2C9QA

Cu(i)cu(ii)-copc at ph 7.5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport(copper binding)
molecule keywords COPPER RESISTANCE PROTEIN C
publication title Intermolecular Transfer of Copper Ions from the Copc Protein of Pseudomonas Syringae. Crystal Structures of Fully Loaded Cu(I)Cu(II) Forms.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c9qA00
1O6SA 1IX2A 2OMUA 3BZ5A 1LYQA 3FAWA 2OMYA 3BCFA 2OMZA 2UZXA 4CC4C 1OT4A 4CC4A 5ICUA 1M42A 2WQWA 3BCDA 2C9RA 1M9SA 2UZYA 2WQUA 2OMVA 1XEUA 1H6UA 4CILA 1O6VA 4AQ1A 2C9PA 2OMXA 2Y5QA 3FAXA 2YA1A 2C9QA 3BC9A 4AW4A 2OMWA 2OMTA 1NM4A 2WQVA 2WQXA 1O6TA 2RA1A 1H6TA
chains in the Genus database with same CATH superfamily
1TLKA 3O3AA 3T0WA 5DO2C 1N18A 4RISH 3TT1L 1I1CA 4TUJB 1NMCC 1COBA 4WFGE 3FCUB 3NFPA 1HAWA 1CDHA 1QASA 5EIIG 3CZFB 1U3HA 3T6ZA 1PJ9A 2CO1A 2EZ0C 1KEMH 3J07A 4N3UA 1EGJA 1U3YA 3ZKMC 4AZUA 4YE4L 3WTUA 4JFOA 5LN8A 4LCWD 4NKIL 4FNPA 3QRBA 1UGNA 5IGXL 1W0VB 4NQEA 2IQ9H 4PMEA 1YMMD 4P2OA 1MFAH 4BE5A 1L9MA 2W0KA 5C3TA 3RDTB 4OLZH 1A9VA 4WWID 2CKBB 4NNXB 3LHPH 3EDEA 1T21A 4IDLA 5FYKE 4X5LA 3U2SB 2C26A 5J6GA 3IAQA 3OJMB 1EV2E 1PAZA 2HKHL 5FKAA 4GAGH 1YLBB 3BKJL 3MMEB 1JNJA 4WEUD 1OHQA 2F2HA 4UZUA 2VDLL 1GIGL 3WE6B 2RIKA 4QRAA 3LKSA 1ONQA 2CRYA 4GBXB 2BIQA 1KJ2A 1BLIA 1QYGL 3ME0B 2EDYA 4M8RA 3RE0A 3D4CA 1AR1D 2VXVL 2W07A 2E6JA 3FF7A 4KROB 4XRCB 4NIKB 1PD6A 3O9WA 3NIFE 3T3MB 2E7LA 4NRXB 3H55A 3ZSTA 1E9QB 3PHSA 2FHBA 3EJRA 1RZJL 1XIWC 2FL5A 3DX7B 2B8OT 2BXYA 4MSWB 4RGND 4POZC 1ZLSH 3RVXD 5B7MA 2AI0L 3T0XA 1IKFL 4J3TA 4LSSL 4CN4A 2XRAH 1O6SB 3S4SB 2X6VA 2CLRA 2Q3AA 3OWEA 2K0RA 2XTJC 3S5ZA 4JNXA 1T0PB 1OTSD 2AEPH 1E4XH 3X11A 2NNRA 4AGMA 1OB1B 2E74C 3GBNH 2YOAA 2MH4A 3O6MH 1KB3A 2H9GA 3ZYOA 5IMKB 4GQ9L 3SDXA 5FV1L 3N91A 4X6BA 1JZJA 3O6LH 2ICWJ 5E00A 3DROB 4BH7B 2KS0A 1AGBB 2H47C 2IDCA 1TNMA 1TQCC 3FF8A 4L37A 1E4KA 4FXKA 1G7PB 4HD5A 3X3GL 3GXPA 1QBAA 4JQIH 4F33A 3B6SB 3OKYA 5I5IA 1C5BH 1DJZA 3S48A 1NAKL 2F5BH 3VD0A 1E7UA 1YQ2A 3HMXH 3FTGB 1X44A 3SDYH 3HNSH 4ZNEA 1BV8A 5JNYB 5KVEH 2BIHA 5AVTB 4ETQB 1FLRH 1KLFB 3G5WA 1A66A 2EDFA 4KGJA 4MNGE 4NHCH 4P46D 3MLTA 4AOFA 3EF4A 4YHYC 4KPHH 1KJ2L 4N20A 2C8NA 3CDFA 3CPUA 4Z7WB 3EJYD 3UBXA 1MJ8H 3WKYA 5CEXB 4WI9A 5EZJA 1T66D 1G1YA 4JRYD 5KOMC 4KJPC 4E2OA 3DX4A 3TT3H 2XFXA 3NJMA 2IDFA 5K5YA 4IGBA 4MKTA 3VW3L 1DBML 3VX1A 2HN7A 2Z65C 4X4YB 1PTZA 2L7UA 1XSKA 4M62H 1UG9A 4O58L 3V6OE 3AREB 4AQEB 1AKPA 4OAWA 1GKEA 2PTVA 4FQ2L 1ZLUK 1OF2B 2EH8L 5HHXL 3DYMA 4ZUWB 1GGTA 3BVTA 1UWEL 3VXME 4WI0A 4OCLC 2R0KL 5GS2H 4KY1L 2HRHA 2Z4QA 1VFOA 1LJMA 1TZOA 1NMAL 3QUKB 4ZUSB 1S7UA 4HZ1A 4G1EB 2C9RA 3FULA 3BJLA 1L6PA 3EJJX 4FQXB 2QSCL 4JFXA 4XVJL 4LAQL 5DI8A 4CILA 1FHGA 4N9OB 1HE7A 3L54A 1QA9B 2DQGL 4PJEF 5FUCC 3TIDA 3NRPA 4YUEL 3VFRB 1J5OL 4FLHA 1MI5E 3QIWC 4MMXB 4AG4H 2FNBA 4XO3A 4QT5B 2XJKA 5IJKA 1N26A 3TA3A 2J71A 5KJRH 4TLUA 5L8LB 3WO4C 1KZYA 2IANB 4YXKH 1G84A 2FX8H 2WD0A 1YEFH 3HG0A 3N1QC 5I0VA 3O45B 2K9UA 3II2A 4N2EA 5DUMH 2VN3A 4JRXD 3VM5A 1U3NA 2AAVA 4N0UB 3WJLC 4NO0A 3OVUB 3T4AB 1J0YA 5GZOA 4LKCA 4GXUM 1WC7B 4A2DA 1P1VA 3QRLA 4V2CB 4AIZB 2W80C 1DVSA 2EKJA 5AVWB 1RURH 2JB5H 1HHJB 3GSVB 5F97E 9CGTA 4QTIH 1AMXA 1C16A 1IGTA 1BBDL 1PVHA 1QNZL 4J3OH 4UQIM 3WGUB 2VL5A 4R26H 2PCPB 3RY6C 2ED7A 4O2CA 2RACA 3L3IA 2I9LA 5DK3A 2LABA 1UJTA 2NXZB 2EDHA 3AG2B 1NGYA 5B39A 4ZMYA 4IRSD 5CU5A 4XNBA 2X6MA 5IB1B 1ZHNA 3GSQA 3PAVA 1FIGH 4MS8C 3PYCA 3TV8A 3L1GA 4ZAKD 5AENA 4IHOA 3PP3K 3WUWA 3G6DL 3S37H 4XNMB 4DQAA 4Y9EA 5HPMA 5CD5C 15C8H 3T3MF 3G5VA 4FZEL 4DKAA 1KYDA 4G8EB 5E4EC 2ZAIA 4NQEE 4APXA 2BDNH 3W9DA 3ZOAA 2NYZA 2ZUSA 5I1JH 2FNWA 2EP6A 4XB7A 5EN2A 3RU8L 3TCLA 1QAWA 5EDSA 2E9JA 4BHUA 2ZSVB 4JY4B 3DVGB 4GQQA 4YAQA 1B4TA 1XB6A 1JJUA 1YJDL 2X4PB 5TGBB 4BFRA 3JZ7A 5FYJU 3AWFA 3POHA 43C9A 4K23H 2AQTA 2J1WA 4AGLA 1BW8A 1ZWIA 4NKOA 3ULUC 1JNHA 3L1FA 3DX9B 4JDVB 5D7SL 5EN3A 3FSZA 4PJBA 5EO0A 2IALA 4JPKL 5GJTH 3QIBB 3CNKA 4MMZC 5C07D 2WLLB 3UAJA 1KB5B 1BZOA 3MYJB 1B0IA 4FG6C 4QLWA 1GYAA 1K2DA 3IJHA 3V8OA 3JWOC 5JPNA 2V33A 2EUZA 3PGFH 3PDGA 3S8WA 2O61B 1MOEA 1WQVT 1P84J 2ROXA 3V4PB 2HFGH 5C0BA 5I19L 3RL1A 5FM8A 3CSFA 4N8VB 3FQXA 3H0TB 1AD9A 2BP8A 7FABL 4AQOA 4P8QA 3CSYB 4GI6A 4Z95L 2XFGB 4MKMA 1MFNA 2B5IC 4G80B 2IDUA 4HJ1A 4CKVX 4DP9X 5CCKL 1DVYA 4L3CA 4Z7WF 1KTCA 1CE6B 1WCQA 3R4RA 1UATA 1I7UB 4Y5XC 3SDXE 3HS0C 4KFMA 4UIKL 3MRJB 2X87A 2NTSP 3SKMA 2OK0H 1Q0YL 4PREB 3TJHD 4LPTA 2Z6FA 4F3FB 4ZZKA 1NCTA 5CKAA 3VXTB 2XDHA 3CGTA 1HQRA 3F7YA 1U92B 4C59B 1Q72H 1FFPB 3L4TA 2XKSA 3KNBA 2FJFB 2P8MA 1SM3H 3WY3A 2RFXA 3G6JE 3WN5B 3HC3L 3VYOA 3GJFH 2VDOH 1E50A 3BQUB 3R19A 3RRQA 3VMNA 2KLRA 1KCWA 1FL6A 2FJUB 5IQ9A 2W0PA 3AY4A 1XGRA 1HEZA 1TTGA 5KYNA 3KPRE 1SZNA 2WP3O 1FYTA 2WKOA 1JFQL 4JO3L 4ODUA 4YHKH 4PJCA 1MHPH 4ZS6C 3HB3D 1O5DT 4XZ4A 3SPCA 3UX9B 2YQ3A 5CBAB 4D9QE 2I9TA 3AQZA 4FLRA 3RUGB 3F12A 1F02I 2LAAA 4LMQE 1Q9OB 2WVUA 3UTTB 4FF9A 