2C9QA

Cu(i)cu(ii)-copc at ph 7.5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
b'HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER RESISTANCE PROTEIN C
publication title Intermolecular Transfer of Copper Ions from the Copc Protein of Pseudomonas Syringae. Crystal Structures of Fully Loaded Cu(I)Cu(II) Forms.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Electron transport(copper binding)
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c9qA00
2Y5QA 2OMZA 1H6TA 2WQXA 2WQVA 1M42A 1OT4A 2C9RA 1IX2A 4CILA 1LYQA 1M9SA 2OMTA 2YA1A 3FAXA 3BCDA 4CC4A 2C9PA 3FAWA 2OMYA 1XEUA 2UZYA 2WQWA 1O6VA 3BC9A 1H6UA 1O6TA 4AQ1A 2OMXA 5ICUA 2RA1A 2UZXA 3BCFA 1O6SA 2C9QA 3BZ5A 4AW4A 2WQUA 4CC4C 2OMVA 2OMWA 1NM4A 2OMUA
chains in the Genus database with same CATH superfamily
2AABH 1JK9A 1T2JA 3RP1A 4PRNA 4PJBF 4N3TA 3ULUH 4KZEL 3KPPB 2FQGA 4K9EC 4PJEF 3ZLQC 1JHTA 3IJSB 2VSCA 5C09A 2Z31B 1XL6A 2WJ7A 2N01B 1BQUA 2ZQKA 1IAIH 5H4YA 1F8TL 2X6MA 5EU5A 1NA8A 1OT2A 3JWNG 3HEIB 5GGVL 5LXVA 4P2OD 5DZLA 5MEQB 1CFTB 2EH7H 4AIOA 2XG4B 5LLIC 1AS8A 4UAOC 4PRHE 3BHBB 4EBQH 4BK4A 4M43L 2NY3C 1EHAA 1WBYB 4PMEA 3V8CA 1M1SA 3L4XA 4LPCA 5EU6A 3SOBL 3QXVA 1KGCD 3IFNL 2H1PH 4Y5YB 4HF5L 2RAMA 1T3FA 5FYJE 3GK8L 3RDJA 5HYJA 4KVPA 1ANUA 3L3IB 3C08L 3B1UA 4JB9L 1SMDA 4IIQA 1XSJA 5EFIA 1T1XB 2E8YA 2CAKA 2AJ3B 4G9DB 4C57C 1YVLA 1EHNA 1NGQH 2QTVA 3AS0A 4JL1A 1TG8A 4JJ5B 1JI2A 5EO9B 1TKWA 4D8PB 2E9WA 4LESA 3LXCA 3FHAA 3WKML 3U7AA 4ZYKB 1GTFA 1BLNA 4YDLC 3DVGB 1CUOA 5JR1H 5FYLL 2Q8BH 4F91B 4JR9L 5D1ZA 1H3GA 1TTUA 5EZOH 4G80A 3TV8A 1FFNA 3QIBD 1X5YA 4Y7OC 2YC1B 3BN9C 1X9LA 3Q3GA 3V0WH 4W70A 1I31A 3U9UA 5FYJH 2VLJD 3MV7D 5L0QB 4JDVA 1KXHA 1U95A 2VITA 3MBEC 4IDLA 4CC4C 4XNUL 2IXQA 4ZJ9A 3NFSL 4UMGA 1KYUA 2QADB 1D9KA 1WJ3A 3MRMB 5MERB 3WJJA 5AG8A 3K72A 2HX7A 4BK5C 1EEZB 1FYHB 1ZSDA 2L4OA 4TNVF 2XJLA 1MCRA 2YD1A 2JCWA 2X9YA 3ARXA 4JFSA 1AGEB 3HHSB 1XGZA 4U6VL 3ULUF 4NZRL 4B9JA 1ODAA 4APXB 3C60D 1ZMYA 4JN2A 5DS1A 4IMLA 2RBLA 1N5AB 4QJ4B 4XPHL 3L7FA 2CPCA 4UM8B 4R96A 5KYWA 2VRKA 1JWMA 1HINL 2HTKC 5E8EA 1A64A 4FTVD 1RERA 4MXVF 4B5ZA 4F7KA 1H0DB 2IPUG 1H19A 2IH1B 5EOTA 1ZT7B 2HJKB 4P2RB 2YWZA 1U8CB 1JYWA 3IJEB 2HLAB 1RH8A 4DEUA 3FUEA 2QKSA 4N86A 2X4OA 4OD3L 4U1SB 3RVXD 3WIHL 1I1FA 2WZPA 2X05A 2YMXL 3L3KB 5A2CA 4XGZA 1LWJA 4GAYB 3IAPA 2HA1A 4ZTEA 4I5BB 3LQAL 1JZIA 4ACPA 4KROB 3WMQA 1WTLA 2CLZA 4CSZA 2ZE0A 1V05A 2H3XC 3VI4B 3WTVA 5CGYC 3QIUA 3K6DA 35C8H 3KLDA 4PYHA 4S2SB 3DYMA 1HWWA 3GIVA 3QDAA 4PVBA 2WWMC 1IARB 1A4JB 1ZVYA 2Y6SD 1WGVA 2F7RA 1AZCA 1HHKB 2DD8H 7FABL 3HA0A 2FD6H 3BEWA 4MB3A 4PRDA 3RTQC 3RG1C 3V4UH 3SDDD 4LSQL 5CZVL 1EK3A 2PYEA 3EYOA 4XMKL 2XXGA 3DBXB 1R75A 2PXYA 1R3JA 4EZMA 1KB9K 1J05B 2G0KA 2RMNA 1F11A 4KXZI 1UWEH 5I71C 2XWJA 3MRQB 1JF5A 4HG4K 1ASOA 3DIVA 1P0SE 1GSKA 3RB5A 4JRXB 4HOXA 4P9MH 2CO6A 3OKNA 1KIQB 1AQ8A 5DRWB 3ZIMA 3FTGB 2FB4H 2XQYK 1S5HA 3GBNL 3GSVB 4IJ3B 3CG8A 1UWYA 4JS7A 3GB7A 3ARDC 3S34L 2DIBA 1QSFA 2BW4A 3G3LA 1BECA 2D0FA 1KGYE 4X6CB 3U7YL 2R8SL 3OKDA 1M56B 2DLEA 1IE4A 4HLZH 4Y2DD 1R0AH 3TO4B 1PPIA 1FNSL 3BZ4A 4G7YH 3EFFA 1U8NB 4UNTA 1FDLH 5DK3A 4JHZA 3UEZA 5L2KB 4GSUA 3UADA 3CLEH 2DQHL 4EOWH 4YXHL 2FYVA 3D07A 4PGCA 4Z76A 4ZMYA 1UCBH 1WWAX 5SX4I 2WIIB 2FLRT 2Y36L 4MKMA 4P5MB 1UWGL 5I18H 3W56A 4K3JH 4DAGL 5C0EB 2ZOKA 1U33A 3N9GL 4AH2A 3SY6A 4X4ME 2HLFD 3HZ3A 2BFVH 5I2IB 4K3DL 2WTOA 1UM6L 1IQWH 3RZCD 1N3NA 5ADPL 2IBZX 4GIAA 3LH9A 4XVSL 3O81A 1QSED 3HC2A 4M1CC 3EIFA 1NDGA 1TITA 1WIUA 2YXMA 2X2JA 1ZGLM 1B9ZA 2PNDA 4YC2B 3QXAA 3EYQC 4XPFH 2V5TA 4NZUH 1IGCH 4RBPH 2XYBA 5KG9A 2WSKA 5CJOL 5DHYA 2YD5A 3TBTA 1R47A 1XO8A 1J7VR 1QKZL 1W6LA 4QF1B 5A3IC 4QXTB 4M1GH 3C5JB 4NQDD 3RWGB 2F1BA 2E7HA 3GLZA 2WUBH 4QJ5B 4LSUL 4UTCA 5K9JL 3E3QC 1DSFL 1Q94A 1AO7B 5IQ7L 2BNUB 2AEPH 2GSIA 4FLQA 5C71A 2NY7H 2P24A 3QUKA 1FN4A 2A77H 2BVQA 1G1CA 2XKNB 5E8NB 5FFGA 4PTTB 1QI4A 4GRMB 5DA0B 1G9NH 5GZOC 8PAZA 3FQ2A 3G5ZA 2CWRA 43CAB 1AHWA 4NJAH 3GHBH 3IGAB 4ISVA 1KXTB 3BDYH 3G5VB 1GA2A 5IJDC 5JLZB 3CHSA 4N4YB 3NRFA 1OCZB 2ZP9A 2AEIT 3SODB 1T6VN 1OP5K 1X6LA 2Q6WA 3BGAA 3UXFA 3DHJA 5JMOC 1QBLL 4NN5B 1KUMA 2YUZA 2AJZA 5EOCL 3WHXB 3LIZA 4AKQA 3BWUC 3ATFA 3AU0A 5F7HA 4M3HA 4ZX5A 1VCBC 1ADQH 2O6CA 2YUXA 2ZUVA 4LDEB 2VAAB 4Q74A 4QXGL 4CA4A 2CCVA 4I0PC 3BVUA 4KKLC 2P9RA 5CN3A 5CF3A 2OV0A 3I74A 3MO1A 1CICC 5K9OB 2F8XC 3POHA 4NHCH 5CP7B 2IV9A 2Y5TA 4ZOCA 4DTGL 3G08B 2IGFL 4WNJA 3RGVA 3PAUA 4YNYA 3B9KC 2G3NA 4BXVA 2Y7LA 4CVWA 5JZ7D 1AFVH 4DUVA 1L9PA 2EYTA 4OY9A 2H0JA 2OCJA 3F65A 4DKFL 5GJTL 2EO9A 4HV8B 2PO6D 2H6OA 2WQRA 3CX5K 4S1DC 3E6FA 1B3IA 4WFFE 2PWDA 2NSXA 1VACA 3NUKA 4Y4KA 5BMFH 3OMAB 2F54B 5CFHA 2CJTA 3L5XL 2F7IA 4HEMA 3OLDA 4DP7X 1BX2A 2HKHL 2COQA 1L5GA 4FGMA 1ZSHA 3VO0A 2CLVB 3HI1A 4LLQA 4M7JL 4LAJH 5KUMA 5GGSB 3QS2A 5D4JA 5LBSL 2VDNH 4AXWA 2Q5BA 3O2WH 1JNNL 5GS3A 1U93B 1W0VA 1R3HB 3MLXL 2PTTA 2J20A 2R69A 4PR5B 1D6VL 4NLAA 1JVOA 2NTSP 1HI6B 4XWOD 2EKSB 3ZTCC 2YAOA 3EOYG 5I9QB 5HGDA 3MGTB 3ZR5A 2FK9A 1I3RA 4Z7OF 4JKPH 4AM0Q 5G2NA 4ZTPL 2XZQL 1CBJA 4JGJA 2R39A 2FX8H 2F2HA 