3TA3D

Structure of the mouse cd1d-glc-dag-s2-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Unique Interplay between Sugar and Lipid in Determining the Antigenic Potency of Bacterial Antigens for NKT Cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ta3D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ta3D02
5L6YH 4X9HA 1KB5H 5F1SA 3IU4L 4KKCC 1A7QL 3VFVA 3DX8B 4GRMB 1KBGL 1Q0YH 1KUMA 5ID1A 1JMZA 4IOFD 4P9HC 5H2BB 2HTLC 1UCTA 3MLSL 1M7IA 3KXFD 1LEGA 3AXLB 3DIFA 5EBWB 4HXBL 2AEQH 5IBLC 5IOPA 4G6AC 1KIQA 5DC0A 1CIUA 5I74C 4ZODA 1F00I 1N64H 4ODBD 1AI1L 2C4FT 2PYFA 4G8GD 2F54E 3K74B 3NTCL 5DHYB 3OX8B 1MAKA 5F1OB 4KGLA 4GW4B 3ZZ1A 5E8EA 2QR0B 3OKDA 4EN3B 4N8CH 3VD3A 1KLGA 3SQBA 1T03L 3C8KA 1FYHB 43CAB 2QADB 3SGDI 4FQLL 3T1FA 1MHPH 5ISZA 4G5ZL 4MLIA 4NHCH 4BKLB 4JM4H 4DVBA 1BM3H 3E8UL 2A9NL 3H9YA 3SY0B 5JHLL 4M5ZL 3KLDA 1HQ4B 4YBQC 3QIWB 4MNGB 3PHSA 3QUZC 5J13C 1T1YB 3MRMA 3EYQC 4PLOB 5DRXA 1U8OA 3LV3B 3F65A 5FXCH 3WIIL 4E41E 4U0RC 4UQ3B 4R0LA 5IB5A 4UB0H 3VXNB 4P99A 1KNOB 1ZE3C 1RIHH 3GM8A 5JPNA 2HLFC 4MCZA 4ONHB 4WENB 2O61B 3QI9B 5L8KB 1U8LB 4RNRA 1UM5H 4XVUD 1UYWL 4N0UE 2EE2A 1IL1A 1X5ZA 4RQQA 2DKUA 1LO0H 4JRYE 4MQSB 5HJ3A 2ADJB 5SWSA 1RMFH 2XN9A 3B8YA 3FQXA 4XPHH 2W92A 4MYWB 1ZXQA 1SVZA 1DUZA 3VDCA 3MJ8B 3DVNB 4FXGA 3B9KD 2DM4A 3QPQC 1EZVX 1KPUA 3G9VA 1UCBH 3HUJA 1YJDC 1W8OA 3HPLA 1E6OL 1FL6B 3S88L 2XWJB 2MSPA 3LHPH 3AC0A 4PJGB 4Y4HB 5HHXL 5EA0H 3MUY1 4KK5D 3PGFH 4N8VB 4K3JL 3OZ9H 3AUVA 3ZE2F 1BP3B 3PJSB 5DEZA 2QSVA 1EFQA 4JFXB 2DD8L 1P7KB 4NJAL 5DJ2A 5GXBB 5TDPA 4L5FH 3VFUA 1K9TA 4JKMA 5IW1B 4WWKD 3VFSB 4GS7C 4PJIE 4K94C 1MLBB 4S1RL 1HQRB 3U4BH 2HLAA 4K7FB 3WCYA 3CK0H 4HV8B 5I17B 4J23A 2R1WA 2NY3C 1UH2A 5B39G 2I9LA 5HYEA 4Z7WF 1FG2B 2A73B 2VLMD 5KG9A 4WI9A 4FQHA 5C2BL 2FSEA 2NY1B 4U6XA 4YHNA 3MACL 2BMKB 4NKOA 3BPNB 4D9RE 1A6AA 4N5ED 1LK2B 4UNUA 1AFVH 1EA9C 1UJ3A 3SDDD 1A7OL 4TULH 5E99H 2CJUH 1HINH 1I4FA 3BO8B 4NZTH 4MDIB 3BZDA 3IDMB 1EJ6A 5D7JB 5IMOA 2CMRH 5GGTH 1AR1C 1AO7E 5H94A 3L7EB 2FATL 1E6JH 3MJ7A 3TBYB 3W82A 4NCC2 2ZCKH 4TUJB 1H8OA 3EOTH 1QD0A 2FLRT 4KTYA 4D9QD 1RZFH 1NBQA 2MCPH 5KVMC 5DEGB 1R3KA 1VDGA 2AK4B 4G6JL 2APWA 2VL5A 1KEGH 4F9LC 2HT2C 2WBKA 4U05A 3FQRA 4OAWB 3V0VA 1KCUH 3ARDB 4LNRB 5C08D 1H15A 2F5BL 3F12A 5IGXH 2CUMA 3TPKA 2GAZB 1KPRA 4QT5A 5DJ8A 4OLYH 3EYUL 5JIPA 2FBJH 3TBSB 4NQSA 1BHGA 4YHOH 4GRWE 2C9AA 5DJYA 1JGLH 5IM7B 4KVNH 2YD1A 4ZNCD 1I1AD 4LAQH 4JZJA 4D0BA 3FONA 4KI5D 4FHBD 4LSSL 1RZ7L 3VXUA 4MJIB 4LDEB 3MBEC 4FXKA 3UYOD 3LH2L 1PG7L 4PJHF 2AABL 5DYOA 1LMKA 4GMTL 4LRNH 4M8QA 1QQDB 2VITA 1VADA 1U8QA 3WHE1 3VXSA 3TO4A 4MD4B 4Z7WB 3ZHDA 3CAFA 2Q8BL 4I18C 4XC3L 2FR4B 5D71H 1FVCB 5IROC 2P5EE 1FRGH 1REIA 1H9VA 2OSLA 3BI9X 1D6VH 3GB7B 5EU6B 1HNFA 3TIDB 1N6QH 3LVEA 3LMJL 1FGVH 3TFKD 5HHNA 2Z91B 4ZTPL 1EDQA 1JPFA 4XGZA 1CQYA 1DBBL 5TH2A 5CINH 3CZFB 2D0HA 3GMLB 3VGHA 5F3BB 3CX5K 3Q5OA 4GW1B 2DL9A 4HEPG 3WDJA 1P4IL 2P45B 3B2UC 4K23L 3RPKA 1T1XA 2YN3A 5EU7E 2ESVA 1J88A 2CRZA 3VU2A 4U49A 4IRJC 4WFHD 3BXNB 4JN2B 3LQZA 5I66B 2XFXB 4NZDA 5DD0H 3KLSA 5HHOA 4CMMB 4JHWL 2ATKB 4PJ9A 4PV9A 5T3XH 1RIUH 5GSVA 1CF8L 3UPAA 3L7FB 1J7VR 1AE6L 3RNQA 5GS2D 5KAQG 1GCFA 1IGCH 2HMID 3MSPA 1MFAL 5FOBB 4J4PA 2QJDA 2W9LA 4L1HA 4XP9L 3KR3L 1U8PA 3T0AA 3L3HB 3VFOB 2QV2A 1I8LC 1CDUA 4HWBA 3NACL 4HIEA 1A1NA 1S9XA 43C9A 4ISVB 1R3JB 4PJ8D 4PJEE 5DLML 1G6VK 4M6ML 3TZVC 1T7WA 3PWPD 3O2WH 1FLRL 2YMXL 1MCEA 3BQUC 2A6IB 4LPUA 4PJHB 3VE0B 1KCRL 4CDHA 4XXDA 5E1HB 4KTDL 2ADIA 3SCMB 1MFNA 3MA7B 4YHYB 2KKQA 2R9HD 4GAYA 2ADFH 1S7QA 1EVTC 1RD6A 5EOTB 5CEXB 2ICCA 2AXFB 4KK8D 4ONFL 3CPLB 2DKMA 3VFTA 1MHEB 3R1GL 4AMKL 1F4WL 1YA5A 3CFEB 3MGTA 1OLZA 1UC6A 4DGYH 2DLEA 4Y5YA 1VEMA 3GMOB 3RWDA 1P4LB 3G5YA 3VD4A 3ARWA 5I73B 3BE1H 5EOCL 3MX0A 2EDEA 2ENYA 3IDIA 4X6FA 5BRZD 3FB6B 4FQCH 2AJZA 5LAXA 1CN4A 3FOMB 1BQHB 3QQ3B 3VA6A 2FH8A 5ICZB 4F7CB 1YMMA 1LP9F 3QWRD 4Q97A 2BK8A 1T7YA 1UKQA 5D4QA 3WO4B 1T0MA 4NIKB 3X11A 5JW5A 2IANE 3OL2A 4LPXA 1OCWH 4WHCA 1MOEA 1YEDB 3BPOC 4Y8DC 5T33H 1YEGH 4UTAL 1RAMA 1T0PB 4NJ9H 4P4KC 3C5ZA 4Y4KD 5CSZB 2GI7A 1AGEB 1NLDL 5F3HB 1Q9LB 4JR9H 4UDUB 3ULUL 3HZYA 2FJFB 4Q9QL 4K8RD 4HBQA 3WE6A 5C0DA 3L5HA 4NWUL 1A6WH 5I9QB 4F57L 5HYJE 1N6VA 1FZKB 4PBWD 5HY9A 5E95B 5KBNC 1IM9A 4KHTH 4NKIL 1QVOA 4NKMB 4QXTB 2OK0H 4L3AA 1W0VA 3I50L 4KRLB 2E27H 3VDBA 5T1KD 1DQQA 1AP2A 4NN6B 3VXRD 1IC7L 4CADA 4GXUM 1SVCP 3VW3L 1ES0A 3T8XB 5DSCB 4JANB 3EYSH 3LQAH 4XX1E 1P4BH 3RUGF 1HHHB 4QHNB 4FQ1L 2E5EA 4WHYH 1L7IL 2LAAA 1T5WA 5FYJD 2E7LA 4PB9L 1MIMH 3ELAT 3W9EA 4OCRH 3MREA 4JQIH 5B21A 3ROOB 5C1MB 1J05B 1QSZA 4JJHA 5SWQB 4JLRB 5FCSH 4TSBL 1G0DA 1SBSL 1CVRA 4G6FB 2IWGA 1FO0H 1YNKH 3ZE0F 1BBJA 3U7WL 3JTSB 4QOKB 1G7MB 4Y4FD 2Q87A 4ESKA 4ZNEA 3VFPA 2WW8A 5C2UB 4WV1A 3DX6A 4MDJB 4R96B 3M8OH 2GJ6E 1RUMH 4N9GA 1JTPA 1Z3GH 4OZHA 3FRUB 3O9WB 4NFCA 1PLGL 4U6YA 4ZSOA 2Y1VA 4LFHD 1BBDL 1Q9OA 3BKJH 4P2OA 5J6HA 2XZQL 3DURA 5E9DB 4NSKA 3ULUE 5EBLA 5GQBA 1NAML 1T1ZA 4C57C 3QCVL 1QSFB 4Q9BA 3LN5A 5CWSB 3EOYG 4QF1A 1A7RH 3RY5A 3HZKA 3NPSC 