1N6VA 4NCC2 5DD3L 4DZBA 4Q9CA 1B88A 2BDNH 1AJ7L 1DEEB 2PW1B 3C08L 2VDOH 3U9PL 3M07A 3EDEA 2BVUA 4EN3C 4BFIA 2M2DA 4MA7L 3MNVA 1IAIL 1AFVL 1INDL 1FIEA 5KS9A 3B5TA 3CK0H 2QQQA 3EIFA 3PJSA 4OCYL 4P3DA 5DQJB 5F1NA 3WNMA 3GRWH 5EZJB 5K9OA 3FONB 4PJ5A 3OZ9H 3HPJB 5E8OB 3V6FB 1L6ZA 1S7XB 2VL4A 5FGCE 2JCCF 3V6ZB 4UINH 3QSKB 3X3FH 4PJEB 5GGRB 1VGEH 5GS0H 1KJ3H 1OTUD 3I2CH 3WD5H 1AHWA 1YEFL 3OAUL 1OQOA 4PGEA 5AWNL 3DPBA 3BT2L 1JPFB 3T0EB 3QXDA 4ETQA 2B5IC 2D03H 5J8OA 2UUDK 5J1TC 4JO3L 5DEGB 3TFKD 2EDLA 3G6JA 1MQKL 4G8IB 5CINL 1BAFL 3MLXL 5HYQA 1T5XA 4J8RA 4MNHA 3BH9A 4RGNB 5GGQH 3WFHB 5C09A 4NKIL 1J1PL 3QNXA 3PG2A 3IDJA 2VQTA 3D6GA 2FB4L 4WDIB 3HR6A 2XQBH 3UTTA 1RZJL 4MXQC 4A6YB 3GHEH 1AKJD 5MERA 1QFWI 4UMGA 2IGFL 2CKBH 3UTSD 4NHCH 1M71A 2GAZA 2MWCA 1WC7B 3BUTA 4JREB 4PPTA 4I0CC 3QHTC 4Y2DA 4K7FA 4CDGC 4Y4HA 2Y25A 4U1KA 4M9PA 3O6KH 1SJVA 3EGSA 3QUYA 3MRLB 3VXUB 1HKLL 4CMMB 4K07A 1UCTA 2AK4A 3RRQA 1RIHH 3C9NA 1UM6H 2PETA 4OLZH 5KSVA 1VERA 4FABH 1AIFA 3SKOA 5F6HJ 4QGTA 2WZPD 4IM8A 4MJ5B 1FCCA 3VGFA 2FJGB 3BGMB 2ZSVB 5C0CA 2OR9L 4JRYB 5INDA 5E6ID 2GEEA 5T3ZL 5GHWH 4RFEA 2G2RA 4KKLC 2MHAB 3QUMB 2F19L 2OI9B 1FN4B 3RY4A 4L3CB 4IMKC 4PGDB 4ZUUA 3G5ZB 4TUOB 3SO3B 4XPFL 3DGGA 3QDJD 1N0XH 3QDME 5HDBE 4HIEB 4M7JH 3IF1A 5I8OH 5ICXA 4PRAA 3RBGA 4TULH 1GH7A 1IAMA 1QBML 1RMFL 1GGCH 5IB5A 1NAMB 2HRPL 2X9YA 3VWKA 2DD8L 5E9DE 4BFEA 5EN2B 4YHZL 4HDIB 4WUKH 1QHPA 5C08B 2X40A 2RAMA 4KI5F 2VDPH 3NIGE 2ZP0T 3GHBH 1EVTC 1XGTB 3V8CA 3IRPX 1QBLH 1NC2D 3E3QC 2XYCA 3K81A 1DBKH 3WL9B 4HF5H 1U9KA 5KTEL 1I1FA 1BLNB 4YDJB 4KRNA 5DJ8A 3JV4A 3FMGL 5E70A 1SHMA 2HH0L 1K4DA 1QKZH 1U8MB 3PUCA 2HFEA 3VXNA 5LBSH 5JUEH 1XIWD 5IJKC 1DBJL 1MVFA 1S7UA 5I8KH 1A2YA 2OJZL 3AB0B 5EOCL 1ED3A 1AI1L 3VWJB 4DEPC 4ERSL 4NRZB 2JB6A 1MJJA 3KXFE 5T5NF 4TPRH 3TBSA 3MLVH 2Y7QA 1JTTA 2PR4L 5FO8A 2JCCA 2OYPA 4Z7OE 1X5XA 4JO4H 4OZFH 2AEPH 2CDGB 4F7EB 4KK8D 1NGYB 3D69B 4DN4H 2R23B 1WFTA 2VISA 3GIZH 