2C9QA

Cu(i)cu(ii)-copc at ph 7.5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER RESISTANCE PROTEIN C
publication title Intermolecular Transfer of Copper Ions from the Copc Protein of Pseudomonas Syringae. Crystal Structures of Fully Loaded Cu(I)Cu(II) Forms.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Electron transport(copper binding)
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c9qA00
2WQVA 2OMVA 2OMXA 1O6TA 2OMYA 1IX2A 1M42A 2OMUA 3BZ5A 2RA1A 3BCDA 1H6UA 2C9QA 2WQUA 1NM4A 1LYQA 1H6TA 2UZYA 3FAXA 4CC4A 4CILA 2WQXA 2WQWA 2YA1A 4AQ1A 2Y5QA 1M9SA 1XEUA 2C9RA 1OT4A 2OMTA 2OMWA 4CC4C 4AW4A 1O6SA 3BC9A 3FAWA 2C9PA 2UZXA 5ICUA 3BCFA 1O6VA 2OMZA
chains in the Genus database with same CATH superfamily
5AYUL 3FO9A 2I85A 3RWIA 1W0WA 3LZOA 3UG4A 2ZWNA 2VMCA 4WHTA 5JUEH 4PGCA 3FN0H 5E6IB 3BAKA 1JZJA 1KPUA 3LEXA 4IRSD 1I7UB 3B7SA 5ECJE 1X9LA 4FQCL 1G43A 3T0XA 1CGTA 4DP5X 4UINH 1AOZA 4LCVA 4WI6A 4XN7A 2BY1A 4JUTA 3U0TB 1MCCA 4XNXH 4Y2DC 3GSNA 5CD5D 3IMWA 2P8PB 3C60A 2I7SA 2Q5BA 3HNVL 1PGRB 4O02H 3UTPD 3EO1B 2V33A 4G42B 3EFFB 1ZLSL 2ADFL 3VQ1C 3DVGB 4PRAA 3QJTB 1FV1A 2NX5E 4ZFQA 2VXSH 2JB5L 1TJGH 3WSQH 5EEUA 2BHFA 1BQHB 2A74A 3HE7C 1P5UB 2A6JB 3SJVD 3K2MC 3SKJH 4YSTA 4LFHG 3D69A 1GVIA 5FYKL 1YNTB 4YSAA 4AGLA 4RGOH 3QS3A 1PD0A 1R3IL 1NINA 1SEBA 5AB9A 2PWHA 4TULL 5E6UB 2WANA 4RDQG 4MCZA 1LL1A 1RZKH 4P04A 2IDSA 5FYLL 1X7QA 4HPOL 1HH9B 5C7ZA 4ZO9A 3OAZH 4HIJA 4QLWA 3SDXB 4NCDA 4O51B 3PXJA 1SMDA 2HB0A 2PP8A 2BZCA 1LO5B 1WF5A 4ES9A 5DFWH 4LT7A 1QFWI 4AYMC 4PV9A 4ZD3L 2M1KA 4NO0B 1FFQA 1MIML 4BFGA 1BDYA 3BGFB 3QNZA 4X5RA 1DZ0A 1JMXA 1DN0A 2EC9U 3C08H 4NO2A 4UT9L 3L5HA 5JIMA 2AS5M 1UJ3C 4PJGB 1BF2A 2LU5A 3B6SB 3FT3B 1KY6A 2IFFL 2JJUA 2CKBA 2X9WA 1RK1A 3O6ML 3F7VB 2COQA 2F5BH 43CAB 2DJMA 4HZAA 1EDYA 3BN9D 3DWTA 3HNSH 5F2FA 1DFXA 3GLZA 3KPTA 2EDFA 1G0XA 4B0MM 4KKCC 4AQZA 1IAKA 3RGBA 2X3AA 3PYCA 4XP6H 2MPAL 3QFDB 2B39A 3VXMB 1XB6A 4BXVA 3CXDL 1E3XA 3VUAA 4TOYH 2FHBA 2XSKA 1UASA 3H2QA 4XN4A 5DZLA 5E9NA 2LE9A 1DO6A 4B96A 1MRDL 1CDUA 4I48A 1WYJA 3TA4D 3HB3C 5HHOD 2OL3L 4M62L 3BZFA 1QR4A 3FH8A 1T1XA 2AQ3A 5DJ2B 4CVWA 4O02A 4ZUTB 4KK9D 5C08B 4JGJA 4OD3H 3TNNB 1EJOH 4N90E 4RGND 2XA8H 1FRGH 1F11A 4OM0H 2IDCA 2KLTA 2WJ5A 3MREA 3UTSB 4N2NA 4WVRA 1QUPA 2PO6B 3UGUA 5DEFB 4XI5D 4F5CA 4FQLL 3DC0A 4HIQA 1A4AA 3MV9B 4PTUB 2ZXCA 1D6EB 4R26H 3PY9A 3V4VL 5E1HB 4MD0B 2RHEA 4S1SL 3QDGD 3MOQA 4PRIE 1X5IA 2FJGB 1JXGA 1EUTA 1XGRB 2YC1A 3LMJL 2B20A 3UERA 1BIIB 2EYTA 3DV6A 1YMHB 1Z5LB 3JWDH 1S9WB 4U1KA 3OAYH 4U6XB 2EH8H 1GSMA 3LPFA 5DJ8A 2WSDA 3ZDZF 1PD1A 4F8PA 4OZIE 2ENQA 1ACXA 3UTQA 2NY6C 5JW4Q 1Q94B 3MJ8A 5BZZA 3LKNB 2BVUA 5D71L 2UZXB 1EHKB 1BVLA 3RU8L 1FO0H 3VI4B 2YQGA 4M1GH 1KCUH 1X44A 4AYGA 5IHUL 1OT1A 2PR4H 5C6TH 3NJFA 1UKQA 3K1KC 1GR7A 1DBBL 3NABL 2EIKB 2R29H 4MASA 2YBRA 4WFED 3SCMC 5DQ9B 2MJWA 1G7QA 3LN5B 1AC6A 4AQEB 2MTPA 4TTDC 1CYGA 2HFFB 3RIAK 1QSEA 3QUYA 1T1YA 3MRMA 3EJRA 4M8UA 3TBWA 3GBLA 5FFGA 4X98B 3Q1SH 3GS7A 2QBWA 4JVWA 4PJFB 1PLAA 4PMEA 5D96C 5GSVA 1MF2L 3FO2B 2VDNH 1PZDA 4CAGA 3BSZL 4DP7X 2OMBA 1QBLH 3GMNB 1VGEH 1KYAA 3RAJL 5FW7A 1YG9A 1AJ7L 4V11A 1U8PB 2K6YA 1KYFA 2ESVB 1FG2A 5D1ZC 1NFAA 3MRLA 3OLEA 3CFNA 5FECA 4NGHH 3VXUD 4F80A 3NZHL 5F9JB 1J8HB 1KTBA 4FABL 4DEWA 5CR8A 2ZCLH 1HEHC 3ZKMD 3TBVA 2PTVA 3SBRA 3DHMA 1F00I 3EW3B 1BZOA 3AROA 1KB5L 1XB3A 2Y23A 4MJIA 2TRHA 4F24A 1KLUB 2DJUA 2OAAA 2OMXB 4TV3A 2EIZA 4BSWA 1TKWA 2AK4A 2VE6A 1JVLA 1ERNA 5JIIA 3LS4H 2DQCL 3KXFD 3PGFL 2NY5L 4WEEA 7TAAA 1GJWA 3ZQ9A 3FSAA 2FJHB 5DEZA 4ZOEA 2X70B 4ODVH 3KPMA 3UTZB 1OWRM 5IESH 4RMRA 2XZQH 1NZRA 1OV8A 4XXWC 1E4KC 2WUCH 1NAML 4MMXB 1YNLL 3BN3B 2CGZA 1A66A 3DX7A 1N67A 3QJUB 1Z9LA 2ZPKL 2YMXL 3GMQA 2J25A 2NQ3A 3B43A 3AT0A 2QQQA 4UQ2A 3VXNB 5C2BL 5DMJB 3ZZQA 1I4FB 3OB8A 1WAAF 1FO0A 2DI8A 3KS0H 5E4AA 5E6RB 1I31A 4UIMA 3PS6A 3QK0A 4AYBA 4H88H 4LEXL 4TQIA 2HPOA 4GEIA 3X11A 5DJDB 1FYTE 3K4DA 4WO4D 4D9LH 2JJVA 5AFAA 2AJZB 4DKEH 1OF0A 3N1FC 2R29A 5MERA 3JVGC 3P30H 3HG1D 1Z5YD 1Z3GL 5FUCE 2PPDA 3LIUA 1HDMA 3G6JF 1ZGLM 3VFWA 4YZFE 1X9QA 4NZUL 3UBXA 4BKLA 4P99A 3WU1A 1TNNA 4XTRD 5IJDC 5IMMA 4FTVB 3IU4L 3H42H 1HFUA 1KTDA 2PCFA 2I27N 3VSQA 3VXSE 3ULVH 4JB9H 3KLQA 2I5YL 1A1OA 4O4YL 5CN2A 3P3UA 1D6VH 3HPJA 3GLAA 4AC2A 5AW3B 3HE7B 1AZZC 2IDUA 4JNXA 1DCEA 1UH2A 1J5OH 3OKYA 2ZIDA 2ZKYA 1MJUH 3G04B 3SY0B 4CSSA 2P5EA 1BPLB 3LZQA 4GRWE 3RNQA 5EU4B 3NAAH 2VGLM 2Q8AH 4ODUA 4XBMA 4RIRA 4QWWD 4B9CA 5IVNA 4C56D 2IO5A 5IW1A 2P52A 5FOBB 1DQDL 4UDTB 2VXVH 2HJLA 2A4ZA 4WI8A 4LAJH 3RFRA 1KIPA 3MCLL 2EECA 1SJEB 4E2OA 1S7TB 1K8DA 4FQ1L 3NMEA 4LQFL 1BOGA 5HGBB 1NCNA 2VAAB 3MXVH 1HIML 4QYOB 4ETYA 3AMKA 5C07E 5I26A 3NIDB 4TNGA 3LS5L 2Y7NA 3FT4A 3RBSA 5AVZB 1T4WA 2IGFL 3JZYA 4DEUA 2R0KL 3LXAA 4X9IA 4UZGA 2V17L 3D39E 1WH0A 3T3PF 4QRUA 1JGLL 2OW6A 2P45B 3LH9A 4PB0H 4WHYH 1N0XH 3MV7A 1I1FA 1K2DA 3ULUF 4AI7A 3FS9A 4JHWL 3UABA 3MUY1 3VXOA 4WDIB 2AQSA 2I9TA 4KTDL 2R2BA 1I1RA 2K7PA 1BFVH 3EYQC 2Y72A 2VLJA 2XTJC 1CDCA 1QFOA 3THML 4P2QA 2VRKA 4UTBL 5IFHH 5I1LB 4GRMB 4WWPA 4I0KA 3K81A 