3HNSL 1N2RB 4OFVA 2XTJE 3TH3T 3JWNC 2JIXD 4EUPG 2Y6SC 4J6RL 4R3SA 1YY8B 4ZS7H 1UT9A 3C8HA 4J3SA 3E2HC 3UTQA 2XA8L 3O6FA 4U1IA 2I9TB 3FOLB 1YMHA 1AXTH 2R29L 4HPOH 3SDYH 2IEPA 4XCYB 5D6CB 2WBJB 4HUKB 4L4VA 5CHNA 1FYTE 5E6ID 2IAMB 3H9HB 3MLYH 1NEZG 1MCDA 3H3PL 1S9VA 5AWNL 1T83A 3QDGE 1EEZA 3EJZC 4X4XB 1W72A 5IP4A 4G8EA 4XNUH 1EX0A 1OVZA 3SKNB 3BAEL 4CJ1A 4QHUA 2ZG3A 3F5WB 1VGKB 4RWYH 1AGCA 5DK3A 2OTWA 3QP3A 1UWGL 4ACPA 5EO0B 3QPXL 3RUGB 4ZO9A 4R0LC 2NY4B 4YHIB 5K59F 2NY0B 1CR9H 2W0FB 4YQXH 1H3XA 1NANH 4MA7L 3IT8D 2R4RH 3TVMB 4I2XB 3ARBC 3BVNB 5JLZB 4OGXL 3T0XA 1R5WA 1T21B 1P5UA 2A9MH 1QP1A 4TUOA 1N59A 2D0GA 1A7NH 4GJTB 4QRPD 1HH6B 4XP5H 2JELL 4YHMH 3GO1H 3BP5A 3MZGB 3V6ZA 2YS4A 3BKCH 4JDZB 1LO3H 4FN0A 5IB1B 2C1PB 2VXQH 4ZXBD 3X13B 3BZFA 3ES6A 5J06A 1XGQB 4BFIB 1JPGB 1CXIA 3I6LD 4P2RE 3DX8A 4GRMA 32C2A 5FM5O 3CLFL 1NBVL 4JDVB 2WIMA 1KV3A 4TNVF 5H2BA 4X6CE 4X6BB 3FO9B 4OB5L 2CXGA 3AXLA 4Z0XB 4OQTL 5EBWA 2H2PC 5M95B 5SWSD 1UZ6F 3P2TA 4LOUC 4WI7A 3RIAF 2OXHA 1Q94A 3MV9D 3U7YL 3BD4A 3OX8A 3WIFB 3QCTL 5JW4Q 1A2YB 3GK8H 4LGPB 3JWOL 4LL9A 5L2KE 4GW4A 4F33B 2QR0A 3SDCB 4LHJB 1OGTB 1RV6X 4EN3A 2X40A 5IB2B 5IUSA 1JPSH 3MLSH 1J1XH 43CAA 4BUHA 2COQA 1PVHA 2DQHL 1U8KA 4ODXB 1UJ3C 3VD9A 3SY0A 3O6KL 1IAMA 4WO4B 1HQ4A 3NTCH 5CLTA 3QIWA 4MNGA 5HYSB 1BOYA 5E8DH 1T1YA 1UM6L 3FRPA 1HI6A 4PLKD 1AQDB 3IXTB 3HN3A 4YAQB 3BKYH 3ALWA 1DL7L 4UQ3A 2XQBL 1DSFH 2CR3A 3VXNA 1KNOA 4U1MB 5C0EB 2BNRD 4PS4H 1V7MH 4ONHA 1M05B 2O61A 5FM5M 3QI9A 3CFJB 2JJWA 1K85A 1U8LA 5D8JH 5I1HH 4PGZA 2MKWA 1J10A 2DYPB 3FKUS 2VLJD 1NPUA 2J8OA 3AS2A 5E2TL 4G5ZH 3SGJC 4OCWH 2ADJA 1FP5A 3D18B 3K1DA 4G6KH 4RMVA 3S36X 5JNYB 3DSFH 4F80A 3KVQA 3IETB 3V4PH 3DVNA 2I07B 3WIIH 1PKQB 4I0PD 4PJBE 4K3EL 3W0WD 1FGNL 1BWMA 3RL1B 2XRAL 3NIFE 2XWJA 1DQJA 3RIFF 4JZJC 4PJGA 4Y4HA 4WUUD 3BUTA 5F71A 4LSVH 4N8VA 3KGRA 5ALCL 2G5BA 1JWMB 5T1DH 1H5BB 3JZ7A 4M43L 1MCWM 2J6EL 4YGAB 3PJSA 5F7YC 1DFBH 3NCYS 1OWRM 1ZLVK 4OLZL 4RAUB 4JFXA 3TO4C 1MFEH 4F9PA 1L9MA 5DJAB 1EO8H 3ARED 3BDYH 4ZOCA 3MRHB 5IW1A 1O0VA 3VFSA 4IM8A 1ACZA 2R69L 2Q20A 1MLBA 5T3ZD 3D9AL 1HQRA 4GAJL 4HZAA 2QHRH 3MLVH 4NQCB 3TBWB 4HMEA 4HV8A 4MMZC 5I17A 3SOBH 2C3HA 3S4SG 3EFDL 3QUXB 2ZUWA 1FG2A 2CPCA 1B3JA 1C5DB 1C16B 4HT1H 4UOW1 2WP3O 5HHXH 4JY5L 4K3JH 2BMKA 2GUOB 4L8SB 4BSVB 3EO1B 4ELKA 5EBMB 5FGBA 2DQTL 4LLQB 1LK2A 3S5LG 2FEDC 1CDYA 4HIJB 2HG5B 2VERN 4J3UA 5IESL 1H8NA 3BO8A 4H20L 4MDIA 3LPFA 3T3PE 3IDMA 3A67L 5D7JA 2B0SL 2W38A 4PJ9C 3TA3D 4FMFA 3FQTB 3I9GL 2G9HB 1U9KA 3L7EA 3RA7H 3B5GA 1K8IB 3TBYA 1U0QA 1FH5L 3KPQB 1KYOK 4TUJA 2XZCL 3NCJL 5JHDD 1PX3A 2P8LB 1B4RA 2EE9A 1MH5A 2R0LH 5DEGA 4J4PC 5C2BH 4NP4H 2BOBB 2AK4A 3VRLE 1JWUB 2YPLB 4ODTH 5DQ9B 5C0ND 1KJ2L 4Z7QF 4NC0B 5B4MC 4OAWA 1BJ1H 1A7OH 4OUUB 2VDRL 1OGAE 3V0WH 3ARDA 4LNRA 5LQBH 4MJ6A 1HYSD 1MFBH 5FYLL 2GAZA 2JCCE 3RP1A 4KJPC 4ZFOB 3WNOA 4IMKA 1CQKA 3IVKB 2F5AH 5IM7A 5A2LH 2AQ2A 4PRID 4NQUA 4Z7UE 3DYMA 3ZTNL 3MR9B 5HTSA 2OZ4H 2A0LD 1F6AB 1YUHB 2VWEC 5E2WL 4G6JH 1FNFA 4MJIA 1LK3H 4NC2B 4Z78B 4O2FB 1E4XL 4YDJB 2X1QA 3T1WA 4X6DF 1QQDA 4FXLA 1KG0B 3QUML 1HKFA 1TETL 3HFMH 4MD4A 4RWHA 2OR9H 4Z7WA 5HHME 1J5OH 1LO5B 5KVFH 5C3TA 2FR4A 2FIRT 1FVCA 3X3GL 4JQVA 5GISL 3SJVD 2OI9B 3FZUC 2IFFH 3GB7A 4Z95H 5EU6A 5HDLA 3TIDA 4Q0XL 4MNQB 3IFLL 4UQ2B 2Z91A 4UZGA 3CZFA 3GMLA 3WSQL 5BQ7B 5F3BA 4GW1A 1DZBA 1FSKC 1RUPL 4Z7VF 3UJTH 1CD1B 1RJZB 2Y36H 4KMTL 1G9MC 5ILTL 4GBXB 1IC4L 2YN5A 1DEEB 2CLVA 5E5RB 4PY7B 2GKIA 3SDAB 4JN2A 4Z7NF 5I66A 2XFXA 1A5FL 3DLQR 3QXUA 5T5FL 4P5TD 2X89A 5KW9H 4CMMA 4LASL 2ATKA 1JP5A 3C5ZC 3EOAB 4WFED 3L7FA 5FYLE 1JI2A 3EDDA 3CDYA 3QIUD 1JN6B 5JQHC 5L7XH 5FF6B 4ZTPH 1Q0XL 2NY7H 5FOBA 1W0WB 2GCYB 3UJJL 3QYCA 3UP1A 4NZRL 2H3NA 1P4IH 2CUIA 1A7BA 4K23H 3L3HA 5FB8B 3VFOA 2X9YA 4MGXA 2YSSB 1BIHA 5CFHA 4ISVA 1R3JA 4O02L 1X5AA 3I3BA 3MTRA 3TYFB 4TTDC 1QZ1A 3TIEB 3G6JE 3O8XD 3CUPB 1HKLL 5KVEL 3Q6GL 2A6IA 1MQKL 4XNXL 3TM6A 4PJHA 3VE0A 2PO6B 2EKSA 5KTEL 1QYGH 1IAIH 4LHUB 3SCMA 1FNAA 5SWZD 3PDDA 4BM7A 1GVIA 3OXSB 3MA7A 4PIRF 1NDGB 3D39E 2PNDA 1I7ZB 5AAWA 4FQPA 4QKXB 5CEXA 2AXFA 1NCDH 3CPLA 3HE7D 5ENWB 1MHEA 5F7EH 3R06A 4JRWA 5INCB 1U8JB 5EU5B 1QRKA 2YBRB 3CFEA 4FQ2L 3UZQA 4Y1AE 1A6UH 4ZS6C 3IRPX 2P48B 1BD2B 3FB8B 3J7HA 2C3VB 1BFOB 1WZLA 5DUPL 4WV1C 3GMOA 4Z7VB 2HVKB 3C8DA 1J1PH 1QG3A 1FLRH 1P4LA 2EC9T 2YMXH 3OAUH 4BK4A 2VKWA 1XGUA 2F53E 2R2CA 4OM1L 1CGXA 4WFFD 4Z5RB 3LAFA 1I3GH 2E7HA 5F72S 4P2OC 3FB6A 5TDNB 4JFZL 4A2MA 2HFFB 1BQHA 2DJUA 3QQ3A 5CKGA 3DUUB 5F96H 4G9FD 3S35X 5ICZA 3VRJA 4F7CA 1MF2L 4NYLB 3TN0D 1CI5A 3GIVB 3QEHB 4ONFH 3U30B 4MNHB 4X98B 4FA8A 4XNYH 4L3EE 2EIDA 4GRLD 4BUGA 2HWZL 1YEEL 5TPWH 4LEXL 1RY7B 5C0JB 3O4LE 4WNQB 4LKXB 3SKOB 1YEDA 3SE8H 1AHWC 1QRNE 5CSZA 1CLCA 3DO3A 5DVNA 1KC5L 1AGEA 1O5DT 3O6FC 4H25A 1Q9LA 4UDUA 3EDJA 4K9EC 5EOCH 1T83C 2FJFA 1A3QA 2QL1A 3U79A 1KGCD 1ODAA 2X4SB 1G1CA 2XG5A 4K7PY 2EYTB 1CLOH 3RAJH 2FX8H 2D7TL 2D03L 5ADOH 4WI6A 2YA1A 1ZVSB 4XP6H 1FZKA 4XMLL 4DAGL 4N0CC 2X41A 1UFUA 4NKMA 4QXTA 4HJ0C 4LVHC 3L3GB 2VUOA 4PJFF 3LEXA 3WS6A 5F7FA 