2M8XA 3NABL 2VLRA 4QRPD 1DVFD 1T0MB 4UILH 4JM2C 5FYLD 3BPNB 5E56A 4MAYB 4F37F 3FO1B 3V79C 1ONQB 3NPZB 2YD7A 3KPOA 1XGYL 3D18B 1TQBC 4OQTL 5CZVH 2IH3B 2ZPKL 4Q6YA 2VQUA 5I1IL 4R26L 3S37H 4V1DA 1FL6B 3F62A 4HWEH 2I9LA 4L9LA 1QSFD 5GGSB 5GS2H 2I60H 3DYOA 4G5ZL 3LN9A 1EEQA 2X09A 1MFDH 4WV1B 5D9SA 3H9HA 4AIXA 4R3SA 1F90H 3FO9A 2P48B 3HMWH 1AGFB 5C3LD 4PLKC 4S1SH 4LOUD 4JLRB 1V7NL 1OP3H 2YC1B 4DUXA 1YMHB 5L2KD 1ZTXL 1S7VB 3MUHL 5FUOL 3H7LA 2G75B 3LB6C 4Z8FL 5DFTA 4W6XB 1WCBA 1PQZA 3LKRA 4GW5A 1FIGL 1Q38A 5D4QA 2DQCL 5FUZL 3GSXB 2WWMD 5GGVL 2E7CA 4NSKA 4Z7VA 5IJKA 1IC4H 1NLBH 4L1DA 2HLAA 4NQEA 1ZSDB 1AQKH 5EU3A 4I9WE 4QYOB 1JV5B 5DJAB 5C0DB 2XICA 3LQZA 2W0PA 1PBYA 3OGCA 3O3EA 4FFZH 3ZTJG 1HSBB 4Z5RB 4XXCC 3S5LG 1XT5A 1VADB 5IOPB 3ZL4H 2VTFA 1AC0A 2YPKA 4NQSB 3L9RB 1HINH 2G9HB 1CFVH 1NCCH 43C9B 1CICB 1P84J 3HAEB 4FTVD 4GFTB 1ZANL 3DX9B 4KK9D 3MOAL 1LO0H 4WW1B 1OB1B 5B38A 1CLCA 2MFNA 4KVNH 3K3QA 4NN7B 5C0NC 4N0CC 5F97E 3JV6A 3HE6B 4GXUN 4LLUB 4Y5VA 1B4JL 3HNTH 4QT5B 3TT1L 1SMAA 5K59E 4M1CD 4HPOH 1R3LB 4LCWA 1PLGL 2LQRA 2I5YH 5I9QC 2QJDA 2XN9A 2R2BA 5CEZL 1LNUA 1NLDL 3C6LA 5E1HB 3OJDA 5L88H 3BRDA 4MDJB 5E8DH 1EFXD 1NFIB 5D7KD 2AJSH 3STLB 4LGPB 2IQAA 2VLKA 5HDBF 1PKOA 3CXHK 4ODXB 4KU1A 3UJIL 5IJVA 2AJVH 2BNQE 2QHLA 1JGLL 1ORSB 5CILL 3VFSA 5ANME 3D48R 4NQVB 5D72L 4F57L 5KVFH 2JB5L 2H8PB 3VXRD 1UB5A 4FQQA 4MS8C 1MEXL 2VDKL 4JM4H 4KKNA 4QTHB 3VFGH 3N85H 3NIGF 2EYRA 1T89C 1YYMH 4EQ3A 1KEGL 5E6YA 5T1DH 2OZ4H 2XKUA 1LEIB 2DQUH 5I18L 2WINA 4LEOB 5J56B 5C9JA 4UV4L 1N26A 4APQB 4EQ2A 1CGYA 4XNQA 2VZ1A 1XEDA 2RGSA 1IBGH 3ARBB 3DIFA 3TVMC 4OCMC 5C0JB 4XXCA 1EHAA 1TJHH 4I18B 5D1ZB 4WWKC 3TJEL 4OAWA 3HZMB 4IMLA 3VDAA 2H32H 5D70L 1CGSL 2AABL 4RGOL 4ALAL 5CD3B 4PB0H 4MWFB 4RWYH 3KYAA 1RD6A 4HBCH 3BP7B 2SEBA 3NZ8A 4CBPA 3LS5L 4Q9QH 1BQHG 5L9DH 2AJ3A 1EGJH 4D3CL 2R0KL 3TJHD 4PLOB 4D9LL 4I5BB 2IAMB 1MCRA 1JCKA 4Y2OA 1DQJA 3K1KC 4ONOA 4K94C 4PRHD 1LP9A 