1JVKA 1CE6B 3MRBB 3VWJB 4LOUD 5EO1B 4XOBA 1VERA 3R7QA 1I9JH 1M7XA 4ZFOA 2VN7A 2HCZX 4YH6A 5IOPB 3MR9B 5HHNA 2XBDA 3BWSA 1IGIH 1JS4A 2G60H 2NY4D 2Y2YA 2BP3A 5T1KA 4YFLI 3CSPA 3B5GA 1AXSA 3QUZB 5D2LE 1O7VA 5E9DB 4TQHA 5CSZA 3TC9A 5E23A 4AYGA 2G2RA 2Z1KA 2L7UA 2Z31C 2FT7A 4LVHB 4W9KC 4ZFZA 4NWUH 5CD5C 2EINB 3EADA 3SE6A 4PJ7B 4F9LA 3FT2B 2AQQA 3CDGA 4F58L 4NO0B 1RIUL 2RB8A 3FH7A 1RAMA 2DI7A 4OJYA 4OSUH 4UTAH 4AL8C 1F86A 2QVMA 1GC1H 3O4LB 1KGWA 3INUL 4Q4IA 1WGOA 2HG5B 1OM3H 2W60A 5TPWL 1AVAA 2O5ZL 4GS7B 1GGCL 5MEOB 1M7UA 4NQXB 1NEPA 1OP4A 4XNXL 5I74B 2BSED 1HJBC 5C0DA 3C9NB 4XNQB 1U8PB 4QHLA 3UP1A 3L2LA 1ADWA 3AZUA 3TASA 1YC8A 1T66D 4L8SA 3PQYD 4Y5YC 4Q6IB 4XN5A 4LCYB 1HYRC 2VLLA 3BWAB 3FT0A 4R0LA 2FYYB 3ZK0A 4U3CA 3KBHE 4OV5B 3BRDA 2ZWKA 3BT2L 3MFGB 2ICWI 3F58H 1GY2A 5T3ZL 3V6OE 3SE4C 3FTZA 1INQA 5LGJA 4E41D 3LZNA 4N8VA 5L9DH 4V1DE 5D7SL 5IW3A 4Z7AA 5EMYA 5DMKA 2R2EA 5GGQL 4MJJA 3CVBA 4ODWA 2WBXA 1SDDB 1KTRL 1KGIA 3LKQB 4P57A 2BIHA 2H26A 3N40P 2CBOA 4PHZA 4AEEA 1IM3D 5FIEA 1T7XA 1VB9A 2B0SL 2E27L 5IB5A 3DOSB 4QAWA 4D94A 2OJEB 2ZCKH 1VF5C 3US0A 4WUUD 5L0QC 2I9LB 2FAUA 4BFFA 2O5XH 2RCSH 4L48A 4YPGB 2QADC 4R8WL 4TVPL 1DN2A 2XC8A 3MA7B 2I07B 3VGBA 5BRZB 2EDHA 3GS7A 1RCYA 5IB2A 1IBYA 3WS3B 4ZFGH 3L3JA 4OJFL 4ZMAT 4OGAC 2XIIA 3O11A 2XPGA 4ZUSA 5LGHH 5CIPB 5IM7A 4HPOL 2E7BA 3QORB 1A14H 1WO2A 3V4LA 3H7LA 4IBYA 1FL5B 3OR7A 2JJSA 2KLRA 3PPEA 4IRSD 4JY4A 2E5EA 5BV7L 5GSRA 1KEGH 1MAJA 3B83A 1A3LH 4L4VE 4FCAA 1OT1A 4WO4D 3VFNA 3AS1A 5KSUB 2FRGP 3MRJA 4NNPH 3FAWA 1INEH 3N6YA 1NGPL 3UMNA 2X3BA 1MCKA 3I6KA 1CGYA 5AD0B 4Y4HA 1VFOA 1ZWIB 4LCWB 4JFOB 4UOJA 2GK0B 2GITB 2XTJE 5BV7B 3EBHA 2E46A 4PJ9B 4LCCB 4XCEB 3RL2A 1NGYB 5HDRA 1VDGA 2CRZA 4NQEB 3C6LA 3GIZH 4HSCX 4KROC 1G7IA 4KJYA 4MB1A 5HHVH 2A6DB 4FFZH 3LPPA 1M71A 2C9XA 3JUYA 2APVA 3BD4A 3U6XA 1KB3A 5J5EA 4LEOA 5T5FL 3EUUA 5ANMA 1G4RA 5IREA 3WTWA 3E9TA 4G6AC 4XC3H 2YQ3A 3VGGA 3WFBL 3RFZA 4RAVA 1IC7L 3NPSB 3F3HA 4L4TD 1I53A 1PIGA 1ACCA 2KMWA 1A9EA 1XTMA 4N90D 4S1QH 3KE0A 2Q7YB 1S7UA 4R97B 2VMCA 1OW0A 2PPEA 3HE7D 2OMXB 3SJVB 1I3GH 3PYCA 1OF2A 2FJHA 3G5YA 3MHZA 2FH6A 1XD1A 2OMWA 1M7DA 1GL4B 2MJWA 3T3MB 3ETTA 4PSPA 1NBVH 1NLDH 5AW1B 1X4YA 4ABUA 3EYSL 4A67A 1F3JB 2X89A 1NSNL 3ATDA 3NVQA 4FS0A 4M5ZH 5DC0A 1CGSL 5I1EL 2J43A 1BD2B 3AWEA 1LE5A 1MOEA 1TJXA 1KG0B 4BH7B 3WBDA 2GVYA 2UY7B 1DQDH 3C8KA 3LV3B 4N26A 3QG7H 5GXBB 1TO4A 5F96H 3MMEA 5E8PB 5C0BD 1FWXA 2WKGA 3QDJD 4IJ3C 1FNHA 1H6EA 4KX8A 2HN7A 5FECB 5TQ2L 3IDIB 1DQQB 3F7LA 3KYKH 4RRPM 2WBJD 5EF3A 4Z7QF 4B9YA 3DYPA 5H94A 2H1XA 3L9EA 4G43A 3QNXA 1SVCP 3VXMB 5EBGA 5I17B 3EBGA 3TO4C 1A7OH 2G9HA 1CYWA 4G6ML 2DEXX 4YS4A 5KUKA 4O9HL 1Y6KR 1FVDB 5DUBB 2J56A 2FO4B 2OYKA 1FVEB 4RGOL 1MJ8L 1OEZW 3IFPA 1C5CL 4P9HH 4KRPD 3QK0A 3UGEA 2G3ZA 3HNSH 3UTTB 5IVZA 1QWNA 3DHPA 4Z0XA 5C8JB 3L7EB 1A9BA 4GG8B 3NJGA 4N0YH 2X44D 1T7YA 5T1JA 1TEFA 2GEEA 1TYRA 1E4KC 1X5AA 3OC8A 3AREA 5SWSB 3SD2A 3U7WH 4K5NA 5C9JB 5F9JA 2ADIB 1P6FA 1XT5A 3HHMA 3JV5A 3BKJL 4M02A 5AZEH 2IANB 4X98B 3VXSB 4Z7VB 3OZKA 4AY0A 2NX5B 2Z93B 2PUQT 1K3ZA 4YC2C 1IIKA 1IT9H 3MNZA 3MROA 4R83A 4XPGL 3TH2T 3PABB 1AANA 1UTDA 2FJGA 2EXWC 4YHIA 4BKSC 3RX7A 1E8WA 3F05A 2FECI 3FB7A 1MFMA 1RZ8B 3TM6A 3UZVB 1E6JL 4PV9B 2GY7B 1ZAGA 3C2AH 2O5YH 2DM3A 3K8LA 3SYCA 3CFBA 2CA4A 3MUGA 1OGAA 5DO8A 5BQ7A 4LLWB 5EBLB 3QIWD 3QUYD 3DUUB 4X9BA 2GB2A 2DWDA 3M46A 1D5BA 3O3UN 4QOKA 3CUPA 5IG7B 2IG2H 2A3TA 1VJSA 4GKLA 4B9KC 4HLEA 1A22B 3MXWH 1MF2H 2XZCL 2XN9B 4C55A 1GYAA 1GMEA 1I1CA 3EBAA 4GAGH 5GRWA 4BQ8A 2B4CL 3ATEA 5FDWA 4A1RA 3TGXA 3WGVB 2QQNH 5IBUG 5IHBA 1E42A 2HZHA 4HIJB 1N9PA 5A16A 2QELA 3FPXA 5TE6L 1IBDA 4X83A 4CUCA 2CGRH 3IETA 4OFVA 1F0LA 2B14A 1ADQA 3VFWB 1BVZA 4NN5C 4Z95H 4XPBL 1K3IA 1H8OA 2ZUUA 4G3YL 1H8NA 1E28B 4NBXB 3IKCB 1RZJL 4PJ8D 1FLRH 2E74C 4X5QA 3RPBA 1KBPA 3GMMB 1A6PA 1JZ3A 1P1ZB 3RPKA 4GKZA 1YDPA 4LQFH 5FV1L 3UTZB 2FWOA 4GW5A 4A55A 3IE9A 1UYWH 3Q48A 3QEHB 3O3BA 3T0XA 3O9WA 2V9UA 4P5KB 3B2MA 3GRWH 3FSAA 4NNXA 3X3FH 3ZE2F 2VGLM 5I1JL 3ZDZE 3L3HA 5D8JL 4YSQA 1L6ZA 5HDQH 1CLYL 1NAMH 2GTQA 1KB9J 1X5IA 4G7RB 4F7PB 1KACB 1F4AA 1G6RH 3GDBA 4W93A 5BZWB 2DOCA 3P4NA 4HG4J 3ZTEA 3BUPA 2JI2A 1DBJH 3MJ8B 4PW9A 2A6IB 4XN9A 3GO1L 5BO1H 4KNUA 4U7KA 3OHXB 5IGXL 4JFPA 1HILB 4G42A 4PWEA 5FAAA 3RVVD 3NN8B 4NZDA 1JNJA 2AJVL 5IROA 1FLTX 3FT3A 5L8JB 1EFXA 1XCTA 2YGPA 4FN0A 2Y2TA 1E7VA 2R0LH 4PRPD 2XVLA 5HGHB 3MN8A 4M6OH 4YWGH 3K71A 3CZUB 5I9QC 1XIWA 1H3UA 3KEHA 1T04A 1A6VL 1VADB 5JHDA 4X6EA 3MOQA 4XE0A 3TT3H 5AVRB 4KMTH 5MENE 4GMTL 3VDBA 4QKTA 2GSGB 5CBAA 3LEXB 1UB5A 3IF1B 3CVDA 4HMCA 3VWJC 2X4NB 5CCJA 2W07B 3ZQWA 2OTWB 3NMEA 2CO2A 4LT7A 4NXKA 1MVYA 2EYSB 2ICWJ 4RWYL 1NDMB 3D85D 3MV7B 3IDUA 1VKXB 2MSPA 3GMQB 2D2CC 3FW6A 3N04A 4O2CA 1K6QH 4LCIH 1AKPA 3QUZC 1L9NA 2FHBA 1Q0EA 2YPLB 1QOKA 1NMBL 4M29A 3B2UC 1BQLH 4RA0C 4G8FA 4LVHC 4UTAA 1C1EL 2I85A 1DJSA 5C0IB 3BEVA 2X4UB 3DV6B 2Z7WA 4N25A 1NCWH 4PGBA 4BSWA 2KZWA 3ARWA 4C4KO 5CM1A 2NNRA 3WFDL 4RIRB 4XXWC 3KPTA 4XMXA 5EZJA 5MEPB 2W0KA 4ALAC 1KCSL 1S7WB 2WCGA 5HHOB 4QXUL 2JCCE 1QP1A 5I1CH 3Q1EA 