1FIEA 4PD4J 5FDWB 2MPAL 3X3FL 1TTFA 2WK2A 4DKEH 4U7MA 4PRPE 3RVUD 5D2NB 1WF5A 3KYOB 4M3JA 5DVOA 3HA0A 3CD4A 1J8HE 5DSCA 5EB9A 3T8XA 3WS3B 1HHHA 4QHNA 4UTBH 4MAUH 1OAKL 3IDXL 1U3YA 4P46D 3VGDA 3C6LC 2UV3A 4YXLH 4NPYB 3ROOA 5SWQA 1J05A 5EO1B 4JLRA 3BN3B 2VAJA 2QSTA 5D96C 5I1GH 1GIGL 4P9HH 4ZQKB 3GBMH 3FFCD 4JEGB 5MEQB 4F58H 3JTSA 4QOKA 2APFA 4PJAE 1JGDB 5CJOL 4D9LL 2E6JA 5CLWA 3GI9H 4LDOB 3U36A 2W9EL 4R96A 1J87A 1LP9A 2JTDA 1OTSD 5IHUL 1S9KC 2X6MA 3FRUA 3LEYL 1MJJB 1LVEA 3GM0A 5J9PB 5DS8B 3AMLA 4FABH 1L7IH 1A14H 1U8IB 5E9DA 4PB9H 3GSNB 5FIEA 2YR3A 5IVNA 4QXGH 4E5XA 1XF2B 1QSFA 1IRAY 2Y7QB 3BDBA 1GC1C 5CWSA 4WI4A 5KVDL 2IC2A 1H8SA 5MEPB 1N2RA 3RZCD 12E8L 4EN3C 1CGSH 4JRXD 4U33A 4KY1H 1YY8A 3LB6C 4LCWB 2QADC 2I9TA 3FOLA 5BMFL 2BCKB 4XCYA 2H1PH 2WBJA 2EDJA 3EFFB 3CSGA 4IHOB 1EVUA 4POZD 4ONGL 3K2UL 2IAMA 3H9HA 4PP1C 5FK9B 3M45A 1QACA 4RA0C 4PJFB 3UTTB 4HSQA 1EXUB 3SKNA 3OF6D 3QIWC 5KSBF 1NAMH 1VGKA 3F5WA 4OCNC 3QCVH 4JJ5B 4HHAB 1X6LA 5EO0A 5KSUB 2BVYA 3BHBB 3RUGA 3CMOL 3HCVB 1JZ4A 2R0WL 3TVMA 4I2XA 3BVNA 2YPVL 3QI9C 5DMIH 3QXDB 5JLZA 4FTVD 1T21A 1JFQL 5FOJA 1XF5B 3BJLA 2CH8A 4JFFB 4OCYH 1HH6A 2HRPL 4HC1L 2D9CA 2XWTB 2XY1A 1N0XL 4LFHG 2YZ1A 2J4WH 5J8OA 3H2WA 3MRPB 4JDZA 5AWNH 1U6AH 4EQ3A 1UM4H 5IB1A 1WEJH 4J3VA 5FHBH 2HFTA 3RTQB 2C3WA 1IE5A 3X13A 1MQ8A 3QB7C 1XGQA 2APVA 4JN1L 5E4IA 4BFIA 1JPGA 1YJDH 4IDJH 4JO1L 4H26B 1UWGH 4U1KB 2EXWD 1IGYB 4IJ3B 4LGSB 1AY1L 3KHQA 3V5DB 4NDMB 1OSPL 3OKLB 4JDVA 2CKBL 2QQQA 3BP7B 1S5IL 1FO0B 4Y4HC 4X6BA 3FO9A 3RFZC 4TUKL 3EZ8A 4Z0XA 3UAJC 1GGCL 4MS8D 2JELH 5DD5L 4XPFL 5FA4B 2IBZX 4I9WE 4KROD 4KUZL 4LLMB 4XXCA 3GMPB 4F9PC 5C92A 4K94H 1S5HB 1Z6JT 1T66D 3WIFA 4MXQC 1RUKL 3OAYH 1M71A 1A2YA 3B43A 4H8WL 3LS5H 1VACB 3ZT5A 1HE7A 3QHFL 4LPWA 1EGJA 3EO9L 4F33A 3A6BH 4LSRH 3SDCA 1NBVH 1OGTA 1PYWB 2FEEI 5IB2A 4AL8H 5HI4D 2ATPB 5KSBB 5HYIA 4OB5H 3Q1SL 1MREL 1BIIB 5FGBC 5DT1L 4JFHD 3Q48A 4ODXA 5SX5H 3HRPA 4QXWA 2UVFA 1FL3B 3JV0A 4WO4A 3TCXA 2VNCA 5AYUL 3U7YH 4OLVL 3HC0A 5HYSA 4YX2L 3S36H 1SMOA 4ZG1A 3UPRB 2QLVB 1AQDA 3IXTA 4YAQA 3TGXA 1YNLL 3LEVH 4M9OA 1BAFL 2YXFA 1LQSR 3IXAB 4FFVC 4U1MA 5C0EA 3WKML 2HTKC 1TQCB 2NY1D 1RUQL 4M4PA 1M05A 1MCPL 3CFJA 1S7SB 2P5WD 4XPGH 1TZIB 2LU3A 5E0QA 3R8BB 5FUCC 1B9ZA 2F54B 3D18A 3O81A 3H9SD 4LIQL 4NO5B 5JNYA 4NUGH 4J1UA 3VXME 3IETA 2I07A 1X5LA 4IMKC 1ZA3B 1ADQH 4OCSL 1PKQA 1S9YB 3CNKA 3RL1A 4OFIA 1QLRB 2QSCH 1IGIL 1MWAL 3MXVL 4PJ5E 4KKAC 3QUYB 5IVXE 1QBBA 4PJIF 4F3FB 4M1GL 1JWMA 1H5BA 5F93C 3U4EB 2EYSB 2WUBL 3MV7D 5J89A 5E4EB 4RAUA 1KN2L 1RJYB 1HEZB 2YD8A 5DJAA 3KPRE 1TJHH 2AJXH 2M26A 1FFQA 3MRHA 3CIQA 2X4UB 3O45B 4JQVC 4E41B 1JGEB 2E6PA 4QRUB 2WUCL 4QXUH 1FDLH 3PWLB 4NQCA 4JRYD 3TBWA 3MJ9A 4MVBD 1VCAA 1VPOH 1XMWA 4S1SH 3S34H 1F58L 4GO6B 3QUXA 1XCQB 1C5DA 3DECA 4MJID 5K9OB 5ALCH 3SQOL 2GUOA 4L8SA 4BSVA 2PTVA 3EO1A 2FHFA 5EBMA 4YFEA 3P4NB 2YD6A 4LLQA 3FJTA 5HVGB 2VXVL 1Q1JL 4LMQE 1OTTD 4HIJA 4XVSL 4CW1B 2HG5A 3HZVB 4HCRA 1WQVT 4C54A 5CP3H 3WNLA 5EUOE 1EAPA 3FQTA 2G9HA 4LIQE 4Z6AT 1ORSA 1K8IA 3KPQA 3RJDA 2MWCA 4NC1C 3WDHA 5KANG 2P8LA 3LRGA 5TFSL 3R0MA 2BOBA 1JWUA 2YPLA 3BWAB 1EHLL 4GRWF 2GK2A 5DQ9A 3HC4H 1KIRB 2VZ1A 3EOBB 3O6LH 4WEBH 2VXTL 5JXEA 1FZMB 4Y16D 4OUUA 3U9PH 1TDQA 3A67H 4GAFB 1HOCB 2B0SH 3BWUC 4X8JB 3QEGL 2LV4A 3ZKXB 3IVKA 1FH5H 5D1XB 2R0KL 3SCMC 1INDH 3GJFH 2VXUL 3MR9A 4YHYC 1F4XL 3BX7C 3O11B 5E2UL 1F6AA 1YUHA 1NAKL 4XVJL 3ULVL 3DO7A 3QRGH 4Z78A 3MRQB 5EORL 1YYML 4O2FA 4YDJA 3U0WH 1B90A 4BQ9A 3FMGH 3UCRA 1KG0A 3O3BB 4HG4J 1JNLH 1LO5A 2H45A 3ARTA 1AO7B 3PDGA 4IDLA 1CCZA 2LABA 3G6AB 4MNQA 3D5OF 4HUVB 3ZKQD 5L88L 4UQ2A 4JG1H 5I1LB 3ZTNH 5BQ7A 5JOPE 1RZKL 1T2JA 4X5WB 2DBJA 4K2UL 3OB0H 3T09A 5JZ7C 5E2WH 4XPBL 1IKFH 1CD1A 1RJZA 3CJJA 5CJXA 3JUZA 5L0QB 3B3IB 3WO4C 4GBXA 1E4XH 1DEEA 2A6JB 3QG6A 3K4AA 5ITBL 4NFDA 1E4JA 4PY7A 3SDAA 4ERSH 3QUMH 2V5RA 4LSQL 3EJJX 5GS0C 2M1KA 3X3GH 4GRWB 3EOAA 1KIUA 1N7MH 1JN6A 5IJVB 1F6LL 5FF6A 4PJEF 3QEQA 1MFDL 1W0WA 2GCYA 1I1CA 1ZLSH 4EI6B 2BHZA 5EIQA 2OS7A 5I9QC 2ZOLB 4KKNA 1A7PH 5FB8A 1LDPL 5FYKL 4F7TB 1WUNT 2YSSA 3WIHL 3ULVE 4Z8FH 2D7OA 3HS0B 4Y0GA 2AVGA 3J8F7 5T5FH 3T3ME 5IIEB 4ZPTB 3WS6C 1P69B 3TYFA 2P5EB 2CR6A 1NL0H 3CUPA 4NN6C 4ZFGL 1DANT 3TCLB 1QSEE 1ORQB 2DAVA 5D70L 3JXAA 1U58B 4LHUA 3HMXL 3OXSA 4MA1B 1NDGA 1GZPB 3UJJH 1I7ZA 3RGVD 4AEHH 3S35H 1S78C 3V52L 4LLYB 5ENWA 2VDLL 1NLBH 4CN1A 5INCA 1U8JA 3QISA 5EU5A 1NDMB 2YBRA 5L2JB 1BD2A 4LSUL 3FB8A 1BJ1J 4OZ4B 1BFOA 3OAZH 4N0YH 3RVTC 4Z7VA 2HVKA 4RGNE 1ZEAH 3MQIA 4PJCE 2CDGB 1OHQA 1A6ZB 2AV7B 1MQKH 5J3HC 4BFBD 3GHEH 2EDQA 1NGYB 5KTEH 1XH3A 4JKLA 2F74B 1N6UA 3OR7B 2O5ZH 3U83A 5HI5D 3LS4H 4M4RA 5TDNA 3K46A 2HFFA 1FPTL 4MZ3A 4JGMA 3DUUA 3DUSA 4KVCL 4NYLA 1RVFL 5F1IA 3GIVA 3QEHA 2Z4QB 3D6GA 4NQDE 4MNHA 2XXCB 4X98A 4N1HB 3O0RH 4RGOL 5FYKE 1UENA 5C0JA 5GRUL 3EGSB 4WNQA 4LKXA 2AK1L 4XC1H 3SKOA 5BJTB 2AP2A 5HDBF 5E08L 1Q8MA 2EDNA 2D0FA 3O9WD 5MP6L 3MNVB 2LU7A 5HD8C 2X4RB 2IAMC 4MCYB 1CG9B 2CQVA 3MRRB 2Q8AL 3OHXB 1CFBA 2WSKA 2X4SA 2ARJQ 5EC2A 2AV1A 1NC2B 5C6TL 1EBAA 4X7SL 