1A1MB 3AY2A 3VA2C 1EZVX 1I1RA 4BQ9A 4OLVH 4PB0L 4N0YH 5D5MB 1YN6A 3BWAA 3NJFA 4U6VL 3BO8B 2KKQA 3LH2L 4GB9A 5G5DA 5FK9B 3NZUA 3VRLE 1OAQH 3S34L 4L23A 4NAJA 2WKGA 5GRZA 1BVKB 4HBCL 5DJDA 3TN0A 1Y1DA 4RH4A 1CFQB 4WUKH 5IV2B 4A7SA 5IBUG 2XC8A 5JO5A 2E47A 3FFDB 3OG6B 2VXQL 1USQA 1CDIA 5IW1B 2YPKA 4BUGA 5F3BB 4NN7B 4LNVA 3TPUB 5IMMB 2W81C 4LASL 2G4GA 4JFFD 3I50H 4XO9A 5JHAA 1PZ3A 3K71A 2WQVA 2I25N 4L3FA 3EXJA 3EFFA 1EEUA 3LHAA 3UZQB 3CFEB 5HHOD 4QHMB 1IV8A 2ROYA 1AOHA 4AMWA 2GFBA 3HNVL 5GXBB 1CFBA 2DQJH 3ZE0E 3QH3A 1PW3A 2VKXA 3SDDC 1YNKH 1WD8A 2HG5A 4MFHA 1DDHA 5IESL 2VO8A 3LZNA 1R5IA 3NT0A 5DK0A 5ENWA 3ZIMA 3DWTA 1RZQA 2XQYK 4A2MA 1ET5A 1KCRL 2BNRD 4I18A 4HWEL 4YEFA 5IHUH 3ROOA 1N8ZB 3APDA 4BUQA 3GHEH 2XT1B 4JPWH 5IB3A 1DN0A 3QR0A 1OGSA 4C56A 1A7QH 2QKIC 5CEZE 2Q8AL 1MJ7H 4R4BB 4QY8A 4X7SH 5GS3A 2Q9OA 4OJAA 4AKPA 1MQKL 1OGTA 1SDAB 4XNQB 5HDRA 1NCAH 4MB5A 4MAYB 2Q5BA 4PRHD 2E9WA 5F96L 2W65B 1T3FA 3QG7H 4AQZA 4KRMB 4R96A 1EVUA 2Q2EB 2BZ7A 3GI9L 4RBPH 5SV3A 5T1LA 4QEGA 1UWGL 4XP4L 2ARJA 3D25B 4FQQA 1PFOA 4O02L 2YUVA 2ZXWB 5IEKB 4AY0A 4P5TA 4Q9QL 3RIAK 3MBEA 1RUPH 2Y6SC 3D3VA 3ARDB 1NBVL 4Q6IB 4HZAA 4UUJA 4J3OG 1MWAH 4QAMB 5BMFH 1OAXH 5D7JA 1C7TA 1MHCB 1TTCA 5EOQL 3ZDYB 4ZYKA 3RYMA 4ZD3L 3VGBA 2X12A 1U58B 4GKZA 4DOHE 1TKWA 4FEMA 4X6DE 1QTYT 4JRWA 1NPJA 3MUGB 5IHBA 4GG8A 2ODHA 3K4DA 5FYJH 3WE1A 1GTFA 4ZDHA 2HWZH 5D70L 4M6ML 4B53A 3HUJA 3EYQD 1KIUB 2EXSA 4FFVC 2E86A 4PG9B 2C1OA 4DZBB 1ZS2A 1GH7A 2BNQB 2WNGA 2F54E 4D8OA 4JFHD 5ADPL 4QHNB 3LX9A 2X9XA 3LY6A 2H0EA 1RIHH 2W8CA 3W5MA 4NUGH 1OWWA 2X0VA 4Z3TA 5T1JA 1L5GB 2EIZA 4YHZH 2P24B 3OSVA 2NCMA 5MENA 1P7KB 4CMHC 2LV4A 3UYOD 2W9LA 1CO1A 3ZHKA 5C0BE 1AQKH 3FQYA 3GMMA 1N0LB 3EIFA 2IH9A 5DRZB 1INQB 1X5GA 2EDEA 2F74B 3UTOA 4HWZB 3LRSA 4EN3B 4X5WA 4X80L 2HMID 1LWJA 4I0CC 5E9DD 3W0WA 4NCDA 1T22B 3EOBB 4MRBA 4RNRB 4NQDB 1DFXA 5D1QC 3LMJL 5C0ND 3WY1A 4JQVC 5DJCB 2FSEB 5FB8A 1VPOL 4WHTB 1O9VA 5DLLA 2GIMA 1ODAA 3TBYB 3CVDA 3CFBB 3U1SH 3TL5A 2FHCA 2ATKB 2GK0A 3BHBA 3MODH 2HLEB 3FHAA 3D39D 3K3QA 5F6IB 5LXVA 5D5MF 1UGKA 1KEGH 3ZTDC 3LKOA 3VXQA 2DKUA 1CD8A 1TJGH 3QI9B 4D0BB 3MOQA 4DEPC 5EFIA 4UNIA 1TQBB 3HBQA 3RAJH 5DK2B 1XGUB 4NQCE 5IB5A 2WYHA 2P9RA 1UKQA 4GP4B 4GLRH 5C0FA 2NTFB 3HZKB 1FYTE 5FCUH 2RTTA 4M4RA 1C08B 2AV1A 2FBOJ 4EUPA 4PJCE 4DGIH 4NKMA 2PR4L 3RKPA 3P4LA 1RVFL 2B1HH 4NM4L 3AS2A 3B7SA 4X8CA 3ZDZB 3T09A 1S7SA 4HUUB 5HYQA 1PY4A 3LEVL 1A4KB 3U7WH 4DZ8B 5GSRA 2NXYD 3PF2A 1A7PH 5IFJA 3COOA 1YVLA 2ZX9A 1E43A 4KQ4L 4G72B 4I4WA 5AKVA 1U8JA 3QDMA 1F4WL 1KGYE 2IAMB 3IRCA 5JLZB 5DHXB 5JTWA 3LB6C 3IMUA 3LRKA 2FHFA 3Q6GH 2MQGA 4JFZH 3MPCA 1AVAA 5DEFB 5GGUA 1WZ1H 3T0ED 3C5JB 5HHNB 3JWNC 2V3DA 2Y7QA 4HIXH 5F44A 3KYOB 1QPXA 1TVDA 3MV8E 3P30L 1NC2B 2D7NA 3P4OA 1GC1H 4NM8L 2Z7UA 2HTKD 4WI5A 3IDJB 4PGBB 1Y0LB 2DTMH 3D2TA 3N41F 1KPVB 1M9SA 5HGHA 2GQHA 4OF6A 4XX1G 2BNUB 3CFMA 1AY1H 3QIUA 3NA9H 2EYTA 5FM5O 3MA7A 1D5IL 3CLEL 5AW8B 3WIAA 1GJIA 1NANH 1NCWH 2CPCA 4W4OC 4XVSL 4FFTA 4PRAB 3LZPA 1WGVA 4PLKD 2QSQA 2ICWI 4WVRA 3LEXA 2CBMA 2VDMB 3PIQB 5DMGC 1JXKA 4RGOL 3BVXA 3ZDYF 1BM3L 4YSTA 2WXRA 3GPEA 3M86A 3HG2A 5CZXD 1U4EA 4CMMB 1GSKA 1KBGL 25C8L 4HJ0C 5ID0A 5LNEA 1E5AA 2F1BA 1U33A 1ZOXA 3P77A 5HDOA 5D1XA 2VRQA 2OMVB 2FATH 2KI6A 1GCYA 4RAVB 3BDYH 3R1GL 5I9QC 3GXTA 1TTUA 3KYMB 4PI0A 1YMHA 3CVHA 3GDCA 5I1CL 1ZLEA 1HSAB 3CZNA 4JGMA 4M8QA 4JJ5A 5C08A 1NC4A 4BA0A 3D3VE 2VXTH 1HWGB 3JV5A 1Z66A 4I3SL 5I1EH 5I5MA 1JCVA 1LM8V 3KBEA 4S1SL 5MEPB 4IJ3B 3HPLA 4XMTA 2EDNA 4I77H 4G3YH 2H1PH 4XHJD 3UCQA 3ZTJH 2W0FA 3FHQA 4NENA 4XOBA 5F7WC 2HAZA 3FN0L 1ITBB 1RZ8A 1U2CA 2VWEC 4GRMA 1E9PA 2B4CH 3UAEA 3FO1A 3MCG1 4KBPA 3VI4B 1X5IA 2HFEB 2WXFA 3C6LB 4KK5C 1QLRB 3CMOL 4ZTOH 4YHNB 4W9IC 1OGAA 2ITDA 2JSFA 3DA0A 2K8QA 3H3PL 4WY7L 4NN5C 4MXWL 3K2UL 3MC0A 2ADYA 3HUJE 1UM5H 4Q2ZB 3MNWB 5FFGA 4IEFB 1HHIB 2FQGA 2K78A 3GRWA 5CWSA 3U4EA 1HOCB 1M2OA 5H8DA 2H2PD 4H88L 4PRPD 5EU7E 1KTRL 3CFJB 4JHZA 4JFED 5MENE 2HRPL 1IC0A 1YC7A 5CD3A 3ROLA 3QUMA 1BQHB 3L5XL 5ESVA 5CLYA 3RX5A 1MRDH 1C12A 3VCLA 3LSOA 3CVHL 4HH9B 4PUBH 4E5XA 4K8RD 2D03L 1NGQH 1JD9A 3EH4B 4DETA 4J6IA 3W0WE 1U9KA 2MOQA 5HVFB 1ZIAA 2D7PA 3L17A 2ZOKB 1UADC 3NCEB 5I6NA 3GK8H 3QYNA 1I1AB 1JYXA 4F7MA 1WZKA 4BK8A 3ET9F 2FDBP 3JTTA 5JZ7C 2ITEA 1IRAY 1F3JB 5AKTA 2QQKH 4YDJA 3GBML 1OCCB 3ZXAC 1GS7A 2C9AA 1P4IH 4MX7A 2HLFC 3DPDA 1UYWH 2WBJA 4MJ2A 3EOTL 3OKLA 4Y1SA 1OW0A 4NZTH 3NJIA 3H9ZA 3TV3H 2XQBH 1BZDA 4X8GA 3CFDA 2LLNA 4R2GC 5LG6A 5F7MC 5DJXB 3KWTA 5BS0D 1KYAA 1ITCA 4ACPA 1D9KB 1ZHLB 1NLBH 4QLRA 1T1WA 1F4HA 1SYVB 3KPPB 5J5EA 1JN6B 3O6FC 1B6DA 1QSEB 3B8SA 1JGLL 1GZPB 1O6TA 3K2KA 4ELMF 1JZFA 5A7EA 3MCKB 4LESA 4FN0A 4JZJC 3H3BC 5MP6L 3GIVA 3QPXL 2YSTA 2FJHA 3QG6A 2J57A 4KJQD 1MNUH 4AJWA 2E6PA 2XN9D 3V9CA 4WJKB 1GGCH 1P7QD 3SGKC 3QUML 5ITBH 4BSVA 5CGBA 1T80A 5HJGA 2P7TB 2VLRA 2VB5A 2YSSA 2DQMA 2C7UA 3QFGA 1I3GL 3QJFA 2W92A 4O02B 3LVEA 4RSVA 