5D2LA 1GYUA 1DCLA 1S7RA 3IJ9A 4GS7C 4ES8A 4HIIB 5IW1A 2DMKA 4X4YB 3NIDF 3VXUA 1L9TA 5IT2H 1KGXA 1EO8L 4HIXH 3U0PA 1UD4A 2K8QA 5CZXC 4ELKA 3EJYC 1MJJA 1KCUL 4Q6IC 5DS8A 4PY7A 1OQOA 3QNZB 4WF7A 1P7QA 3CZEA 2ZJSL 4AITA 3RY4A 4DPAX 1JV2A 2XHNA 4G6JH 4M48H 2G75A 1IC1A 5IMMB 4QHUB 1FO0H 1KZQA 4AVHA 5IBLD 5AZ2L 4JFQA 1G1YA 2RHEA 2ARWA 2QVTA 5AVVB 2PN5A 3PXJA 5E5MB 1UFGA 1YEIL 1ROWA 4HZLB 4YBLB 3QDGB 2EVGA 2Y06H 3MUJA 4ATTA 4IK7A 3K81A 3DXAE 4MCZB 4MB4A 5EU4B 1ZLUH 3L5HA 4JO1H 4NT6A 4YUEH 5HYEA 1XGUA 2VLRB 4IGBA 5BJTA 3QRGH 4X7TB 5DMYA 2R0KL 1N64H 5J9PA 3CFNA 4JFTA 2GJRA 2HAZA 4LSDA 4V1DA 2ENSA 1CLZH 2ZSWA 1BBJA 1VFBA 2LU3A 3VXRB 1ZD6A 2X1WL 3HZYA 4BBWA 1NFIB 4J39A 1PDKA 3BH8B 1RZKH 1RK0B 4PJIB 4P5TA 3ILQD 4AZ8A 1A7RH 1ID2A 1K8IA 5DRXA 3DRQA 2GEQA 2F53D 1MCWM 3RNQB 3Q6GL 2A74A 2OP4H 3QORC 2RGSA 5L2JA 1BJ1J 4FTDA 3FTXA 1BIHA 4KTDH 1OLZA 2J88L 3KJ6H 1LO4L 2R1YB 2XFGB 3OKOA 3KCPA 1UD6A 4GP8B 1H3VA 2HUHA 4FEIA 1XZ0B 1JF1B 3NZ8A 3IMRA 4LSRH 3O3AB 4OLXH 3SCMD 1TQTA 2I7SA 2BLFA 5DR5H 3V9CA 5ES4B 1U41A 5BV7C 4PJ9C 4LCCC 4MS8D 5GIRA 4FFZA 4URTB 2DQDH 4XNYL 2WSPA 3TA4D 1HDMB 2I9TB 4LIQL 3WG7B 2FX7H 3LEVH 4L4VA 3T0ED 2FHCA 4RGMB 2BOLA 5F1KC 2PWGA 3NJXA 1TQSA 2VKXA 3WENA 1WBZB 5KTEL 2QSCH 3QISA 1H6UA 5FGRA 1H3TA 2TSAA 4APQA 3K7UA 3D0LA 4K2UL 3TBVB 4YHLL 3EJZD 2EE3A 1RU9L 1WS8A 4NM4H 3NPSC 5KN5B 4FXGB 3HMXH 4RAHA 2EIBA 4CBZA 1I85C 3FQNA 4R97C 3UO1H 5DJYA 5A2AA 4PJXF 5EA0H 1I1YB 1A4AA 5C3LD 2EE9A 3IDGB 3L5WB 5IFHH 2NZ9C 1T0MB 4P2QA 5LO7A 3W9DB 4JY5H 4LF3A 4YDJA 4XMLL 3W37A 4R4BA 4UZUA 4ZPTA 2XWBB 4PRIA 4NC1E 3TLRA 3V79C 2APSA 2ARJA 3MCKB 3OAUL 3AXLB 4B50A 1EGJL 1DDHA 4OIIL 3GBDA 1WA2X 1YZZA 1AI1L 1QRNE 2Z35B 2P5EA 2A6KA 2GPZA 4FQHB 4X7SH 3MC0A 1Z3RA 3UJJH 3LXAA 4MXWL 1ETZB 4J23A 5DK2A 2MFNA 1CL7L 4JZJB 1HKLH 2VDOL 4EAEA 2EDXA 1EFQA 2XSKA 3CHPA 4EN3D 2VUKA 2YD2A 2EE2A 4O00A 3PIQB 2K70A 5KVDL 2EDJA 1VGEL 4HX1A 5HYSG 4QRQB 1X5ZA 2OR8A 3OX8B 5DD6B 5LG6A 5G4OA 4PI2A 2VL4A 1CYGA 5E94B 1WEJH 3EOAA 3BZDA 4XO8A 2VDOB 3S88H 3GYRA 2OW7A 4XRCA 3DJSA 1A6AB 4FQLH 3PWLA 3CX2A 2OX5A 3U46B 2BOCB 3WXWL 3DGGB 1MQ8A 3QQ9C 5IEKA 2H0PA 2HLEB 1OAZH 4ADIA 4XN8A 2E9IA 3QI9B 4N22A 1DN0B 1YEHL 2J6EL 3QH3A 4D0DB 4ILDA 4N6RA 1U8OA 2YMTA 3WTTA 3NIFF 5L4JA 4J8RB 1IUZA 4GI8A 1HOCA 5BVJA 3HCVA 4PUBH 1HZKA 4ONFL 3D3VE 2ZKMX 3PF2A 1DQJB 1UXWA 4OCYL 4U0QB 2F7QA 4NX0A 5GS1A 4R7NA 4JQVC 1ZTXE 5D96B 1J1OH 2PO6B 4HH9B 1LEGB 1YN7A 5EN3A 2AV7B 1M9SA 3HR5A 5F7LB 3T1FA 1G43A 2A5UA 1W15A 4RH4A 3SBWA 4NIYE 5I1GL 5PAZA 4UWQB 1F4WL 2HT3C 2V17H 1GAFL 4JM2F 4AIZB 4AG4L 1J12A 4KAQH 5LUMA 1E5ZA 4R7LA 5EEWA 3L3DA 1UH4A 5AAWC 3ME0B 3K1DA 3ZDXE 2E7DA 2JKSA 1S8DA 3O0RL 2PMZA 3FMGH 3D51A 1Q9OA 2VDML 4OZHE 3V0IA 4WEBH 1YPZF 2JI1A 4HCFA 4GG6E 4HXBL 1IBFA 1MQKH 3FF7A 1XGTB 3ULVD 3T3PF 2GJJA 2IPUK 2DM2A 4JFFE 4Z5RA 3MRGA 4FXKA 4TSCL 4F1ZA 3BUBA 1B2YA 4DP5X 3MBWB 4M00A 2VZVA 4DUWA 2D7NA 1MG2C 2NY1B 2VDMB 3QQ4B 1TTBA 1U8KB 1S7SB 3OKKA 4UIKL 2BSTA 2FCBA 3R1GH 4UQIM 4PAZA 4PHXA 1SQ2N 4ZO8A 5ITFA 3H0TA 3HE6B 3C12A 1WFMA 4WTWA 3SE3A 3NA9L 5D9SB 3S3JA 4FDWA 4XB7A 3CK0L 2IPKB 2V7NA 2NY4B 3PP4H 3RWCB 2B4CC 4MA3A 3FFCB 4WW2B 4Z7NE 3STBA 1E27A 1KBWA 5DI8B 5HYIA 1KPVB 1RIVH 3AT0A 4Q97A 5JNYB 2JLPA 4RGNE 4WV1A 4X6BA 5F7MC 1RVFL 4KKAD 3HNTH 4HQQL 5CBEB 3GRWA 3UCRA 4FQXB 5HGBB 1NCOA 4NP4L 3W5MA 2BNQA 3EGXB 2AJYH 2XVBA 3HG3A 1NAMA 3U6RB 1KB5H 3QZWA 3WU1A 1KYOK 3X1GA 3UTOA 3SDCD 4E41B 4P4KA 5CLYA 2CZNA 1G6RA 1I7UB 2MOQA 3QUXA 1H9VA 1RZJC 3H85A 4CNIB 3T2NL 2YPKB 5K39A 4NRYA 5SWZB 5AW7B 3UC2A 3J07A 4QYOA 3BZEB 1ACXA 1NKGA 2EE0A 2JJVA 5DWUL 4DQOL 3WY2A 3BRGC 3J2PA 5KS9F 5LAPA 3EZJB 5ILTL 1BF5A 1JGLH 1NINA 3OHXC 1UJ3A 5C0GB 1Y07A 1Z3GH 5AWNH 3SY0B 5BNXD 3Q9PA 5B1JC 2XU9A 1YECH 1T5WB 3GSUB 1A4CA 1AR1D 2P28B 5D7KD 5BOZG 4B7LA 3LN5B 1PIFA 3QFDB 2W80C 2C8NA 5A6IA 3CHOA 4TQPA 2IEPA 3PE9A 1UACL 4OLYL 1E50A 5I5JA 5CJ8A 3PLYA 4XO3A 1RULL 3T8XA 3H7BB 3AQDA 5DFAA 2ALWA 1OQXA 3MRRA 4GAFB 4JFDB 4C59B 1UOLA 4G8GD 2ZAGA 3F5WA 2HPTA 4H20H 5FGBA 3NEEA 1XGPB 1TFHA 2BP5M 4R4NC 4N2DA 3B56A 1KBBA 1R5IB 3V0GA 3ETSA 3PV6A 4JZNA 4MA7H 2DWTA 3D0VB 3DMMB 2VLKE 2V9TA 4WUUB 4Z3TA 5AQ0A 1LILA 3BQUD 2BS8A 1JXGA 2WHVA 4AGPA 4PB0H 5I0DA 5DJDB 1GJWA 2L8AA 5AYUL 4G70B 4KVCL 4JDZB 4TL5A 3ZSSA 3SGDI 3QWOA 1EANA 2BHZA 2GSMB 1AZNA 2UY6A 3SYOA 5D6DC 4I2XB 5FUCE 4AGMA 2CCLA 4TULH 3IVKB 1P9MA 1YMME 2VQUA 3IGKA 3EJSA 2IO5A 5HTSA 1ZV5A 2ZSVA 3C09B 2IOIA 3NSFA 1Z9PA 5C2BL 1JD7A 1S9VA 2J57A 5JXAL 2VT0A 2BNRB 3LPWA 1KTJA 1R33A 1PKQA 4PLJC 1CK0L 4A04A 1YEFH 1OO2A 4MDIB 5IJKA 3D18B 4KI5E 1JGVL 4B95C 1E0OB 5JUEL 3FSOA 2J1WA 2FVNA 4L1HA 1PFCA 3QJFB 4RNRA 2D31B 3GMOB 4XMVA 3HBQA 1FFQA 2RQ8A 5DS2A 3TZVB 1FO0A 4Y16A 4YFDB 1RJZB 4XCNB 1OZTG 3U36A 1XGQB 1BQRA 3KXFE 3TO2A 3GMRB 5I8KL 4XVJH 1T20A 4MJID 2ISDA 2HKAA 2JCCA 1DVFB 2DM7A 2VXTL 4PJXA 4MAYD 5F1IA 5KSVA 5ALCL 3GBEA 2FNWA 5CINL 3UROR 3T0BA 3D2TA 2PCFA 2XETA 4GQRA 2VO5A 2J72A 3CC5B 1LXMA 2G2NA 3EGDA 1C12B 3PGDB 5HJ3B 4K3EL 1EHKB 4LL4A 2CIKB 4YBLC 3CFKA 4J3OG 1VFAA 4OLUH 3TIEB 4FYSA 2UVEA 2LR4A 4YHPA 1WUZA 5KZCD 2BCKA 4LSTH 