2EYTA 5TE7L 1JF1B 5I0ZA 3DGCR 1ZVSA 1H3PL 2NY4C 3BKMH 1C1EH 2HWZH 4G8GE 1YEEH 1IQDB 4HUNB 1AKJB 4X4MA 5D5ME 4UINH 3TVMC 4XB7A 5ERWB 3ARPA 3X14B 4PLNC 1I7UB 2Y72A 4HWZB 2WBJD 2ZJSH 1DDHB 5D2NA 2R23B 3KYOA 5D1QB 3WS3A 3CLEL 3VG0H 4EKXA 4JG0L 3FT4B 5D1ZD 2X2YA 1KFAL 1KN4L 2NY6D 5J6GB 4NPYA 5EO1A 1UWEL 2D03H 1LO4L 2NY0D 1QHOA 1WSST 4PLJC 4X4ZA 4ZQKA 1QLEH 3KYKL 5F7KC 1CT8B 4I0KA 5ANME 1JGDA 3QQ9C 2WP3T 5T5NG 3ULUF 3D3VD 1KCVL 4X7DC 2BP3A 4FP8L 3VWJB 4L4TD 1NCBL 2QSQA 3LPGA 5DWUH 3VI3E 4KWUA 5J9PA 5DS8A 1QFUL 3ILQD 2AERT 3ARRA 2R56L 4XXCC 3X12A 1DBJL 3GMQB 1KELL 4G6MH 3GSNA 4BSJA 5T1LD 4P9ML 2A83B 4RISH 5HYJB 2HVJB 1XF2A 2QQKL 1YDPB 2Y7QA 1GIGH 3RVVD 1MCOH 2X1WL 1UKTA 3TV3L 5MEPA 3HI6H 1FCCA 4NRZA 3SDCC 1UB6B 5CJOH 1ZLUH 4CRPA 4FS0A 1VGEL 1XEDA 4N68A 4LCWA 1SEQL 1YNTB 3IGAB 5MERB 4DZBB 4CU7A 1WITA 1P1ZB 3S96B 4IHOA 3EFFA 1S7XB 5E6YA 3QXVA 3V6FB 5FK9A 4DVRH 2DB8A 4PJFA 4WO4C 3UTTA 3VFGL 1EXUA 4HS8L 3ROLB 1JPTL 3OXRB 4RMWA 4JJ5A 4HHAA 3D0VB 5KSUA 4CBPA 5KVDH 4KQ3H 4HWUA 3BHBA 5AUMB 3HCVA 5DUBB 4IOIB 1VHPA 1YPZE 2B1AL 2UUDH 1BFSA 5SV4A 3MV8D 4ZYKB 3QXDA 5F70A 2GJ6B 4JDTH 1XF5A 4JFFA 1OT2A 3KLHC 3MLZL 3PP4L 5CD5D 4ONGH 5FCUL 1CFTB 3BIBX 1F02I 2Z8WC 3UBXB 3MRPA 1T3FB 4QHKI 5E8NB 3BIAX 4KAQH 4X6CF 3RTQA 2GYSA 4ONOA 1G1YA 3MRJB 4OV6F 4EEEA 2OQJA 4H26A 4DUVA 4U1KA 1IGYA 1FYTD 5EU4B 2V17L 3V5DA 4NDMA 2XTJB 2VC2H 3BP7A 3ZMRA 3QZWB 1FO0A 4ZPVB 2YPVH 4EIZC 2DYPD 2ORBH 2ZNXA 3MXWL 4Y5XB 3TH2T 2K7PA 4WCYL 1N3NB 1MJUL 3BFOA 1H5BC 5HI3D 1U42A 1EUUA 4EI5D 1WFUA 5FA4A 3AY4C 3OKMB 5BZDB 3QDGB 4LLMA 1P9MA 4D9QE 1NGPH 3VGFA 3GMPA 2ZUSA 1R3HB 2CIIB 1S5HA 1SYVB 4NCDA 1X5YA 3S8WA 3OG6B 1J86A 2M2DA 5F9OL 2EDLA 1U2CA 1VACA 1GRWA 3TJHC 5FM8A 3RVXC 4JPKH 6FABH 1JI1A 1FBIH 1PYWA 3CC5A 1J0HA 5C08E 3TWCH 4P2QB 3QUXC 2ATPA 1UACL 2DRUA 3B9AA 5KSBA 4K7PL 2DQIH 2ENSA 3JWDC 2FECL 3WUWB 4L8SC 3K8MA 3ZKMC 1BIIA 4LLWB 5DD5H 4RFEB 4XPFH 4HK3J 3FRPG 1FL3A 3U1SH 3QJFB 1CLZL 4R8WL 4XI5C 3V5HB 4F37K 3CH1B 4KI5E 1I1RA 2HJKB 2AGJL 5BCAA 3UPRA 1II4E 1D5XB 3P30H 4LRIA 5KJRL 1NAMB 3IXAA 2DTML 5D7KD 2QQLH 5E70A 1G6RL 4X6CB 3O4OB 2EDXA 1FORL 1S7SA 4XNMB 1TCRA 2Y06H 5HPMB 1TZIA 2ICEB 3Q1SH 3WHE0 3CDGA 5GGQH 2O5YH 2NZIA 5L2KD 4U3HA 5HYFA 1NGXB 3H3BC 5JXEC 2AJSL 2F54A 2YRLA 3NIFF 3HAEG 4UT6H 5AYUH 4NO5A 4OLVH 1KEMH 5FV2A 4IRSD 3RRQA 4PTUB 1YNLH 4GKOA 1S9YA 1BAFH 2VLKB 2DWEB 4RBPH 4WFHE 3ZKND 1QLRA 1D5IL 4N8VG 4HJGB 3T2NL 5KSVB 4EDXB 1MCPH 2NXZD 3QUYA 3UTPE 1CD9B 2UWEE 2OJZL 1JHKL 4UV4L 2VN7A 2VR9A 4F3FA 1G9NL 5GHWH 2C26A 2HJFB 3U4EA 5IVOA 4KHXH 4YK4C 2EYSA 3ZSSA 3D69B 4YBLC 2EXYC 1I9EA 1FFNB 2EIBA 3T2OA 3OGCB 2B4CC 3LN9A 1U8NB 3ZT7A 2CD0A 1RJYA 1C7SA 1K2DA 2K9UA 2YA2A 4GS7B 3O45A 4E41A 2OI9C 1JGEA 5HDQH 4WY7H 4JM2F 3PWLA 4F7PB 2H26B 4UDTB 5JW4M 2IG2L 1JGUL 1CL7I 3GKZA 3PWPE 4KFZC 1G9MH 1XCQA 3T3PF 5F44A 4TVPH 5K9OA 1WIPA 4K8RL 3G9AB 3DMMB 5CJXC 3HB3C 3HE6D 3RJQB 4HUUA 2MFNA 4CW1A 2R0ZH 3HZVA 3EYVB 4GKZB 3SDAC 2DQGH 1XIWD 5IQ9B 1F90H 3P77B 1JIBA 2FD6H 3HG1D 4XP4L 2A1WL 3VRLF 1EIBA 3JUYA 3BGFB 2R15A 4RCAA 4ZO6A 2NX5D 2V2WB 2H2SC 4MQXD 5LGKA 4NOFA 5GSRB 4XCNB 4UT7L 2DLHA 4M9PA 1Z5LB 1QNZL 4GBXD 4QGYA 3BWAA 3QIBD 3TT1L 3VRIB 2JJVA 5FYJL 1JZ5A 5M7QA 1KIRA 2NYYD 3EOBA 4OSUH 1FZMA 5FHAL 5BRZE 1NC4B 4M6OH 3NA9H 3GSWB 5BOPA 4NBZB 1HOCA 3U9UB 4X8JA 4PJ7E 1KLUB 4BZ2L 5DUML 3GIZL 1XR8B 4OF6A 1VFAB 4YHZL 5D1XA 1WZKA 3AU1B 2BDNL 1JZ2A 4G3YH 3TEUA 4N90D 2EIZB 1LEKB 3O11A 3O8XC 1GGYA 1WBXB 1MFCL 4M6NH 3MRQA 4JM2B 3HI5H 3QJHA 4GQ9L 4JFDB 3KYNB 3O3BA 2YUXA 3KJ6L 2IQ9H 1AGBB 1DBAL 2BVTA 2GEEA 3MRNB 4L9LB 2JJSA 3A0OA 3MRIB 1FNEB 1AO7A 4YIQA 2PO6D 2YD4A 3W2DH 3CMGA 5HHVH 3E6HB 3QNYB 5FKPB 3VFWB 4D3CL 3G6AA 1B4JL 1I85A 1BMGA 4HUVA 4MA8L 2D9QB 4AG4L 2WWMC 4YFLF 4Q2ZB 4MB4A 4KQ4H 5I1LA 3P0YL 4X5WA 3EKCA 1BVZA 3O2DL 2X4NB 3RU8L 5EDXA 2A6JA 4U1JB 4TTGA 4PD4K 1BGXL 4CN6A 1OGAB 1VENA 5FYJE 4QRQB 3W5NA 1CZ8H 5C86A 5DMYA 1PEWA 4K9EH 2XTLA 1OARL 3QBTB 5BS0D 1FJ1B 4KUCF 4I3SL 1W72H 2FLBT 1FG9C 1DBKH 1X5GA 1OAQH 2HT4C 5IJVA 5L88H 3L1OH 3U6RB 2N56A 2DLFL 4EI6A 2Q76B 1H3WM 3G6JF 2ZOLA 4NM4L 2NY2B 1S3KH 2OP4L 4FG6C 2AJUL 4DW2L 5DJZB 4M1CD 1AR2A 1TJGH 3HS0A 2W59A 1QFWL 2XQYK 3TZVB 5IIEA 4ZPTA 5MENB 2GJZB 2VDKH 3ARQA 2P5EA 5FO8B 1AQKL 5E2VH 3K0WA 2X4TA 5T3XD 4L8CB 5D2NC 1EBPA 3IYLW 1INEH 3TCLA 4M93B 1ORQA 2ZKHL 1U58A 1JBJA 3AB0B 4EBQL 4KPHL 4MAYB 3NCBB 3GJFB 3TH4T 3BESR 4LQFL 1WGOA 1LDPH 1TZGL 1EEYB 4LLYA 3GRWL 1NDMA 5L2JA 4D2NA 1DQML 1KJ2B 4XPTH 4OZ4A 5K33A 3WXWH 1A6ZA 5JTWA 2BERA 4JO2H 4BQCA 1NGYA 4BZ1L 5CIPB 4CUCA 2DQJL 1BQHG 1IGML 1WFNA 3OR7A 1OP3H 5CJ8A 5KSAD 4TOYL 1OP5K 1GC1H 4ELME 2VZUA 1V3MA 4ZDHB 5C9JB 4TSAL 1CD8A 4HH9B 2Z4QA 4DWHA 3HRZB 4HIHB 2DL2A 3K2MC 5HSFA 4FQIH 1D9KD 4M7JL 2GSIB 3EGSA 2GW5A 3WFBL 5BJTA 2BRQA 1WAAE 3QUMB 4NZUH 1I7RB 3G6JB 2DMBA 2RBLA 1F4AA 1OM3L 5F1NB 5TE6H 5EU3B 5GGSY 3I6LE 3MNVA 2X4RA 4MCYA 1J1OL 1CG9A 3MRRA 4BSWB 3OHXA 4GSDL 5IG7B 1X4ZA 2BFVH 1NFDE 4XP1H 3D39B 3EYFB 1NC2A 4KVCH 4JKWA 4R90L 1JF1A 2P49B 1T4KB 5SWSE 3HMWL 4FFYL 1X6NA 4Y1AB 4RGOH 4LCWD 1AKJA 