3CMGA 2IPKB 1MG3C 5I16B 2R2CA 2AJ3A 2DJ4A 2XXFA 4OD2A 2H41A 1X6NA 4KK6D 1T7YA 3SDAA 4B60A 2F7RA 3OKEB 3PWJB 4LLYA 5JW4N 1UM4H 4U1NB 3IPBA 3BAWA 4FRWA 1CFTA 1XF3B 4UCFA 2F9BT 4PJEA 5LCVA 3TIEA 2A74C 3HE6A 1BZQK 3RJDA 2P5WA 2MCPL 1H3GA 1KTKE 1EBPA 5EORH 3W11C 3GMQA 2LU5A 2G9HA 4GUPB 3OGCB 4J8RB 2R69A 2BWQA 4IIQA 3EOAA 3UZEC 3CU7A 5TQ0L 3Q44A 4XCEB 5CGYD 4JCMA 3FTXA 5D6CB 3OGOE 5D7IB 2ZX6A 2WAHA 2V2TB 5E6IB 3QULA 2AFNA 4XCNB 1XSJA 3VJ6A 3WDHA 3ABLB 5M94B 1E5CA 2DWEB 2AK4D 3NIDF 5JORB 1DUZB 4XNXH 1V27A 3DOSB 3MACH 2P8PB 4OT1L 3FUJA 4FFZH 5EU4B 1ORSB 1W0VA 4LSTL 6PAZA 2DAVA 1A4AA 1QHQA 4EI5C 4TQHA 5GJSH 3S3DB 3RDTA 1A7OL 4NNXA 4TQEH 1N64H 1IM9B 1CYXA 2A9NL 2NR6A 3QAZB 3MXVL 2F19L 3U2SA 1WBYB 2XBZA 4GINA 3ML9A 2OR9L 5D1XE 3QUYD 5C8JA 1TZHA 4LKXB 1T1XB 4PRDB 2VITA 3K81A 3MMEA 1E5UI 4UB0H 3FOMA 4KRPB 2EACA 4TNWK 1FIEA 3FQ4A 3RWHB 2LTQB 5C08E 3EDJA 4PJFB 3MGTB 1OPOA 3V0WH 3DTDA 3I2CL 2ZX7A 1R3JA 3MBXH 2AJYH 5BRZA 5T3XL 4PFEA 2OSXA 4GAYB 3RA7H 1INDH 4TULL 3H9SB 3HRZC 5IF0B 3KWVA 4MSWA 4NQXB 2WW8A 5I8KH 1SHMA 2I24N 4LF3A 3ZYZA 3LQAL 2WLYA 1KXHA 3N42B 1OGAE 5E6SB 3U1QA 4OLXH 4XMWA 4WU5B 1GGBL 3BP4B 1L7TL 3PL6C 1OB1A 4BKLA 1GZQB 1W72A 4JFDB 1PQZB 1U8PA 4PS7A 4UDUA 3ZTJG 1FC1A 1JRHI 2PP9A 1Y7VA 4M48H 4BE6A 3BVNB 4HGKC 5EPMA 1V3LA 1HSBA 2D0FA 1QTPA 4JHWL 3IJSB 3QRGL 1G7PA 3G6AA 3QEQB 4MYWB 4KI5E 1IKOP 3P0VH 4ONGL 3P11L 3FL7A 3NIGB 3WG7B 3FTGA 4PP1D 4RFEA 1VZIA 3QWOA 3T4YB 5EMYA 2WLMA 4ETQA 5DDHB 3VGHA 1UOKA 4X99B 4Z7QB 1TVBA 1YUHA 3MZTA 1KJMB 2Y5TB 3NSCA 4WSJA 1RY7B 4QRBA 1TXKA 4LSRL 2BP5M 5I73B 3A3YB 3O11B 4Z7WA 5AOKA 3MCYA 5LDUA 1KV7A 4Q58C 1ZTXH 5CEXA 1FQ9C 3DX2A 1QSFE 1TQVA 5B1CA 3BCFA 4APQB 1CGYA 2Z1PA 3RNQB 3S36X 1CB4A 2R4SL 3VNYA 3NRFA 3O2WH 1R9FA 1D7BA 5A3ID 1OP5K 2ZP8A 32C2B 3EDFA 3O4LA 5GRUL 1I8LA 1BZ7B 2J12B 5ESQA 1TMCB 2NY5L 1K85A 4ZFOL 1OF2A 2JF1A 1H8OA 4OM1L 2QADC 4X9BA 1W72L 1JSYA 2XVLA 4DW2H 1Z3RA 2OR8A 2NRDA 2XPYA 4A1RA 4S1RL 3PHOB 2P4AB 4D7PA 2A6DB 4OBRA 1YO4A 4JR9H 3FB8A 3CZGA 3B5HA 3ZU8A 3OZ9L 1ZA6B 3PP4L 3UBXI 3BYYA 4NNYB 4O4YL 1QA9A 1YECL 4TRPH 4F27A 4QGYA 3LCYA 3VFRA 4ZI8A 4B9YA 4QT5A 3ZBMA 4BRVA 5IJDC 4FNQA 1OL0A 2CQVA 2L0DA 4FQIH 4XCYA 4ERSH 1JVKA 2DH2A 1E8ZA 2VLRE 1T4KA 5KAQG 4FQPA 5IM7B 2JCCE 5FYLL 4KKBC 3JWDL 2NW2A 4N0UA 1KN4L 2VDRL 1X7QA 4P2RE 5K39A 4YBHA 3T4AA 2X9YA 3C75A 3CK0H 3QC5X 3VACA 3U9UB 1ILUA 5H94B 2R2EB 4RMRA 1WC7A 1UXWA 3UO1H 3N43F 3GMRA 4EIZC 3H42L 5C0IB 3NDYE 4PJEE 1QR1B 4M1GH 3KBPA 4HS8H 3GSVA 2GT9A 1JG9A 2ITCB 4X9YA 5FUOH 5DGQA 1G94A 8CGTA 1EQWA 5E1GA 3CH1A 4O2EB 5AB1A 3OKOB 4Z7OE 1ZDQA 5IFAH 3DX0A 1RMFL 1VSCA 2HT4C 4ZS7L 4BZ2L 1N10A 3FU3A 4K73A 3FCBA 4OZFA 5GS0C 3DX6B 1YEGH 3MRGB 4HUCA 2EDXA 2N1TE 3VXRB 1CK0L 5IB1A 3T3PB 5CIPA 2FUTA 4FXGC 4XWGL 5DD6B 1HZKA 3UTZB 4XN5A 5EIIB 3OL2A 4F9LA 3GXFA 3QGVA 4K3DL 2Z4TA 4AUUA 3APMA 4ONOA 2BOBB 4OTXH 3VFNB 1NBYB 4HCRL 4JDEB 1SJHA 3MA9L 3NJVA 4U6XA 2ZSVA 2BERA 2A83B 3D85D 3QWNA 3DVGA 4JY4A 1XCTB 2ADGB 2IIJA 1HI6B 4RA3A 3LN4A 4HOZA 4ZFGH 4EEEA 4ZPTB 1B3JA 2VRKA 2YPLA 4B9PA 1A6UL 3AXIA 2OYLA 4K2UL 3EUDA 2AXFB 1MCHA 1L0XA 2FVNA 3PRZA 4PY7A 4N2GA 3I9AA 4RGMB 3CZEA 3WKNA 2DLFH 4LPYA 1JGVL 3UTQB 5LXGL 4JB9L 1AACA 5BRZE 3MYJA 3HE7A 3RFZA 1PX4A 3T3ME 1GL4B 4GW5B 1PZDA 2O61A 1J0ZA 1FNEB 4MXVF 5HDWA 3T0AA 2PXYD 3PABB 4ZFZB 2VDQB 1SY6L 3IXTB 1E4WL 3GSOB 5E2WH 3VWJC 3KM2A 2CH8A 3EFOB 2GBVA 3EGXB 1U4FA 4AYSA 3FOLB 2ZYIA 4BHUI 3M1OA 2ZKMX 3OBAA 4G80A 3SE4C 2DL2A 3KCPA 5BW7A 3TJEL 4TVUA 5JR1H 5T1KA 3WXVL 1SNRA 3BT0A 1UA6H 1CE6A 3DX1A 2D0HA 4GSRA 4NZUH 2GTWA 3BSZL 3SE6A 1WA2X 1WZLA 2FX9L 3H54A 2IFFH 4WO4A 1RZKC 1B90A 1TZGH 2L04A 3FQNB 1XMWA 4XMZA 1U92A 4TSBL 2YQGA 4HEME 1CFVL 5MI0C 1UXMA 3WN5A 3ULUH 4L3CB 4ZO8A 1M7DA 4K5OA 1MLBA 3F8UB 3BQUA 3AQDA 1Z9LA 1MCRA 4LSPL 5E5UB 4BRJA 5IIEA 4KJYA 4YC2B 1VCBC 3OV6A 3QWQB 3WLWC 2C3VB 3Q0HA 3LXBA 3JWOH 1VF5C 1NCJA 2NNCA 4HKJA 2VMEA 3AQXA 4GRWH 1PLCA 3IJYA 4Z7WE 2BSRB 3NQIA 4BFFA 3V4VH 1I31A 3AU0A 3P4NB 2OMUB 2QPFA 4LSQH 2BO0A 1Q9OA 1ZAGA 3O8XD 5CINH 1DLFL 3ZTNH 1A1MA 1YN7B 4WUUB 2FLRT 2NPLX 4U1IB 5SX4H 4XCFH 3BJ91 5D5MA 3NJNA 4TL5A 3BO8A 1A5FH 5I1HH 4UT6H 2JKIS 5FK9A 2AVFA 1NM4A 4GKNB 2ZUWA 4MD5B 1BVKA 2XZCH 1JNLH 3MX0B 4LGPB 4OD3H 4WRLA 1CFQA 4Z8FL 5IVXB 4QXGL 1FDLL 1WBZA 3B7RL 4P2CG 3IB4A 5A6IA 4R0LB 4DHLA 2OP4L 2XZAL 4ZOBA 5IW1A 2NY1D 2EEXA 3ES6B 3WFCH 4RMWA 3ARBC 4OB5H 1ZT4A 3WNKA 3LZFH 3QDGB 5E70A 3ECBB 1E28B 5ICZB 3CX2A 5PCYA 2EE3A 2C9QA 1IQDB 1TZIA 3M45A 4M56A 1NM9A 2XUWA 3UZQA 1JZ4A 4QHMA 5DFTA 1NEZB 5J11B 4AL8C 4XVUD 3NSJA 4GW4B 5HJ3B 4PG2A 4ZT1A 4YZFF 3TOPA 2IANE 4Z7NF 3BMWA 2XV2A 1JGIA 5MEQB 3VXSA 5BVPH 2AXGB 1F1GA 1VCAA 2J8UB 1T1ZB 2VN7A 4N0UE 3CUPA 4QRPB 1NPNA 2A2QT 2UUDH 2VZ3A 4Y5VA 5DD5H 2NY3C 3MLXL 1N8ZA 2XWTB 5AWNH 1FYHB 3ULVL 1ZXKA 5K9KB 1L0YA 5EBWB 2Q87A 5E08L 1YCSA 2GJ6D 5HI5D 3Q13A 4UT7H 3CFUA 4PWGA 4UINH 3QDJD 1AFVH 3D2UB 4E41B 5E2JA 2CJUH 2FB4H 3QCVH 2WJ7A 4JO2H 