3N5AA 3WHE1 1J8HB 2XZAL 4PRBB 4XCFL 1JGUL 5FC9A 3BPCA 1E6OH 1XX9C 1JPSL 3O41B 5F89B 3PHOA 3GJFK 1LO5A 4NQTA 4ORZC 1KTKE 1AGFB 3H9YA 1UGNA 4YOKA 1F6AA 3AMKA 1QX1A 4ODUB 2WLLA 3B7UX 4LKCB 5FCUL 5D6CB 4BSVB 4ZUVB 3NIGB 2KPNA 4N2AA 1E5CA 2Y5EA 3HZVB 4XH2A 3MRPB 1JP5A 3RWIA 1JHKH 3AY2A 1GJIA 1TZGH 2ODIA 1KFGA 1OPGL 4L8DA 3K2UH 2EACA 1DE4B 2CO7B 3QDME 3SGJA 4WJG3 4AGNA 3FF8A 1ZVSA 3NTCL 4U0RB 4DCQA 3HN3A 4E9XA 3DX7B 4DZ8A 4P59L 2FL5B 1M6OA 3SYAA 1FYTA 4GYBA 4PJFE 1L7TH 3TBBA 2ZXGA 4H5SA 5HYQB 4Y2DC 4M7LL 5DZNA 2VISA 4E0RB 2YN5A 1I8AA 5HI3C 1X9QA 3VI3B 5IUSA 4Z7UE 4HHWA 4AENA 4EBQL 2DEYX 5GZNC 3DSFL 1GOFA 1GCYA 1GZPB 4UBDD 1MVUA 5AW2B 4JHBA 4HD5A 4EDXB 2G4GA 1YJDH 3VG0H 4RGMC 1FE8L 3CZNA 3BP5B 5CN2A 2WLMA 3G6JF 5DMIH 4BE6A 5FOJA 1LEKA 3LHPH 3MOAH 4QAMB 5I0XA 4Y2OA 5JHLH 3UTPD 3HMXA 1BMWA 3HRZB 1F45A 1U92A 2HLFC 3AQXA 3QQNA 3QFJD 2B9BA 1JV5A 4JM2A 1K2DB 3KYNB 3B7RL 2B3RA 2ALAA 4RZKA 1SZNA 2ATPA 2XIDA 1ZE3C 4FXGC 4KJPC 3RIFF 2K8MA 4F20A 3BUIA 1GVIA 3CAFA 2ENJA 3BP4B 5ICXA 5FO2A 1Q9LB 4CVXA 5I66A 3NABH 1MRFH 2P43B 4DWHA 2YD3A 1YPZA 2HJLB 5CP3H 4HHAB 4Q56A 2Q8BL 5JDSB 5EN2A 3UYRL 4ZAKA 2NZIA 2IFFH 5EZOL 1ZVHA 4FQQB 5B1AB 4JPQA 2X42A 3STZB 1ZXKA 4PTUB 4XNZB 2QKIB 4PRHB 1I8UA 5FYJL 5IHZB 1HNGA 2BVOA 1IBHA 1GR7A 1SHSA 2EUWA 4O2FA 3OQRA 2WZ6A 4X99A 1CPUA 4JZJC 1V3LA 5DQJA 2NCEA 5HJDA 2JB5H 5IVXF 4E36A 1BBDH 3HB3B 4UQ3B 1J5HA 4MAUL 1DL7L 2JF1A 1UB6B 1DQMH 4IJTA 3E8VA 1AP2A 5FM8A 5CILL 1GY1A 1JDCA 3RRQA 5I1KH 2XVGA 5I76B 3DC0A 5I30H 3IYLW 2NW2B 1GS7A 5F0LB 4YSCA 1AXTL 3D4ZA 1UD5A 1WAAF 2NQ3A 1RZFH 4KRNA 3I75A 3W0WE 1ZHNA 4OUUB 1IKFL 4P46D 4MFHA 3LJ3A 4KZDH 1XQ4A 1YG9A 4X8JA 3CXHK 4JG0H 4OV6F 2AVGA 4JFWA 1OSZA 4BFIB 2C3WA 3U1QA 5JOPE 4LP8A 5DHVH 5JMRA 1GHFL 3GSXA 4U3XA 2J8UE 2C1PA 3L16A 4PJ8B 3TV3L 3UTSE 2KLSA 1ZLSH 1NGXA 1F2QA 4UILL 3SDAB 4C56D 2AK4A 2NUTB 3QI9C 1PY0A 2IQAA 5D70L 4B9PA 1Z5YD 3PWVB 1RZGB 1OAQL 3QHFH 4FFVD 3JYCA 2ZCZA 2ESVE 4O02B 2C7UA 3HAEH 4UOW1 4L8CA 1PLGH 3PDGA 3WNOA 3L4YA 3QEQE 1IZKA 2R15A 1WA0X 3L08A 5IEHB 4Z8FL 3WE6A 3S5LG 1H5BB 4WFGE 4PP1D 3TA3D 4MNHB 1D7DA 5EBMA 1NC4A 4JL2A 5ECGA 5D96C 5L8KB 2PO6C 5DJ8A 4M93B 3FQRB 3VFUB 2P7TA 1SY6L 2NUPA 3GPEA 3S4SA 3RFRA 1SN0A 1DEDA 4L0PB 4LNRB 2Q1EA 4YX2H 4NQCD 2UZIL 3VGAB 3V4UL 5CN1A 5A40E 5TK2A 4JFYB 2DQTL 1O7DC 3D3VA 2B1AH 3GMNB 5DD1H 1G7PB 1OT4A 2VDKB 5F3BB 4CMHB 4GW4A 3NBNA 1YN6B 1UWEL 3FHEA 3IPEA 1BYNA 1JZFA 1MCCA 2V8MA 2DQCH 4GRLD 5C07A 4FG2A 5CGTA 1F1AA 4M7KL 4WWKA 3TXAA 2OK0L 2HFGH 1SOXA 4HJ0C 4P9ML 3F7VB 4K9EH 1M1XB 1CFNB 1JYVA 1CIUA 1D5IH 4JHVA 3TVMA 2NY1C 2WXNA 3UG4A 3ML9A 5CR1A 2QQLL 2D7PA 3GGWB 4OLZH 3FH5A 3MU3A 3VD5A 4AMXA 3DETC 3HE6C 2JSFA 1X9UA 3II1A 2FATL 4ODSH 3T65B 5T3XE 3QB7C 2NY4C 1J1XH 3PAZA 4QRPA 2R56L 5I5MA 4XWGH 4WW2C 5FA4A 3MRKA 4MJHA 5JIMA 4OCSH 5EDSA 1NFDE 3BFWA 4N3UA 2CKBL 4CGUB 3LRGA 1CMOA 1YNLH 3ZHNA 4FQXC 1Z9SB 3ZSTA 5EU7C 3TYGL 2EC8A 5KVGH 2FGWH 3BVVA 4R5TA 5HVWA 1R3LB 2A0LC 4JFEA 4LSVL 5EU6D 4C4KT 4EOWL 5C0RL 2J12B 1O75A 3DV4B 3G7TA 3RU8L 5FOBB 1UCBL 2WLIB 3DTXB 4KTEH 5LN4A 3L17A 5DVLA 1S7XA 5HYJD 4A39A 1DO5A 3HN5A 5BXFB 4N0UE 1D5ZB 4ODTH 4JFHD 5JHBA 4PS4H 1T0OA 1QA9B 3IDMA 5GS2H 2K4WA 2APTA 1VZIA 2DJMA 5TDNA 3M8OH 5TE7H 4WKZA 4MJ5A 4MQXD 3VX0A 1JZ7A 2OL3B 3LYRA 5JOFB 4OF3A 3ZZ1A 5CWSA 5T33H 3TJHC 1PZAA 3WXVH 1NCAH 4YR6B 3B7TA 3OGCA 5D1ZD 1VHPA 1XF3A 3K4DA 4KNSA 5K93A 3KVDD 4J3OD 4DUXA 2DLTA 1IGCL 3ES6B 2YRLA 4PGDB 4QRAA 5ISZA 5J89A 4HGWA 2KERA 5JW5A 2FO8A 2VDLH 2Z8RA 2H3KA 3HG5A 7CGTA 1NJ9A 4HWEL 5FB8B 2K9FB 4HPHA 2EIDA 3S2AA 4GAJL 3P2BA 1OWRM 4MCYB 4OFIA 4FNTA 4CSTA 4TLKA 2J2ZA 1D9KD 4OGQC 4F33B 2HMIC 3MZTA 2VJ0A 1AE6H 2COVD 2PTVA 4HMDA 4AQEA 2H2SC 1DUZB 4XXCC 1VIWA 5HY9B 2Y69B 1CDIA 2H6PA 1HXKA 3ALPA 2IWKA 1U3HB 2QEJA 2NY7L 4HETA 5FGCE 3ZMRA 3L1FA 3DMMC 3CVCA 4IRJB 1LO2L 1E4JA 4HOZA 1UHVA 4XE5B 3ZL4L 1QFWI 2E8ZA 1PJ9A 4MX7B 3PWNA 5GGTH 3KWVA 3HUJE 1Y18B 3BD5A 4KTGA 4AMKL 4FOMA 5E4OA 3NDYE 3TH4T 4EXPX 4Z7IA 4NKOB 4TS6A 1PLBA 4ZDHA 1ORSA 1JRHI 2D7TH 4FZ8H 1PSKH 3QPXH 4EJ1C 4U1MB 2FEDD 3F62A 3E6HB 3DVNB 3GEWB 4XP9H 4EVNB 3MX0A 2VLKA 2WZPD 2RFXA 1DVYA 4FQJH 2BIQA 3F12B 4CJ0A 4WFHE 3T6VA 3ULAB 5FO9A 5E6IA 3D4YA 5IB3A 1EJOH 4YHZL 4AEIH 2HKFL 5D1XE 3ZL1A 4LKXA 1AQKH 3GMPA 3QIUD 5D4HA 5FYJU 3H9HB 1E9PB 1YEGL 5F7BA 5J13B 1TFPA 3KCWA 5IESL 4OM0L 4FNLH 4S0TD 1KEMH 1ERNA 3IK2A 3TZVC 3AU1B 1F00I 4JVUA 4TF4A 1EO5A 1AZRA 1V27A 4AEFA 3EJUA 4Z3GA 2DJSA 3C87A 1NWPA 3DGDA 2QR0B 4OT1H 1XF1A 4OVVA 3FONA 5LQBH 2HSIA 3OMNB 5JIDA 2NXYD 2PYED 1DVFC 2D8KA 4N8VG 3T9WA 4PCKA 3VFSA 2M1KA 4MD4B 2PXYD 4HJTA 3K6SA 3NFPB 4LVEA 2AJXH 1IGMH 2YSTA 3PL6A 5F9WB 3KH3A 3P02A 5K9KB 1D3CA 3LRSB 4JQIH 1KCLA 3I9GH 3LEYH 3SDXE 1QNIA 1KPRB 4ERSL 2HFEB 2RJMA 1U0QA 3C5ZB 2Y07H 2VSDA 3SIKA 2SODB 3AFLA 3ARFB 1AMYA 3VFMB 4DP2X 4DP9X 1UM4H 3Q8EA 1ZA3A 4KJWD 4G7SB 1AY1H 1SM3H 1IU1A 2CMRH 5IVXA 3ZQXA 4HUWA 4G8IA 1CFMA 4IBTA 2KLTA 2H41A 4R7VA 1QSFD 1T4WA 1KELL 3UC0L 2AEQL 5ERWA 3VTMA 1F90H 4WO0A 2UWEE 3BISA 1I7RA 3SD5A 2IH3A 2ZXBA 4ZQKA 1BLIA 5CKGA 4JFZH 4U4BA 1G7HB 3MYJA 4KITB 1I9JL 1WAAA 4K7PL 