3MV9E 3NN8B 4X9BA 1FL5B 3CFCH 3H42L 2AK1H 4KH2A 5ERWA 3X14A 4KJWC 4EDWL 1SJHA 1I7UA 4TNWK 1DDHA 3DUHA 1V05A 5EZJB 2F53B 3VGAB 5EUKB 2R23A 5D1QA 5E8OB 1ZGLM 1YEKH 4YEEA 5TJWK 4IIQB 4PJAF 3LQAC 5J6GA 3RTQC 3WXVL 5EIIB 1R24A 3WKNA 3T0EB 3IKKA 5TE7H 4PV8A 1EO7A 2IGFL 4JFYB 2XZZA 4IJ3C 1H3PH 3B5TA 4OGAC 1JK8B 4PPTA 5ID1B 1R0AH 2FBOJ 1CT8A 3S7GA 4PB0L 3O4LB 4QHKJ 5T3ZL 2Q3ZA 3F7YB 4HJJH 1IM3B 1QRNB 4HXAL 2J3SA 2RHEA 1T22B 5F7HA 2C1OB 5IHLB 2N7AA 3V95A 1MRCL 3VWJA 1HIML 1RIVH 2PYED 3H0TB 3P0GB 1F6FB 2RQ8A 4Y2DD 3UYRH 2BNRE 3GSVB 1P9MC 2CK0L 3EJYD 4HWEL 2VLLB 2RJMA 3FQNB 1YC8A 3GMQA 5GZNC 4TYUA 3GMMB 4KKLD 5TQ2H 2A83A 5HYJA 2HVJA 2GY7B 2KZ1B 2PETA 2ZSVB 1YDPA 3ZYIA 3S37X 2V9QA 4KZEL 1IC5L 2Z31B 3B9VA 3NH7L 4JVPA 2H9GB 5I19L 1UB6A 1B2WH 5FEBA 3H8NA 3CSBA 5ADPH 1YNTA 2BY3A 5MERA 4PRPB 5HDOA 4DZBA 1P1ZA 4ODSL 3VMNA 3S96A 1S7XA 3RDTB 3V6FA 1G84A 1H0DB 5GRYA 4DVBB 3WLWD 1QFUH 5F9AC 2NR6D 2R56H 4WUUE 3C2SA 1P6AB 5JW3L 1MAJA 2FGZA 3ROLA 1NUFA 1JGVH 4ENEC 5F7MC 5EZIL 3OXRA 3U46B 4LRIC 1NFIB 3V4UL 3CFBB 5IB5B 2EDKA 5AUMA 5DUBA 1IC1A 4IOIA 1ZMYA 1TQCC 1GJIA 3ARBB 3FO2A 4HLZH 4ZYKA 4CVZB 1DE4B 2GJ6A 4XWOD 4QRSB 5T3ZE 1I3UA 2YWZA 4JKPL 1CFTA 3X17A 3DYPA 4LLDB 4R7NB 3DV6B 5HJ3B 4UUJB 3UBXA 1UKSA 5HYQB 2JLLA 4NCC1 4HWBL 5E8NA 5I1AB 2FX7L 3FQXB 3VXUE 4A6YL 4JY4B 3BZ4B 1ZSDB 3MRJA 3MRLB 5H37G 4W6WB 5L9DH 1JWSB 5D7SH 4UOW0 3ZSTA 1DN0B 1QFOA 5EU4A 3HPLB 2OMNA 2ZUTA 4XAWH 3OKYA 4JB9H 3QZWA 4ZPVA 3PQYD 4OD1H 3WV0A 3QUYC 1F3RB 4U1GB 3LZFL 4Y5XA 1YN7B 2VMFA 4QHMA 1N3NA 5F21B 4ZD3H 3ARFA 2Y23A 4JCLA 3OKMA 5BZDA 3QDGA 4KRPD 5JHDE 5TF1L 5E4EC 2P46B 1I9JH 1I9IH 1R3HA 4OQ1A 2CIIA 1SYVA 3VFUB 2R8SL 3DXAB 1C5BH 2FGWL 3C2AH 1F8TH 1RUAL 2AXJA 5LGHL 4BK5A 1MHCB 3MRCB 3CSYB 1FIGH 4M5YL 2H32H 5D7LD 5KAQF 3BUYB 4P2QA 3QNZA 1W0YT 3F8UB 4M7KL 4XHJD 3WUWA 1JNNH 1IBGL 4HK3N 4LLWA 4RFEA 5HYSG 4PRIE 1I4FB 5AZEL 3QJFA 1RU9L 4FNLL 5IMOB 1HYRC 3CH1A 3CVIH 4I1NB 3MPCA 2HJKA 3IFNL 4PYHA 4Y2OA 4U6VL 3E3QE 4B0MM 1D5XA 4P2RA 1NAMA 3QDMD 2EDWA 2WNGA 4OM0L 2ILLA 1K4CB 1QKZL 3QA3B 4X6CA 1M1SA 2I27N 3QO0B 4XNMA 5GRVK 1HILB 5GS2H 3SJVE 2AI0L 2ICEA 4XNQB 4HG4K 4PBXA 1TZHB 1ZHNB 2WWKO 5IEHB 5FUZL 1NGXA 3VA2C 2VUYA 4OTXL 1YQVH 2FRGP 4R8WH 2W07A 4HKZB 5IVXF 1KPRB 1LHZA 4QT5B 1ZGLA 3ZKXC 2VSCA 3ETBF 2VLKA 2DWEA 5D1XC 2DTMH 1NEUA 5CJQH 4YHPB 4J12A 1TJIL 4HJGA 1VFMA 5KSVA 4EDXA 4P23D 4O2EA 1VFOA 5I1EL 2OL3L 2DDQL 1FN4B 4XMKL 4JO4L 1YEHH 4WFEE 2HJFA 3MLWL 2V7NB 3PV6B 1OF2B 2VITB 2BRRH 3D69A 4FZ8L 3LKSA 3UO1H 1FFNA 5EG6C 3OGCA 2WAHA 4KRMB 1U8NA 4M8VA 2JJSC 2DQDH 3MFFB 5CILL 4C56D 1QUNA 4URTB 3UX9B 1DVFB 1S7VB 5EBGA 4ZUWB 4JE4B 1Q72L 4F7PA 1ERNA 5DXWA 4QRTB 1YN6B 2H26A 4UDTA 3UC0H 4B50A 4HF5L 4DK3A 2Q7YB 3SKJL 2FZ3B 4O2CB 2CRIA 3H7BB 4L8BB 5EUOF 2D2OA 2DI9A 2YK1L 1Z2KA 3DMMA 3HHRB 5L0QC 5I1CH 4TPRL 4R4NC 1NBZB 3C60B 1O7VA 3PL6A 4MJ5B 4OQTA 3EYVA 5SWZE 5E00B 4MMXC 3MROB 5IQ9A 4NM8H 3VXMB 3P77A 2XNAB 4UILL 4XCEA 5JUEH 1WBZB 4GLRI 1BWWA 4JPVL 4W6XB 5EZLB 1WT5A 4RA3A 5IK3A 4APQD 1NGZB 4E0RB 2V2WA 2EDDA 2IG2H 4H1LH 5GSRA 1SEBB 4XCNA 4AEIL 3QDHA 1Z5LA 1DN2A 4K8RH 1UA6L 2ITCB 4R9HA 3VRIA 1J0ZA 1I9RH 1FAIL 2ITDB 2KPNA 5E5UB 1A1NB 4N1CA 4HW6A 4WFFE 1I3RA 3ZHLA 1NMBH 4BFEA 1NC4A 3KPRB 3GSWA 4DKFL 2AEWA 1CXEA 4G9FE 4ORGB 3U9UA 3MBXL 1CE1H 1KLUA 1F97A 4S1QL 1MPAL 3WNNA 2A74B 2VDQL 3LKQA 5I1IH 1XR8A 1GHFL 1VFAA 4KV5E 2EH8H 4ZNEE 3AU1A 4QRRD 2N4IA 1OAXL 1JRHH 4OI8A 4P59H 4MA1C 5C7XH 2EIZA 1LEKA 4LLAA 1S7QB 2WLYA 4ZSOE 5EU7C 5JA8B 1F11B 3NZHH 2V5MA 3P11H 3TT1H 5F7DB 3VFTB 1V5JA 4JM2A 1RURL 3I02B 3KPOB 4GG8B 4JFDA 3KYNA 1YEIL 1AGBA 1RHHB 4LSTH 3MRNA 3SKMB 4QHLB 5FFLA 1BEYH 5B3JF 1SM3L 4L9LA 5EUOB 4MJ2A 3MRIA 3KPTA 4KK6D 3BD5A 1FNEA 5DD1L 2F8VA 2VDOH 2XWBB 5EZOL 2X7LB 3MJ6A 3E6HA 3DWTA 4PP2B 4M7LT 3QNYA 4Q74A 5FKPA 3VFWA 5GZOD 4YHZH 4JHAL 2VSDA 4NO3A 5BV7L 4Q2ZA 1OSZB 3OJMB 2AJZB 4WI8A 4YHLL 2X4NA 3AFLA 3STBA 2MQCA 3LSOA 4U1JA 3OTTA 3T0WA 4XPAL 5HI5C 1OGAA 1DBAH 3WN5B 2J6EA 2XZAH 3ZDYE 3EHBC 1NMAL 3KPLB 5F6HI 1A6TB 4HGKC 2IPTL 3CXDH 4KKBD 4WW2F 3FN9A 1FJ1A 2NZ9C 4F15B 2IH1B 2YUVA 3I2CH 4KK9D 2DQFA 3FFCE 4HIXH 4YXKL 3ULVF 3PABB 3RWFB 3MJGX 4NT6B 3U6RA 1QBLL 3T3MF 4LBEB 3P0YH 1UXWB 2Q76A 4U3XA 3MLXH 5C0RL 4XAKD 5DJZA 1OAZL 5D2LE 1T1WB 5CCKL 4IMLB 1PEZA 1LE5B 1TFHA 3JV6B 2Q7NA 2CGRL 2GJZA 5I8KL 2PW1B 5FO8A 5DD3L 1CDHA 3SE4A 2VXSH 2CO6B 4HDIB 4WU7B 5K9KB 4L8CA 5DJXB 4MLSA 1ZTXL 5D1QC 3LRHA 4KJQC 5J1TC 1CICB 4JRXE 4EUPB 5TQ0H 1U41A 4MAYA 1DJSA 4JPWL 1XF1A 2DLFH 2AS5M 3GJFA 2NPLX 1ZGLP 4NM4H 1A0QH 4EOWH 2EDYA 1EEYA 1U3HD 4DW2H 2BJML 1EHNA 1L9NA 1NEZB 4ZFZA 2UY7A 1WWWX 4DKDC 1QFWH 4YWGL 3NCEB 1KJ2A 1F13A 5IFHH 4D8PB 1AQKH 3A6CL 3RWEB 5DA0B 1KCKA 3VWJC 1KJMB 2YRPA 4OT1H 5DGRA 3UTSD 1T0NA 5CIPA 2ZKHH 2MQ0A 1Q9OB 3VWKB 5C07D 2F58L 5C8JB 5C0IB 4MHHG 3N9GL 4FTVE 4WW2B 4PG9A 4ZDHA 4R2GC 4FZEH 1T1ZB 5I16B 4HH9A 25C8H 4QWWD 15C8L 4FQXB 2D4FA 3HRZA 1N26A 1KJ3L 3ARGB 1D7FA 1Q9WB 4MNGE 2VZTA 3WD5L 4BZYA 1JHLL 3HNVH 4HKJA 2GSIA 5FECB 3BMVA 3V7AG 5IT2H 1AHWB 3PHQB 3MNZB 2PXYB 3QUMA 5IBUB 1I7RA 3G6JA 5GJSL 