4ONFL 3S6CA 2JI3A 2W65A 1JXGA 5DFWH 1L9NA 3VGAC 4NKDA 1MRCL 5BZDB 4LOVA 1DQDH 4M6OH 1OARH 3GSWA 2YRBA 3D25A 3CXDH 2XWEA 1AZUA 4JO1H 1NIDA 3VG9C 4DKEH 3ARGC 4XGZB 4BEIA 1OTUD 2F8VA 2DMBA 5TH2B 1BFOB 3ARDA 2DM4A 1AQDB 2Z1KA 5C0RH 1I9EA 2OMWA 2VC2B 2XA3A 3REVA 2YBGA 1HESA 4GG6F 1OAUH 1S4IA 3GTTA 4YSCA 5IREA 4QWWD 1ILSA 6FABL 1R33A 3LN5B 4M93B 4WU7B 5AW4B 1U58A 2AQ1A 1D5BB 1A6AB 2XKUA 4PU2A 2AC0A 3UJJH 3ILQD 1PG7X 2K9FB 5EU6B 3MUGA 4OVUA 5C2UB 4XC1L 3VFGL 3O3DB 2UZIH 2D7OA 1TR7A 3SD2A 1DVFC 2K8MA 1ZTMA 4M7ZC 3P3YA 2YPLE 1KTLA 2N7SA 4HHAB 1M3JA 3UJTL 4TTGA 3THML 1X5ZA 4DCQB 3K4ZA 5SWSA 3PJSA 2J6WA 5JW4R 2C3WA 2B9BA 4XH2A 3GSUA 4H8WL 3MV11 5HVHC 5E1IA 2GSMB 3AG1B 1L5GA 2EVHA 1VA9A 1TJIL 3I9PA 4K71C 1U8OB 5ALCL 3WNMA 4DUVA 3BP7B 1AHWC 4HJJH 1G7LB 2P24A 4OZIB 1HQ4B 1P7KA 2E4FA 3Q2VA 1XF4B 3BPCB 3F83A 1SHXA 1MFBH 1FL5A 3B9KA 4XBEH 3I85A 1N6UA 1WPCA 3TGXA 1DJGA 2ZXQA 2R29H 1KNOA 2PYEB 3DVNA 3R0NA 5DRZA 4E9XA 3I6LE 3KPRD 3QXTA 4N5EC 4HBQA 3DMMC 3L5WA 2P3YA 1W0YT 5FO2A 3DIDA 4NQDA 3KL5A 3QCUL 2WVTA 5E4IA 3U6XS 2BS9A 1BEYH 5DJCA 4OKDA 5B7EA 4DP2X 3SCMB 4WHTA 3TBYA 3FUKA 3BVDB 5G4MA 3CFBA 4EPSA 5EEUA 2JKTM 3KH4A 2C3HA 3GMLB 3FQWB 2X53A 2WINB 5AKSA 4GS7C 2ATKA 4PS4L 5IKCB 1F2QA 3AWGA 4G8GA 3V0DA 5L0QB 4XN8A 1MNNA 3EO1A 4E42B 1A9BB 3VGEA 1AD0B 1LEKB 1RUQL 1KENH 3C6EA 3QI9A 4QRUB 3QORA 5AW0B 4QAWA 3FUMA 2R7EA 4PLJD 5FHAH 1XGUA 3IRPX 1E5YA 4I7ZC 1G5GA 4YS4A 4OGAC 1TENA 4MAUL 4JS7A 5A43C 3I9GH 2EDRA 5C3IA 2D73A 3P1VA 3HZKA 3P02A 4KX7A 2FIKA 5GGQH 1ZANL 3OLDA 2IG2H 3CFQA 3EYFA 1KY7A 3PAYA 5EOCL 4OQ1A 4DVBA 4QF1B 1DHKA 1F3DH 5F7UA 5EUKB 3NQKA 4AMKH 1G4MA 2AANA 4G8AC 4IBWA 1IKNA 1XGQB 4PJXF 5KBNC 2X6AA 2ZKYA 2DEXX 3FXIC 1KCVH 2QR0A 3EBAA 4RRPG 3GSNA 5D5ME 1JE6A 4X6EA 3IDGB 1BOGA 4IMLA 2VDNH 4UT9A 1ES0A 5SX5H 4PJ6A 3MO1B 1MCEA 5JLZA 5D7LD 2J8UF 3K72B 1DDTA 1IVTA 1OM3H 4Y16B 4HX1B 5DFVC 1G0DA 5HHNA 2V5YA 4F7KA 1IGYA 2A1WL 5D8JL 4H8UA 3F7RA 3VWKB 3MU3A 4UMSA 3U2JA 3VI3F 4ELMA 3O2DA 5AOIA 4XMPH 5DT1H 4BCYA 3IDIA 2YUWA 1IBGL 3HS8A 4IMKC 4PGBA 5JHBA 2L7JA 4LQ1A 2DQEL 4LU5H 4HFUH 3F62A 3LPFA 5ECGA 3TO4A 3HC2A 1B3IA 5TK4A 1HJCA 1MFDH 2X2HA 5K9OB 4X6CB 5E23A 1T1YA 1T5XA 4ZMZA 3VXSE 2PTUA 1JF5A 3VU2A 3FTYA 1U3HC 1J5DA 1ZPUA 2Z0BA 3DGGA 2NZIA 4HIIA 4PRAA 4DTGH 2PO6A 1S6NA 3NCWA 4CA4A 5ACMA 4R7DA 3CCHB 4ZUVA 2IO5A 3ARSA 1WV7T 1LTXA 1X7SA 4P2OC 4YPGA 4TOYH 3KS0J 2H0FA 3C12A 3MXWH 3OAYK 3W56A 4LARH 1A2YB 3U9PH 4CMMA 2X09A 1BA9A 1OAYL 5J3HC 1T20A 3GSNL 4LGRB 5DRXB 1EBAA 3B2PA 3JWNH 1FZJB 4WW1A 3HB3B 1EJ6A 4RAVA 3QCTL 4JKPH 4EQ3A 1TPXC 3TBSA 1RQ5A 3UP6A 1R3IL 2R56H 4HSQA 2BOCB 2F54D 1N6QL 3GMPB 2D4FA 3DX8A 1GOHA 3HCVA 4PQXA 3NGBB 4XN4A 1PDKA 5AUMB 1UURA 7CGTA 2HPTA 2W60A 4UBDD 3O2DL 3B9AA 2YR3A 3O9WC 4ZO7A 4OI8A 2E7LC 2Y22A 3AAZA 1XTLA 3L8QA 2F53A 4R3SA 4L18A 5IBTL 3U2IA 3ZDYE 3T9WA 2VM3A 1O9WA 5HDQL 3SZKC 3HKFA 4GJTB 4PJAB 4Y2DB 4Y9FA 6TAAA 3WKML 4TLTA 5F7HA 1D5ZB 4JJHA 5KSUA 2LT9A 3VI4A 2UX7A 4UDTB 4NAMA 2HFEA 1YQVL 2ZNXA 3FU6A 3C6LA 2V5TA 3NPSC 4H1LH 4B0MB 1KXVA 4NOBA 1J8HD 5C0GB 4K3EL 3GNMH 1M1SA 1M6UA 4Q2ZA 3MNWA 2YUZA 4NXKA 3LJ3A 1KIQA 5DXWA 4KHTH 5CN2A 5J4MA 5SWSE 2FWOB 3PDOA 3P9WB 1DLHB 2OX5A 1HHIA 3Q2NA 3EGDB 1YHPA 3OQRA 3WELA 1E0OB 1E4KC 5C92A 4FXKC 3WNIA 3QQNA 1HOCA 4AVKA 1BYNA 1AS7A 2JCWA 3Q9QA 5C0CD 4LCUB 4KKCD 3O2VH 3SKOB 4FFYA 5F8RC 5KVDL 2BH0A 3Q1SH 5BPPA 4ENED 1BZ9B 2C3XA 3ATFA 4G6FD 1AJ7H 5DMJB 2XVGA 2Q8BH 2OL3H 4HFWA 3P69A 3DARA 3CZUB 3ZMRA 4L8SA 3D0LA 2EECA 3L2LA 1XFPA 4YDIL 5INCB 4NQCD 1DVUA 1JF6A 4QXUH 4JY5H 2HPOA 2Y36L 3GZKA 4QRSB 2L8AA 2JKLA 2NY4B 5DZOA 4DKTA 5FDYA 3MRKB 4MA1C 3ZHFA 3S7GA 1QW9A 5D1QD 4KWUA 3UYRL 2C4FT 2VMCA 5I15H 4NQDE 2WLIA 2VZUA 1MG2C 1ZLDA 2LLLA 2ZXGA 3CZKA 3JTSA 2WC7A 1MHEB 1Z3GL 3MLWL 4UNTA 5E6RB 1RJCA 3VFVB 1CLOH 2DI9A 4JN1L 3ZDXF 4IGBC 3FT2A 2BVTA 4PGCA 5HHMD 3TEYA 3IDYC 3IS1X 4ZO6A 4JREB 1S5HB 3VFWB 4P0DA 1UQSB 1WEJH 4PBXA 1BQKA 1PBYA 2DYRB 3MREB 1ZV5A 2CGRH 4L3AA 3T2NH 4QKXB 4XP5H 3RTQD 1CYWA 2OZ4H 4S2SB 4I3RL 3HI6H 2ED9A 1CIUA 3JT2A 5FO9B 3OX8B 3Q6FA 1EEYA 3QPQC 1MLCB 1ZHLA 1XEUA 4A7VA 2H6PB 2Y2YA 2CXKA 1SYVA 1A6WL 1T04B 1JN6A 4PGDB 3BPLC 3S5YA 4FJZA 3MV8D 5FW7A 1TYRA 1GZPA 4HSCX 4EAEA 2ZCKH 2WXNA 3O0RL 2DQDL 4FFYL 4HK0B 4YPJA 3A6CH 3MJ6A 1DEEB 4UM8A 4XNUH 1S7XB 4PRIB 4R9HA 1OSYA 3D12B 3GJFB 2VDOB 3TA3C 5T3ZL 2P42B 4JM2B 1A9EA 2WY3B 1EFQA 1LMKA 1INEH 4JFSA 5F7EL 1YJDC 1CD1B 2JKNA 3SO3B 4BFGA 2AJSH 4DWHA 5TE4H 1UB5A 2ZT9C 3D5OF 5E5MB 5KSAD 4B9KC 4XP9H 5GZOC 2BM3A 1KCSH 3MRLB 2OMXB 5DZJA 5LWYH 4PPTA 1DN2A 5DJ2A 2BRRH 5F1NB 2X4TA 2QGDA 2YKLH 3ERXA 3QT2A 4F58H 4RAUA 4NSKB 1CZ8L 2F18A 2DKMA 2J4WH 1FL3B 4P59L 1JGEA 1I8IA 2E27L 4JLRB 5DURD 5T5FH 4RSYA 4A2LA 5EOCJ 5I30L 5C2BH 1RZPA 5BUGA 3OGCA 4AXWB 2A73B 3ARXA 3VFPB 1BGXL 2J88L 3HRPA 2WXLA 1TETL 1GYUA 3L7FB 4OZHF 5GPRA 2E3VA 4IRJD 5LB1A 4R97B 3L81A 4FL4C 3GD1C 4E0RB 3D39B 4FOMA 3CFCH 2B77A 1WA1X 3EDDA 3FTUA 3JUZA 3PREA 