4DGIL 2VZUA 4P2RE 4HKZA 5DJDA 4YWGL 5DD1L 3T0EE 1UACH 1TPXB 3B9AA 4YZFF 4Q0XL 1YEDB 5EBLB 1AR1D 4ZUVB 1QEWA 1KN4L 3WHXB 1Q9WB 2DTMH 3OAZH 2IFFL 1FNEB 1NFDE 2YUWA 2O26U 1WEJL 4LAQL 2JF1A 3HN3A 3BO8B 2GK0B 4FQHB 4PJ9B 3EOYG 1HH6B 3KWWB 2JLLA 3MJ7B 4OCXH 1IGYB 1UKQA 1E4WL 3LMJL 2F9BT 5L2JB 1HZHH 1IM9B 4MX7A 4X7TA 1T2XA 3MTRA 3U83A 4B50A 1JVKA 1T89A 3Q5YA 3SOBH 2Y06L 1FRGH 4YDIH 2ED8A 3OJMB 1DFBL 4WW2A 2ZG3A 1BFOB 3U82B 4U6HB 4ZXBD 2BOBB 3FO0H 3SDAD 1ZHLB 3CNKA 4ZUTA 3ZE2E 3U30C 3EUUA 1Q72L 4QRRB 3QCVH 2PTUA 3TVMA 4M93B 4LHUD 3BUYB 4X9FA 1KT2A 1ITBB 3S34H 2YMXL 4HH8A 5ACZA 2X7LB 1FAIH 2C5DC 2KL6A 3RKDD 4X4ME 1RV6X 1PZ5A 1CCZA 4BZ2L 3LPFA 4CADA 5TQ2L 5E8EA 1JL8A 3BN3B 2F53D 2WP3O 4PGBA 5CZXD 5GRYA 4NO0A 4RMWA 3GSOA 3BVNB 4JRYE 4TSCL 5IMOB 2GT9B 4WUUD 4BH8A 3ULVL 4W4NA 1TVHA 4GAFB 1FLTX 2E27L 4G6AC 3QA3B 5GZNC 3OX8A 3D39B 4YAQB 1HDMA 5TPWL 4AIZB 1I1YB 4HT1H 5J6HB 2IWGA 2UYLB 3U36A 3BN9D 3SJVD 1AXTH 3UYRL 3TCXA 2BNRD 3EYFB 4IRSA 4X0KA 4MQTB 4HUUB 1I7UB 25C8L 4U3XA 3QUZC 3QDMA 3LKOB 5DK0A 3DMMD 5FDWB 4MNQE 4NQXA 5K9KB 5K59F 1TTGA 1KTLA 3MLUH 2EEDA 3GMQB 1X4YA 5E7FA 1ACZA 5E9DA 1JHTA 4RZCB 1YZZA 1I7RB 3CJJA 3SDDD 1R5VA 1ZE3C 4ZUWB 4PJGB 4M48L 1F8TL 4OSUH 3TC9A 5C07A 2P45B 2R1XA 3E6FA 4NRXB 3O45A 3HLAB 1GJIA 4U1LB 3VE0A 4LSTH 4AIOA 2R2CA 1WV7T 2UY6A 3C5SB 2NY4D 4OGAC 4N0UB 5CLTA 1CL7I 3CAFA 2XTJC 4JPKH 4PV9A 5I66A 1UZ8B 1LO2H 4NC1C 1C5CH 1V3JA 1U3YA 5HVGB 3ZKQD 4Y4FB 5HY9B 3O11A 3L3JB 2LTQB 4HIJB 5E6IB 3KYOB 5EOCJ 1QLEH 4HWBL 5EUOE 3FT3B 2EKSB 3ILQC 2C3XA 2R0ZH 2HYMA 3KXFA 5DSCB 3F5WA 5GSVB 3I84A 3OPZL 4RRPA 1Q9KA 4Z77B 3BRGC 5D71L 3QDJB 4M6ML 1U6AL 2WBJC 1NUDA 1TMCB 2IMMA 4LVHB 4G43B 1J8HB 3CPLB 1ZT7A 4UTAL 5HYJB 3MRDB 5IVXB 4F3FB 1G9NL 3SPVA 2V7HB 2A73A 3JTSA 2I25N 4UDTB 3TBWB 2QQKH 5EIIA 4JDZB 1M7IA 4H1LG 4KQ4H 1NC2B 1ODAA 2DQIL 3ROOB 1QO3A 4EI5D 3WFCH 1SYVB 1BD2E 2V9RA 4EZMA 1GRWA 2ZWLT 4XCNA 3WIHA 3RZWA 4Q9RL 2ORBH 1D6VL 4PJEF 1CL7L 