4OLXL 5F88B 2DM3A 5ESAB 5F1NA 5EU3A 4FFWD 3Q5YA 2MMXA 4L4VB 4RZCB 3RWIB 3V5KB 4S2SB 4BSWA 5BO1L 1TCMA 2B39A 2XYCA 3CSPA 3FN0L 5D5MF 5IG7A 3FQWB 1MCQA 4TOYH 3D39A 1X7QB 4GT7A 3V8CA 2Z35A 5DMGD 1AGCB 3QFJD 2X1XR 3O2VL 4F7MB 2KH2B 5A40E 1T4KA 1U8HB 4ALAL 5GRZA 4DN4H 2BVOB 1MI5B 4LVHB 4Y1AA 3FHAA 2NCMA 1XGTB 1FL5A 2XQYG 5DRZB 4TQEL 4WTZG 1N4XL 4RGNB 3N1QC 4W4NA 3QEUB 3I3DA 5A3ID 4ZAKD 5EZJA 2O5XH 2F53A 5EUKA 1ZT4B 5E8OA 3IF1A 4NO0B 3V6ZB 2HFGL 3JV4B 3CGTA 4PJGE 3V6OE 5CZXD 3ARZA 4GG6E 2DOCA 4IIQA 4X9IA 4AH2B 2QKIB 3C6LB 3L5JA 5C0CB 5I8OH 3ULUC 1NSNH 1CDIA 1HDMB 5EIIA 4OF8A 4OLWH 3T0EA 5D96B 2Y9RT 4NQED 1UH3A 3LCYA 4JFHE 1TQBC 4JFYA 3UZEA 32C2B 1KPVB 1JK8A 1L7TL 1NMCB 4HK0A 5FYKU 3S37H 3TLRA 2XTJC 3O4LA 1MUJB 3WBDA 3D2UB 4UBDC 5CGYD 4UNVA 3F7YA 1IM3A 1QRNA 5FM4A 1VERA 1T22A 1K8DB 4HBCL 2C1OA 4Y5XC 3HNTH 4P3CH 2DN7A 5H35B 3H0TA 4P5KB 5C9KA 2BC4B 3WFDL 3ARFC 2J1KA 4WI2A 1NCWL 1A3LH 3GSVA 1OL0A 1Q94B 2NLJA 3OWEA 2VLLA 1YEFL 3FQNA 3KXFB 2P5WE 1ZA6B 4X6EB 4KKCD 3GMMA 3WL9A 1FVDB 3MJ9H 1OAUL 2ZSVA 2DI7A 2W65B 5CJ5A 2IGFH 2Z31A 4LCYB 2H9GA 2HTLD 4G8GB 5BVPL 5D5MB 3JWDH 5T3ZH 3H9SE 4O58H 1UWXK 4HXAH 2B8OT 5JDJA 5IBLD 4G6AD 5F9JB 1IFHL 1MRCH 4PRPA 1NCCH 5DTFB 1IT9L 4HCRH 1P2CB 4K3GA 1J0YA 1U8KB 3RDTA 1Y18B 1H0DA 2OLDA 1E4WL 1WV7T 2C7UB 1QBML 4HWEH 3GEWB 3MNWA 1YPZF 1G9EA 1Z9LA 1CD0A 2WIIB 1NGWB 5KVGL 1XR9A 5FUCE 4YE4L 5D72H 1HI6B 4S1DC 4ODUB 3U46A 1MLCA 1NFIA 3CFBA 1IC5H 3NH7H 4OCXL 3MV7E 4AYFA 5ANMB 5DO2C 1WIOA 3H9ZA 3DRTA 2VB5A 3ARBA 4BELD 3O4OC 4CJ0A 2V7HA 4CVZA 1DE4A 1ZANH 2H6PB 3W11C 5HGHB 4QRSA 4BQBA 2X70B 4R7DB 1KENH 1G7QB 1BJMA 4UV7H 3DSNA 4OBRA 4LLDA 4R7NA 1A47A 3DV6A 4WHYG 4UUJA 4YBQD 3GI8H 5HYQA 3QUZD 3RPIB 4KZDL 1SYSA 3EYQD 5I1AA 5B39A 2IF7A 1I8MB 1CYGA 4YBHA 4MJIE 4XHQA 4M7LL 4OGYL 4JY4A 3BZ4A 1ZSDA 4QO1A 4Y5VB 1X5HA 3MRLA 5EZIH 3HC3L 1JWSA 4GAGH 1DN0A 2HLFD 2I5YH 1RULH 3LN4B 3MOAL 4FQJL 5D7IE 1DQJB 1I75A 4OFYA 4MXVE 4DFHA 4PRHD 4PREB 5EU6E 1YN7A 2G5BB 4CN4A 2OCFD 3BW9A 2B4CH 1KLFA 3KHOA 1BFVL 4WGVB 3T08A 4OZFH 3DYOA 5C0AD 3GBNL 3MUGB 3OAYK 5GRJL 3QPQD 3DXAA 3IAGC 2R4SL 3LIZL 2X9WA 4ODHL 3CXHJ 1Y0LB 1MHCA 3MRCA 3BP6B 1TTUA 3CSYA 1SY6H 4Q6YA 4B53A 4OI7A 5C6WH 5DFVC 3CFDB 3BUYA 1FNGB 5ICXA 4KI5F 4UIKL 4ELKB 3MA9H 1JUFB 3DMMC 5I75B 2ZCLL 4TRPH 5SX5K 1PQZA 5C0BB 4KDTC 3PL6C 1F5WA 3SO3B 1AXSB 3MOBH 5D93B 5IEKB 2YWYA 1Y6MR 3FFDB 2DQUL 4KTEL 3QCUH 3NAAH 2FGWH 5F7WC 1WT5C 4I4WB 4G43B 2NY3D 3BGFC 4G7VL 4M62H 2HN7B 3UEZA 3JWOC 4EQ2A 4M5YH 1IEHA 2KZWA 1MH5B 1K4CA 3QA3A 4XCCL 3F7VB 3QO0A 1QPPA 4N5UA 4PJHE 1HILA 4XNQA 2BXZA 1YQ2A 1TZHA 1ZHNA 3SGJA 3KPSD 4RX4A 5IEHA 1OPGL 2KQMA 1WWCA 4U7SA 4JO3H 1AR1D 4MJ6B 1A6VL 3BPLB 4FNLH 4HKZA 4XBEL 1RJLA 3NPZB 5LBSL 5HVWA 3IFNH 3GHBH 1I1YA 5CZVL 5HGDB 2HKHL 3TNNB 2B7DT 3M1BB 4YHPA 1B0RA 1XGYH 5C08B 1UEMA 4MQ7B 3NZ8B 1FN4A 2HT2D 3UPCA 1PGRB 1BVKA 4LP4A 4MXWL 4DN3L 2V7NA 2VR4A 3PV6A 5I8CB 2ZUQB 4JM2C 1PFCA 1MAML 3GNML 1OF2A 5C09D 1GGTA 1I1AB 4HC1A 4OTXH 2DMCA 4L9LC 3MFFA 1ED3B 1DBMH 5I30L 2KUTA 3WFEL 3BRDA 3GDBA 4WW1A 1EMTL 2CRYA 1DVFA 1S7VA 4ZUWA 1GGIL 2ED7A 4QRTA 1YN6A 5TDOB 4MSWB 4B7IA 2Q7YA 2FZ3A 4O2CA 4NN7B 2J88L 2VR5A 4L8BA 3H7BA 2OL3H 3MBED 3QDJD 2H32B 3GSUB 1V7NL 4NWTL 4XMKH 1T2XA 3JV5A 5AYQA 1KOAA 2QBWA 4X9GA 4JFDD 2CLVB 1TVBB 1C08B 1NBZA 3C60A 2DKSA 4MJ5A 2FO4B 5E00A 4OCMC 1NCUA 3G5VB 2APTA 3MROA 3O6ML 3FT3B 3UTPD 3VXMA 2XNAA 3L5WB 4XMPH 1WBZA 2WZPD 3PWJB 4Q9RL 3WFCL 3UMTA 4QTIL 5EZLA 2VLRB 4O4YL 4LARH 1NGZA 5B22A 4OZIF 4E0RA 2RCSH 3QXTA 4BJLA 3ZE1F 2JB6B 1SEBA 3B2UD 4RRPA 2UZIL 5F6HJ 3EO0B 3SE9L 2HKFH 2YK1H 4YXHL 1L6ZA 2H3NB 1PG7X 2ITCA 2ITDA 4IRJD 1MIEL 2NY2C 3D25B 4JGJA 2OJEB 1YEJH 3SPVB 5LCVL 4FOMA 3KPRA 5DJ6B 2YD9A 2ZUXA 4ORGA 4UILH 5DA4A 4KDVA 4NO2A 3SE4C 35C8H 1AJ7H 1BVLA 4N0FB 1DANU 4PJDE 2A74A 4QOKE 2EKSB 4M93C 2FNBA 2GQHA 3K3QA 2I26N 1CGTA 2PW2B 1MRDL 3AB0C 5ACZB 1MNUH 3PWPB 5FGCB 4MAYC 3O3AB 3REVB 4Y19D 1G6RB 5DQDH 1CXKA 1JNHB 1WZMA 1F11A 5ABDE 4ZOAA 5F7DA 4X7FC 5EOQL 3I02A 3R06B 3KPOA 4O5LL 4GG8A 4I3GA 3TZVD 2A77L 3GMNB 5MEND 1RHHA 3SKMA 4QHLA 5EUOA 3BQUD 5LXGH 1X5FA 2XWBA 5I8EB 3LKNB 2G60L 4Y7MA 3RVWC 1XGUB 2X7LA 3E6FB 4M03A 4PP2A 5HGGS 3IU3B 4JVWA 1X3DA 3GSNH 4N8PA 3UXFA 5JR1L 1C5CH 1OSZA 3WLBA 4GXVL 2NXYC 3DTXB 3THMH 3MODL 3NIGE 2OBGA 3VRJB 4FFZL 2WBWB 5E94B 2AAVA 4HPYL 4ODVL 1DLFL 3VXOB 4OZIB 4N1EA 5TE4H 1YYLH 4HLJA 4UT9L 3ZDXE 3WN5A 2YOCA 1SM3H 3G6DL 3EAKA 3B8SA 3KPLA 1A6TA 2QQNL 4H25B 5GGRY 4PRNB 4OJFH 2IH1A 4TSCL 2Y5TB 4DGIH 3QR2A 3PABA 1DP0A 3RWFA 2VDML 5BV7H 4NT6A 4K71B 3KYMB 4JFED 5FKAB 3D3VE 4K3DL 1L6XA 2VZSA 4LBEA 4Y4KB 3SBWA 4YHLH 1HHJB 3G08B 1UXWA 5FUOL 2FX9L 1D5MB 3UJIH 4H1LB 3OJDB 4L4TE 4YDIL 3LDBB 2XKUA 3GSOA 5CEZL 4AY0A 3Q0HA 5JMOC 3PP3H 1K6QL 1T1WA 2EH7H 2VZVA 4IMLA 5I15H 4P4KD 2P4AB 1NGQL 4MD5B 1LE5A 3JV6A 3LEXB 4YDKH 1EAJA 3NCYP 2PW1A 2K1MA 3VXPA 2IPTH 1IQWH 1CLYH 1B6DA 3FL7A 4HDIA 5DR5L 4WU7A 3FTGB 5K9KA 5DJXA 1KSRA 3V7MA 3VGAC 1LD9B 3WYRA 1WTLA 5D9SB 1BQLH 1XF4B 4XCFL 5DRNB 1F4YL 1CICA 4IIQC 1QBLH 2D7NA 4DQOL 4EUPA 1HXYB 1EJOL 