4CU8A 4BK5A 1Z2KA 4PJHF 5LBSL 5EU4A 1JHTB 3SBPA 4MNHB 2AW2A 1UYWL 5L2JB 2M8XA 2YD2A 4FNUA 5F9OH 4NWUH 2Y6TE 5EO9B 1WBYA 1P5VB 1S9VB 2X41A 4N2HA 1FNSH 3FQTB 4GKSB 1Z5HA 1T1XA 1SLVA 3SODB 3ORJA 2XV3A 3QARA 2WIIB 1DYZA 2VQUA 2WVSA 4YHIA 3TYGH 2B3RA 3RWHA 4ALAL 2XG4B 4YSRA 1JYWA 1GHFH 3FRPG 3MGTA 4P3CL 4U1KA 2HCZX 3UAJC 5KYWB 5C9JB 4QI3A 4Y4HB 4DGWC 4F2MA 2GSIA 1ZXQA 3JWNG 4I0PD 1X5MA 1NMBL 2LU3A 3HN3A 5JPNC 5D7KD 4K0OA 5I76B 1LE9B 1HXKA 4P05A 2AJUH 3L1OH 1T2JA 1CYGA 4Y2LA 4PJ7F 2VW4A 2OJZL 1PJWA 3VI4E 5GGTL 4HIQA 3LNIA 1V7NH 4HDIA 3KLHC 3FAWA 5CS7A 1FFTB 5DVNA 5C09B 4UIMB 3GJEA 5KVFH 3AT9A 4UV7L 4WTZA 3BP4A 1M42A 1G7IB 1GZQA 3TVMC 1WP6A 3GLEA 4TVPL 1FFOB 1MWAB 2HRGA 3OJDB 5KANI 3BVNA 1UASA 3WSQH 5I1GL 4B9ZA 1NIAA 3GS0A 4XAKE 2DMHA 4H1LG 5HYJD 2G75B 4CC1A 3AW5A 4XP1H 3H56A 4GRLD 3RJOA 3FN9A 4LQFH 1P1ZB 1SOXA 4R4FL 5I0YA 4N0RA 4ZX4A 2UWEB 3PU7A 5T3ZE 3BRDA 4PJ9A 4GEIA 2GK2A 3T4YA 2QHLA 1H6EA 3AY4C 5DDHA 4K5LA 5IVNA 2Z64C 3VH8G 5I6OA 3LNEA 2UVEA 1KJMA 5DS8B 5DTFB 3V79C 1SYSA 1Q0XL 2IADB 3QZWB 1N0XH 2FYYA 3FAXA 3A4EA 5JZ7D 4CNIB 1VLXA 1HFUA 3HJEA 3MRBB 4YNYB 1F3RB 3DI2B 3KLKA 1TG8A 3AJ7A 4M7LH 2QV4A 1X9UA 5AW6B 1IBHA 4MQXC 4POYA 5D55A 4WTWA 5D1ZB 2PR9A 2Y0SA 3S88H 1YNTF 5BO1L 32C2A 2JJSA 1BZ7A 5E8PA 3ARRA 1IFHH 1CTOA 2UY6A 2YUXA 5GGSA 3TN0C 3CN4A 1IEAA 3E6FB 4YHPA 4DPCX 3P4MA 4L8CA 4LPWA 2CXGA 1WTGT 1NBZB 3U48A 2BVPA 2WXHA 1RUMH 5EU5A 2NY2D 3G9VA 2HH0L 1J0HA 2DPKA 4KUCD 4IIZA 1XGYH 4NHUB 3ZDWA 1E5ZA 1HCFX 4ETYA 1QSEE 2PW1A 1T0MA 3Q8AA 5JOFA 4YBLC 4KH9A 5A16A 4ZBJA 1WIPA 4NNYA 3OF6D 3Q9PA 5ISZA 4X83A 1VB9A 2YO3A 3B83A 5E8OB 3IN0A 4A04A 5K1NA 3EYUH 4ZMLA 2VAAA 5HD8D 1K5WA 4RMBA 3W81A 2X89D 4WJ5B 1HCVA 4PV9B 4OH2A 4ZRGA 4FQ1L 3X1GA 4X98B 1CJYA 4N2NA 4PRPB 2VISB 4I18C 4HJUA 3LS4H 2VR3A 4BFIB 1RZFL 4JHVA 2WGNB 3BMVA 4M48L 3RKDC 2CCVA 4K7PX 3AU1B 3B3IB 2QPEB 3DHUA 4R7VA 2OYKA 2RB8A 3CVIH 3NFSH 3UBHA 3U9UA 4Z5RB 4I9WE 3HC4L 4HMEA 2F58H 1AKJD 1RJYB 3QHZH 2NX5B 1PCSA 2XIIA 4Z9KB 5C0IA 3MRMA 4RCAA 1J1OL 4F1SA 1O0VA 3NUKA 4X5XB 1CQYA 1T0NB 4ELDA 5I66B 5DUPH 2P8LA 3OKOA 4ZMVA 2BJMH 1DQIA 4O51A 3PFUA 1IAKB 4P4KB 2X4OA 4U0RB 5I24A 4K55A 5EZOH 2UYLB 1XGZA 1A47A 4B5EA 1I1FB 4FMFA 4P5TC 4BQ6A 1DJSA 1Z32X 5D7IE 4GW1B 3MBEC 3OMIB 4CJ1A 2K4AA 2WUBL 3KJ6L 4JZNB 4LCYB 3L4ZA 3UADA 3KHQA 1JMXA 1T2QH 3NABL 4TVPE 4Y4FA 5D7JC 3UTZA 4AITA 4AEHH 3A67L 5EIIA 4YDLC 2X38A 3S96A 1LO5B 5I1AB 4UQ2A 4DVRL 3BIAX 4MZRA 4FTVA 1FVCA 3IYLW 1XZ0B 4MD4A 4DGUA 3U4AA 3DIFB 4KZEH 2BOBA 1DQLH 3N55A 3GRGA 1GXEA 1TFPA 2DQHL 4JDEA 3QZMA 4M4PA 4EXPX 1XR9B 2I26N 4AGPA 4KHXH 1AYOA 2WUCL 3ARFD 4D3CL 4HK3N 1F4YH 4ZPTA 1QO3B 3CQQA 4QNPE 5JPMB 3VXUA 3BIKB 3W9EA 3T65B 5JIMA 3BP5A 3V52H 5H35B 2XJLA 3N3EA 3C5XA 1TIUA 1TJXA 4GEJA 3LNFA 2CKBH 2BVOA 4AQ1A 1NGXA 1HHKB 2WTRB 5EU7C 1HEHC 2IQAB 3M17B 2MSPA 4F2ME 5L6YH 4FYTA 1ECYA 4GG6A 4KI5D 5GS0H 3NACH 2FO1A 3H9SE 1R5VA 4GW5A 4EIGB 2NQCA 4UQ9A 5J12C 3ARPA 1FVEB 4Q6YA 1KTDB 3QQ3B 1NCNA 3QJZA 3IXTA 3GSOA 5AYUL 4B96A 2KDGA 1KT2A 5K59F 5GGSY 2WVVB 2ZG1A 2BVEA 3EGXA 3EFOA 5BZWA 1WUZA 3QP3A 5FA4B 2IWFA 4AH2B 1L0PA 4YQXL 2EIJB 1Z6JT 1AGDB 4LCVA 4IOIA 3S5LG 1BVNP 1EEQA 1QSFD 2OI9B 3CZLA 3HZYB 2RCSH 1ZVNA 4R90H 1CXEA 3FQNA 2AQNA 4NKQB 3OQ3B 1S7VA 4FCAA 2V8LA 1A3LL 3QEQE 1NCDH 4PW9A 5T33L 3NIGE 4KJWD 4IBQA 2GSGA 5EOTB 1EHLL 3BGFB 5I75B 4RMVA 2AK4B 1LK2B 3HAEA 1U36A 1A4JA 4LCWA 2ATPB 4OIIH 4Z7QE 2JJVA 3KLAB 4TPRL 2BSBA 4F57L 1YMMA 4PJDB 1DBBH 5DMIH 1ZGLB 4JG1L 4DAGH 1FVDB 2HVKA 2BSRA 5CSZA 3QZLA 5I1LB 3S35X 2GB2A 2H2SC 5IW6A 1SN0A 1T03L 3QUYB 1KJVB 4W9LC 3S3JA 5FHBH 2L7EA 2HKFH 5AW1B 1MJUL 3LKQA 2J1ZA 4NZRH 4WUUA 1I9JL 3GM8A 3TWCH 1U95B 3H85A 4FMVA 1DQMH 2R1YB 3HG1B 2WXJA 1ZLVK 4XP6L 1OKEA 3S3BB 4MD5A 3DUUB 1RZKH 3WJMB 2HT2C 1ETA1 5JDSB 3ZUNC 3OC8A 4MJID 1WD9A 4P2RD 1NQBA 4MB4A 3GFUA 2ICEB 4ZFFB 5LGYA 1W8OA 4QCIA 3FW6A 2X6CA 2HXAA 3VFOA 3MLSH 4J3VA 4A68A 2XX0A 1OY3B 3CAFA 2LLGA 4I89A 5FGCB 2YD0A 3MJ9H 5TF1H 3ISRA 2TRHA 2AJXL 3ECBA 5IEHA 1E28A 2WV3A 3DURB 3G5YB 2IAAC 4BELD 2A9CA 4PJXA 5ICZA 5ISZE 1IQDA 4R8WL 4DP8X 2MPAH 3US1A 1SMOA 1KN2H 2AQRA 3CZSA 5CO1A 3QIUC 4OCXL 2ENPA 2CZNA 4XX5A 2CDGB 2JK5B 4U1SB 3GT6A 2CRZA 4Q7DA 4AZ8A 3GKWH 1YYCA 1L7IL 3VQ1C 1VACB 2WZ5A 2AXGA 4KMQA 3DV6A 5D7HA 3H4HA 4B0MM 4L5FH 1MHHB 2X28A 1MEXL 2J8UA 4NJAH 2CLZA 2PPAA 1BVLB 1BFVH 35C8L 3NAAH 2ZNWA 3E8UL 1JZ7A 4LCCB 4PRBB 1T4WA 1W0WA 1A8ZA 2BY3A 2DJMA 2OXHB 2DM3A 3B1UA 3VI3A 3TZVC 5KVGL 1MREL 1I85A 3ISWA 1K8DA 3BUYA 5HDLA 4G6JH 4E9YA 2MHAB 3OG4B 5F9AC 2YRZA 4P46A 3EO9H 4PJ5B 3VXOB 1DFBH 2YGOA 5D1XC 1HKLL 3FN3A 3KVPA 3UPAA 3DECA 3IDMB 3N1GC 1MCSA 5KTEL 4JRYA 4YZFE 3U7YL 4V11A 1J7VR 2HP4A 3WI9A 3WXWH 3PV7A 4DJMA 3ZKND 4UM9B 1TEGA 1M56B 1RLBA 1XH0A 2YAMA 5FGBA 1QBBA 1UM6L 4GBXD 4B95C 3K6OA 5DQDL 4RWYH 2XV6B 3T3PE 1OE2A 2DLGA 2YGQA 3LKRA 4YBQC 2V2XB 1AQDA 5LGHH 3RBGA 4WKZB 4GQPH 5JHLH 4KROD 5C1MB 2CDEA 4X5PA 3TBWB 2MQCA 1SDDA 4FJ6A 4IOFD 