3KPMB 3O45A 1RJLB 2LAAA 2ADJA 1U4FA 1KYOJ 1TQVA 5I1DB 2DN7A 3KPQB 2GUOB 5DJAA 2DW5A 2CXGA 4X4XA 5H4ZA 5JTWA 1O5DT 1T22B 5HDWA 2A6JA 1CXKA 4U0RC 2C34A 4W9FC 4XVTL 4D8PA 4NUGH 5KSBF 4UF7C 1TJMA 3CU1A 1R5VB 3CXFA 3BRFA 5KVEE 3OAWA 1N0LA 4DGWC 3F04A 5JO5A 3X1BA 4BFRA 5INDA 2P47B 3MV8E 3E3QE 5D5ME 1W80A 2XNAA 5CNHA 3LKOA 4FQPA 1QPKA 4UDUB 4GEIA 5DDHA 4BCZA 2Z92A 5I28A 1O9WA 1ILUA 4L5FE 1WG3A 1FORH 2MOGA 5JHLA 3LN9A 1U4EA 5T1MB 2MQGA 3A6BH 1MNUH 2LAGB 4TNEA 4O51B 1OB1A 1BEYH 1HL8A 3V8OA 1OKEA 5C7XL 3V2AR 1C5BL 1ACYL 2GAZA 1ES0A 1OWWA 2VAJA 1C08B 4QI3A 5KYUB 1OXYA 3HRZC 1HXYA 4GLRI 4ZRGA 2X2YA 4F7MB 3TEUA 1GGBH 2V5YA 4BJLA 3QDHA 3NAAH 4Z7UA 5L6YL 3FQYA 4GP5B 2YXWA 4Y4FB 5CP3A 3FOMB 3IU4H 4S0HA 4EDWL 3GBML 5EZLB 2VDPH 3T2QA 3EJRA 4GRWB 4GW1A 4KK5D 4I0CC 3EH1A 3MBXH 5AEAA 2Y4SA 2GHWB 4L5FH 1R19A 1SJVA 3LKRB 1TVDA 3P3SA 5DJCA 2X4QB 1QEWA 1W0WA 3BIAX 2W65A 5HBBA 1BZEA 1RHHB 4L1DA 2CO1A 1U58B 5CAYB 2OXGB 1Y6MR 3DVIA 4XO5A 3ABKB 2QKIC 2AW2A 4ZFQA 1BQHA 3N1PC 2CR3A 3FB8A 3ULSA 4F7CB 25C8L 3MRIB 3F6IA 3QCVH 4FG6C 4KXDA 3VRLE 2HVJA 4FG4A 4XPTL 1G0DA 3L9BA 4HLZG 1I7TB 4G1EA 3HB3C 2DKSA 4IU2A 1ZLWK 6TAAA 1G9MC 3IDXH 4JHUA 3B4NA 1DBKL 3V5KA 4HS6B 4BKLB 1G7QA 4N9GB 4J3TA 1EZLA 4WFED 1IGYB 4YLCA 5LGHL 1KCRH 1BW8A 4F2ME 1KLUA 4XZUB 5IV2A 1MHHB 4RZCA 3ZBMA 5DHVA 4FNQA 3RGVD 2JIXA 5HVFB 2OXHA 3MCG1 3QXUA 4WHTA 4I4WB 5EUOB 1URIA 1IBBA 3D69A 3ESUF 1NTDA 1RD6A 4NP9A 4PJ8C 3C60A 4KUZL 4ODXA 3HAEA 3TONA 1ITBB 1SBSH 3D05A 3SDAC 1VZGA 2I25N 4XNMA 4Y89A 2HWZH 3DX0A 1PZBA 4ZUWA 4Y1AE 4JPSA 4Y4KD 3I02A 2OFQA 4LL9A 2OZ4H 3RL1B 5CFAA 1IEAA 2ATKB 4FLHA 2WQWA 4E9YA 5CHNA 5KYYA 5HHQB 3AG1B 1H5BC 2AXFA 4KWUA 3MV9A 3OR6B 3HHRB 5CUSH 3UTSA 5LDUA 1HN1A 4DGIH 1XF2A 4M93C 5KW9H 2YSSB 4JPIA 3BSZH 1ID5I 2XG5B 1JERA 4KGJA 2I24N 1U30A 4XOEA 3VGAC 4S1QL 3NEXA 1CFVH 3TN0B 4BFEA 5DTFB 1NEZB 4E42B 5IF0B 1SRDA 3QW9A 5DEZA 4LAQH 2ZCLL 5E00A 4XP6H 1JGEB 4KKCD 3U4KA 1QZ1A 3PREA 3EBIA 2IVFC 3LY6A 4LRIC 3N43B 4CMHC 4YHML 5J3HD 1XR9B 4PWIA 2DDQL 3FQWB 1E4XH 3VCLA 2AI0L 1SDYA 4NI3A 3ULUD 4MZ3A 5GRUH 3RWEA 2A9NH 4HJJL 1PG7L 4AT6A 2V7HB 4PJHE 5HDBF 3TCTA 5T1KD 4N2HA 4YIQB 1KNOB 2TSBA 1DQDL 5C0AE 4HLJA 4WQOA 4YHNA 4GQPH 1TUPA 2ZX6A 2XT1B 1A6ZA 3CTTA 1J48A 2NQDA 1OSYA 1EJ8A 3RPIA 5JA9A 4HIHA 4AK1A 3BSGA 1CO1A 32C2B 3DECA 2PABA 4AL8H 3TOPA 4UQDA 1PCXA 1SXSA 2EIZB 1HK6A 4WNQA 4AW7A 1OIOA 2NYZA 1MW2A 2GJ6A 3A47A 3O3DB 1A7OL 3QPKA 5EDXA 3QA3A 1A1NB 1U8MA 1F8TH 4HJEA 5DRZB 2D9CA 5GGVH 3DJTA 1W8OA 3KEDA 3GBLA 2DYPB 2PCYA 3ZZLA 3CZJA 1BP3B 3V5HB 4S1SL 3VD4A 5LBVA 2IC2A 3B8YA 3MNVA 3QRFM 3WNNA 2NY2D 1HEZA 2YEZA 4M43H 3THML 3TEZA 1FG2A 4UINH 3TBWB 1HAWA 1MW1A 4TLTA 5B8CB 1TETL 3SOBH 4AX3A 4J3VA 3IFNH 1N59B 3LN4B 4HF5H 5LB1A 3H9SE 4MMYB 1ONQA 2R1XA 4LQ1A 4H8PA 4NO2A 3GK8H 1TZHA 1I82A 3KVPA 4JCMA 1KTDB 4KKQA 4UYPA 3C08H 4F7TA 4IYKA 4GSDL 1KJMB 3IMSA 1IC5L 1IAMA 1IT9L 1LL1A 3IFOB 3MBEA 3OG4B 4G8EB 4GKNB 1LQBC 2QV4A 4CC4A 2V2TA 1E8ZA 1JWUA 1O6VA 3PNWB 5TDOA 1M6UA 3WKMH 4U6TA 1TVBB 3MRCB 4BK5A 2JFCA 1DEEA 1I9RH 4HT1H 5FYLH 2Z4QA 1XD0A 3PFUA 1L4IA 2P8LA 2CRIA 3R18A 3X13B 3NZUA 3AUVA 2F0CA 1QAWA 3GDCA 3HKZA 4HAGA 2EDTA 5KVMC 4G5ZL 5HGGS 1KJ2B 2WMPA 3WHE0 3JVGC 4PSRA 5AW4B 2IG2L 2K6YA 4QY8B 1U3HC 3B6SB 4S0SD 3SZKC 5CEZE 3CXHJ 3R06A 2Z8SA 2R29L 1P7KB 3GNML 3NFSH 4IRJC 5BZXA 3VI4E 5B22A 3CSYA 5GGTA 3T2OA 1X44A 3LH2L 3CDZA 3NESA 3ZR6A 4A6YB 5FR3A 1XBDA 5BS0A 3I9PA 2WVVB 3DX6B 2R2BA 2V3FA 1I9IL 4PU2A 5KSBA 3T5WA 3PUCA 3KW7A 5AALA 3UBXA 4E9SA 3Q2VA 1S9YA 1E3XA 3ILQC 4Q58C 4Z9KB 3V6FA 2AJSL 1UUSA 4U6VH 1LP9E 2K3HA 4UQEA 4E41A 3HC4L 1FJ1A 5C0JA 4N5UA 4Z78B 1BFOA 3F6JA 5CEYA 4Y4HD 4XPHH 3SGEI 3DSNB 3ELAT 8FABA 2F7OA 2HRLA 1FNGB 3EG9B 2D4FA 3OVUB 4QTIH 1HINH 3NGBB 1XH2A 3WL9A 4MNQA 5CGMA 4P3CL 5DQDL 4NKDA 1LMIA 4XC1H 1UVQA 3ROLA 2MOVA 3C6LD 5ID1A 1E4HA 2ZG1A 5IW6B 3HUJA 4JRXE 4J7RA 2WKOF 1A02N 4NLHA 4OD3H 5DVPA 3RTQA 3WIHH 5BRPA 4L2LA 5J13C 3NCJH 2YMXH 5H35A 5E2UH 1CD1A 4JKWA 4V2CB 3V0HA 4HPYL 2IPTL 1WDAA 4BKTC 1CDUA 2GFBA 3FOLA 5HDQL 3KWWB 1S5IL 3IDYB 4J12A 2R2HB 3ZXAC 1DZ0A 4TL4A 2JB6B 1A2YB 3T4YA 1CURA 4D0CA 1AC0A 4X6CE 2M2DA 4JQIA 5I0YA 3D9AL 1L9RA 2DLHA 5CJXC 5F9WC 3RAJL 2CRYA 2HPOA 1PG7X 3UZQB 2JE8A 4LSQH 5CZVH 2X89D 1RP9A 4H13C 5T1LA 2CM6A 3DX3A 3C5ZC 2NW3B 4OTXL 4XMKH 3ARDA 5EBWB 1I4FB 3ARFC 5G5DA 4D7PA 4YK4B 1JMXA 3OAZH 3CH1B 3GKZA 4FNPA 1CI3M 4GI9A 4MXQD 5E6YA 1QFWM 1VPOL 5D4QA 2ZG2A 4NUJA 1VRSA 1WE5A 4ELMB 2DL9A 4F8NA 2WQAA 3BYTA 1E9OA 1UD8A 4IMKC 3ZUCA 3WNMA 1SF3A 4XCYA 1ZT4A 3SDXA 4K7FA 3Q01A 3ZDZB 4YMPA 3IT8D 3GBNH 4UTBL 3CZFA 2OA9A 5IJVB 3NSCA 4NHUA 2P5WA 4IRZH 4KX9A 3FBQA 1AKJA 4BK8A 1CCZA 5DJ0B 3SKNA 1QQDB 3VGDA 5I15L 4ZS7H 4LCIL 4P05A 2EUXA 1J5OL 2ZXCA 3QUGA 3OKMB 1BSIA 2XXCB 2WD0A 2R8SH 4L3EA 2WWKO 3WIAA 4P0DA 1BQLL 5BUPA 1MZZA 2UWEA 3X1FA 4WWNA 4AEHL 2CHXA 1FNSH 2E4FA 1V7NL 3VGEA 4P5RA 1EMTL 4JRYA 2AZUA 4N2NA 4QRTA 4BUGA 4UV4H 1AD0B 1CXEA 1QBBA 3ARED 1AO7E 3NRPA 4YXHH 1FNLA 4ETQA 3VD3A 1JN6B 4ZXBB 1E90A 1ZDQA 4NN6B 1T5XB 4Y19B 2HFFA 4X2UA 5EOCJ 1FNEB 4KK6D 2GJZA 3PJLA 5E4IA 3QO0B 1Q1JL 4N2FA 