3D85D 1F3DJ 4GW5B 4HFUL 3VXRB 1OAYH 1OTUC 3QHZL 4HKXB 5EO9B 3T0EC 1U36A 3RX7A 1MEXH 5GGVH 1F45A 3FB7B 2W9DL 1NEZA 2VOTA 2BHUA 5CCKH 5L6YL 4YHKH 1LO2L 5I1KH 1KB5L 1ZWIB 4ELMF 3BRGC 3U36B 3L6FB 2X1PA 1LP9B 4D8PA 1P7QD 3ZTJH 3RWEA 3RQ3A 3MUZ1 5AZ2H 1KJMA 4Y4FB 3VWKA 4JREC 4M7ZB 5FDYA 3FAWA 4QCIB 5C8JA 5C0IA 3MV8E 5HHPB 2AEQL 1FC2D 5ALBL 4JPWH 4WW2A 1WAAF 4XWGH 5I16A 4E5XB 1N64L 4UIMB 3JVGA 4FQXA 3G5XB 4HEME 3N06B 2Z31C 3ARGA 4DJMA 1Q9WA 3B83A 5FECA 4IRZH 1NFDF 5CEZE 1MRFH 1AHWA 3PHQA 1N8ZB 1H3GA 3MNZA 2PXYA 2R39A 2X1OA 5F88A 5ESAA 3GGWB 4MHHI 1KXVC 3BYTA 2WWKT 1RZ8B 4RZCA 3BT2H 4N8CL 3RDTC 3RWIA 3MLUH 2OTPA 3V5KA 4S2SA 2JIXB 2VH5L 3QG7H 5IBTH 5DMKB 3FQWA 4J3XA 4PBVC 1X7QA 3IRZA 3OKEB 4M48L 4NHCL 4JM4L 4F7MA 15C8H 1BM3L 5E6IB 1U8HA 4Y89A 2BVOA 2IPKB 3B2VH 4WJ5B 1I8IB 1TXKA 1MI5A 2Y6SD 5IFJA 2R1XB 1XGTA 4I77L 3K8LA 3AMKA 4MB3A 1CK0L 5DRZA 1NUNB 5ISZD 1PKQE 3QEUA 4OLUH 3BN9C 3NIDE 4UB0L 2GK0B 1RIHL 4XB8A 2Y07H 1ZT4A 3EJZD 3HTLX 4NO0A 1NCAH 1P84J 3JV4A 1MVFA 1UM5L 3TNMB 3ZHKA 3P73B 4AH2A 2QKIA 3C6LA 4ELMB 5C0CA 2AEPL 1HDMA 4HUWB 4QRPB 2HP4A 4OI9A 4CGTA 1A9BB 3REWA 1RMFL 3F7RA 4ZFOL 4ALAH 1R3IH 1KPVA 3ARBD 3IAQA 1MUJA 4ZXBB 3D2UA 2IH3B 4CMHB 3HLAB 3WIHA 4U1GC 1GGBH 1K8DA 1UCBL 4FQQB 3AS1A 1GYAA 3NBNA 5H35A 4P5KA 2BC4A 3DX9B 2XN9D 4V2BA 1EHAA 1JF6A 5D7KE 5JPMB 5EA0L 4H0GA 2ZSWA 2F8XC 2FHBA 1NFDB 4O9HH 3OZ9L 2F15A 4AEEA 3KXFA 4X6EA 1ZA6A 5HVFB 1M71B 1FVDA 3ZKSD 3IU4H 1A7QH 2W65A 4LCYA 1KBGH 3HZMB 4G8GA 4L5FL 2OM5A 3MV9B 5D5MA 5B38B 2XXMB 1WFTA 2EZ0C 4XX1G 2HJLB 2H2PD 3U4BL 5F9JA 3NVQA 2B5IC 3CK0L 2RB8A 5DTFA 3Q6FB 4HXBH 1P2CA 4LOUD 1Y18A 4O51B 1AI1H 5DJCB 2C7UA 3T04D 4QNPE 4OV5B 4RMRA 5CSBA 1YEFH 2WIIA 3HC0B 1NGWA 4ODUA 4TULL 2P7TB 1B0WA 5E99L 2CJUL 3U0TB 4NZTL 2B1HL 3N1MC 1R3LB 2EDHA 5ANMA 3VGEA 2CMRL 2E9IA 2K7QA 2UUDK 5GGTL 4HGWB 2D3VA 4OD3L 5I6XB 1E6JL 3JSSA 1T03H 5FGSA 2H6PA 2ZCKL 5HGHA 3RX5A 2X70A 3EOTL 4FQLH 1IT9H 4R7DA 5EC1B 1G7QA 1RZFL 3P9WB 4ZOBA 2MCPL 4Z76A 2BNRB 3KWWB 2ID5A 2A9NH 3E8UH 4OF5A 5JHLH 3RPIA 4M5ZH 5I0DA 1I8MA 3S4SA 4J1UB 2EECA 4OIBA 4YE4H 4MQTB 2V9RA 2VLJB 4WEMB 5DC4B 5KS9E 4Y5VA 5GIRA 4RGMB 1KCUL 2DLTA 5BVJB 1PBYA 2YD3A 5IGXL 3LN4A 1KXTB 1UVQB 4OLYL 2FBJL 4YHOL 4PREA 3HG1E 3B9KA 1UYWH 4MNQE 2J8UE 4KVNL 4I0PB 3W0WB 4LAQL 4AIXA 2NX5E 3MV01 4AQ1B 2LU4A 4YZFE 4WUUB 4GXUN 5FO7B 3RI5K 2CIKB 3MUGA 3VD5A 3RKDC 1Y6KR 4LRNL 4XZUB 2NY5L 4K07A 2BXYA 3KNBB 4EZMA 2UYLB 1Y0LA 3HC3H 1DVFC 3BP6A 3MMEB 5I18L 1E6OH 3NFSL 5D71L 1YPZA 3S88H 1OB1B 3CVHL 1FRGL 3AREB 3CFDA 1D6VL 1FNGA 6CGTA 3VXUD 1N6QL 1KJVB 3P9MB 1FGVL 1X5JA 4PJXE 1JUFA 4S0SD 3VXSD 4ZUSB 5CINL 3TO4D 5C0BA 3C60C 1BFVH 1CIDA 1AXSA 2DD8H 2KDGA 2C5DC 4NJAH 4GRWH 4N90E 1EAPB 5IEKA 3FFDA 2R4SH 4PY8J 3RZWA 4S1RH 3DX7B 4I4WA 1ORSB 4G43A 4OKDA 4H8WC 2HN7A 5DD0L 5T3XL 4EXPX 1RIUL 3F7VA 3TA3B 3I75B 4YC2C 2ESVD 3MACH 1A02N 2VAAB 3C5JB 1U3ZA 2ZPKL 1IGCL 4J3OC 2ZCLH 2MQ3A 1IKNA 1CDJA 1MJ8L 5JHDB 2ZP0T 5HHOD 3VH8G 4P5MB 2MNUA 4PJ9D 1JPST 3MCLL 3DI2B 1NANI 3AS0A 4KTEH 1BQUA 1FNLA 4LCUB 2FATH 5HGDA 4RBPK 2Y4SA 3TNNA 3O2WL 5DVMA 3M1BA 4J4PD 5C08A 4G9DB 4TN9A 5DEFB 4MQ7A 5BS0E 3NZ8A 3GSQA 4OKVB 3DO7B 5B4MD 5I8CA 4YK4B 4YBLB 4X8XA 3ZYOA 4PRIB 3DROB 1OPGH 1I1AA 2ADFL 5ACLA 4KJPD 1RPQA 1EEUA 2F5BH 1A6VH 4HUXB 1ED3A 4OZFB 3EYUH 3VGBA 4A6YB 3KAAA 4HGMA 5TDOA 5DHVB 4M00A 2R2EB 4MSWA 3LKPB 3HPJB 1R5IB 3SJVB 2H32A 3BE1L 3GSUA 2VZ3A 1TNNA 5CZKA 4LSSH 1RZ7H 5T3XE 3LH2H 1PG7H 1D6EB 1ETZA 4FQCL 2AABH 3QG6B 1TVBA 4GMTH 3GNMH 1C08A 4HX1B 5F7UA 2FO4A 3DETC 4JHBA 1RQ5A 3WN5C 3G5VA 5MHSD 1ZKAA 1MCIA 3FT3A 2Q8BH 2EDBA 3FZUD 3L5WA 4XC3H 4V1DB 5K9QG 3PWJA 1EMTH 4QEGA 2VLRA 4F15C 3LMJH 4X4ME 5IR1B 5T33L 3SHSA 4NJ9L 3BGAA 3QEQB 5IFAL 1DBBH 4P5TB 2JB6A 1YMMD 3SBWC 4JR9L 2OR7A 3EO0A 2E3VA 4TVPD 3QIUB 1A6PA 4KV5F 3D25A 1T89A 4U1LB 2OJEA 2HAZA 3STZB 1KTLB 1A6WL 3WJLA 3SPVA 3C5ZD 1CGWA 5DJ6A 3IJHB 4JHWH 1TTGA 5T5NF 2XI9A 2EYRB 4KHTL 4N0FA 1CF8H 1MCKA 4WGWB 2ICWB 2OK0L 2IBBA 4X6DB 1AE6H 2LVCA 2E9JA 4ZUTB 2PW2A 3P0VL 5ACZA 1MFAH 1CICC 3PWPA 5F89B 3D87B 2UZIH 3FO1B 3OKOB 3O3AA 4XP9H 3KR3H 3O8XB 3REVA 3EYSL 1M7DB 5J56B 1P4BL 4YXHH 1G6RA 2X4PB 1JNHA 4Q6IB 1IM9D 1QFWM 1RI8A 1SBBA 3NACH 1FZOB 4NQVB 4JQIL 5SWZB 3GMNA 5DLMH 4M6MH 4TTDD 3ABZA 1FHGA 3WFZA 1DUYB 3QWOB 4PFEA 1YNKL 5I8EA 3LKNA 1IEAB 4W70A 3E6FA 2FJGB 5JDSB 3HE7B 5IMLB 1KCRH 2DM2A 3IU3A 1XH3B 2VISB 1R5VB 2CKNA 4ZUUB 3ZYJA 4KTDH 3M8OL 4LCWE 3VWKC 1RUML 3DPBA 3ZDYF 3DTXA 4OF0A 5F9DC 2R2HB 4WW2C 4KU1A 3DUSB 4B7LA 1CXHA 5F1IB 4XTRC 3JVGC 2JJTA 4FQXC 3BKJL 5E94A 2OL3B 3VXOA 4OZIA 4ZS6D 3UTTE 3R1GH 4O5LH 3ULVC 3QRFM 3ARGC 4AMKH 1F4WH 2FDBP 1D5BB 3PF2A 3R8QA 4G9FB 3T65B 4PR5B 2PXYC 3TN0B 5SV3A 1HH9B 5DD6B 3QWRA 2IFGA 1AGDB 4HAGA 3EW3B 4PRNA 5DQJB 1RFDL 5T1MB 4P2OD 2Y5TA 5D2LF 4ZS7L 5JR1H 4GXVH 3KYMA 1WC7B 5EC2B 5FKAA 4HPOL 2AV1B 3SDYL 4Y4KA 3FQUB 1S7TB 4JFFE 2GSGA 1HHJA 3G08A 1FFOB 3MRFB 1D5MA 4H1LA 1YY9C 3OJDA 2PYEE 1RZKC 2AEIT 2IQAA 2E8YA 4JKKA 4X80L 4RWYL 5J7CC 4MD5A 3O6FD 4UTAH 1EFXB 4RGNC 4L4VD 1IVLA 3PNWB 1CR9L 1NLDH 3FTGA 3BH9B 