3DTXB 3HNTL 4FTVE 4P2QD 2ESVB 4NFCA 3SGDI 5B38G 1DQKA 4GP8B 3UO8B 1D5BA 2VDPH 2Y7LA 4OLWH 5ALBH 2N7AA 4F2FA 3MKGA 2FEDD 5I71B 1H3TA 5J13B 1AGCA 4Q0XH 3MRRB 3QZBA 3PHQB 4UV4L 2A9ML 4S0SD 4KGLA 2DQTH 3QEUB 3VXUE 1LQBC 5CILH 2J5LC 4DCQA 1H3UA 2HFFB 1FN4B 3VRJB 3I6GA 1EO8L 1OSZA 1XR8B 4IS6A 4P5KB 4EBQH 4JPVL 1VEMA 1YEJH 3AS1A 2I60L 3RZCB 2OXGB 5HHVH 1DBKL 1THAA 3LRMA 5F3HA 2PETA 4LRNH 3MLRL 1RHHA 4JRXA 2FLBT 2EABA 4F24A 3WV0A 4M5ZL 2R8SH 1LNUA 4LLAA 1AI1L 1EJOL 4PMFA 2Z8WC 5B1KA 4HHWA 4WEMB 2QVTA 3FK3A 1WFNA 5KYXA 4DGVL 4JFTA 2FD6H 4P9ML 1TEFA 4P9HH 2W9EH 2VR7A 4PJDF 4WDIB 4KTEL 2A4ZA 4F37K 5C7XL 3PDDA 2B7DT 3BGAA 4MA7L 5SWZB 2DF3A 4J6RL 1EO7A 4WI3A 4F7PB 2H3NA 2JTDA 3S3CB 5BOJA 1WFMA 1MUJB 1N7ML 2CDFA 3FB7B 5D72H 3UERA 1EMTL 1NMCB 4HPOL 3GMLA 3FQWA 4FNLL 1UKSA 1KIPA 4XPHL 2WBJC 3RWFB 1NKGA 4IRSA 2AQPA 4QHLA 1OW0C 4E42A 1AD0A 4R84A 3CWGA 3DPBB 2YWYA 3TNNB 1IQWL 3ARED 3U4BH 3OAZK 4ZAKA 4D0CB 2B20A 2NZ9C 3QW9A 1M71B 4B7LA 2WMPA 4KK9C 1I1YA 4HXBH 4LLVB 4RLDA 5AALA 2X2JA 5DYFA 3S4SG 4DERA 3DRTB 1CE1H 2QEJA 1XX9C 4QJ5B 1YMME 3MNVB 3BUQA 1VESA 4UILH 2R0LH 4FQXD 2BMKB 4NI6A 4JO4H 1QSVA 4QF1A 5E0FA 1M1XB 5J1AB 3D85B 5EUKA 4JQIA 3P2BA 4YGAB 4I1RA 1FGNL 1T6BX 4JFQB 4XZUB 4XVTL 4ZMAT 3WIHH 1J18A 3A5VA 4HCIA 3ALWA 4GIPD 4UAOC 1K8IB 3HMXA 4WUUE 2QHRH 4Z76B 2DWDB 3B37A 4HKXA 2IAND 2GC7C 2JXMB 3LH8A 1N59A 1U6AH 2ODIA 1PSKL 3IDGA 2H3XC 2NW3A 1A14L 1ID2A 2XIBA 5D1ZI 5C07A 4Z3FA 4KXDA 3WIFB 5D2LF 3S8FB 2X7LA 3BZ5A 1NL0H 1XIWB 5B1AB 2HZHA 2O5YL 4EVNB 3LKPA 4HQQH 5I0WA 2Y25A 4PJGB 3LVTA 1D6EB 4W4NA 4M61B 5DD3H 4L3EB 4RGNE 5G55A 3SDAC 5KAQF 5DVLA 2BZCA 1E4HA 2PXYB 5KBPA 4Z7VB 3MRCA 2AF2A 2XTJB 4EDXA 4LGSB 3REWB 4WIQA 1BM7A 4GPVA 1OHZA 3HE6C 5HPOA 1JL8A 3P40A 3TT1H 1EZVY 4QKTA 4Y1AB 2BOLA 2WO2B 3MHZA 4PJXE 1FZKA 2E76C 3CXHJ 3G08B 5L7XL 1LHZA 4I87A 1IJ9A 4LLWA 1CDCA 4G70B 5F71A 2EE2A 4IIQC 5IR1B 2FO4B 4D94A 1K4CB 2CIKB 4YE4H 3LQAC 3TH3T 3B2DC 5K9OA 2NXZD 4NKIH 1D6VL 2Z8SA 4IKLA 4C57C 3L4WA 5GGRA 4D7BA 5IGXH 4OFDA 4NUJA 4ZPVB 2IH1A 3TBTA 3MTXA 2J8UE 2OV0A 5M7QA 4JUTA 4QRPE 3IFNL 3VXPA 3SQOL 3V5KB 5AVYB 5K9JL 5T1MB 2LHAA 1DQQB 2BY0A 1PAMA 1YPZF 4TTDD 1BWMA 4N22A 1J0KA 4Z7UB 2HKHH 1QATA 3F64A 3BKJH 3K91A 1NFAA 1NAML 3RDTC 3HMWL 2VDLH 4NRZA 1X5FA 1GIGH 3ZHNA 2NR6C 5DUBB 3VGDA 1BPLB 3T0DA 2ZXEB 1QYGH 2CCWA 3FBKA 3VSUA 3D48R 2VLME 2VXVH 4Z0XB 2LOEA 2R1XB 4KO7A 5SWQA 4JRYE 1TTRA 4HV8B 1TZ8A 2IBZX 4OZHA 2IH3B 3OC5A 5K93A 3UAAA 3BDXA 1RZJH 1OAKL 3EYVB 3IS0X 3WLBA 3KHOA 1RU9L 5AUMA 4ZUUB 1BHGA 2AI0H 1IKFH 4LSSH 2EH7L 3QIBD 4XTRC 5EEXA 3ZKXC 2QVMA 4JKWA 2CJTA 4FQLL 4JM4H 4NCC2 3T77B 5HY9B 4WAFA 5I17A 4JFPB 4OLYL 4Y19D 2H6OA 4PJHA 4TUKL 3WS6A 4ISVB 4G7VL 4PJAA 5CLTA 4CRPA 3NEOA 5F3FA 4BH8A 1DJHA 4YL4A 4KRLB 2BSTB 3FQ1A 4GQ9H 3UDWA 4CU6A 3HBGA 5IP4A 2NY5C 2VDNL 2OQJB 3BZEA 3FS9A 3BSGA 5EF3A 1P4BL 1PCXA 3C09C 4JFFA 4XT1C 3X3GH 4A2GA 1ZVHA 3VB8A 4HIHB 3QIWB 1MKFA 1MCBA 2CHDA 3OHXA 5HHOA 1CL7L 1NAKH 4LVHC 3AG4B 1DLHA 2QPDB 3WO4B 3BPNC 1HN1A 3EGDA 1NANI 5E5RB 2WZPD 3ZRSA 3HI1A 4E9QA 3SO5A 3SKOA 4GYBA 3MBWB 3FSOA 4CADA 2A6IB 4OZIE 1KJ2H 2BNRA 3U0WL 5DHVH 1R5WA 3BQUD 5AEAA 3MGOB 1E65A 2YAOA 4JKMA 3B7TA 2NYYC 2L4OA 2Q7YB 2G4EA 1IEHA 3EZJB 3RWGA 1VEPA 4TNGA 2DMCA 4XPFL 3TESA 2GJ6B 2BSED 3CDCA 4HS3A 4IM8A 2VLLB 1HS6A 3OAWA 4PCSA 1DBMH 3HZVB 4U6TA 3VW3H 3QDJB 1OP9A 1I8MB 4HIPA 3ARZA 1S7QB 2YXWA 3B9VA 4O58H 4C47A 4PRHA 5C0AB 1MHEA 2PWDA 3VFVA 2GJZA 4FQ2H 3UTTD 2EH8H 3LD8C 5HHXH 2CKNA 1N2RA 1KPUA 1UWEH 4C4BA 2O6CA 5DVMA 3ZIYA 1MAML 2XI9A 5CMAA 1UQSA 5D71L 3RDJA 3VXNA 2CGZA 2R0KH 1I8LC 2WLJA 2WQRA 5IK3B 3ZQXA 4KY1H 4Q14A 4F7EA 5AVZB 2X3AA 3G04A 3WFEL 3M88A 1NMAH 2E7DA 1K6QL 3FO9B 3KG5A 3FTSA 4XVJH 4UTAL 2QSCH 4LAQH 1BYOA 4ECNA 3V5DB 3ABZA 3M1CA 4NUPA 5FO9A 1MFEL 5GGRY 5TDOA 1RV6X 2DQGH 3OX8A 2PMZA 1IC5L 1NDTA 1J5OH 4YUEH 4EXKA 2XWRA 5EIQA 2H6PA 1ZLWK 3PXJA 1T04A 4J12A 4Z7VF 1A25A 2XYCA 2VKWA 4XPGL 1XH1A 2H3KA 3U6RB 3HA0A 4NO2A 1FZMA 3DETD 4CN6A 1DEEA 4AIEA 3GUFA 4A6YA 2HT3C 1MXDA 1JV2B 2ZOUA 3HBZA 3I3BA 5DZ9A 2JB6A 2GAZA 1YNTA 5KVEE 4QGTA 4MMZB 4Z78B 2YA0A 2ARJQ 1UWYA 3EFDL 5C07E 4B9CA 3MUZ1 3II3A 1CXIA 1LO4L 4GRWB 4PLOB 1QPKA 5E5MA 5HVGB 3V7AG 3TS8A 4P4RB 1RL1A 1Y18B 2OMXA 2WXOA 3V4VB 1BBDH 1QNZH 2JJTC 5F1NA 3CHRA 1QRNB 5IT2L 1MWOA 1ZV9A 4NP4L 1C8PA 1ADWA 1CC3A 3BZDA 1CLZL 4KITB 3MJ7B 2UXTA 4B9JA 5I8CA 2HB0A 4ZMXA 1FPTL 1FL3A 1QHOA 3IJ7A 1IL1A 4RWHA 4WNQB 4JLRA 1ASPA 4I2XB 2APBA 2AXHA 2XWJB 5E9DA 4MAYD 4Y5XB 2MRYA 4L2LA 3HS0B 3Q3GA 2G0LA 2E7MA 4AXWA 2FUQA 3G6DH 4RZKA 2QZ5A 1Z9MA 1R24B 4MB3A 3POCA 2GY7B 2Z8RA 3VFPA 1XCWA 2GUOB 2EIBA 2ZX8A 3R06B 4FZEH 5D9SA 3TFKC 1NGZA 1EVTC 1SMAA 2Y7SA 5DZPA 3HC0A 4YHLL 4MJ6A 3RNKB 4E0RA 4GSXA 3ZZLA 3D39A 2GITB 3CXHK 3AM8A 3RU8H 3UEZA 1BD2D 3RVWC 5HYSG 4F9LC 5EC1A 2MWCA 3FO2B 1JHKL 3GB7A 4LIQL 4HLJA 2PW2B 2D3LA 4AT6B 4N9GA 1YJDH 4B97A 3FMGL 3NK3A 4W9CC 1D7DA 4A6YL 1F0LA 1S7WB 2DI8A 5ETUB 