4LSSH 5DJ6B 3C6SB 4XMLH 5CWSB 3JV4A 2XZZA 2A9CA 4HJTA 4L48A 3HB3B 3REVB 2Z4TA 1UWGH 4WCYL 3ECQA 4LVNC 3MYJA 3OG4B 4BFBD 3V52L 3BLKA 1BMWA 4ZQKB 1YQVL 3COOA 2E47A 3IJ9A 3PWPD 2HA1A 1RUMH 1WGOA 3GJFK 3ZHNA 4X0NA 4N9OB 1IGFH 1E0OB 5JPMB 2ZKHL 4FOMA 1K4DB 5FYLD 4FQIL 4GAJH 4Z18A 3IAPA 1ODAA 5D7KD 1KELL 3FQWB 4L0ZA 4KHXL 2N7SA 1R3HB 2GJPA 1E3FA 5MHSE 4DAGH 1GPOH 3NH7H 2GJ6B 3WS6A 4PJEB 1T2QL 1P7KA 5L9DH 3B83A 2WC7A 3O0LA 5H2BA 1B4JL 4RSVA 3WENA 2VDLH 1XHHA 3KPOB 2WBKA 2P5WE 3S3PA 3BT2H 1A3QA 4GIAA 2QPSA 5HYSG 4FFWC 4YHMH 4AEFA 4YDIH 4KKLC 2ZUYA 3O6LH 3D2UA 3VI3F 2H26A 3BH9A 1WAAA 5JPNC 2P24B 2X4NA 3DMMD 3D4ZA 2NMSA 4R2GC 2OYKA 3ZTJG 1A9VA 2Q6WA 2R23B 4KJWC 5I6KA 3H9SA 1ID2A 4Y19E 2NY6B 1XEUA 4LPCA 2E7DA 1T1WA 2V0AA 4AL8L 4BIKA 1DBJH 2AEPH 1BW8A 4JG0L 1FHGA 4YAQA 2VMDA 4WKZA 4TS6A 1INQA 4Y5YC 5EU3B 5F0JB 4KITB 2E8YA 4EI6B 3D30A 2XJKA 2FWOA 3OG6B 3G6JA 1VFMA 4JPWH 5BZXA 1G1KA 2H5UA 1R4XA 3OTTA 3UJJL 3W9DB 2FBOJ 4UIKH 3QDME 2IALA 4GKSA 3RLSA 5DC9B 2F58H 32C2B 4PS3A 3DO4A 3BPCA 3SCMB 2F1EA 2X4SB 5CJQL 3TCLB 3VG9C 1MLCA 4WAFA 3WIIH 5E9DE 1M6OB 2OXHB 3L3KA 1HN1A 4CVZB 3M07A 2QGCA 2VUYA 3P1VA 4N2DA 3U9UB 3VYNA 5IR1A 4KRPC 4N5ED 1BMGA 1GGBL 2IMNA 2UV3A 1JPFB 3R1GH 5B38A 3IDJA 3DX8B 3S35H 1WD9A 4GSXA 5D96B 1HYSD 1MNUL 1CDJA 3TJEH 2Y5EA 3RL1B 4OJEH 4BQCA 1JHLL 1XF2A 3U7WL 2H2PC 1UENA 2EUZA 4BFKA 3IF1A 2DMHA 3CPUA 4U3SB 3TWCL 5D1ZB 3H3BC 4EDWL 5L88H 3BHBA 3D12B 2VLKA 4ZTPH 3Q3GB 4IDJH 4ZJ9A 5DJZB 2J3SA 4G8FA 4R5XA 4FFZL 1OCWL 2CRIA 1H19A 2A83B 5CIPH 4GI9A 2VSMB 4FG2A 3C75A 1T7VA 1CWVA 2ZNWA 4PY7A 4P5KA 3MRRA 4OSUH 3TJPA 3ZZSA 4AM0Q 4Y1AA 2AANA 2BZ7A 1AKJD 2R1XB 3QQ3A 1MRCL 1IBBA 4HCRL 4RCAA 4ZUUA 1AXTH 3QUZC 4RRPA 4URKA 2BHZA 5AUMA 1BFSA 3QORA 4LHQB 1GRWA 1HCVA 3TV3H 2VN5A 4JPKH 1ESOA 1MLBA 3FH7A 3KPNB 1XWVA 3FO0H 1S5HA 4IMKC 5KVFH 3S37H 4BV1A 3NPSC 5EPMA 1DVFD 3P11H 3L54A 4I3SH 2EP6A 5FM5M 2PTTB 2W5PA 5GGVL 3VWJA 1OP9A 3O2DL 3NQKA 1FSKC 1KC5H 2WBXA 2DYSB 4G6MH 4GXUM 2JWYA 3CFCH 3VFTA 2C7UA 3CWGA 4XP5H 5GGSB 4FP8H 1BYOA 2VZ1A 4QAMB 3OSKA 3BH4A 4IBVA 3V7MA 3VXRB 1VESA 2Z8RA 4WJKB 3T4YA 3WFBL 1QR1B 2D2CC 4C58B 3CH8A 5IMLA 4NRXA 1E5YA 3INOA 4MQSB 4DGVL 3VWKC 3KLDA 1FFNB 2EDEA 5F7BA 1QX1A 1SN2A 4UYQA 1JV5B 1OHQA 3FRPB 4QHMA 5L4IA 1Q9KB 3CMOH 1LE5B 1MCWW 2Z93A 1U3HB 3FKUS 3EYOB 1DVSA 3RB5A 4FI8A 4D8PA 4Z7NE 1AO7B 3F7YA 3B3IA 1J0IA 2OFQA 3SPHA 3V10A 4JZOB 3VG0L 4J3UA 4JRWA 4LRNL 1DLHA 1JTOA 1KTRL 2DF3A 4QRPB 3IDGA 4RBPK 1ZE3C 1SM3H 3ZKXC 2Y1ZA 1LO2H 4Z0XB 1THAA 4IGBA 1AR1C 4XNQB 4E0RA 2WQRA 4HXAL 4OIFA 4POZC 1YUKB 2WSPA 1LEGB 3L4CA 3RVVD 1Y1UA 4EKXA 4F7TA 4UNVA 3TS8A 1M2OA 2IPKA 2BFGA 5DK0A 3A4FA 1GW6A 3V5HB 3EBHA 3MRQA 4GW5A 3L45A 3JTSA 4XMTA 1ITBB 3FUEA 1D2OA 5SWSD 3SD2A 1U92A 1L3NA 2OMWA 3D50A 3MN8A 4GQ9L 2YPKA 3H6JA 4LE8A 5CIPA 4YR6B 4Z0BH 4OT1H 2BVOB 5I8EA 4Y7OC 3IDYC 3U83A 2R8SL 3ULAB 1MREL 5BUPA 4GH7B 1DANT 2J88H 1N6UA 2XDHA 3TP4A 1DCLA 3CSYB 3O0RL 4MVBC 4YZWA 3ECBA 5TH2B 4BK8A 4N8VB 5IQ7L 1X5HA 4NCC1 2CBQA 3PNRB 4X5WA 2R2EA 1JXDA 4KZEH 4H8WC 1FAIL 1MFBH 4JO3L 2RFXB 3QDJE 2YRPA 3LTVA 2A5UA 3MBWB 5JQ6H 1M7XA 43C9A 4PRNB 2QELA 3SE8H 3KZ8A 1PSKH 4ELMB 3MAWA 4HC1L 1GHFL 1L9QA 5F44A 1N26A 2M2DA 1YMMB 4EN2A 2I32A 4FCHA 1KGCD 5IOKA 4JAMB 5BO1H 1QQDA 4EDXA 1HH6A 1MDTA 5AAMC 4OD1L 1NMAH 4IK6A 4NN5B 4FYSA 1PNDA 2XTJB 4IU3A 4PJ5E 3QXWA 2Z7YA 4BELD 3NVQA 2PXYC 1F8TH 1U8IB 3FQTA 4JN2B 4JREC 1Y07A 1ZAGA 1I1CA 1OSZA 2HH0H 3FFOA 5TJWK 5F96H 5AW0B 4F8TA 4LVNB 5T3XE 4PWJA 1GOHA 1OAXH 2VDOH 4WTQA 1ULVA 4MLIA 3W9EA 3HRZB 5DHEA 3T3ME 5FWQA 4M8RA 1JI2A 2G5RA 2CZNA 4FJYA 1YNTF 4U1LA 4YSPA 5D7JA 5DJYA 3KHOA 3UTTB 3CPLA 4X8JA 1X3DA 3HZYB 3C6LA 1CJYA 2XG5B 1B0IA 4N0FB 5INCA 4GT7A 5DF0A 5JQIB 3KR3H 2WQXA 1B2YA 4AZUA 5A3ID 1DUZB 4Q6YA 1URIA 4OLXH 4WEBH 1KNOA 4C8XA 2VYRE 1FGVL 2FGWH 5LBSH 3VFUB 4IBTA 2ZXWB 2K6WA 3VYOA 1N2RA 2QSTA 3PHOA 3SDXF 4MJHA 4POUB 4LSUL 5D7LB 2E7MA 4E41A 5EIIG 1NCBH 4JO4H 1IT9L 4NP4L 2CDGB 3K6SB 5JLZA 4M5ZL 1KDJA 3ARGC 1KN2H 1UT2A 1F5WA 1QFUH 3AQYA 2F54E 2XN1A 2YQ2A 1I1AB 3BXNB 1UJTA 2DTMH 3TT3L 1VSCA 3BMVA 4PJ7B 3HBPA 4F8NA 2BLFA 1C1EH 5JPNB 4R2GB 2DYPD 3PL6A 3Q0HA 4YXHL 1UUSA 1HI6B 4OZ4A 3FCBA 2FTAA 2Z31D 3UBFA 5TF1H 1XGTA 2G9HA 2R0LH 3CMGA 5T5NG 4OM1L 5DFTA 1BIHA 3HG0A 1D9KA 5F7EH 3S0PA 1ZGLB 1IM3D 3HKZA 1WA0X 3MJ9L 4DP8X 4LAQH 5HDWA 3H9ZA 3SGJC 2OLDA 1JZDC 5AZUA 4OZHB 2JVUA 2MCPH 3OPZH 4L3AA 3AABA 4CMHC 4RA3A 5E8OB 4OQTL 3L6FA 4I18C 1I9IH 4MA7H 4DOHB 3X13A 1IE5A 3MXWL 3A6CL 3A3YB 4HIXH 4EXKA 2YO3A 1ANUA 1P4LA 2X28A 4LSQL 4UQ9A 4MZRA 3IVKB 1KBVA 1IARB 1RJCA 4KRPB 3S5YA 3SGKC 1CL7L 1RZIA 2JI3A 4F91B 1MVYA 1NCGA 5HHQB 2EE9A 3KLHC 3ZMNA 3TTSA 3B56A 3GJFB 1JBJA 1W8NA 3WO4C 3CFMA 3S5LG 3U25A 4BK4A 2J1ZA 2ZUQC 1DVYA 3ABZA 4AJVA 1ETB1 5AOIA 1CPUA 2WP3O 1IAIH 3Q9QA 2VDQB 4QHUB 5ITBL 5LQBL 5GRVK 3CH1A 3KWWB 2ARJB 3QFJB 2E75C 2DQEH 4MZ3A 3WKYA 2VMFA 2VRQA 5BS0B 3O2WH 2OTUB 3MLVH 5IKCA 3HBZA 4DQOH 1IGML 4MAYD 3HS0C 2XWTA 3GHBL 4JFED 1U8OB 2EIJB 1YEFL 4NQCB 2DLFL 5LBSA 5C0AB 3VU2A 4FYRA 4NXSA 1SJVA 5HTSA 2DMBA 5E6IA 1SY6L 2DZEA 1I7UA 3B2VL 5DHMC 