4YQXL 1AH1A 1LD9A 3ULUH 5D9SA 3GSXB 2CSPA 1XF4A 4Q9QH 4D0CB 5DRNA 2A9ML 5F9WB 1A7NL 1VA9A 1HXYA 4K3DH 4XP5L 4ZUVB 4GW5A 4YHML 4NWUH 3GO1L 3VXRA 3CU7A 4HKXA 5EO9A 3BKCL 1HCFX 4F57H 1LO3L 4N0CD 1DQTA 4HJ0D 4PGEB 2VXQL 3FB7A 1NMCC 4NKIH 3P9LB 4P46B 1FAKT 1K6QH 3I50H 1ZWIA 2XV6B 2X9XA 3L6FA 1LNUB 1IC7H 3VW3H 4NGHL 4MX7B 3FFCB 1OP3K 4FQ1H 1UADC 4Y4FA 5DRWB 5C0CD 4IOFC 3X12B 2J5LB 4QCIA 5ACMA 5HHPA 2X09A 3LD8B 4PTTB 4G7YL 4UIMA 4TSBH 1SBSH 3G5XA 3CFKB 4DCQB 4LLUB 5D2LB 3H6JA 3PWNB 5EN2B 3U7WH 4AENB 2YUWA 4NRZB 1ITCA 3GK8L 1LO2H 1B6UA 1N8ZA 2CDFA 1RK0B 3GGWA 4MD0B 4JQXA 3VXTB 1RZ8A 1PLGH 5FA3B 3RZCB 1JPSL 1BBDH 2JIXA 4PG2A 1J1XL 5DMKA 4JRXB 2XZQH 3PQYE 5ALBH 3UTZB 5BV7B 1BF8A 2BNQB 4JAMB 3OKEA 1K4DB 3IKCB 1TPXB 5E6IA 1V3JA 5CEYA 4F8QA 4EN3D 4A2LA 3FN3A 2IPKA 3O2DA 4WJ5A 1I8IA 1IGJB 3HNSH 4PJGF 2GFBA 5E8DL 3LB6D 4GG6F 2R1XA 4J6RH 2QADD 4PRDB 4BQ6A 3F6IA 2EKJA 3BKYL 4BA8A 3PWUB 1IEBB 1DSFL 2XA8H 1JYXA 2GK0A 2R29H 4PP1D 3RY4A 4PS4L 4JFOB 1V7ML 5JXAL 4TVSa 3H3PH 4ETYA 3QIWD 5D8JL 3TNMA 2VH5H 5I1HL 5D7LE 3FT2B 3P73A 5GRVL 3SGEH 3CXHK 4FTVB 4ELMA 3BAEH 4XVUC 3T0VA 1AGFB 1MHHB 4HUWA 4QRPA 4Y5VC 4M48H 3NCFB 4OCWL 1SJEB 2OQJB 1A9BA 3IB4A 3QPXH 1QFPA 4G6KL 4S11A 3DSFL 1IILE 3QI9D 4MA7H 3WFHB 3V4PL 4I77H 4ZXBA 1OQXA 2IH3A 1M4KA 1CK0H 3HLAA 4OGXH 1IAII 1WAAA 2V5SA 4FMKA 1Z0NA 1A4JB 4FQQA 3B9KC 1B88A 5D6DC 3KJ4B 2Q3AA 4DKAA 2A38A 3QDME 3BYYA 3DX9A 2E6QA 4P2CG 5JPMA 4YGVB 5DVLA 2B20A 4LSVL 1RZJL 1NFDA 5T1DL 2AEPH 4KK5C 5DDHB 1TNMA 1DFBL 5GS1C 5GGUB 1MFEL 4KROB 1K3IA 1EO8L 3HZMA 3CLFH 3BDYL 4Y4HD 3MV9A 3CC5B 5B38A 4LVNC 3HAEB 3GRWA 1EO5A 4NBYB 1IGTB 3UAJD 2HJLA 1H3VA 4WWKC 2QHRL 3MLVL 3AROA 2L0DA 3Q6FA 4OQTH 4I3RL 3SOBL 1JYWA 5I75C 2OR8A 5AEAA 4O51A 4HT1L 5DJCA 4GG6B 2AW2A 3IDJB 3SO3C 3DVFA 4OFKA 4DOHB 4MXQD 4OV5A 3ESUF 1RZGB 3QCTH 4CVXB 5D93C 2GY5A 3JWOH 1AD0A 2ICES 2P7TA 4N5EC 3U0TA 4HH8A 4ZOEA 2XA3A 4P3DB 3SDDC 3N85L 1R3LA 4HGWA 2J7LA 2OX5A 5GJTL 3RA7L 1TCRB 4C56E 4ZMAT 4WDIB 3CDGB 5EC1A 5C0BD 5KZCB 1P5VA 2WINB 2VE6B 2DQHH 3KG5A 4DUXA 1YZZA 2R0LL 4NNYA 1IKNC 2BNRA 1ZS8B 3KWWA 4NP4L 2NW3B 5D7JD 3O6KH 5AD0B 5I76B 2A6DB 3AS3A 4U6HB 5D7IF 3INUL 2FYYB 2P5WB 4MXVF 3BPLC 2P24B 4YH6A 2I24N 1UM6H 4ODTL 2VLJA 1PKOA 1MVUB 4F7EB 4L8DB 4FFVD 4IOSD 1DL7H 5EIVA 5BVJA 2HTKD 3V0WL 2XQBH 5LQBL 2BSTB 1MFBL 2B1HH 3UBXI 1ZVYA 1UVQA 3H9SB 2AK4D 4OD3H 1U93B 4LPCA 2F5AL 4HUMB 4RDQG 2V2XB 4I0PA 5E2TH 3W0WA 2ZUQC 3AY4A 3ARDD 4WIQA 1JF5A 4OIAA 5J12B 2OZ4L 1I1AC 4WUUA 5FO7A 1CFNB 1LK3L 1K2DB 4KI5C 3S3PA 2CIKA 3L3DB 4XZUA 1A64A 2CK2A 3KNBA 4HQQL 2UYLA 3HFML 2OR9L 4H88L 4K3EH 1PD6A 1J5OL 3MV7B 1J9CT 1FGNH 1MCWW 3MMEA 5CMAB 3DVGB 1NUDA 4KKAD 5KVFL 2XRAH 4CU8A 1OB1A 3FB5B 3AREA 4OZGE 4NN7C 2IFFL 4OF7A 4Z95L 3VCLB 1KJVA 4R6UA 3P9MA 4G8FB 4N0UB 5ICYB 4NRXB 1UZ8B 4M43H 2J6EH 4HUUB 4JRYB 5E24E 4ZUSA 3NCCB 3TFKC 5IQ7L 1NBYB 4OLZH 2XIDA 4QRRE 3UJTL 3DI3B 4U6TA 2W0PA 2Y36L 3MCG1 3IDYB 4PUBL 5EU6D 2NY5H 3PUCA 2R69H 3DX7A 3D9AH 5DURB 4GAJH 4WUKL 3T77B 5KW9L 5I18H 4LPVA 3L95A 4LCCB 3NFSH 5D7IB 3CVHH 3EFDH 3TA3A 3I75A 3U0PB 1U2HA 3RBGA 2NNAB 4J7RA 4JY5H 2VAAA 1XCTB 3C5JA 3K7UA 4F2MB 5L7XL 4C4KO 2DQTH 2NY7L 4ZO8A 1IGFL 4K55A 3PWVB 1T89C 5JHDA 2HMIC 3V4VL 3VI4E 2X89D 3ARSA 4P5MA 3WJLC 5IESH 4H20H 3GKWL 1TITA 3ME0A 1BLNB 4PJIB 2VLRD 3I9GH 1F2XK 3L9RB 4LCUA 4Z77A 1P7HL 1FC1A 5MEOA 2ZOKB 4Y16B 1UB5B 4PJ8C 2XZCH 3NCJH 4G9DA 5DEFA 1FFPB 5E7BA 4NNXA 2XKNB 1QYGL 3SGEI 4OKVA 1IAIL 2ZPKH 3W5MA 1CXLA 3OR6B 1N5YL 1KJ2H 3FCTB 3QJHB 3CFIC 4PRIA 1MJ8H 3DROA 4I48B 2VDRH 1OW0C 4JZOB 3MCLH 2R9HC 4NZJA 5FYLH 4HUXA 1NCDL 4JFQB 4YIQB 5CIPH 5F7EL 4OZFA 3SDXE 2IBZY 2BSRB 4KK8C 4XAKE 1TVHA 1A6UL 3SCMD 1E0OB 3GMRB 3K4DA 2HT3D 1WCQA 4A6YA 1QTYT 5DHVA 3AM8A 5FGRA 2R2EA 5IB3B 3DHJA 1XF3B 3LKPA 5KN5B 1J1PL 3HPJA 3OAUL 1HXMB 1MCFA 1SY6A 1R5IA 1MSPA 2D7QA 4AK1A 2FEEL 3SJVA 3I84A 4S10A 5J57B 2E8ZA 2JJTC 1I3GL 1D6EA 4JCMA 5JIIA 4HX1A 2MCG1 1GPOL 3RY6C 5JOEA 2GT9B 1G9NC 5F96L 3UDWC 1TETH 1PSKL 4X7CC 4GMSL 3OBAA 2FWOB 1RSFA 3B9DA 4V1DA 4XNYL 5GISH 2ZNWA 5FAAA 4Q0XH 5TPWL 3IFLH 4RRPG 2P42B 1MCJA 5IR1A 3SE8L 3F6LA 2RR3A 3RHWF 4YO0B 5GGSB 4P5TA 4K71C 3OJVC 2CO7B 5JZ7D 3WSQH 2BX5A 4Y4KC 1Y6NR 3W39B 1RUPH 4HIIB 4KMTH 3LDBC 4P0DA 4PJDF 1BZQK 5ILTH 3T0BA 3UTSE 3QIUA 1IC4H 1U3JA 2VKXA 5K9QI 4U1LA 4K8RC 3MUJA 1OP5H 3STZA 1KTLA 1CLOL 5C07E 3RAJL 2FX8L 5GS0D 1ZHLB 1A5FH 5BW7A 1KTKE 3IJHA 5ADOL 2EE3A 4LASH 1WVZA 5CP7B 4XP6L 3QO1B 5ID0B 2EYRA 2X4TB 2DI8A 3RWCB 2ICWA 4W6YB 4X6DA 4ZUTA 1WICA 4E9LA 1OD7A 3BH8B 5IFAH 3RWGB 1Q0XH 4DKEL 1O7SA 5F89A 3FO1A 3OKOA 3O8XA 1M7DA 4NZRH 4UTBL 1BZ9B 2X4PA 4MAUL 4Q6IA 1JE6A 2DTSA 4YXLL 5HDBE 1FZOA 4KJYB 2XACC 4NQVA 5SWZA 1G7HB 3TESA 3T4AB 4O02H 3BGMB 1ZHKB 3C5SB 5I1GL 1GH7A 3NIGF 3RGVB 1DUYA 1G7JB 3QWOA 4P9HL 3QFJE 3GBML 1IEAA 1HKLH 4F58L 3Q6GH 4NN5B 2VIRB 2FJGA 3C87A 4XNXH 5JDSA 3HE7A 5KVEH 2VO5A 5IMLA 2IALB 2VISA 4Y8AA 1R5VA 4ZUUA 3GI9L 4Y4FC 3R0NA 3ZDXF 4M7ZC 3P0VH 4AZ8A 3TBTB 1UXSB 7CGTA 2R2HA 1S78D 4DEPC 4G6FD 3ZL4L 2EIEA 5DJDB 4FABL 2OL3A 4QOKD 1A14L 2DQCL 2Q6WB 4PJEB