2NSQA 1AOZA 1T5WB 2QT6A 1CS6A 5L2JA 4WNSA 4OF3A 1J5CA 2YS4A 5D7SH 1IBFA 4XXDA 1P5VA 1KLUA 3FFOA 4JPKH 1XAUA 5FKPB 2H7WA 4GKSA 1UCTA 4XO4A 1NLDL 1IIKA 5I26A 4NWTL 2H5UA 3VFSB 4WLCA 3L48A 3IMTA 2WIIA 5HGAA 5IWLC 3ETSA 4OZHE 3RGVD 2BNQD 1XBRA 3QJHB 2V7NB 3DUSA 2AERT 5F7YC 3GIZL 5I19H 1MY7A 2XVBA 4H40A 5KYWA 2WLNA 3AXLB 1QWNA 2Z7WA 7FABH 1AQHA 3HE7C 3RFZC 1ZGLM 4KDWA 4Z95H 2NNAB 4FP8L 1QQDB 1M7IB 5CCKH 5I76A 5AVUB 4G7SB 1LE9A 3C9NB 5JHDD 4PJAE 3INUL 3Q1EA 2BY1A 1H5BA 4ODTL 3NN8B 5DRNB 1J9QA 3P73B 3L08A 3T0EA 2JJWA 4UIKH 5CFAA 5BW7C 1Q0YH 4YDVB 5DVPA 3STLB 3GZQA 2TSBA 4EN3D 3K0WA 3Q5OA 1KBVA 2DD8L 1R3HB 4JFFE 3BP6B 1IX2A 4NBZB 1X5XA 1LYQA 1G6RL 4HU8A 4G6KL 4GT0A 5DHYB 1FFOA 1RP8A 3HC3H 2ZICA 3SDDB 3HLAB 2H6UA 3IETA 4WO4C 5FFOA 5CSBA 3L9YA 5KSBB 5JOPD 2VH5L 2ADJA 2WN2A 3ECQA 4ZSOB 4BQCA 2A38A 4AWJC 2G75A 2NT0A 1QUNA 3MRHB 3FO0L 4UOW1 3ZQ9A 1DP0A 3WN5C 1JFQH 4JO3H 5J06A 1UJ3B 2BNRE 2HLAA 4W9JC 2D3NA 3GMOB 4Z3IA 1ESOA 3WHE0 2QKIB 3IDNB 1P4LB 3E80A 2YXVA 3D05A 2CM6A 2EDOA 3EO0B 5DS8A 4TXVB 3SQBA 4XHQA 3KPOB 2P43B 2DV6A 1SXBA 3K80A 3SD5A 4PB0H 5IOPB 3QNXA 4HKBB 4CNIA 4LEOB 4U6VH 2FAUA 1UC6A 3LH2H 4PRHE 1EA9C 3S34H 5C0DB 4HBCH 1LE5B 1UXLA 1BDYA 4MCYA 4YL9A 4N6RB 1CLCA 1HTYA 1IMHC 1JXFA 4HSAC 2V37A 4PYHA 3WY2A 5HI3C 3T1FA 2CUMA 2PLTA 2E7HA 4L8BB 1CXKA 2VXQH 4ZQTA 1MF2L 3QHFL 2FJSA 2IAMD 4TSCH 3E6FA 4LASH 3KEDA 3N40P 2A0LC 4WFFE 1RSFA 2ZXDA 3PWNA 2B59B 1NEUA 1NBZA 3G6JF 3CDGA 2EDDA 3F7QA 3WHXA 1KZQA 3HNVH 4W9EC 5CU9A 3RIFF 2ED6A 4HT1L 1NC2D 1YYLL 5AKRA 1OP3K 3EJZD 3ZGIA 2CO6B 5IESH 2YZ8A 5AL8A 1KB9J 3IKCB 1QMUA 2XBDA 2ZCHL 3NSFA 3H7BA 3TNMA 2V9TA 1E67A 4PRIE 1G0YR 4L4TB 3UBGA 4XBGA 1Y1UA 1KCRH 5JW5A 4HWEH 5I0DA 4PG2C 4M3JA 3HBPA 2LE9A 3UGEA 4MJ5B 5D4JA 1HH9B 3HG4A 3MROB 4NZFA 4PV9A 4X98A 3QJQB 4ICWA 4PRPA 2Q8AH 2VISA 4LLUB 3MJGX 1OAZL 2XKNB 4Y5VC 4CMHB 5DJ6B 4CDGC 4JFEA 1MQKH 1Z9SB 2Z35B 2I7SA 1IE4A 3CC1A 3T2QA 3UBXG 3DGDA 3AU1A 4GP5B 5F96H 2WO3B 4H8WC 3IVKB 3KL3A 4Z5RA 2Y7NA 5IHLB 1S3RA 3MZGB 3GI9H 4XAWL 1RJYA 1TVHB 5GRVK 5HI4D 1UWGH 4XP4H 3SY0B 4TQIA 4AGNA 1MIEL 1MVFA 4O02H 5E9DE 5CBEB 5D1QB 2ZPKL 4NQSB 3QQ9D 4J3UA 4Q9QH 2MMXA 5ITFA 2VDNB 1WIUA 1XGPB 1NBVH 1JK9B 3DX3A 1E6OL 3IDXL 3RGBA 3BYTA 3ZTEA 4GOSA 5F9WB 4IRZA 5EOQH 5ADOL 2UYLA 4AVIA 4ZD3H 1RSYA 5IG7B 4XX1E 3IU3B 4S0HA 3QUZD 1RK0B 1TNNA 3ARDC 1ZE3C 3D39E 3ZE0F 4LCYA 4DEPB 5ICYB 2WWOA 2NYKA 3BH8B 3VO0A 1H3PL 2WWMC 5MEOB 1KIRB 5EUOB 1OP5H 4EF3A 4G6AD 1OZTG 1Q9LA 1WFTA 3KPNB 3Q05A 3IT8D 5I74B 5I1AA 1GW6A 5D70H 4M6MH 2WSPA 3RVVC 5BS0A 2DQFB 3QNYA 5JXEC 1OANA 3X14B 3KWUA 2PCFA 3MRPA 1I75A 5CKGA 1WHPA 4UTBL 3B56A 5ADPH 3OPZL 1G9MC 2I07B 5DZLA 4JL1A 2I5YL 5EF1A 5GSVA 5F1IA 2MKWA 3BWZA 2YRLA 4NGHL 3CN3A 3QJVB 2VM4A 1JI2A 5JPMA 3BIKA 4PR5A 3T65A 3MV01 1UWFA 2XN9A 2ZJSL 5AVQB 4WKXA 1P7QA 5KBLA 2VUKA 2WTRA 4QR7A 4A38A 3M17A 4TS6A 3GKZA 5KG9B 4K8RL 3FRPB 3LEYL 1HCZA 3FFCB 3QDHA 4X80H 1Z9OA 2MIZA 2YA1A 4W93A 1DE4B 4NERA 3B9KC 1FVEA 4OBSA 1KTDA 5I28A 4NZJA 2XACC 3LMJH 3TJPA 3WD5L 3L3OA 4KXBA 3BZ4A 3EGSB 4LOUC 1VPOH 3L3KA 4IRZL 3L5IA 2FJGA 2BX5A 3ZT6A 1QG3A 3FU8A 3TVMD 1T7WA 5C09E 5BV7L 2JKJA 4LSDA 1MDTA 5BQ7B 1HL5A 5B39G 4BBWA 4MDIB 2R9HD 4X6DF 4QHUB 1I1AD 3D0AA 5DJZB 1AGDA 1U91B 4X9IA 5DJYB 3MRQB 1FWXA 2MNWA 3EBHA 1A3RL 3HZYA 4GAJL 3B3BA 3S36L 3MRIB 2XA8L 5E0QA 3ZMEA 4IRJB 3KVDD 3UZVA 1OSPL 1ECZA 5F21B 1RUAL 3V0HA 3WEXB 1EHAA 4ANWA 3QORC 5FLUA 4MMYA 4H1LB 5EOTA 2UWEE 1CDJA 3GQFA 3PAUA 2FECL 2PR4H 5FDWB 5FYJE 2H8PB 1CT8B 5CJ5A 1RVFH 3EDKA 4NM4H 2AK4A 1DVQA 1EUUA 4K9JA 3SYPA 1HYSD 2WTPA 4LK4A 5AL0A 2ATPA 3QUXD 3IMVA 2EXYD 3KPLA 1SHWA 1D9KD 2ZSWB 3US9A 3JTBA 3LEVH 3ATBA 2DYPB 5EU3B 4PJDA 1D5RA 4TUOA 3OKMB 1ZGLA 2DWSA 3JV4B 1QSED 1PU0A 3NJKA 3VH8B 4P5MA 5IQLA 2IDQA 5I1LA 2ZUUA 4KQ4H 3SKJL 4ZUTB 1IKNC 3QUYA 3F7KA 5L4MA 3BH9B 2QGBA 4BYHA 1F4WH 1FBIL 3L9RB 3MRNA 2OL3B 4AYBA 4X9HA 3B34A 4KKLD 1CCZA 1SQ2N 5DHMC 4CVZB 2XETA 3V0JA 2R4RL 4H26B 3VMPA 4Q4EA 5E03A 2KZ1B 1B9KA 3N44F 3IPFA 1XF5A 1SOKA 1V54B 3P30H 3DUUA 4I0PB 3ZE2B 4RX4D 4NM8H 1XTMA 4WK0B 1P9MA 1XBDA 2KBGA 1QHPA 3L3DB 4XPAL 1NWPA 1QFOA 4YLCA 2WZAA 2B1AL 1ZVSB 4AYGA 3QEHB 2Y9RT 4UQ3B 4HUKB 2X70B 4HC1A 4X4ME 4I9WD 4C58B 4J27A 2J21A 4NN5B 4NT6B 1ZT7A 1DSFL 4MZIA 1D5IH 4JJOA 4HGWA 3CLEH 3DURA 3G5YA 1G7HA 2WKOF 2AAAA 5AB2A 3VGGA 3K8LA 2EVGA 4XVSH 4AX3A 1OVZA 3PWPB 3QZOA 2P45B 4PJCF 1XHHA 3TO4C 4HLZH 3APFA 4OR1A 4ZFQA 2HJFA 2DIBA 2AK1L 3D9AL 4G9FB 1ZS8B 2BXZA 4GUCA 4I48B 4OY9A 1A1OA 3GC3A 1A1NA 4RGOH 1BZEA 4KNUA 1BM3H 4ZQKB 1VACA 4F15B 2YHGA 4PRPE 4OFYD 5D2LA 1NOLA 3CLWA 2PO6C 5E6ID 4FZ8L 4RMSA 1KBGH 25C8H 4JZOB 4EQ2A 2F1AA 2EYRB 2WBKA 1BVLA 2BHFA 3H9HA 4YE0A 1NCCL 5EUOF 1R3LB 1S3KL 4KXAA 2ALAA 4WI6A 2W88A 3IKKA 4NQUA 3R1GH 4ILDA 2NX5E 4HLEA 1VKXB 1AIFB 2MHAA 5I1CH 3W37A 1UD5A 1F11A 5HGDB 2XTLA 1IM9D 1E4JA 1M53A 2HFTA 3GSXA 4GSDL 1CD9B 2J6EL 3IDMA 3IWVA 2BWDA 2V3EA 1VFAA 2QQQA 2DDQL 4HMDA 4I3SH 4TMPA 