2OTWB 2MOQA 4P4RA 1MCBA 2UXTA 3NUKA 3NPSB 1VEPA 1JZ7A 3U0TA 1IKOP 1CD9B 3VI4F 3RYMA 2FUTA 4H2AA 2ODIA 3P0VL 5CU9A 1FSKB 1IAMA 1MEXL 4HU8A 5JHBA 5I1AB 4X8XA 3ZRSA 3FXIC 2ZCZA 3NA9H 1TEFA 2JKTM 1KBGL 5HVGB 3EO1A 4G42A 3L4YA 3EFFA 4ECNA 3ILEA 1JZGA 1G7MB 1LEKB 3DVGA 3MX0A 5BRZD 4XP9H 3T0VA 4AV0A 4JMXA 4MHHI 2DQTH 5I5MA 1BQHA 4PBVC 3RGVB 1QLRA 1UA6L 1DJHA 3S6CA 1P5UA 2DKUA 2A6JA 3SQOL 1KJVB 3CZLA 1E9QA 1MPAL 3RKDD 1OALA 3B9EA 1M71B 1YNTA 3ZE2E 2XQBH 3HHSB 1DEEB 5DC2A 4ACPA 2HT2D 1GAFH 3ASNB 1IBFA 3OKMB 4XO8A 3S36H 2YAQA 4PJBB 4OF0A 5EORL 3IMVA 4JDVB 1JHKL 4O2FB 1IGTB 4MXQC 3VVWA 5FO2A 2XWRA 1JXKA 1HH9A 3ZKXB 4FMKA 2BO0A 3SDXA 4O51A 2Y06H 1AR1B 5C0DB 1LO5A 2IWKA 4ONOA 3BWAB 2AXWA 5F7MC 1I8MB 2N56A 3LHAA 1JK9B 2WHVA 4RFOL 4NO0A 5BPPA 5C3TA 1JPTL 1BGXH 3I9GH 3CE1A 4RISH 5CKGA 2YJQA 1N4XH 3RA7H 3P0YL 3VA2C 1C9SA 4OGXL 5DURD 4XC1H 3RUGB 2VJXA 4JY5L 1QWNA 2OM5A 5F3BB 3FT3A 4JQVA 2LVEA 5DMIH 2JJSC 3LDBC 1TQBC 1WPCA 2A77H 5T1DH 3PP4L 2B7DT 1M1XB 3F7VA 3OJVC 43CAA 3IDYB 4OKVB 3W2DL 1S78C 1VHPA 5E03A 4MJ5B 3T0EE 3T6ZA 5MENE 1QKZL 2COVD 2BM3A 5K93A 1AR2A 5FR3A 3GSQB 4GLRI 4PRPD 3QFDA 3KGSA 2C34A 1VDGA 3HFML 3VXMA 2BNQB 1BXAA 1JOIA 3GI8H 5B8CC 4XP4H 5CSZB 2BFVL 2YA1A 4NN6C 1ILSA 2BJMH 1JPSL 3VVVA 3FU9A 1NFKA 3LV3B 2JKLA 5EBWB 3BAXA 5FM5O 1XF5B 1U9KA 3GRBA 3NSDA 4GPVA 5LNEA 3N1GC 3ZKSD 4X6CE 1V7NH 5K9KB 3WS3B 1LDPH 3GIVB 1K6QH 3QQ9D 4IYKA 2KZ1B 2KMWA 3SPJA 5AB0A 3QQNA 3KLAB 5DJ2A 1X4ZA 7FABL 4ZUTA 1COBA 2YRLA 1PS3A 5CN1A 5C08A 3TNNA 4F27A 3QIWB 3UC0H 1Y7VA 2LABA 2XYCA 2EO7A 3DYOA 4QRQA 4LOUD 3SYOA 4TVPH 3UTSA 4EOWL 5DEFA 4RFNC 2W65B 1VB9A 4QRRD 2PXYB 3MV9A 4TUUA 1CR9L 2KHAA 2ICCA 4PTUA 5HDQH 4JREB 1D6EA 4U05A 1N5YH 1LEIB 4MD0A 2XBDA 3DYMA 3SYAA 2AJXH 2FJGA 1XGRA 3KVDD 4AJ0A 2HUEA 5I6MA 4NFCA 5CGBA 5IHBA 2CLZB 5CEZH 4A7QA 1BIIA 3BUIA 1NGQL 2JKSA 3S3CB 1G6RL 1YMHA 1Z5LA 2G3NA 1S9WA 1YEGL 4R8WH 5KW9H 1T3FB 2X6BA 2BC4B 1CTMA 3BYYA 5IB3B 1ORSB 4U6XA 3UCQA 4WENB 4L8BA 4AQ1C 4DVRH 3S4SG 4DPBX 5JR1L 1T66D 4HGMA 4KGJA 3SB3A 1WV7T 3LKNA 1MCEA 5JDJA 2XQYK 2UZXA 4FFYL 4G43B 5D55A 2B4CC 3VI4A 1N64L 3BRGC 5KVEE 4HWUA 2IANB 3SQRA 5I0DA 4AVIA 4MXWL 5A2IH 3T1FB 4M4RB 3N42B 3GMLB 5I0XA 5KYWB 5DQ9A 2DD8H 4AQEA 4FI6A 3TEWA 3AY4A 4FG6C 3ESPA 2HFFA 1U6AH 4W9FC 5I8KL 1FLTX 3LEVL 4I1NB 1J86A 3BKYH 4XOBA 4PW3A 1EWHA 1EO5A 4X98A 3LQMA 3DIFB 2WM0A 3E2HC 3PP3H 1HZKA 2OZ4H 3FO2A 3OZLA 5I19L 2XJLA 1XGYH 4U1IA 4HCIA 4HFUH 4NZ8A 3GMNA 5EG6C 3KWXA 2J5LC 4NJ9H 2MWCA 3FZUC 1U8PA 4NERA 2ESVA 2X2IA 4PS8A 1MDAA 5F9JA 4CMHB 1J8HA 3A5VA 4OTXH 3BWUC 2PW1B 1JMZA 4I18B 5GRJH 3GTTA 4HBQA 2JTDA 4FEMA 4KK5C 2HKAA 3OM3B 4JM4L 3B3BA 2CQVA 1QYGH 4Q6KA 3V0JA 1EO8L 2WVTA 3WDHA 4HQQL 3WNKA 4ENZA 3QEQB 5DT1L 1HXYB 4A55A 1KLUA 2XXGA 1D7FA 2Q7YA 2DM4A 2WQVA 2CUHA 1MW3A 2OMXA 4GKZB 1S9VB 3KG5A 3K3QA 1KCLA 3MCG1 4JJ5B 4AENB 2PP9A 4FTDA 5IBLC 3WO4B 1AE6H 3CHOA 2WQSA 3WNMA 2W95A 3MLUL 2ZUQB 3IFOB 1MQKL 1GC1C 2X70A 3ETBJ 1E8ZA 1DBAH 3UG3A 3UTZA 4WUKL 5B1BB 1AXSA 3O8XB 2DWXA 3EDJA 4KFMA 1SJHB 3ZHLA 3ZY7A 1T03L 2UYLB 3ESVF 1OD9A 4MMXA 3U36B 3W39B 4UM9D 2E27L 3FN0L 1KEML 3EH2A 1KLGB 3WY4A 5ANME 4Q4EA 5GGRY 2UXGA 5TF0A 3HS0B 5BV7H 2EEBA 3TVMD 2YGOA 2X6CA 4PMFA 1AOHA 4BBWA 1I4FA 4XN1A 4N9GB 5ADOH 3HPLB 1IC0A 3P73B 2FQEA 3DETD 2LVCA 3A6BH 4U6VL 4ZXBC 3ZDXE 3OZKA 3VTMA 5DJDA 3EG9B 3NCBB 2AJZA 1OGAD 3EF7A 1MY7A 5DYOA 3QE5A 5IUCA 4G7YL 4HMCA 3LJ3A 4XWOD 4Y1TA 5KS9E 5L2JB 4OCWH 3BDYH 3VCLB 3SKJL 4FTVA 2PCYA 1MJ7H 2FNBA 3LKPB 2KPNA 2OZ4A 4RGOL 3ARYA 2Z91B 4QRTB 3QUKB 5EOQH 3GXPA 1OTSD 3HCVA 2HT3C 4E9WA 4KOCA 1UHVA 1KPVB 3HE7A 1FYHB 1VZGA 2EE2A 1O5PA 3G04A 3SY0A 4PSRA 1J10A 5LAXB 4PWFA 3LQAC 3ECWA 5EU4A 5FGBA 1CDGA 3NESA 5K9OB 1P1ZB 2YD8A 1MAMH 2VLRB 1MUJB 1MI5B 5FOBA 2NT0A 4UDTA 3D5OF 5J5EA 1UACH 4W9HC 1SJEA 1S7TA 5EU6D 1Y0LB 3SDAD 1F56A 2RALA 1S7VA 5FYJL 3RZWA 5LG6A 4P2YA 1RIHH 4B50A 5HGBA 2VAAA 3D18B 5A6IA 3D9AH 5BW7A 2UWEB 4QYOA 1I8KB 3K72A 2WAQA 5C0CB 3UC2A 2OCJA 3LPPA 3DSFL 3H55A 1PKQB 3WJJC 4YSRA 5C0FB 3BPNB 3LDBB 1PZ5B 4ADJA 1GY2A 1J1OH 2F8VA 2QTVA 4K2UH 3QP3A 4IBWA 1KUMA 2MH4A 1F3JB 1XSKA 1N7MH 4WDIA 2ZUSA 4R97C 5ITFB 3WV0A 1TZOA 5KSUB 1YPZE 4N5UA 5B8CB 1N8ZB 5I1LA 4GRMA 1PZSA 5DJ6A 3C6SA 4ISVB 4NN6B 4K15A 2Z8WC 5CWSA 4ZO8A 4M00A 4RA0C 3ZL1A 3REVA 1U2HA 3L3IB 1U91B 3D52A 2DEYX 4GMTL 4PCSA 4ZQKA 4JFHD 4NQDD 4PJIF 4TLTA 5KAQF 3U2IA 1ZLUK 1R19A 1S7RB 5JPMA 4XCEB 3ZRFC 2HJFB 1K4DA 2ITEA 1PMYA 3EO9H 3FOLB 5HDBF 1KENH 4TL5A 3FQWA 1KCVL 4Y9GA 2ITFA 4FX5A 5CSGA 5JIDA 5EBGA 1OCCB 2C3XA 2XRAL 3OMNB 1R3HA 2CPUA 3LRGA 4RFNB 3IXAB 5I30L 1IGCL 2Y7MA 2GJ6A 1OANA 4PJEA 2AERT 3RVXC 3BAWA 3V6OA 2PYEE 5KYYA 3BE1H 1U0QA 1BEXA 1OAUH 1NCHA 5C0EB 4HGKC 5D1QE 2CIIB 1NKGA 3HUJB 2RR3A 1B0RB 5AW9B 1AI1H 1DJYA 2P24A 3I9AA 3AS3A 4IIQC 1KCUL 3BEWB 2R23A 3EOBA 1SVZA 5AVQB 4AQ1B 2YS4A 2VKXA 5KVDL 5F9OH 2NR6C 4B9JA 5JHDE 2R29L 5ECGA 4GI8A 3KPRE 4L4VB 1ADQH 3ZOAA 5EU3A 3HEIB 2ENSA 4H0IA 2WNGA 5DD6B 1LE9B 1XIWD 4EI6A 3CVCA 2AXGA 3W9DA 4PIBA 32C2A 4F57L 1HHJB 1E5UI 4H4NA 1AHMA 1JRHI 3SCMA 2X4SA 3DV4B 3TCLA 4AJWA 3TASA 1T7WA 1M6OA 