4HKXB 5FK9B 5HD8C 1U42A 4LCUA 1UWGH 1CXIA 3LKSB 6CGTA 1P4IH 3T6XA 1XF4B 4X0KA 5FO7B 4N5ED 4DAGH 5MENB 2XX1A 5LBGA 4NKIL 4K3DH 3LS4L 3RTLA 3MV8A 1W72B 5ADPH 3FPYA 1E3FA 4XVSH 3QR2A 3B2PA 3CFJB 3WUZA 2J6WA 5AKVA 4GQ9L 2DWEB 4G6JL 2A9AA 1B9KA 3NCEB 3FO9B 3MREA 1AGCB 1OGAD 4Y4FC 2H8PB 3QULB 2FUQA 4AV0A 1A5FH 4JLRB 3ZDYF 3KDPB 5CJOH 4QOKD 1TZIA 1EWHA 1CDJA 1N67A 1QKZH 4HDIB 2E4TA 1HL4A 5EC2A 1FP5A 3ZGHA 3RGBA 3EOBB 1A4KA 3DWTA 2NTFA 5A2IH 2ITFA 1BEXA 3CDFA 4LSUH 3VJ6B 1HHGB 5K9JH 1FZOB 2WLZA 4ZUUB 2C1OA 1MHPL 1DSFH 5IQ7H 3CSGA 2XTLA 3JXAA 3DRTA 4L1BA 3MNMA 2F9BT 1HH9A 2OTUA 4N2MA 3EHBB 4J3BA 4G9FA 3RQ3A 4R26L 1NM4A 3FO2A 5E6SB 3RI5K 3SE8L 4JHWL 4I0PA 4AE0A 4Z3FA 4FZEL 4R2GD 5I23A 1CICA 2F54E 4JKKA 2APXA 4OB5L 2P8PB 3T6ZA 4OLWH 4HS3B 4HC1L 2HVKB 3B9KA 3BAXA 5C09B 1HHHB 1QBLH 4XTRC 3FRUB 3V6OC 5EOCH 4BWTA 4I9WD 3BO8A 3O9WD 3KJ6L 5EU5B 1SFHA 2WGNB 1QSVA 4QXGH 5IHUL 1NH6A 3GUFA 4P3DB 1C9SA 5CXPA 3QEGL 2Y25A 3LB6D 5BPPA 3US1A 4WTQA 6PCYA 3CNKA 4MSWA 3K2IA 3W57A 3FO0L 4HMEA 1P7BA 3X1NA 2OZ4A 3DXAB 4X8GA 1PQZB 4BQBA 1NMCB 4JO2H 1KIPB 1N8ZA 2IGFH 4OGXL 2EDMA 5D7IF 3KR3L 1NEUA 2ZUTA 3UDWC 1INDL 2NNAA 4P4RB 2BWIA 1FVCA 2AFNA 2DH2A 4C83A 3QFGA 4H26B 1UM5L 4GUOA 2CBQA 2JQMA 4QO1A 2FR4A 1PZ5B 1HSAB 2WTRB 2YD6A 3BE1L 3BSZA 5DEFA 5CZKA 3RWFA 5IROD 3WS6C 1QLRA 4NO3A 3GJEB 1EFXD 3REVA 4NM8L 2CR0A 5AUMA 3L5XH 3GUTB 3HFFA 4I3GA 5JIQA 4QJ3B 3GT6A 5FW6A 5FWRA 3K74B 5J12B 2ERJB 1OAXH 4NM4L 1XIWD 2VDRB 5EF0A 2GG1A 4M7JH 3VFRA 4MNGA 3TN0C 4Y9GA 1XGRB 4MJ4A 5LBSH 5JHDD 5D1ZB 1J9CT 5LAXA 2VQTA 4JEGB 1U3NA 3PJSA 4U1LB 5FA3A 4FP8L 3S3BB 4UM9A 5HI4D 3MLXH 3O4LE 1JWSB 1FFNB 1D6VH 3Q2CA 3VFVB 1IFRA 1TZAA 2X7LB 3KPPA 3Q3GB 1IKOP 2YJLA 5K59F 3TESA 2MQCA 1NBYB 4JDVB 2Z31A 1SJEB 1U95B 4C47A 4ZTPH 2ENQA 2XZQH 4NFCA 5I26A 1YYML 3KYMB 4QTHB 4AQ8C 1KJ3L 3FU8A 3OJDA 1SJXA 1COBA 1K72A 4HOMA 4FFYL 1UZ8B 5MEQA 4ZI8A 5H8DA 4LDLB 1CFTA 1KYDA 4YHKH 1KLFB 3QJSB 2XG4A 4UT9L 4JO4H 5C0ND 1NFKA 2IGTA 3GXPA 3BHBA 3RIKA 3WLBB 4Q14A 4A7GA 3P54A 5C08B 5J6GB 1U8IB 3RDTB 1EVUA 2AJUL 4KC3B 5EHFA 2X0VA 4BA0A 1YNTF 1MH5B 4D8OA 4BQCA 1KV3A 5FW7A 4Y5YA 3D39E 1NUDA 3VXUD 2E86A 4F58H 1RIUH 3L3IA 5ESVB 3B7SA 3D4GA 3QZWG 4K5MA 2X4OB 1R24A 3SE4A 3B3IB 1I1FB 2AJ3A 4G9DA 3INUH 5FYKE 1BZ7B 1JXDA 2VXSL 4JN1L 4XHJD 2FSDA 2N3JA 2O5ZH 1GGCH 1P7QD 4JJ5A 3VD9A 1KN4L 1TLKA 5EO9A 3I85A 3VWKB 4XNXH 1GYWA 4ZYKA 1EZVX 3IWUA 3SKMB 3DVGA 2CLZB 5B8CC 2EIEA 1QRNB 4X6DE 4FX5A 4M8QA 1Q9WB 2DQJH 2VABB 3S37L 3LOWA 1YSOA 1XMEB 1I8IB 2YC1A 5BOPA 3BT2H 3KPSE 4MJ6B 5T3ZH 2OMYB 3QWQB 4TVPE 4X0NA 1J1OL 3SQRA 4PWFA 1EAPA 2BRQA 2YAEA 1JCKA 1J8SA 3MRMA 4IGBD 4XPAL 5MERA 2AAVA 3JTTB 5D7SH 1Z9NA 4BRVA 1EEZA 4PS3A 1UWXK 3PV7A 4AGLA 5GGQH 1J0JA 2CIIB 2RIKA 4HAKA 1QG3A 2CNZA 3JV6B 4MAZA 1IM9B 4V1DD 1SXNA 3H9ZA 7TAAA 5E51A 1AGEA 3HHSA 2B0SH 3BVTA 3IDJA 2E27H 4LLYB 4P5TD 1N5AA 2CO6B 3IE4A 2B7DT 5CIPH 4UM8A 4B9CA 3FRPG 3PXHA 3ZKND 1ETB1 3TBSA 3H4FA 1H0DA 1Y0LB 5EIIB 1ZT7A 1ZTXL 2HJKA 1A7NL 4P2RA 4R8WH 1HE8A 4TVPH 1U8CA 1A21A 3O6LL 3IJEA 2HLAA 2GW5A 1C7TA 1WFIA 4OJFH 4PJ7F 5IHHA 3ZE0F 1HH6B 4N8PA 1E5BA 1PG7W 4HPOH 3EF4A 3L3KA 3DIFB 5L8LB 4GAYA 3X12B 4K8RL 3LQZB 1WZ1L 3HG1E 3PWJB 4I5BA 5HHMD 5MI0B 3U82B 2ZP0T 5M95B 5BV7H 3WFEL 2X1OA 2PW1B 4ZX6A 4A2HA 4YZFE 4YPJA 4MRBA 3NGBC 3CN2A 4RFEB 4S2SA 4PW4A 3KPRE 3WIHA 3VVVA 1MDTA 1A4JA 3BWZA 4WWID 4L4VD 1NGPH 3EYUH 4WAFA 4BCXA 3FQ1A 4PJDE 2AJYL 4U1JB 3OMIB 1G4MA 4X8XA 3ISYA 4GXVL 1KB5L 4NZJA 4APQD 2DWSA 2C9AA 4OZHB 5ETUB 1FCCA 1JJUA 1NC2B 3R4RA 3DBXA 3BPLB 5IVNA 2XTJD 1NCBL 4GG6B 3IDYC 4UBDC 3ARGB 1J05A 1LQSR 3ARBB 4JFFB 3MRQA 3AWFA 3T77B 4QGTA 3W82A 1J10A 1QYGL 2GHZA 2ZX5A 1OANA 5JIPA 4GQZA 4JRXA 4P2QD 5T5FH 4GUQA 3WFBH 5E0QA 2ZD0A 1KIQA 2BRRL 1Q0XH 1IC7H 4UQBA 4PRID 2X6BA 5DRWA 3FTGA 4OFQA 5D1ZI 2OMVB 4D9LL 2GT9B 1QABA 3GSVA 3BD3A 3JT2A 2P5ED 4BQ9A 1E65A 2PCXA 4QXVA 3UZEC 5CJQL 4YK4C 3UTTE 2B59B 1FL6B 2NT1A 4X6CA 4AQOA 4ZNEE 3EYSH 3QXTA 1WICA 1M7IB 1NSNH 1WAPA 4R6UA 3LKPB 3TO4A 1Z6JT 1CGSH 5I1EH 2BVQB 1U8NA 4RA3A 4H20L 5CLXA 4PJBB 3SHSA 3H2PA 4RMUA 5L2KA 1JXFA 3RWDB 4PJEB 5B4MD 1ZLVK 5DMGC 4KK8C 2MTPA 1WBXB 5LNEA 2IANE 2IOOA 3VXSE 5ICZB 2NX5E 2B8OT 4MD0A 1YLBB 1OGTB 4BFKA 4PB0L 1GZHC 1S7VB 4AOFA 3GD1C 1BZ9A 4MYWB 1HHJA 4P5MA 4ZODA 1OP3H 3MLPA 5C0EA 1E4KA 2I69A 3UPRB 3ESOA 3LQMA 1QUNB 5I2IA 1BMZA 2FT6A 4NRZB 1TCRB 2ZUXA 3ETBJ 4HFWB 4GIPD 3W38A 4X6FB 3LZLA 4RGOH 1MJ8H 2Y5TB 1C5CH 3EDEA 3Q5YA 1M53A 2B9AA 4NN6C 4ZXBC 3S37X 2VRAA 4H0GA 3V0EA 3KD4A 4J6RL 1PNCA 4PJAE 1G0XA 3Q5TA 2XN9E 3OPUA 4QF1A 3KNBA 4QXTA 3COOA 2JK5B 4ANXA 3C5JA 5F7FA 2OCFD 5AKRA 3RWGA 4ATWA 1T1ZB 4JG5A 4E2OA 3VQMA 5FPIA 1W8NA 3CMGA 1AO7A 2BNUA 2ZNWA 3BKJH 4XVJL 2W9LA 3DX9B 2WB7A 2L3BA 1CS6A 1UZGA 3NPZB 4XPGH 3T3MF 3VDAA 4B0MM 1JPST 3SPCA 3CMOL 2XKNA 5E8NA 1XXFC 4PTTA 2O30A 4GRMA 4U2YA 4F24A 5E03A 43CAA 1A4BA 6FABL 5MP6L 2B16A 4P07A 3IGAA 4U4IA 2TRHA 1F3RB 1GRWA 3FB6B 3OXSA 4WKXA 1E6JH 3G5VA 3VAEA 2BSBA 3HZMB 5I1LA 5JLZA 4DKDC 4B60A 4I7ZC 1ZS8B 1I3RB 1YMMB 4NDMB 2CH8A 2UV3A 3BUYB 1I8MB 3WHXA 4LGRB 4KPHL 3U0TB 3EHBC 3K46A 4G5AA 