5C0EB 3OKKA 1KTRL 5F6IB 3PL6B 1K2DA 4NM4H 4Y19E 4LLDA 1HHHA 3IJHA 1ZS8A 2XPGB 1XIWB 3F7PC 3WUWG 4C58B 3A6CH 2H9GA 1P69B 3QRGL 4X6EB 1NFDF 1HHIB 3WN5B 1ND0B 2DQEL 2NY1C 2R4SL 3MNZA 3OKLA 1CLYL 4G9FE 4HH9B 4ODTH 1SQ2N 4X5XA 5IHUH 2FX8H 3S4SG 3WNKA 3ZTNL 5B3JF 4LSRL 3REWB 1PW3A 1OL0A 3TCLB 5J7CC 4OZ4A 3KYNA 4DKEL 1AQDA 3RDTD 3VFMB 1F11B 5CSGA 4YDKL 4QO1A 4E0RB 1LEKB 1TCRB 3SE9L 3QUXC 5DHYA 2Z4QA 4YDLB 2DN7A 2AXFB 2BERA 2ZUYA 3ZE1E 2HT3D 2IH1A 3W9DB 1G7QB 1J87A 2VIRB 3EJYD 3P4NB 3ZE2F 4BQCA 1TTUA 1N4XH 5ACLA 2JJSC 4G6KL 4DW2H 1KYOJ 4MCZB 2J6EH 5C6TL 4R8WL 3KGRA 3O3DB 3O2VH 1YPZE 5FGBA 4PJFA 1WBYB 1MCKA 2WBJA 3C8HA 4R90H 3MRCB 3RWCA 4LRIA 4EVNB 1CBVL 1AGCB 2FBJL 4PD4J 1X4XA 4CDHA 3MV8B 4ZS6D 3KYMB 2AQ2A 3MRJA 2CD0A 1YEIL 4K3EL 4QRTA 2V5SA 2X4TA 2B4CH 4QY8A 1NCTA 1YEKL 5B39G 2ADGB 3DRTA 4PV8B 5KSBB 5FM4A 5MEPA 2VLJD 1TZHB 3HAEH 3UZEA 2XKSA 2D0GA 4GLRI 5EZOH 1ETZA 1D6EB 5JLZB 1MY5A 4Q9BA 1B6UA 3SKMB 1CT8A 3WSQL 3VGDA 2NYYD 3DYMA 4DVBB 3TO4D 5ERWB 1FGNH 1BEYL 2F5BL 2VUYA 3KS0J 3HRZA 4YK4B 1ZA6B 4L4VE 4G8EA 3IFOA 5ANMA 4DZ8B 3STZA 1HEZB 1WBZA 4MB4A 4F58L 1F4XL 4EUPG 1P4LA 4UT6H 2I9TB 2A6JA 1B0WA 5EG6C 5CHNB 4Z0BH 1Y0LA 3OKEA 3QDGD 2HKFL 4DKFL 5BO1L 1R5IA 3UPAA 4B53A 5TE7H 2VE6A 2R8SL 4X6FA 4ZMAT 5DJCB 4F7PA 5IR1B 4DFHA 5T3XD 1UWGL 1IGCL 2JJSA 4NNXB 4RFOH 4PY7B 1GGTA 1JF5A 4ZFOB 3CLFH 1H0DA 4M7ZC 3QISA 4QHKJ 4P5TA 3QIBC 4CN6A 3QJHA 1N64L 1OPGL 3ULUD 3L3KB 3F8UB 1FBIL 1TETH 3QIWB 5EUOF 2XY2A 2V7NB 3RAJL 1IGJA 5I17B 4E42B 1RZKC 4O2EB 3U1SL 1CZ8L 1BOYA 1NBZA 2D9CA 2B1HL 3U0WL 1KJ2A 3FN0H 4G7YL 4Y4KC 3LKQA 1ZEAH 1SBSL 3GSNB 2P5EA 3GSWB 3DV4A 2H6PA 5F7EL 1XGRA 3QEHB 5T1LB 1GXEA 3ZKXB 1QVOA 4IS6B 4ZTOL 1PFCA 1I4FB 1O5DT 3BXNA 4QWWD 2VDRL 4NWTH 5J6GB 4P5MB 2AJXL 1GGBL 4DAGL 4P2RA 5ITBL 1Q0YL 2F54D 4OKVB 5D7LD 3O41A 1QLRA 4N8CH 2Y6SC 5I1LB 5I6XB 3AXLB 4MA3A 3A6BH 1T21B 2DICA 1F4WH 2XV6B 4BA8A 1NFDA 4E41E 5TDNA 2XWBA 4J6RH 4G8IA 3KYKH 3V52L 3FAXA