2OXHA 3AVEA 1QBLL 2IWGA 3NEOA 5F89B 4LDLB 2QADD 4CVZA 3U9UA 4UAOC 4ELMF 4K9EC 4WEUD 2XIBA 2QGDA 5E1IA 3GINA 3WFCL 4NXKA 3E2HB 3DX8A 1XD0A 2P28B 3RL1A 3WNJA 2X9XA 2X4TB 1E6OH 2C9UA 3FTXA 4PTTB 1IM9B 3NZUA 4AE0A 2J5LB 2IEPA 2HP4A 2YAFA 5I74C 3GBDA 1AGDB 4P2RE 4U3SA 3W0WD 5D1ZA 4ODBD 5CJBA 3Q3GA 3ZVVA 3DTDA 5DJZA 3RX7A 4ADIA 3GC3A 2HRHA 2PN5A 4XPHL 1BF8A 4RGNB 1ECZA 2A83A 5D8JH 5J12C 4HG4K 4XZ4A 1YA5A 4FQHB 2ZD0A 2X0UA 1RUPH 3AB0C 3U4AA 1ZRUA 4MNHB 2R1XA 2VDPB 5IVXF 4NPYB 1QSFE 3DGDA 3KL0A 4PEEA 2E6JA 3C2SA 4AMXA 1SFHA 1J18A 3GPSA 4ERSL 2XZQL 4EQ2A 3EZJB 1TTAA 5AVSB 3FBKA 5LGYA 3C60D 3ARVA 3ME0B 4WHCA 4J12A 2QGBA 5C3IA 5I1GH 3KPNA 3BGMB 3FQ4A 1FDLL 1SYSB 2YN5A 3KNBB 1GIGL 3GBML 4G70B 1N3NB 1QNZL 1SUJA 2VIRA 5E8PA 3MRNB 2PTTA 4TNEA 1EXHA 4MBOA 4XXWA 2V9UA 1E4KA 2WBJD 4G9FD 2EVIA 5ESVB 3HI6L 3QR1A 3ARRA 3QPQC 3B8YA 4NUGL 1EAQA 5FDWB 5AYTA 5FHBH 1AQKH 5T33H 1HXKA 4A7UA 4NLAA 4NNXB 2CJ3A 5DWUH 5FW6A 4XNDA 1DQKA 3ROOB 4H26B 1VKXB 4S1QL 2FBRA 5D72H 3VXRA 3P30L 4GAFB 1ADQA 1UM6H 4ZZFA 3CZUB 4L1DA 4OZGB 3SPGA 1NUFA 4ZXBB 1FFNA 3NGBC 5T1MB 4XVJH 1JV5A 3FRPA 1TLMA 3PE9A 1WWCA 4ABVA 3JVGA 4JE4B 1J8KA 1LE5A 1U3HA 4N2IA 1AO7A 4DKFH 4Q9QL 2CDEB 3FAWA 1D6VL 3GSVB 1NDGB 3NJLA 4JZOA 3ZMEA 3B2UC 4RX4A 2W9DH 4OZHF 1G7PB 4I77H 4QRPA 2J72A 4X4KA 1MJUL 2OMYB 3M8OH 5AG9A 4Z0XA 4HZLB 4XNQA 2JCCF 1VERA 1Q9WB 5EDSA 3S34H 1VLXA 3IJSB 4P49A 3CIQA 1LEGA 1GGCH 2JV6A 3V5HA 4LCWE 3CN0A 3L16A 4PLJC 1LXMA 1JGUL 2VXVL 3EIFA 5KVMC 1CXHA 4LEBA 2D4DA 4V1DD 2OX5B 1J12A 4WGWB 4YR6A 5DVPA 2H2SC 2BVOA 5HHMD 4UILH 5E5LA 1E4WH 1ZT1B 3MXVL 4X4ME 2FECL 3CSYA 3NJIA 3POCA 3QR0A 3GTVA 2CG9X 1J9SA 5TH2A 4EO5A 4N8VA 3W5MA 3KXFB 4HSQA 3QULB 2XT1B 3RBGA 4AYDC 2RFXA 2EDJA 3MBWA 4WF7A 4OCYL 3F65A 4JRXA 3VRIB 5A6MA 3GGWB 2HKFL 5GJSH 4PRNA 4K5OA 3K0WA 4I9WE 4G5ZH 4X7CC 4ELMA 4NQXB 4U6HB 4Y5VC 3PAVA 3MDJA 2OMUB 2DMKA 1YMMA 5D7SL 2RQEA 3PV6B 4MFHA 3FCGA 4JAMA 3BFQG 2C9QA 3F7RA 3D85B 4L9LC 5FO7B 5JIQA 5I73C 4LIQE 2YPVL 1IC1A 4R97B 1I1YB 2NRDA 1BOYA 4HBCL 4UV7L 2J71A 3RRQA 4OCMC 2R0WL 4MD4B 4NCC2 1F6FB 2ADGB 1YY8B 1YDPB 3OGCB 1LHZA 1U8IA 1ASQA 4R6UA 3TPUB 1FVDB 4JN2A 4ZNCD 1WT5C 2E8ZA 2PKDA 2QVTA 3GJFH 4FULA 4HSAC 4OD2B 5JW4N 3TO4C 4K8RL 4NNYB 3SD5A 2HG0A 3HVNA 3HRZA 2K7QA 3OR6B 2VDQH 3UTTA 2PF6A 5HYQB 4HSCX 3D3VD 3HZYA 2XG5A 1F3RB 3U46B 1S3RA 3QHZH 4ACTA 4N0FA 4PJBF 2HTLD 3MV01 5FYJD 5GZNC 4M43L 5KANI 5L9DL 4UYPA 2JLLA 3EFOB 1Q72H 4N0YH 5ENWA 5TFSL 1DUZA 2OP4L 4HUMB 2AFNA 4ZNEA 4LOFA 1KGCE 4AUUA 3VFUA 3GSXB 2EEFA 2DQIL 4KJPC 5EO1A 1I7TB 4WY7L 5DR5L 5BMFH 2D3NA 3KLKA 3NJJA 4XX1E 4R7XA 3K6SA 1HHGB 1H3PL 1ZHBB 3L4WA 5FUOL 2EDYA 1UD5A 2KUTA 4MXVE 1TLKA 5ACZB 2YOAA 1DFBH 1AD9A 1I1AA 3BXNA 2OBGA 3Q9PA 4LLYB 2GAZB 4HPHA 4I9XA 2XV0A 4PJ7A 3RUGF 5JPNA 5IHZB 3V0DA 2Y6TE 1PEZA 4IIQB 1HI6A 5JOPD 1MHEB 2FRGP 4KK8C 5HYJB 4KQ4L 1CE1H 1Z9SB 5JYMA 3UO1L 1NM9A 1EANA 4Z7UE 4F7MB 4HD5A 2VXUL 4XNBA 4ALAC 3FK3A 1ZGLA 2GY5A 2DWEB 4YDZA 3QJQB 5I5RA 1AG6A 4XVUC 1E4JA 3T1WA 4ODHH 1XSJA 3MNDA 3D4GA 3D05A 4XRCB 2DLHA 1TTRA 2AQTA 2KQNA 4OZHA 2GBTA 5F7UA 4LSDA 1NIEA 2BSED 3MNVB 5E24E 1Z7JA 4MJID 5E8OA 1SOXA 1D7BA 3KM2A 4S1DD 3CXHJ 2AK4D 1FBIL 3ZSSA 1UOKA 3QH3B 1FIGL 3O2VH 4UAOB 2J4WH 3OAUH 5BO0D 2BSCA 1FAKT 2XX1A 1N59B 1Q9LB 1ZE3H 2DQJL 4KNQA 5D2NE 3V0VB 3BT0A 1EEZB 4BCXA 3QJXA 4DUVA 2X1PA 5CINH 3X1FA 3PRZA 3GJFA 4Q56A 5I74B 4BWUA 5AW2B 4ZMNA 2BOLA 3B1TA 1I7RB 3PWPB 4J2XA 2BP5M 3IGAB 4QHUA 4NQSB 3VYPA 3KWWA 2ARJA 2GTZB 3QFJA 3HBGA 3MZTA 4N86A 5J12B 5BS0A 1Z1WA 1NOLA 3AB0B 4JPQA 3FO0L 3RDTC 3VFMB 1U8OA 4HCFA 5KVFL 4NQCA 1A7PH 1CO1A 4XT1C 5DA0B 5C0AA 2YARA 3DPDA 5AOJA 1THCA 2JIXD 3D34A 4GKLA 1M4KA 4G6ML 3VNZA 3A67L 4X5QA 4MKTA 1Q38A 5I5IA 4H8WH 2A38A 2PWDA 2OTWA 1OIOA 4ZSOB 4BM7A 1CQKA 5CMAB 4XP5L 4CGUB 4AEIL 1L0YA 4NQUA 1HNYA 2F53E 2K6ZA 3KWUA 1K3IA 4JRYE 2ZCKL 3OLGA 1PX3A 5AW7B 3GBNL 3H8NA 5I1AA 1UFUA 4Z3EA 4UB0L 3RP1A 1R0AL 4DVBA 4IOIA 3N42F 4UOJA 3LSOB 3PHAA 2VW4A 1LEKA 1G7MA 4Z7VE 1GGYA 5E2VH 15C8H 2WXHA 1MFUA 1CIDA 5E1QA 2ZONA 2JJWA 5FUCC 3BGAA 3RGVA 2OL3B 3SSGA 5L8JB 1TEYA 2J43A 3M17B 1RSYA 1KJVA 4G7QB 4X7TA 5JORB 1P4UA 3NGBB 5LN4A 5E7FA 2VSCA 1M71A 3ARUA 3HHSA 1TQVA 3EUDA 1DEEA 4OCXL 1Q1JH 5CUSH 4EZLA 3CN1A 5CJ5A 2IADB 3M1OA 4N0RA 5HY9B 1SM3L 2AV1B 2GC7C 4FKKA 3OKMA 5H37H 2NX5B 3RVTC 4RBPH 3U6XS 4PJBA 1O9ZA 3CHRA 4EBQH 4G8GE 3C5XA 1OXYA 3QIUC 5TGBB 2KC0A 4JDVA 3GXFA 4O2FA 1IGTA 5IG7B 3DJTA 3INUL 4PWEA 3W1ZA 4F9PC 3AMLA 2A0LD 5I66B 1H6FA 4N8CL 5DWPA 1VF5C 1R17A 5C0DA 2ZYHA 3BWAA 3V4VB 1I8MA 3IGFA 1JK9A 1RZJL 4OF6A 4XHQA 4YBLB 5FO8A 3P4LA 1PDKA 2WZAA 4XMUA 1EEQA 2EDRA 3DJZA 3MV7D 3FU6A 3ZLQC 1GTNA 1UC6A 5DS2A 2R56L 3RUGA 1R3LB 3LN4A 2ZE0A 1JVKA 5H94B 3QRFM 5F3BA 4N85A 2CIKB 2R39A 1F4YL 2GJZB 2WXMA 2QSCL 2IPTL 4JL2A 5TQ2L 1M1XA 1WFJA 4P2QD 1Q0XH 3BSGA 4KKBD 3B5TA 3U9PL 4UQBA 4MJ5A 1JNNL 1CDBA 2NY1C 2XC8A 2GFBB 3BKML 2XIIA 1WZ1H 1MW0A 1KOAA 2VXQH 3SE8L 5I6NA 3GSQA 4ZO7A 1PSKL 1A7OH 1J05B 5BVPH 5GS2H 2BNQA 3KBHE 4JG9A 5CSZA 3BIAX 3RY6A 4KI5E 3RFZC 1IZKA 2NZ9C 3LV3A 4K3EH 5EBWA 4D3CL 3ULVD 1XF5A 1M56B 4Y2LA 