2EQDA 2XZCH 1A8ZA 4ABQA 2VAAA 2EAEA 4ZFOB 2EDDA 5CCKL 1RUML 4EI5B 4WY7H 2B4CH 4LK4A 3OWRA 3QUML 3FHQA 5T1KB 4M7LT 5K9OA 2ZUWA 1KGCE 1YNTA 5CP7A 3L81A 3RX8A 1UKQA 5TE6H 1MSPA 4QWWD 2H9GA 2OJ1A 2F8VA 3G08A 2H0FA 4XMUA 1I1AB 3KXFB 1TZGL 2X9XA 1SNRA 3K2UL 4BWWA 1JGDB 2MH4A 5GGVY 4W4NA 12E8L 2BNQD 3MRFB 3GZQA 3MLSH 4XPBH 5INCB 4G3YH 3S3DB 3QUMB 1L9QA 4HV8A 4HZAA 3TBCA 3ZKQD 5KEZA 1RZJH 4P4KD 4C58B 2IOMA 1L7TL 3QUXD 1N6QL 2Z4TA 2PWFA 2F54A 15C8L 3N42B 5HYFA 1A1MB 1PX8A 1S7QB 2X3AA 4H44C 1NMCC 2CLVA 4ELDA 1NGZB 2FIKB 4Z7VF 3MACH 1PKOA 1S9XB 5I1JH 1CI5A 1U93A 4L8SB 5D8JH 4L1TA 1R3HA 1NBZA 2VLJE 5D2NA 1CLYH 1YJDL 3QQXA 3MV7E 4M62L 5D55A 1QBAA 1HI6A 5E6RB 2ZG3A 2FT8A 4JPWL 2P26A 3MGTA 3ZTJH 4Y1SA 3K5SA 1DJXA 1KC5H 4FA7B 4ODBD 3S4SG 3JQOB 3GO1H 5LBSA 3QQ3B 4MVBD 5L88L 5J12C 2ERJC 1QHQA 1RIHL 3OBAA 5IGXH 5DC2A 4WI0B 3MRBA 1MAKA 1ZK5A 3VWJA 4ZMOA 1WAEA 5EO1A 2NY0B 1B2WH 5DMKB 5HGAB 5J4MA 4KRMB 2PYFB 2YD0A 3N40F 3QDMB 1X5GA 2CSPA 5D1ZC 5CLWA 2MQ3A 2H26B 5IOPA 4JHAH 3MR9A 1TZOA 3WN5B 2WIMA 4JM4L 4PBVC 1OAJA 4Q89A 2AXJA 3U83A 3QUZA 5DUML 4PJFB 4FTVE 5E9DA 5F0MB 2OMZB 3KLHC 5KOVC 2Q9OA 4GOSA 3UAEA 4GUPB 1A6VH 3SBPA 3MRNB 1KDJA 4GMTH 4OI9A 2PETA 3WJJC 4PJ7A 3FT2A 1KIRB 4NO0A 1OGPA 3WJLA 1HCFX 1UA6L 3GXFA 4XXWA 4E9WA 2D3LA 4LSSL 1R46A 1W16A 3O6FB 1UQSB 3EZ8A 3BQVA 3ZL2A 1BBDL 5C1MB 3RDTC 4NQXA 2A38A 3PGCB 5DWPA 1KTBA 3ETBF 1DQKA 4D9QE 5I1KL 3C9NA 1NMBH 4XNQA 2QGBA 1U8PA 4R3SB 2A9CA 1KY6A 4HK3J 1B0GB 4PLKD 1UG9A 2Y6TE 3QDGE 4Q6IA 3CHQA 3IDNB 4LCYA 2Y0SA 3BWAA 1MLCB 2FYYA 3EFDL 3NSYA 3WFDH 2GTWA 4OV5A 2HJFB 1XFPA 3C75A 1KCSH 1WZAA 3O6ML 4QXUH 4Y16D 4CVZA 1LNUB 2DF3A 4IOFD 4LDCA 3ARRA 4NC1C 3SO3B 5CEXB 3BP6B 3S36L 3V5DB 3VWKC 4AJVA 4P2CG 1EO8H 4DHLA 5E1IA 1SDDA 3ZYIA 3LKQA 5EOQL 4HZ1A 1KCUH 2X2IA 4RMSA 4HSQA 5IVOA 3ML8A 1DLFL 3DOSA 2ZJSH 3D7PA 2VR9A 5I16B 3P9WB 3OKEB 2B5IB 4YL9A 2OJEA 3BKCL 4DEWA 2I9LA 3X2QB 3A67L 1UJTA 5AZ2H 1GOHA 2H2PC 4YPGA 2X1PA 1TENA 2W9EH 5GISL 2CU9A 3MA7A 3G5YB 1JHLL 5FKPB 1LYQA 4CILA 1HNFA 1M7DB 1YEIH 2CBMA 2I07A 4N8CL 4PM1A 4YX2L 5BRZA 2EXTA 4PRAB 1PX3A 4EKJA 1FAKT 4WU5B 4PG2C 3ZW3A 5CIPA 2AC0A 2B1AL 3QORA 4K5PA 5I1IL 1GSMA 1ZGLB 1FZKB 2AKRB 2ZWSA 3ESVF 1FL5A 1NPNA 2CRMA 1G0YR 4LHUB 4FD0A 2DQCL 1VEOA 2J8UB 4P23A 5KSUA 2NY6D 2ZAHA 4ENEC 5IWLC 3MGOB 1DVQA 1KY7A 2A83B 5FCSH 1PZDA 3FDWA 2CO4A 1I7ZB 4K9EL 3NSJA 4PJGF 4PD4J 4K3HA 3WCYA 1QI5A 4Y5XA 4QMEA 2ESVB 5AD0A 2O26U 1ZWIA 4LCWA 1IAII 3EGSB 4JFOA 2GK0A 2GITA 3QEQB 4MCMA 1FYTD 4NQSB 4PJ9A 4LCCA 2ICES 4XCEA 5J8OA 1NGYA 1DJYA 5JXEC 4WEEA 4NQEA 3RHWK 5MI0C 8CGTA 4RBPK 4ODSL 4PWKA 5I8EB 2FZ3B 1CBVL 3AQZA 1NAKL 3MCYA 2A6DA 1LO4H 2GBAA 1HZHL 3IFPB 2WWKT 4X4KA 4DP6X 4ZMLA 3KDMB 5IOKA 1ZDSA 4CDGC 1YNLL 4U1NA 1BREA 3Q1SL 1CGUA 2JKXA 2GUYA 3MV11 4NQDE 4Z0XB 4K8RC 2FGWL 5IQLA 3TCLB 3WNPA 1CD8A 3IJ8A 3F7PC 4L3AA 1I85A 2Q7YA 3QCUL 1GGIL 1T6BX 2ZWNA 3ZKMD 1UWFA 2OMXA 1EAOA 4XNYH 3SJVA 2X6VA 1WYJA 4JM2D 1N18A 3BPLC 2GKIA 4LIQH 1ZE3H 1ZK9A 4HH8A 3ARGC 5T5FA 4PS4L 3PCYA 2WVUA 5CMAB 2N7BA 2OKMA 4NAQA 5I6PA 4XNBA 5TE7L 1DQVA 5T3XL 3ARBC 3IAQA 2FEEL 2GC7C 4NCC1 1OV8A 3L1OL 4JDEB 4ZMPA 1F3JA 1FPTL 3ARTA 2CPUA 2MQ0A 1E5AA 2AXHA 4K2UH 4YHLH 1BD2A 3MI6A 1KG0A 1RU9H 1YY8A 4BH7A 4YHIB 4ZOBA 2UY7A 3WTUA 3LV3A 4YDZA 3UTQB 3ESNA 3DX8B 3KAAA 3BLPX 4I77L 5E8PA 4ZAKD 4HBCH 4Z7OB 1BPLB 3IS0X 3TTSA 5E2TL 3IDIA 1DQQA 3JWNE 3T6WA 5K69A 1M3JA 2EEXA 5E2JA 5AZUA 3CBRA 3TJEL 1NFDB 2ROXA 4PJIF 3VXMA 5I17A 4PH8A 1SOQA 1VFMA 2G4EA 3OAUH 1EGJH 4OIIH 4E5XB 1AE6L 3SGKC 1AI1H 1G94A 3NRQA 2P8MB 4IKIA 2Z9TA 4PS7A 4GSRA 3ELQA 2F5BL 1AZBA 3NJFA 1FVDA 5FDWB 5DUBA 1YHPA 5AFAA 4NPYB 1L3WA 2FO4A 2W0FA 4MXWH 1FVEA 3WEMA 1CL7H 3IETB 3SDYH 3UTTA 2VDOH 2Z64C 3GMLB 1SEBB 3REWB 5C8JA 2AAAA 3GHPA 4ZNEA 1HSBB 4GG8A 3VTTA 2BDNL 1ZEAL 2AXGB 4PEEA 5ABDE 4RFNB 1QEXA 1G5GA 1VGEH 2J44A 4I18A 3GSWB 3WLWD 4WTZA 5C6WH 5SWSA 1OTSC 4NEHB 3G9VA 3JZ7A 5ABZA 2D7TL 5E56A 5C9JA 1PSKL 5GS0L 3WNJA 3RURA 5FFLA 3FT4A 1O7DE 1FF5A 2ADIA 2AK4D 2F74B 2Z0UA 4XP9L 2WCPA 5HVHB 2IANA 3VXSA 4LBAA 4Z7VA 5IQMA 2OM5A 3WXWH 5JYMA 3FN3A 2Z93A 4JQVA 3FUJA 2X2UA 3IS1X 4YSOA 2JKTM 3PABA 1GZQB 2BJML 4Z3HA 2X87A 1QTPA 4HUKB 4P99A 4K55A 1WK0A 5F7WC 1MCIA 2HTLD 1RZ8A 5KAQF 1NC4D 2J6EH 1YEHH 1J9SA 3UZVA 4PV9A 2IADB 3E2HB 2KZBA 3S3CB 2WBWB 2CKNA 4LLWA 5EBLA 1TMCB 1WA1X 1IGJB 3DUUA 2CQVA 4H40A 3ZQ9A 4OCYH 5IG7A 2ZTBA 5K1JA 3UYOD 3D3VD 5EIQA 1EHLL 3EO1B 4Q9BA 1I9EA 4W9JC 2PPCA 2WPGA 5I1GH 3D8MA 1BVNT 1F4WH 1GAFH 4AG4H 1H9DA 3APCA 4HIJA 3K71B 4WWKD 5EU7E 2ZF8A 1U6AL 2R27A 3KMDA 1URLA 2WM0A 1FAIL 1XIWB 3KLSA 5C6TL 3O0RH 3QAQA 1JZEA 3PHQA 3VFWA 4POZD 4EUPB 1T80A 1BQHG 2VDMH 3QUHA 4RMRA 3TVMD 4M3JA 1AY1L 1L0PA 3OQ3B 5DJ2B 5F88B 1E28A 4P3WA 3IKCA 1U9KA 1XXDC 1T2XA 4L1LA 4WI8A 5D1XB 5SWZE 4GNKB 1F90L 3GMMA 4EI5C 2OTPA 4TSCH 5I75B 4YEEA 1P1ZA 3ZMEA 1ESOA 1QI3A 4QRPD 4RETB 3UTZA 1H3PH 1LJMA 3JTSB 3P4MB 4JFZL 4G6FD 2YGQA 3QEHA 4UIKH 1M3IA 5AVQB 1OOAA 2ZKHL 4P5KA 1I1AC 2YZ8A 3SO5A 3HG0A 3K6IA 2HRPL 4OW6A 2RR3A 3NA9H 4BINA 4F9LC 1YY9C 3CK0H 4JFED 4QNPF 4PGBB 3MNWA 4F7PA 2NXZB 4LARH 1EDHA 