3ZK0A 5T1LB 2EDQA 2XX0A 4BRVA 5K9KA 2Y7LA 3CCHB 3WS3A 3GIVA 4G6AD 4Y5VB 3IMRA 1DBML 3T04D 5K9QG 3KLAA 4C4UA 2GBUA 2GTWB 4L9LB 4YMPA 4P3CH 4XCFL 5I73B 3QIWA 3LKRA 3UZEC 1RZ8B 5AAMA 1CFQB 2YGQA 4LP4A 2ZZUT 1OW0A 2XACC 2CU9A 4PV8B 2W65A 2ADYA 2PXYA 1O6SB 5ESAB 3GKWL 3N40F 2H1PL 1MXGA 5SWZE 1XQ4A 4CJ1A 1BBDL 2YJLA 3H3PL 5D7IE 5H37A 4KTGA 2A4EA 1F90L 1LEIA 3TO4B 3QZWG 2ZXQA 4Z3HA 3H9SD 4ZRGA 2CLZA 2XWDA 2FO1A 1KB5B 3LZFH 4P07A 3BH8A 4NKOB 4Y5XC 5LBSL 5KSAC 2Z3FA 1T3FA 2BC4A 4LK4A 1D3CA 5IB3A 1FFPB 1ORSA 2XFXB 3ZSTA 5A40E 3NEXA 1SJXA 1U8QB 4MD5B 3QZBA 2BNRD 1EAPB 5DK3A 5EZIH 1VEMA 1MSPA 4PRIB 3KCWA 1OP5K 3EYFB 1OM3H 4G59C 4H40A 4G43A 4JX0A 2ZX9A 1DQIA 1KGUA 4X5LA 5KYNA 4NM4H 3ZTEA 3CJJA 3ETSA 2GSMB 4JR9L 2DOCA 4Y2NA 1WJ3A 2ZP0T 1PYWB 2IANA 1G9NL 5L6YH 2F7RA 3AAZB 1AZVA 5DD3H 5CM1A 3T1FA 4M4RA 3CN4A 4PW9A 2UWEF 3GMLA 4DZBB 5ILTL 5KYWA 2DL9A 4JFDE 4PG9B 2HJKB 4JUSA 5F93C 1BM7A 5HI4C 1R5IB 2E6PA 3HZ3A 4KH2A 4LAQL 2BPBA 1T0NB 2VXQA 3RB7A 1HHHB 1ZMYA 3CVIH 3PHQB 1PZUB 1D5IH 4LKCB 4NAJA 3BKCH 1KIQB 4OV5B 1BVNP 3A4AA 1MHHB 5JHLH 5M7QA 4EE2A 2UY7B 3EOTH 5AVVB 5KOVC 3TH2T 1GOFA 5EC1B 5EOTB 5TE6L 5EUKB 2L04A 4K8RD 5J6GB 1L7IL 4Y1AD 3SGJA 1KXTB 4KJQD 5BRQA 2IVFC 4WV1C 4I7ZC 4L3FA 3RTQC 3TM6A 2AK1H 2PW1A 2A3TA 4I18A 5GGUB 3VD9A 2EUVA 3PGCB 3QORD 2WZ5A 5CJOH 2Z1KA 4DJMA 3QEQA 1UG9A 4OR1A 2DMCA 1KIUB 1OAKH 1HXYA 2VH5H 3NFNB 3W3BA 5AZEH 4GKZA 1S9VA 1KCRL 3IU3B 3QI9C 3VWJD 4YSSA 4JJ5A 4AENA 1SFDA 2DQEL 4YGAB 5DUPL 1MKFA 4ZFGH 3KJ6L 3EGSB 3IFOA 4GRLC 3LIZH 1F02I 1QO3B 2PW2B 3QG6B 3TEZA 3O8XA 1T22A 1SJHA 2UYLA 4PP1D 4DW2L 3UL4A 2A4CA 2FCBA 3U36A 1QOKA 3W39A 4ZUSB 4HIPA 4N2CA 4CVUA 5ID0B 1KLGA 1AHKA 3KDPB 3HS0A 3E1ZA 1S9YB 1C5BL 4GW4B 1NDTA 4P2OC 3HUJF 5IW3A 1JERA 1RJYB 3WTWA 4N9GA 4DESA 4M03A 5I23A 3J2PA 2WQUA 1N10A 3POHA 2A1WL 3IDXL 3TV8A 3ZKND 2DAVA 3EG9A 3HIZA 2L3BA 3GK8L 4YDJB 1KZYA 1KGXA 1X5KA 2XI9A 3U6RB 3G5ZB 4HWBH 5CHNB 3Q5TA 4K73A 5L2JA 5HHVH 4G6FD 3PUUA 4UNIA 2Z31B 3VCLA 4GS7C 1UGKA 2QVIA 5KJRH 1G4MA 1KB9J 5TE4H 1JVOA 3ZE1E 3E1F1 3LKPA 2FHCA 4M7JH 2Z91A 4QRTA 5LDUA 2BIMA 3QUKA 2H0PA 2VW6A 3S36L 2IG2L 5JHLA 2Y22A 1WK0A 5EH1A 5CP3H 4FMFA 1KPVA 4K23L 4XPAL 5IROC 1CI3M 1L5GB 3QIBC 4WZ9A 4YDKL 2DQUH 5LAXA 4UTAH 4GSRA 2NY2C 3DHJA 3MLWH 4F33B 5K59F 1HC1A 2DWTA 2XNAB 3VXSB 1P1ZA 4L3EE 5K9OA 3RVWC 2VLRA 4HEPG 3BLBA 5FHAL 1MUJA 3U1SH 5C0BE 3D08A 1MI5A 4NWUH 5GZOC 2ED8A 4JW3A 1JGVL 4I85A 1ZEAL 4G82A 3NP4A 4UF7C 3PDDA 1N4XL 4ZS7L 1WE5A 1OSPH 1Y0LA 1FWXA 4GRWB 4M61A 5F6HI 3FW6A 3OHMB 2GK2A 4KTEL 3D18A 2WD0A 2UWEA 3L13A 1F2XK 1I8KA 4I1PA 5J1TC 4PIRF 2YD0A 2B4CH 1RZFL 1W8OA 3JV0A 4KBPA 1OT4A 4B7IA 4Z1PA 5C0CA 3N1PC 3LIZA 1S2EA 2ARWA 1BEYL 1M9WA 2VN6A 1PKQA 3O41B 4PS4H 1GGIL 1X5AA 5C0FA 2JJSA 3U6XA 2CO3A 1PZ5A 3T71A 3NCMA 1BQUA 3AUVA 4GP8B 5AAWC 5L4JA 5FO9B 5F3HB 2G30A 4GNKB 4MQXC 1YYLH 4X7DC 4XC3L 4PYHA 1FUNA 1F3JA 4K3JH 2NY1B 3H9YA 5F1NB 3AWGA 2I07A 3QYCA 4M7ZB 5GRUH 3QGVA 3ZR5A 2AV7B 1OHZA 5KSUA 1HYRC 5EUOE 5B8CA 1N8ZA 1A1NB 3BISA 3D39B 4A67A 4D8OA 5D7JD 4HJJH 2G9KA 3PAUA 4ISVA 3RFZB 1NAKH 3NIFF 4XMXA 1NGWB 2XWEA 3V5DB 4HWBA 1U91A 2EABA 3I50H 3UC0L 3OB0H 1QFWL 1ZS2A 4OZGF 4OZFB 5B39B 3SZ6A 4KH9A 4LRIA 1RUAH 4NKIH 4OLYL 3HN5A 1S7RA 4TVPL 1OAYL 4U7KA 3ZGIA 4XCEA 2O6PA 4KKPA 1TJHL 2HJFA 3L9RB 3QPKA 5HDQL 3FOLA 3PJNA 4ZAKC 1IIKA 1SUHA 3QT2A 1KCSL 5GS0C 2WLZA 1MFNA 2J8HA 1YN6B 2VDPH 4HMEA 2AZUA 2XG4A 1NCWH 5CP3A 3IXAA 3FHAA 1I9RH 4L29B 4L1HA 3RX5A 1BSIA 4G8AC 5BZWB 1CK0L 4LSPH 4UTAA 3QZPA 4L1LA 2F8XC 4R8WL 5FK9B 3C87A 1DJWA 3JYBA 3NN8B 3QDAA 2VQ4A 1GC1H 5JYLA 1TZIB 3B9KC 5GRXG 3LAFA 2DQGL 1IC4H 4P9ML 5C0EA 3QYMA 2CIIA 1SXZA 3HUJA 4Y5XB 4RVBA 3HI5L 1B0RA 1L9MA 5KSAB 4LLDB 2O1AA 1R24B 5E9AA 4ANKA 1J0JA 1AQDA 1JPEA 2EH7L 4DK3A 3QQXA 2ZX5A 3PUCA 4LSRH 4L4VA 5CCKH 2GJJA 3CVHB 5HI3D 5DD6A 1LE9A 1AZNA 3UADA 2CUIA 1X5XA 4QHKI 1J1XH 5T8IA 4IMLB 1QBML 5F3FA 4NI6A 1HHJA 4O9HH 3FFCD 1I85C 3CSFA 4Y19B 1EAOA 3DV4A 1WBYB 1JIBA 3ILPB 3F2LA 2FT6A 1C5DB 1XGYL 2HVKB 4JFVA 2FO8A 4IW4C 5F89A 2UXVA 1H3WM 3KYMB 2CDFB 2ZF8A 1CFVH 2EIBA 3NJXA 4HLEA 3QDMB 5IZ7A 1M2VB 5CCGE 3N43F 1F18A 1YY9C 2X4TA 4PTTA 4XN8A 1IM9A 2OYMA 3MRHB 3ZDWA 2ZAHA 5E9DB 2BHYA 2D7MA 2VJ8A 4AEHH 4G7VH 4TXVB 1D5XB 1FPTL 2OSXA 4LGSB 3LQAH 4WRLA 4WV1B 5FUZL 3BIKB 4G8EA 3PV7A 3RTQB 3X3GH 4F93B 4WFGD 2Y1AA 3ZDYE 4KHTH 3SY6A 3UBXG 1LP9E 4FQHA 3EUUA 5E6ID 3F6IA 2HTKD 1JFQL 3M46A 4QD2E 4MNHA 3DA0A 4NPYA 3SQBA 2WVSA 2HN7B 2V9QA 4N0CD 2MCMA 4FXTA 2XKUA 1NFDB 1YECL 3QI9B 1BZDA 1S7SB 2P7TA 4KO7A 3T08A 5CGMA 3FONB 4OFIA 4AQ8C 3ME0A 5DJ0B 3UGXA 3BGMA 2B1AH 3KEHA 1JRHH 1SYSA 3KH4A 3KNBA 1H5BC 3FTGB 3PPSA 4GRLB 1CF8L 4N22A 2UUDK 1N3NA 1F86A 3R7RA 4L8CB 1D5BB 1U8HB 2FLBT 4A2MA 3MRNA 3WTTA 3WELA 1HZHL 5HD8D 2NQDA 4JRLA 3OQ3B 1GYWA 2DQ6A 9CGTA 3IMBA 3RHWF 3H7LA 4PS7A 5FDWA 1D2PA 1G0DA 2X4UB 2XWZA 3WGVB 3ROOA 4H26A 1VKXA 2CALA 4P2OB 2C7FA 2WB1A 4PJHE 5B7MA 5J4MA 4EVNB 1KY7A 4F7PB 4HPYL 4OZGA 1OQXA 4CSPA 3UBHA 1H6EA 2F1AA 3IBOA 3SDCC 4ZXBA 4OBRA 2V4LA 3GI9L 4XXDB 4PLKC 4BZ2H 4OI8A 4JFQB 5EN3A 1A5FL 3VX1A 4L3CB 1ES0B 4K5NA 4LOVA 3IN0A 2C4XA 1DL7H 3WI9A 2CDEA 1KZQA 1P4BL 3GSVA 3A21A 1NDGA 1QWHA 3OLIA 3G6DL 2HZHA 4J8RB 4TPRH 2YEZB 3QNXB 4NO0D 4YXKH 1C5CL 1G7PA 4J27A 2O93L 4H2CA 3MRCA 3CLWA 5HP5A 1BYNA 1SXNA 3HZKB 4U49A 2PUQT 3H2PA 4HZLA 4M93C 5JDSB 3B9VA 1Q9WA 1MCOL 3U1PA 5I75C 3MU3A 3IJSA 1BZ8A 4GSDL 4R4BB 5H35B 2AXHA 4Z7NB 5TDPB 2V5TA 2O30A 4HXBL 2A9AA 4JKPH 3QIBB 3KH3A 2CNZA 1NWOA 2NY2B 4LP8A 3UIZA 4PRHE 2OX5A 4CN6A 4N87A 2O6FA 3STLB 3UZQB 2X9ZA 2FR4B 2V2WB 1ZT1A 1S46A 3T6XA 2MFNA 5LNDA 1T5KA 5AYUH 1Y6KR 1QRND 2DBLL 1CBJA 2EEDA 2ROYA 2P47B 4YHOL 4ENED 1ROWA 3KXFA 5J89A 3VMOA 3QULA 1CCZA 4LEOA 1W15A 3O3DB 1WWWX 3QWRA 1J1OL 1DVXA 4ZUWA 3EZ8A 4B9IA 3GRWA 3VRIA 2DH2A 3T0EC 1ZT4B 3ZN6A 5LWYL 2CD0A 3HMWL 3PAYA 4XXCC 4NQXA 2FZ3B 4JFTA 3EJTA 4U6HA 3HNVH 5EF3A 2PO6D 2OMUA 1CXIA 2ADFH 3PV6A 4G1MB 1ZLSH 3T09A 1ZDQA 2EVFA 1HL8A 1ZTXE 3MV9D 3D85A 4XBPB 5FO7A 2EUXA 4XE0A 2JB5H 1WDAA 3QDJB 5FFOA 1I1YA 4R84A 1MQ8A 3ZHFA 4WSJA 4CL7A 2X1OA 4X4ZA 4ONFL 5HHME 3TJHC 1V5JA 1SLUA 3ZRCC 3ETBF 1YY8A 1YDPA 3EAKA 5FYKH 3TPUA 4FQXC 1FVDA 3BC9A 1K5NB 2IDFA 3TBYB 1N12A 3LZNA 1R3IH 4BZ2A 3EH5B 4PG2C 3TYGL 2XBTA 3Q2CA 4LCCB 2ZSWA 3F04A 2FWUA 4WU7B 4FXGC 4NNYA 4TULH 4OLWL 3K8LA 1SPDA 3OR6A 5SX5H 5IMOB 1NIAA 2JB6B 4HPOH 4WHYG 3V8OA 4QHLB 5HYQA 2LAGB 4LMQE 3U46A 1S5IL 3ESUF 3E9UA 4ZAKB 1TO5A 1T6BX 2PLTA 4NUQA 4NP9A 4WTXA 4KPHL 1IE4A 1AYOA 3EFOA 3QEUB 2F8IA 4ZD3H 1MIMH 3MODL 5B38G 3FSZA 3V0IA 4CN1A 1NIFA 4F5CE 1T0PB 2VO8A 3T3MB 1JXFA 3GSXA 3SO5A 1E4XI 1I7TA 2WB7A 4UT9H 5FAAA 4K55A 2C3GA 4GXUN 4AGPA 3DGCR 2IFFH 1HHGA 1ZHBA 2FUQA 2GIYA 4JHAH 1IKFL 1L6XA 3O6MH 1S4IA 3B9KB 1E28A 2Y6SD 3MGAA 4JO8A 5ACZA 3LZRA 1KTKE 1U8NA 2X44D 3HHRB 1IFHL 4LLYA 2GAZA 5EU6B 3SDAB 4B5EA 1SN5A 2XN0A 4DPRA 3WD5L 1JNLH 5IHZA 2EC8A 4IIQA 3TT1L 1QUNB 4D0CB 2XVBA 2MPAH 1MHEA 3C8KB 4M6OL 3UZVB 5HYJA 2ESVD 3CXDH 1Z9SA 4LASL 2NR6A 4O5LL 3RWHB 3IS0X 4F7MA 5BOJA 4RRPG 1J8HD 3EXLA 1MRDH 2F7QA 3BP6B 4LB8A 4WNJA 5CILL 2DWEA 2FEEI 2F54B 3IPEA 3WN6A 1A6PA 2OL3H 4M62H 3U0PB 4TF4A 2QSQA 5IQOA 2BWQA 3PFUA 4FERA 2AQQA 4UMSA 4TVPD 3MNVA 4UBDC 5ANHA 1ZTXL 1A4KB 3S48A 4BFRA 3V7AG 1AAJA 2DI9A 3N41B 5G5DB 1QSEE 1E6OL 2XXMB 5FKPB 1OTTC 4NWTL 3QH3A 5D4JA 1CLOH 1JF6A 3K6FA 5JZ7C 1N59A 1Q9LA 2CPCA 5I16B 3V0VA 5C0GB 3K2KA 5CEZD 2APSA 1KFGA 3OPUA 3E8UL 1OB1B 4RAHA 4PUBL 4HKBA 3V4VH 4MMZC 4E68A 4XVSH 5D8JL 4S1SH 5JOPE 5KZCB 4HCGA 3WY3A 3LMJH 3PWPA 4KUCD 1SXBA 3WHE0 3IGAA 3ALWA 3Q48A 1AZRA 5M95B 4HIHB 2GTZA 2A73B 2NDFA 4ZYKB 1QHOA 1GW0A 3MRDB 2IQ9L 3PJSB 4IKKA 5DVNA 7PCYA 3VFMA 3VDBA 4MJIE 4A2LA 3MBXH 3RU8H 1K72A 1MXDA 1JJUA 2EAEA 4Y2DD 2ZJSL 3GZOA 3IGKA 3S8FB 4UT9A 1WIOA 5IHUH 3JTTB 4P06A 4ZSOA 1DBBH 3KL5A 3NABH 4N26A 4FTVD 5CMAA 1H5BB 2J1YA 2Y5QA 4YHYB 3PG2A 1AANA 4C4KO 3BRFA 2QDWA 4YHNB 4YL4A 5FC9A 3DMMA 1UM6L 3GD1C 3BCFA 4DN4H 1E3ZA 1OF2B 3HE7D 3DIVA 2H41A 1IRAY 2WCSA 3GO1L 4FZEL 4FQJL 3LSOA 4W9JC 4TKWA 3VD0A 5A2LH 3BSZH 5AVXB 2BIQA 4JM2C 4OJCA 2J2ZB 2G75B 1AJ7H 1BD2B 3AQDA 4QRFA 3VX0A 4ZFOL 5AB2A 3IXTB 4JFFE 1NA8A 2H9GB 2OL3A 4K3GA 4HW6A 3KPQB 3SDCB 5JORA 4P46C 4GI6A 1RXLA 1SGKA 1DDTA 3NZHH 4FABH 2IADA 3QUXC 5HY9A 2AV1A 4CC4C 2NX5A 1H8LA 1KWKA 1PIGA 2CBPA 5CBAA 2YAEA 5D7EA 3MRIB 5TGBA 4QCIB 1M7IB 1GGCL 1KB5H 5IG7A 2BSRB 1CYXA 1DANU 1T20B 4G2AA 4BFJA 2VZTA 4DK5A 3ZE2B 4HEME 5I66A 3CBKB 5EZOL 1N6VA 3DBSA 4M6NL 3FU3A 2EYRB 4R0LC 35C8L 3PGFH 3T0AA 2LLGA 3V4VA 2NY5H 5I75B 1BYPA 3G08B 3H0TB 2CRYA 2OI9C 2HFEB 3W0WB 2WOYA 2P5EE 2AAAA 4MS8C 1LO4H 2NXZC 4N2OA 1G6RB 3LNEA 1R3LA 4KKCD 4JDEB 5H94A 2NY0C 3VM5A 5KYXB 2CIKA 3CX5K 1ACYH 3ZDZE 3EBGA 2ZPKH 4JGMA 2HWZL 3IT8D 2CO7B 2H6UA 4FMVA 4MB5A 4KY1L 1R3KA 1RK0B 2Y07L 4PHZA 2WLJA 2GFBA 3HB3D 4YDVB 1BV8A 4JDTL 1TYRA 2ZXEB 4F92B 3V9EA 2FAUA 2VAJA 5DZOA 2DS4A 3L9BA 1J05A 3QW9A 1S7WB 4LEXH 5KYUB 4I5BB 4OF5A 2XVKA 5C0NC 5D93C 4EI5C 1DVFA 1G7IB 2GB2A 2MQGA 3T0EB 1Z3GH 2FB4L 4AWJC 5G4MA 4FFTA 4G9FB 2WBJB 5T1LA 5T5FL 3CCHA 3M6DA 4NZUH 2V6HA 3VFPB 1DQTA 3DXAE 2Q7NA 3Q01A 2H1LM 3IU4H 3QAZC 1KF9B 2GTWA 2JQMA 4W9IC 1Z5HA 2EDBA 2I5YH 3Q8EA 3BSZA 1RZ8A 2HPTA 1CFQA 3O6FC 3GXNA 2VLJE 1RFDL 4PV8A 2WXOA 2F1BA 4HLZH 3VTTA 1O6SA 3FT0A 3MV11 4FQXB 4QOKE 2R69L 1PBYA 2ITDB 1E8XA 1KCKA 4GJTB 4JHUA 4MS6A 5IBTL 5T1KD 2E7CA 4M5YL 3TO4A 3WNPA 4E42B 4FXGB 2PWGA 3B7YA 2BDNH 1TO4A 2RCSL 4N0YL 1DQDH 4NPKA 4UV4H 3CQPA 2NY6D 1KB5A 1OY3B 4NKOA 2QMKA 2EDKA 3V0FA 1IQWL 1Q9OB 4FQ1H 3AFLA 2CXKA 1FFPA 2X9YA 2XFXA 5GZNA 3VFNB 2EACA 3V4LA 1U8QA 1XH3B 4MD5A 1EAPA 2DMGA 1HIMH 2R83A 3MV8E 4PRIA 4LO9A 5DD5L 5JIHA 5IBUG 3EYFA 3SCMD 4XNUL 5IB1B 1PLGL 1IL1B 1TQCC 3LS5H 5JW3L 4GRWF 4TTDD 5D1QC 3SPCA 2IGFH 2FL5B 3NZ8B 1CQYA 1PYWA 2D7PA 2HCZX 2R0KH 3FPXA 1C7SA 3AAZA 2J5WA 1JGLH 2EDHA 4DZBA 4RGMC 3LNHA 1SBBA 2QPUA 4JHWH 4A2EA 4PG9A 2HJKA 1LK3L 3NCCB 3QEGH 3V6BR 5HDRA 1JWMA 4DO6A 1R5IA 1WAAE 1NBZA 1T0NA 3ZYJA 1A02N 1TMQA 1ZSDB 3THMH 1HHHA 4UTBH 3PHQA 1FNSL 5D1ZD 4X99B 4N1EA 3N2JA 4HUVB 1KIQA 1RIVL 2GSIB 4OV5A 4OJFL 5GRZA 2IDQA 1I75A 1MHHA 4PU2A 1CLYL 2UY7A 2MQ0A 4WCYH 5IESL 5EC1A 3V52H 2Y7OA 2G2NA 5EOTA 1YQVH 1RSFA 3G6JE 3RX9A 4XPGL 