3BDBA 3GXUB 4TPRL 4XBEL 5BZWA 4E68A 4QRUB 1RVFH 1UADC 4WVRA 4HQQH 3MJ8A 3HAEG 2VSKB 2A6IA 1LO3L 4AC4A 4JCWA 2L7EA 3RKDD 4NP4H 3OHXA 3R4DA 3EOTH 2IALB 1HILA 1FH5L 1MHEB 5CSBA 4UZGA 3SYPA 3RVWD 2F08A 4HP5A 5B1JA 3NN8A 4X5PA 4XP1L 3RWHB 3VYPA 1FNAA 3K6NA 4L8SC 2BVPB 2VIRB 4HWUA 4WUUE 3T2NH 3A6BL 1MNUL 2CR6A 2LQRA 5HGHA 1GMIA 3GC3A 3UBFA 3VSUA 4FJ6A 3GSRB 3UYPB 3O6KL 5ISZD 5DWUH 1UATA 1R1CA 4DF9A 1OK8A 1VADA 2MRYA 3NFNB 3KGTA 4WI7A 3PDOB 1Z66A 3D48R 1SXCA 5DA4A 2AP2A 3LEXA 3IF1A 5KVEL 2YGOA 4UAHA 2OS7A 2X4NA 2W07A 2NY0C 2OTWA 4HCRH 2EYSA 3BPOB 1RKRA 1USZA 4XMTA 3IU4L 1NDMA 4YBQD 3WN5C 1VKXA 1M05B 3GMQA 2XWTB 1UACH 1ZIBA 4KKBC 2BY1A 3CBJB 2WLYA 4NSKB 4L5FL 4OLYH 3UJIL 2WNKA 5I0VA 4R7DB 2VJXA 4HUNB 1VAHA 2AQ3A 2YPLA 1RULH 3L8QA 3QEUB 1JZ5A 2J7LA 5C0IA 4OJAA 1VFBB 5D6DA 4OCWL 3DV6A 4Z7QB 2XCMC 3BAJA 1NIAA 2YBRB 1NLBL 4RIRA 3FCUB 5MEPA 3O6FC 1S7WA 4W9HC 5HHOA 1UZ6F 1MUJB 2BFGA 4HIIA 2VLKD 4WHYH 4X4YA 2VE6B 3RIAK 5AYUH 1F1DA 4XI5C 3U2IA 2AGJL 4YDMA 2Y1YA 4A7TA 2X9ZA 4KJQD 5E6ID 3KCPB 4Y88A 2EDEA 4OZIE 3QNZA 4L4TE 4F3FB 3BDXA 4IOIB 4H1LB 4N90E 4AYSA 4CN1A 4OLVH 4NRXB 4ZPVB 2GQHA 1BFVL 5LDSA 1QZNA 2IMMA 5C2BH 5IMMA 1D5XB 1DCEA 4QHUA 5JXAH 4RMTA 3DBSA 3WFHB 3OAYH 4ZMNA 3STLB 3CFMA 2AK1L 1JGVH 3SO3C 4M7ZB 5E5MA 5AYTA 5JUEH 3ABZA 5CD3B 4Y9FA 3IEAA 1X5FA 3M88A 4ZW7A 5TTRA 4MCZA 1MI5B 3QPQD 5EU4A 5KSAB 3EXLA 1PJWA 2VLRA 3PL6D 1JK8B 4X7TA 3FUIA 3QDJE 2B5IC 1V8HA 2VXTH 3LZRA 3S96A 2WK2A 2FH8A 5CUSL 5ALCH 4PP2B 3O3EB 5DD5H 5CINH 5DJYB 4IEFA 2CXKA 3VXRA 3M17B 1NFIA 1NIDA 4KFZC 1F1GA 4K3EH 3BH8A 4Z0BH 1RK0A 4PJIA 4YDJB 3HVNA 4NQVB 4F2MB 5CCGE 4KTYA 2ZKXA 1CFVL 2J4WL 3NYKA 4X5LA 2UXTA 3A4EA 4KX7A 3LRMA 3RNQA 4DKAA 2ARJB 4TQIA 1UH3A 1CGVA 4J27A 5TFSH 2XZAH 4XCFH 3N50A 4OI7A 4OZFB 2IDQA 4NQCA 1SXAA 3GPSA 1JPSH 4OH2A 2XN0A 2R1YA 5DK2B 3G04B 4HWNA 3QZNA 4MQTB 4HULB 3INOA 2DQGL 1XZ0A 5FCUH 3O3AA 2ZXWB 5DMJB 1ILSA 3W39B 3UBXG 4RCAA 4JRFA 1P84K 5I73B 4S1RH 3RJQB 3LPFA 4HUVB 1OPGH 3CQFA 5GZNA 1HESA 1LWHA 1HDMA 2I9TA 5A43C 2O5NA 4AL8L 4QLWA 4QRRB 3NTCH 1KYFA 3ZKXB 1WBZA 1HT6A 2X4SB 1KPUA 4P59H 3P40A 2LGNA 4UT7L 2OX5B 2IDFA 3O4OB 3QXWA 3M1BB 4M7LH 3TBVA 1E2ZA 1Q9KB 5IEKB 4I89A 4KUCF 3B34A 5KN5A 4FXGA 1X3DA 4ORGB 1G5AA 3OHMB 4O2EB 1TNNA 5IMKB 4XAKD 2ATAA 3DSFH 1RHFA 4OF7A 1I1YA 2IV8A 2ZICA 2UZXB 1F42A 2Z91B 3IDGA 3L5WA 4HIEB 1M57B 4F5CE 1T0MA 4X42A 5IJCC 4UINL 2D7QA 5I8OH 1FE8H 1QPPA 4N2OA 2X4TB 4PJHB 1CDBA 5EEYA 4FJYA 4HWZB 3FZUC 5GS1B 2VZ1A 4E9TA 2V9QA 1CLOL 3AXLA 5C0AB 5DFVC 4BZ2L 3LNHA 5AL0A 2Z35A 2ZYIA 2ADFL 4IDJL 4FQHA 3AAZB 1DUYA 1MCLA 1RMFL 1X7TA 2E75C 3VNYA 1HYSC 4H8WL 2VOTA 2H47C 1ZHKB 1H6FA 1ETZA 1DJGA 3JZYA 4UIMB 4JNXA 4U1IB 4JZJA 3KYAA 3VRJB 2XFXB 1EGJA 3RJOA 5F7YC 2D7MA 1I9RL 3MJ9L 4HT1L 1Q9OB 3PIQA 4JPVL 4MLSA 4A2DA 1CGWA 4NYLB 2DLIA 5F6HJ 3NIGF 3UYRH 4QRQA 1ZANL 2V9RA 4MDRA 3OX8A 5DD6A 1G9MH 1J9QA 4FFWD 5CZRA 3RLSA 5E94A 3VW3L 1IAIM 2CUIA 3E1F1 2FLBT 3VQ1C 3WKPA 4LVNB 1Z5LB 4TTDC 4KO9A 1J5DA 3OZLA 2V0AA 1XR8B 1A3RL 3ISRA 1CE1H 4RISL 1A6AA 3QYMA 3U46A 2BOCA 3DGGA 1PGRB 4H7VA 4HJSA 2CA3A 4JO3H 4AGQA 4MAUH 1BM3L 1DL7H 5FUOL 3BVDB 2JIXD 5CILH 3QJZA 4RFNC 5I6MA 3A4AA 5B3JF 3QI9A 3H9SB 1DN0A 4D0DA 1RZPA 1AXTH 2IDCA 1CR9L 3VI3F 4J8RA 4WV1B 2VXVH 4YO0B 3VXNA 4A68A 4F27A 1IKFH 2B2XL 2IWGA 3FTSA 2WQSA 2I7OA 1DQJA 4CN4A 1IC0A 5HVHC 4JUSA 4QTIL 2BP8B 1X5MA 2D3NA 3K4AA 3W0WD 5ID0B 3TFKD 3L1GA 5CEZL 4PVLA 3U30B 4HH9A 2J6EA 4K15A 1GHFH 4XC1L 1LEGA 3OV6A 5HI5D 2EC9T 4LPUA 3TV3H 2YAFA 4UUJA 2OR7A 5GS0C 1OTTC 4UILH 3MV9D 4MQ7B 2YN3A 4JM0A 5D70H 4AIZA 3NCJL 3UTSD 1OAQH 2WO3B 1ZPLA 2ID5A 5E2UL 4UNIA 4ZS6C 1YUHB 3ME0A 3E2HC 3BP7B 3CHRA 4ZMXA 3LVEA 1NUFA 4AE1A 1NL0L 1MLBA 4Z8FH 4FF9A 1SJMA 4Q8BA 1MAML 1CG9B 1AC6A 2CJ3A 2VDKH 1XGTA 4MWFB 4WFGD 3F8UB 4ZMVA 3WTSA 4M03A 1SY6H 3UPCA 4AVIA 3D1MC 2BP0B 1HQRB 2UZIH 4BEIA 2DQUH 3MBWA 1LP9B 1P2CB 3FCGA 3QQ4A 1U8KA 1S7SA 2X70B 1SYSA 2DQTH 1XIWC 2HT4C 1MFDL 5E08L 1EQWA 2JKWA 3X3GL 3HE6A 1NIEA 2JV6A 3V0AC 4H2CA 1PD6A 2EH8L 1LK2B 1URZA 3OB0H 5D9SA 3DI2B 4JO5A 2IPKA 3G6AB 4OZGE 3RWCA 4ZZKA 4F8PA 3FFCA 5FEBA 4WW2A 1UKTA 2IAMB 4M7KH 5DI8A 5JNYA 2OK0H 1KPVA 4YHOL 3L6FB 5AL8A 5D1XC 1FRGH 2NY3D 3OWEA 5CBEA 1J18A 3FUFA 5I75C 4A7SA 4M1DL 5HGBA 4MDJB 1J8RA 1JG9A 1CF1A 3ILPB 3EGXA 4OD2A 3I6LE 2QQLH 3MSPA 2N59A 3U6RA 2GJ6D 4DOHE 5A2JH 4AQAB 5A2BA 4IRZL 4A7QA 1JF6A 4DESA 1I7UA 2W95A 2F8OA 4ZS7L 3DROB 5F3FA 2IJ0C 5DURB 2YKLL 2FATH 3UAFA 4CNIA 2YPKA 4JFVA 2R56H 4DH2A 2NXZC 5SWZA 3BZEA 5GS2D 1M4KA 4HSAC 1QLFB 2CKBH 2XWZA 5D4IA 5DCCA 5FHBL 1PKQB 3WUWB 1ZLUK 4DKTA 3DPBB 4ABVA 4UV4L 3TYGH 5C0GA 3VD2A 1TQUA 3HMWH 4LLVB 4LSVH 2OL3H 2YA1A 5C0RH 3QNYB 3SY0A 4ABWA 4B27A 5I1HL 1DQTA 3RU8H 3EAKA 4JRLA 3I6GB 4WLCA 4KXBA 3LN5A 3QFDA 1ZJAA 2G5BA 2HX9A 1LO0L 3BN9D 1D7CA 2N0MA 1JYXA 2ZZUT 4WUKL 1P4IL 4ONHB 1T20B 3MBED 1IEBB 2BOBB 5JW4M 5H2BA 1JZ2A 1RPUA 2BHUA 3AY4A 3QZBA 3A6CL 3ABGA 3H7BA 1U91A 2NR6C 4HCRA 4JFDA 1AIZA 1NCUA 4FQ2H 4EI0A 3H6AA 4MGXA 4XXCA 2G5UA 1XGPA 2F53E 5ITBL 3RBSA 1A47A 1R5IA 1PU0A 3S5LA 3S97C 3BYYA 1GPOL 2ICWB 3BPOC 3D0VA 3DMMA 3O8XB