1WBZB 5J6GA 1KTCA 1UWXH 1KXTA 4A7VA 4D9QE 5ICXB 1Y1DA 2ZKHH 3WFEH 3ZHKA 3CQFA 5CGYC 4NQVB 4FQIH 2C3VB 5GGUA 1U95B 3CZFB 1TPXC 1YEIH 1JDDA 4W9EC 3PGCA 4KHXH 1A47A 1ZANL 2CR3A 5E2WL 1KIUA 2E9BA 2QFPA 4FLRA 4GRWH 3NFNA 4PQXA 4A39A 4KROC 2XKNA 1BQHG 5D5MF 2DJ4A 1TTUA 4MMZB 4BZ1L 1B4JH 5FW8A 5IJVB 4NC0B 1A3RL 4X8CA 3FB5B 1NEUA 3EGSA 3LRLA 1JZFA 5CJXC 2A6IB 2VLKE 4YVUA 3HN3A 1QO3A 2PW2A 3QG6A 3M45A 3D3VB 1KV7A 2I69A 2VR5A 1TU2B 3LRSB 1A7PL 4GO6B 4J23A 2GUOB 4JY4B 3VXRD 1G9MC 4PJXF 4YEEA 4ZUSA 3P77B 1XSIA 2AF2A 4BHUA 2VO5A 2LTQC 5ID0A 4NIKB 1ODUA 4Y1AE 4V33A 5EIIB 2BIOA 2CBOA 4M7LT 4UU9B 4AL8H 3GB7B 4JG0H 1S9YA 4GW4A 3BSHA 4JKKA 1RJYA 6PAZA 1AO7D 2PWEA 1L9OA 3VJ6B 3UJJH 2HG5B 2BRQA 3ENEA 1CGYA 4Z77B 1RD6A 4HKJB 4QRSB 3T3PE 3DARA 1E50A 4YDJA 5DHVB 3IFLL 4FFVC 2ICWB 4QRPD 2H0EA 5ANMB 3AC0A 3U6RA 3ULUE 3G5ZA 5CJQH 5CHNA 4DEPC 4OZFH 5I2IA 3V7AE 3IE9A 3BUYB 1NCDL 2KYIA 3ATFA 4OCSL 1GGBH 2Z31A 4LP5A 1VFBB 5E5UB 2V9RA 4RDBA 3ZDXB 4UTBA 3AWEA 1MNUH 1UM5L 5IJKC 2NLJB 1JHLH 1GOGA 1TVBB 1IV8A 1G7JB 2CHZA 3KL3A 3SKOB 2G4EA 1FNFA 3TWCH 2BRRH 1L5GA 3ATAA 4P46B 4YHIB 4AQAB 3MLRL 4EDWH 3LVEA 5K1VA 2PPAA 1G1CA 5F8RC 2HUHA 3L2NA 4FFZH 1OCWH 4UM8B 4F33A 2XNAA 3VXSA 4UNUA 1KCBA 3RILA 4P5TC 2AZAA 5K9JL 3HJ0A 4ZO6A 1BBJB 4F9PA 1MRCH 3S5LB 3SHSA 4Y4HC 4DKTA 4H5SB 2WLNA 3CFIC 1FCGA 2Q9OA 5F1SA 4R0LB 5EB9A 5DZJA 3N1MC 2NY3C 3QWQB 4ODSL 3X2QB 3SOBL 2V7NB 1M3IA 1YMMD 1YEJL 3WLWC 3CVHH 4F1SA 1MZZA 2E4TA 2NXZB 3DUHA 4QI3A 5GGVH 1CN4A 1NFDF 4ZMXA 3O2DH 1ZVHA 3VI3E 4Z7WF 2NY0B 1GJUA 3O41A 4BWTA 4I0PC 4RMQA 3EYQD 4GMSL 2XTJD 1A7OL 1KBKA 5FO9A 3MBEC 2R4RL 5F3HA 4UDUB 3ZO0A 3NA4A 5BNXD 4YWGL 4BYHA 3QRLA 4M29A 1INEH 5F1NA 3LD8C 2LLNA 3WFBH 3WL9B 3C8DA 2JIXB 2B2XL 5FLVA 4UMGA 2WAHA 2E7LA 4DGVH 3T8VA 3DX6B 1WUNT 4L8DB 1CU4L 5D2LF 1NCTA 1A1NA 3D39A 1IEAB 3UTTD 5LGHH 5IVOA 3BQVA 1U36A 2OMZB 4FI7A 2CWRA 5JW5B 4EI5B 3RFZA 1NGWA 5K5YA 4P3CL 3V5DA 3KW8A 1V54B 3DOSB 4OZFA 5B39A 3VG0H 5IVZB 4X2UA 3I6KB 4LRNH 4WW2F 4BWWA 1RVFL 5BRZA 1Z66A 1EGJL 3L9RA 5LBGA 3WTYA 3QAZB 4LVOC 2UX6A 5C7XL 1BHGA 5D7LD 1UKTA 2AEQL 4N3UA 2EC9T 1YN6A 4J6RH 3VFOB 3ZX1A 5G55A 1KYDA 5LVEA 1W9XA 3KPPB 2IWFA 2QLYA 4NBXB 4HK3J 4PGDB 5LO7A 4FFWD 5IQ9B 2OKMA 4L29A 4ZFZB 5BZWA 4KKLD 4OGYL 1IVLA 2UVFA 4FFZA 5FK9A 4GQ9H 4PJXA 4R2GD 3WKNA 2GUYA 3NN8A 4G9DB 5G2NA 4QYAA 1DYZA 4KJWD 1TZIA 2R8SH 2WWKO 1MREH 4O00A 1U93B 3CV5A 9PCYA 5IIEB 4Y5XA 3O0RH 5KSAA 4LLDA 1OP5H 4ORZC 2WXLA 2A9NL 5FM4A 1R24A 2VABB 3CTTA 3GSUB 4PWHA 3NP3A 4Z3TA 5BQ7B 5JOFA 5IB5B 2BP8B 4WGKA 1SN0A 3K5RA 4Y9EA 3CVHA 1S6NA 5DRNB 1TQCB 5D1QB 3ZUNC 4E41E 1AH1A 5H4YA 2K45A 3O2DA 5E95B 1TDQA 4DCQB 1GHFH 5IREA 3BAIA 4IMLA 1QRKA 4KRPD 4NZFA 2KBGA 4LHUG 1KTLB 4H44C 2J55A 3FSVA 1WBYA 3ILPA 5DRWB 2HVKA 1C5DA 3KPRB 4NZJA 1M9SA 1XCQB 4OD1H 4BINA 2DIAA 2CDFA 3KYMA 1P53A 2H2PD 3IJEB 3L7EB 3DRQB 1UOLA 5EIQA 3OKOB 3QDMA 2BWDA 3GDBA 4W6WB 3T6WA 1M2VA 2ZP9A 2CCVA 3MRHA 2ZICA 3QFJD 4G6KH 5E9DA 3TA3C 2QVFB 1MCHA 1RURL 1X4YA 1D5XA 3DROB 4JHZA 1DZBA 4WV1A 3HNTL 3BIKA 5D2NC 5EZLB 3BVNB 3RTQA 1XZWA 3QUZD 2J73A 4NQCD 1IJNA 5C0AD 5GQBA 1TF4A 4KRMB 2G3MA 4BRJA 1TPXB 3PWNB 3OKNB 1WCQA 2B15A 3LZPA 3RI5K 3LB6C 4YHKL 2CMRL 4PJCF 5GRVL 4P2RB 1RZJC 1FGVH 2HN7A 4QRRA 3RIFF 3LIZL 4KROB 4CGTA 1NFDA 3JT2A 3QI9A 1S7SA 4LSUH 3ZR6A 1WVZA 3VRJB 3FONA 3CGTA 1IT9H 4NP4H 1P4IL 1XFPA 1V3LA 3L1OH 4CMMB 2WOBA 4M5ZH 4ELDA 4C83B 4GRLA 3FTGA 3LQZB 3T3MF 4XMPL 4BQBA 2BY2A 2XCMC 3S4SB 4ZS6C 3UJTL 1D5BA 1QSVA 1U8HA 2O5XL 5DDHB 1QSFB 5I6XC 4L8CA 3TT3H 1F41A 4DUXA 1CFMA 5I1CH 5IQMA 1NCIA 1OAZH 5JXAH 3TN0C 5JA9A 1YYML 1W16A 1HEJC 2LTQB 3VWKD 2BNRB 3GFUA 2X4UA 4OM1H 1E5AA 1HQRB 2VDRB 2VJ0A 3TIEB 5AG8A 4BGDA 4P2OA 2AQRA 1VACB 3MJ9H 4EVNA 4F7PA 5E6SB 2CM6A 1J8SA 1DSYA 2ZOLB 3TBTB 1EHAA 1SQ2N 4XXDA 2EXYC 3V4UH 1J48A 1CFTB 4XWGH 4L3CA 1ES0A 3HMXL 4BK5C 3WJMB 3MXWH 3A6CH 2J12B 4ZBJA 2J8UE 4DEPB 1AR1D 1DJGA 4G11A 4LSQH 3S7GA 1Z0MA 4LLWB 4POZD 4J8RA 1JPST 1HVXA 1U8KB 2YEZA 3QNXA 1CL7H 2ITCB 3DX0A 4JGUA 4NQED 1KN4L 2W9EL 3HZKA 4UTAL 4WFHD 5JDSA 4L4JA 1JSYA 4XAWL 5T3XH 3FQUB 5H35A 4R4BA 4D7BA 4P4KC 5TDPA 2F6AA 2TAAA 3U1SL 5IROA 2WGNB 2L7JA 1TR7A 1G5AA 3QIBA 4HP5A 4GW1B 4H0HB 3NTCL 4ZW3A 5ITBH 3G5XB 3JV5A 2FJFB 3K4AA 4MVBD 1SNRA 3QUML 2WN2A 1U3ZA 5TDOB 5EEYA 2NT1A 3FQRB 3STLA 5JNYB 3UZQA 1IIIA 4W1TA 5GZOA 2FR4A 2KERA 1IGMH 2V2WA 3GMOA 2AJYL 5ERWB 2NSXA 3GHBH 3IKKA 3U30B 4LCWB 4HIIB 1YEFH 4ABWA 1KGWA 4C4KT 5GISL 2GYSA 2DLIA 4Y4HB 5CZXC 2VITB 4IRZL 4PS4L 4YX2L 2NY3B 1G9NC 3O3DA 3OXSB 4P5MB 2EKSB 4IOSD 4F1ZA 5C9KA 4FJZA 1F45A 1YYLL 4BFNA 1ZT4A 1KYOK 4HAGA 3KE0A 1TITA 5G4OA 3H54A 3P0VH 4HGWB 4Q4IA 2CO6B 2FZ3A 6PCYA 4I0PB 3K1DA 5EO0B 2YD7A 2VXTL 4QRBA 4YHZL 4G1MA 3IVKA 3K6NA 3MBEB 2PXYD 4FC3E 4XBPA 1EPFA 3QDJA 5SV4A 4K94C 1BZEA 3NCXA 4KI5C 5J56B 4HKXB 4DP9X 5LGJB 1UA6H 1UGNA 4JFSA 3SQOH 2DIBA 1WEJL 1MPAH 1NGZB 2IXQB 1RUAL 2O5YL 3VXME 5DRZB 4APQC 4F2FA 2C9PA 3CIAA 4X4XB 3TBYA 1DQVA 4FS0A 1UOVA 5EFIB 4RAUB 4LCCA 5HGDA 5EORH 3ARBC 4MA3B 4NI3A 1ECYA 4R7NB 4KTYA 1JHKH 4PJCA 3OWEA 2BSDA 3CG8A 4OKDA 2QV4A 4Q0XL 5IMOA 2JB6A 5D1XE 3U4BL 4A7TA 3L5XH 4QHLA 3O4LB 1QFWM 4LVOB 5C08E 2HRGA 4AK2A 3SYPA 1CXLA 2K4AA 4BSVB 2IAND 1TVHB 3QEUA 4RFOH 1CIUA 3K2UL 3UTSE 3V6ZA 1JPTH 4OLZL 3GZPA 3T6QC 3P0YH 3ARGD 4RLDA 4XPFH 1S8DB 1IC4L 3G3LA 1MIEH 4NEHB 2OSYA 4JY5H 2OSLB 1ZLEA 5F9WC 2HAZA 2EO1A 3LXUX 3PP4H 3U7AA 1CG9B 2J7LA 4TSCH 3ZTJH 1QMUA 3FB7A 4MBRA 2CCLA 3B9KA 2YPLE 5GS2D 4FQ2L 1C12A 1CICC 3DSNB 5EU6A 1PFCA 1QKZH 3SDAA 3IRPX 1BWWA 3D06A 4D0CA 1QUNA 3WEXB 3UZVA 1W0VB 3C8KA 4PJAB 4PBXA 3HFMH 2C5DC 4S0HA 2CGRH 2XETA 3VD1A 2BFVH 3RWHA 1V7ML 4RZKA 1QAWA 3MLYL 1VFAB 1JPSH 2RBLA 3BP6A 5J11C 4P8QA 1IGYB 3QWNA 3EYVB 4PWKA 1YEEL 3CFJB 4YK4C 2XVGA 5D7HA 3SZKC 3U0PA 4FHBD 3SE9L 1KBWA 2MMXA 5FGSA 2AXFB 3BZEB 1HL4A 4NRZB 4KK6C 5IWLA 3ZHDA 7FABH 1I85A 2B77A 1A4KA 3ARSA 1RUQL 3CLFL 4ONGH 5E8NB 1JZEA 3AQZA 5IEKB 5G5DA 3KLHD 1DQQB 2AEOA 5FKPA 2JLPA 4QGTA 3K71B 1NGYB 2CCWA 4PVMA 4EOWH 4G7VL 3EXJA 4OUOA 1FF5A 1K3ZA 4LF3B 5I16A 1I3UA 1ZHKB 4OH2A 5C0GA 1CR9H 3MPCA 1E2ZA 4JFUA 3QB7C 1OB1A 3X3GL 3S88L 2N1KA 1VIWA 5KAQG 4W9DC 4Z95H 1KDIA 3D0VA 3SKNB 2H0FA 2JTYA 3TA3B 1VADA 4PWGA 3OMIB 1A2YB 1KCWA 1F1GA 1D5RA 1X5MA 4TUKH 3IK2A 4YN3A 1HCFX 1NGQH 4YSEA 1G6RH 1Q8MA 4YSUA 3VMPA 4HIHA 3US1A 4I4WB 3BUPA 5D2NB 4QTIL 1YEGH 3CHPA 25C8L 2AJ3B 1FLRL 2A73A 3PWJB 1F6AB 3SODB 4ZYKA 2NW3B 4PI0A 1XH0A 1LVEA 4UZUA 5AL8A 3NIGF 5JR1H 3MRDA 1QA9B 4YIQB 3PJSA 4E5XB 2J57A 3L4XA 4NSKB 3KPSE 2KLRA 1JRHL 1O6TA 3SIKA 2E56A 3GRWL 4KKQA 4FFYH 1N64H 3HLKA 1Q0YL 4GUCA 4LU5H 3ZUCA 1G4RA 5EHFA 3IDNB 1HKFA 5J06A 2G3ZA 4NNPL 3JTTA 4PN6A 1NCOA 1SZNA 4R4NC 2X4QA 5EZJB 4CC0A 1H5BA 1HCYA 1FNAA 4GEJA 1F6LL 3DDFA 4NOBA 5I6XB 5T3ZE 5AZ2L 3W38A 3EDKA 2YKLL 3QBTB 4YHNA 5AVRB 2FSDA 3K5SA 2Z9TA 3TN0B 2FH8A 2IBBA 3KVQA 1RLWA 1TSRA 5G4NA 3PWUB 1AQMA 3JTBA 4U1HB 2Z65C 4B9GA 2BSBA 2Z0UA 3EJUA 3UIYA 5I19H 2WNWA 1O7DE 1CDYA 2J2ZA 2F53B 1BD2A 2G75A 3EYSL 4N8VG 4QNPF 1XIWA 4JRYB 4R90H 1CYWA 3IXTA 3NK4A 3FCUB 4U0QB 2H9GA 4DQAA 1MI5D 3KPQA 3SDCA 1XAUA 2X4OB 4LXFA 4M1DL 4N0UE 4DETA 4MXQD 4EUPB 1AGEB 4UOW0 3FFCB 2D31B 1NMCC 3NFSH 3QZNA 4Z7VB 4GUPB 1QP1A 2H4EA 4J8QA 4JM4H 5AVYB 3GWJA 3MRIA 2YD2A 3DI2B 4QCIA 1M7IA 5CN3A 4BFOA 3V0GA 5DT1H 2BSRA 4B3EA 1T20A 1JN6B 3PQYB 1MN4A 3F01A 3QR2A 1F42A 3UPAA 4KXZI 5C0CD 4KKRA 4HJ0C 2EYRA 4LPVA 5K69A 1UCBL 3BAYA 4JKNA 3G08A 3H0TA 2A6DB 1CB4A 1OPGL 4Z76B 3MLUH 4YFLI 1WC7B 3VDAA 5JXEC 3W0WA 3T4AC 1MQKH 1NLBH 4G8IB 5IB2A 3N9GL 4WUKH 1S78D 3IKCA 4MDJB 1T03H 1G6RA 3B5GA 4OCNC 4RQQB 4JDEA 4AV4A 5KYXA 2VTFA 2E27H 1KEMH 3NCJL 5FA3B 3ZJAA 3LKOA 3QXDB 2AVFA 2CO7A 5IMKB 5MEPB 1RK0A 2FJSA 2QQLL 4IOFC 4FFYA 4KX7A 4YDVA 3ISWA 1MHPL 3AT8A 3QHFL 4U6VH 5C3LD 1XGQB 5FF6B 5KYUA 1S7WA 3TEUA 3MRFB 4I5BA 3VFSB 4XGZB 2E86A 2I25N 2VR3A 2BVPB 3FFDB 4G7YH 1G7IA 4JFPB 4EZJA 3T0EA 2AQ1A 4BDVB 3FB8B 1NPNA 2D7TL 4XXCA 4G9FA 2WBJA 4K9EL 1WRFA 1K5WA 3F05A 4EAEA 1H6UA 4GT0A 3VFPA 4TTGA 3ISRA 1N5AB 2OR9H 2DM2A 5IK3B 1AIZA 2UX7A 2Y25A 3SGDI 5IOPB 1FJ1B 4HUNB 1JZHA 2E9IA 4A38A 1JZ4A 5FV2A 5L4MA 2R15A 4TSAL 3JWOC 5I8OL 3ZDXF 3K4ZA 4EIZC 4APQB 3E6FB 1TETL 4FQXA 5ADPL 1K8IB 2D7NA 1IC5L 2YUXA 3KHQA 2ITDA 2XA3A 4PG2A 3ARZA 4W9LC 3RGHA 2VM4A 3OL2A 4E42A 4PSPA 4FXGA 4OW6A 5IHLB 1ADWA 4QO1B 4OFVA 4P2CG 2IJ0C 2G4GA 1EX0A 4L4VD 4CU6A 1E67A 3L4UA 3SDDC 1Q9OA 5FYJH 1GXEA 2LFGA 5SWZB 3VFNA 1AGFB 5F72S 5D7IB 1N70A 3CD4A 1XH3A 4OF8A 3QXTA 4JHAL 5GPRA 5ICUA 3LYRA 4AGQA 3DOIA 3EJYC 5IB1A 3VH8B 2GJ6E 4FG6D 3L3JB 4OQ1A 1PF3A 3N0AA 3DSFH 3V6OE 2FL5A 2X2JA 3NZ8A 4V1DA 5CFHA 1C08B 1XD1A 5HSFA 1JNLL 5F9WB 4K0OA 1A0QL 5A1AA 4WFFE 1CD1B 2JKRM 2FBJL 2RQ8A 3QCUL 4L1TA 1BAWA 1XGUB 4F15C 2BXYA 4R4FL 5J1AB 1CICB 1QRNB 2EDWA 1IM9D 4WK2B 2GITB 1I8LC 1LD9B 3FZUD 4FZ8L 1ZSDA 1AYRA 4X99A 4DFHA 4HUVA 1PG7W 2GSIA 4G7SB 2JXMB 5J11B 3DGGB 3GHPA 2EVHA 4YK4B 4NUJB 4GMTH 2YMOA 4KK5D 4JFDB 3IETB 1A6TB 2XWXA 1ZLWK 1WBZA 1YQ2A 1CLOL 1EUUA 1VA9A 1L7TL 1BQ5A 5ICXA 1N8OE 2H1XA 4CADB 4Y16C 2A7BA 2C3VA 3B9AA 2AVGA 4Y9CA 3I6LE 2EIMB 3WXVL 2P80D 1VAHA 4PI2A 3F7PC 2HRPL 1KCVH 5B22A 4XVSL 3A0OA 4A2DA 2CGYA 3VXQB 3AUWB 5IBLD 1KTJA 1BZQK 2XRAH 4XVTL 2WWKT 4YBHA 4CJ0A 2OR7A 1KFAL 5I30H 1IGCH 1SDDB 5CEXB 3CSTA 1DEDA 4OLUL 3WUWG 2ALAA 4HWEL 1KG0B 1AQHA 1QI3A 3B2MA 1DVTA 3MNMA 5IJVA 2EDMA 2EQDA 1KBPA 1ONQB 2FWLB 3FB5A 3HE6C 2X89A 5C9JB 2CLVB 1YZZA 2A6IA 3G6AB 3ILDA 4WI9A 3D3VA 3LRSA 3MBXL 1TU2A 4JY4A 5BUAA 2GUOA 1X5YA 1OL0A 3G5VB 3OKDB 3P77A 4O58H 1G84A 4TYUA 4ZXBD 1G9EA 5KVDH 1T2JA 4XNZC 5EIIA 2KKQA 4UU9A 5D6DC 3GB7A 3VB8A 3PNWB 2LV4A 1T6VN 3LKSB 1M7DB 3BVVA 1ZPLA 5F7YC 5C70A 4KUZL 3VJ6A 2HG5A 4AJYV 4Z77A 1R5WB 5HGAB 4HKJA 4ZPTB 4DN4L 3IMTA 1WS8A 4F57H 5EWIH 5DSCB 2ICWA 5ANMA 1QLEL 4RMTA 2A6KB 4M8QB 2ETWA 4GUQA 3V0WL 4NC1E 4U1JB 4X5XB 1JF1B 1HJBC 2E46A 1SBSL 3K6IA 4GO9A 3BUYA 2HT3D 3VFVB 1J87A 3WFCH 1VFBA 5IUSA 1TYEB 4D9RD 4D7PA 3Q7JA 1NUDA 1TVBA 4LVHC 3DPBB 1G7JA 1ZJBA 2G3XA 5I6OA 1EEYB 3SKOA 4PJIE 4A6YL 4P46A 4AQAA 5HI5C 1EZSA 3CVDA 2BSEA 5AW1B 1WGVA 4KO5A 5DMYA 4XPHH 1NMCB 4UM8A 5K9QI 3B9DA 4JGNA 1EDQA 3ZE1B 3MOAL 3KVPA 5HXMA 3ULVF 5HDBE 2Q3AA 3WN5C 3II3A 1JD9A 1KXQE 2P26A 2A74C