5DJ0B 4KRPD 4OF0A 4S1SH 4OZGB 1J5HA 5E2UL 2EYSA 1UHVA 4GMTL 5C0EB 3GSRA 4OI9A 4WTQA 4HC1L 3FN0H 2LU7A 4G1MB 4AVHA 3LV3B 2V2XA 2VERA 4P2YA 3IFLL 1B4JL 3CMOH 1ZSDB 1MW2A 3PGCA 4PWKA 4WY7H 5K69A 1KDIA 3H3PH 1UT1A 4MXWH 3K2UH 3H9SD 5IQNA 4BV1A 3DTXA 4N2FA 5EZIL 3TF7C 1QFWL 1S9XA 4ZMOA 3O6FB 4N25A 3UL4A 1LL1A 1S5IL 3MLUL 4KQ0A 3C6LC 1R1CA 1AZVA 3MRFA 4KDVA 1RKRA 5DU7A 2NCEA 4DO5A 5EC2A 4JZJB 2EJ1A 1CBJA 1P6WA 3SPIA 3MRRA 4IU2A 5B4MD 4Z77B 4H88H 1ACZA 2UVFA 3QEUA 4JFDD 1Q1JL 3AABA 2PNDA 4AKQA 4DFIA 3BAKA 4BSJA 3G7TA 3H7LA 2HFFA 2HRPH 4Y2OB 3B5GA 3RVUC 1G43A 3BH4A 1P4UA 1OV8A 1DJWA 3L5XH 3FCGA 4FFZA 5E2TL 1NUNB 4CSPA 4G7YL 5DJ8B 5MERA 1BAFL 3CVHH 3QEQD 1TT6A 2HJKB 5K1JA 3EHBC 1PD0A 2D03H 2IPUG 2YAPA 1W91A 5AB9A 3K6SB 4L8SC 1JBJA 1SRDA 1F90L 3CIAA 4AYEC 4P5RA 1JYNA 3T6VA 4M1CD 4I0KA 1RK1B 4YSEA 4WGKA 5KVMC 2C5DC 5E6YA 1YEDA 3X12A 5JIPA 2EVJA 3GF8A 4E9RA 2OMYB 4WENB 2B39A 2VQ1B 3QWRD 2A74B 1AKJB 3GBMH 4G82A 5F0LB 4LXFA 4WDIA 4Z6AT 5JYLA 4R4ND 2FYVA 4RRPM 1E8WA 1JFHA 1S7RB 1E30A 3QVAA 3ZMNA 5IROD 1BBJB 3EOTH 4Z1PA 3RWCB 4YK4C 4AYFA 1P0SE 2WJ5A 4FJYA 1XD1A 4APQD 3AADB 1WA0X 3GJFK 1XO8A 3DXAD 4FGMA 1MCWM 4F93B 3RWFA 3S5LB 1GZHA 4LHUB 1TU2A 2WQ8A 1I3RA 3T1WA 3G5XA 1EX0A 3DPBA 5AVSB 4XNYL 4DEUA 2X6BA 1M05B 2AK4E 1CFNA 2JNZA 2FT8A 5MP6H 1BAWA 3QPXH 2RH0A 4LL1A 3SOBL 3DRTA 3R8QA 3VGFA 4JCLA 4PJDE 3IXAA 3QUMH 4N2KA 1NDMB 4AL8L 2BMKA 1J11A 2BC4A 4OGQC 3PWUB 5J1AA 3D85A 1TJHL 2VXSL 3IAPA 4IU3B 4L9DA 4RFNC 4F20A 4EDWL 1I3GH 2EIDA 1Z9NA 1BEXA 4JFQA 4OJYA 4XZUA 1YY9D 5B8CA 1CFMA 4NQVA 3UEQA 4Z76A 3WEBA 1RXLA 2WQAA 2ZYRA 3ARTA 4LBEB 3G5ZB 4X7EC 2JXMA 3AMKA 1B2WL 5DA4A 1E27A 2P48B 1J1PL 3U6XA 3HRZB 4WHYH 3WIIL 5IJCC 2DQCL 5EZLA 5FYKL 3MFGB 4F9PA 3KWWB 3AROA 4CUCA 4M61A 2VW7A 2MCPH 1VEOA 3FQUA 1LEGB 2OMNA 3I6KA 5I6KA 2PXYA 4B41A 4Z7VA 2YQ2A 1H8NA 5FGCE 3REWA 3X1EA 1ND0B 1IBZA 1JZIA 3RPKA 3LIZL 3QNZB 3N1PC 4X4XB 5TQ0H 1RD6A 5DC0A 2EDWA 3KBFA 2WWKT 4MXQD 1CU4L 4FD0A 1MCKA 4JW3A 4XMLL 3A21A 1JF1B 3SGEI 1K4CA 1WE5A 4EN2A 2D9QB 3T5WA 1MVUA 4OT1H 4YR6B 4N1HB 1YAIA 4LSTH 5I2IB 1S78C 4G8IA 1LD9B 5D2LE 3VXRD 4DNLA 1YEWA 2NZ1A 4GQZA 4ZPVA 3CJJA 4GT7A 3V5HB 1A7OH 4LCIL 1J87A 4NDMA 5ICXA 1GGUA 2A9NH 4NO3A 3MXVH 3V6OA 2F19H 1RZGA 4BK5C 4NX0A 2N01B 3TZVD 4HLZG 2OR9H 1UXSA 3KPMB 2ZAHA 1DL7L 5AOZA 3FZUD 2BK8A 1SUJA 3DO7A 4X5QA 5CJBA 5DR5L 1EJ8A 1OEZW 3ARQA 3QAZC 2ZD0A 3HR5A 4PJ5E 1PG7L 2CGYA 2XNAB 4RBPK 5E9NA 4KUCF 3ZL4L 2Y06L 5I1DB 5CCGE 3MKKA 1JS4A 1F5WA 1IAIL 2V7HB 4L4VB 2XXGA 3GXUB 3I2CH 5DMKA 1HE8A 5AOJA 5T3XH 1IGFL 1PS3A 4HJTA 5IW3A 4TULH 3BSHA 4DESA 2EXWC 3EYVA 1CVRA 4P04A 1J86A 4Y8DC 2WOBA 1JDAA 3C6SA 1DZBA 1ETZB 2Q86B 3KYAA 4JK0D 5HY9A 4ZW6A 2CIIA 2QADB 4R7NB 3LQAH 4JFPA 4XPTL 1CL7I 2DY2A 2N7BA 1E2VA 3SE8L 4DN4L 4ZG1A 1GGBH 4QTHA 4ISVA 1OIOA 3V4LA 1L7TH 4PWFA 1A3QA 2ESVE 1R47A 1N3NB 4C4KO 2WIMA 4J4PD 2XWDA 2BSTA 3QQDB 4DPAX 5J9PB 3O3EB 2H32B 2FZ3B 3WDIA 4BXVA 4JHWH 3QRGH 4LNRB 3UMNA 3NZHL 1EFXB 4IBUA 4Q9RL 2IBGA 1Q90A 3CU1A 5BJTA 4YSPA 4HIHA 1QEWA 3MFFB 2WLZA 2LU4A 4ONGH 3P11H 1MJJA 2YKKA 3PV6A 4OD1L 2B16A 2AXWA 2AABL 4P3WA 1CXFA 2GTZB 3ETBF 4XMUA 3CLFL 3N2JA 5LBVA 1XZWA 1PZ5A 2Z92A 4NBYB 4ORZC 2VABB 1VIWA 3WJLA 5AZEL 4LLMA 2XWXA 2GBAA 1I7RB 2A6IA 3ZGHA 1P2CB 1AZRA 4LSRH 4PSPA 4PJ9C 1RZIB 5LAXB 2IMNA 1ZEAL 4YSOA 2D31B 3HI5L 3D33A 3VE0B 2MOGA 2APFA 2VE6B 4K07A 1ICTA 3R7QA 5DJAA 5H2BB 3SHSA 3BGMB 2GJ6A 2N59A 2NDGA 1JWSB 4PTTA 3GEFA 3QDJA 1UCBL 2R4SH 1I8MA 1OPGL 4JDZA 5I6XC 5GRUH 3B2UD 1G87A 4J2QA 1HH6B 5DYOB 2NY5H 4KAQL 3UTSD 4L1DA 3GS7A 4W9HC 2G9KA 4OM1H 2SEBA 4MYPA 1EXGA 4B3VA 1W72H 1ORQB 1F6LL 4PRNB 4WUUD 5J6HB 3WNJA 1WFIA 5CUSL 2JJSC 4LEBA 5IK3A 2NZ9D 2W91A 4S1RH 2FX7L 2EC9T 1IGML 2XG5B 4S1DC 4A67A 3OZ9H 1B0WA 3PP4H 4FS0A 2QMJA 5F0PB 5JMOC 1KJ3L 3OB0H 3NESA 4GMSL 2X1QA 4KI5F 1YECH 1M6OB 1TCRA 4O4YH 4X6FA 4YGVB 4CC4A 4PBWD 4CVXB 4P2QB 4AGQA 4V1DD 1JZ8A 1NGWA 1R34A 1TSRA 4JPSA 1P7BA 4JM4L 4YO0A 4HUWA 3PNRB 4BZ1A 5HYEA 3MLPA 1XGTA 3QDGD 4PV8B 3UOAB 4FKHA 2APVA 2YARA 2CUIA 1JIBA 1G9HA 1I53A 3KPQB 5FYLH 4BDVB 2OJ1A 3JWDH 1JV2A 3EH2A 4OGZA 1KN4H 4XMKL 1CF8L 2VDRH 3UYPB 1EGJL 3DC0A 1OLLA 4PBDA 1E8YA 2P5ED 2DMKA 3TBCA 4Z78A 5C86A 3HFML 4XXWA 3KYNA 1AXSA 3VSTA 4ZMWA 2XXCB 4HJIA 3NSYA 4CU7A 1MCCA 1AHMA 3H42H 1F4XL 4E5XG 4X7CC 4MA3A 4QRPD 3G6JA 4PJGE 4MD0A 4P4RA 4KZDL 1ZTXE 3C5SB 2A6JA 3VWJB 2WB1A 4Z7VE 1I4FA 1QRNA 1RMFH 2C9XA 1AQ8A 4MLIA 4ZS7H 4BZ2H 1RJZB 3CVCA 5IQ7L 1HX0A 3D1MC 4AC4A 3KPRA 4OV5A 1I9RL 4WNQA 4Y1AE 3D2UD 4E41D 3A0OA 4WHYG 2XWJA 5DLML 1CK0H 4UT6A 4J3SA 3KJ4C 3MJWA 4ANUA 1J05A 3MR9A 2VLMD 4XWGH 5F0MB 2YMXL 1R24A 5DS2A 4Y9GA 4C83B 3BXNB 3R06A 4H2AA 4IOSD 4K3DH 5CLWA 1FNGB 4D8PB 3TONA 5KN5A 2HJLA 2WXMA 4C8XA 5MI0B 4NN6B 3RNKA 3HHSA 1FZOB 3GHBL 1CR9L 3MV7B 4N2AA 5I1KL 2GITA 4FI7A 3HLKA 1WICA 2JKWA 4NLAA 4U1MB 4Y4FC 2Y5QA 4HCRH 4MVBD 1SGKA 3IFOB 3MA9H 4BZ1L 2R23A 4EZKA 2JCCF 1S7WA 3HVNA 1A6UH 2NY0D 4ORGB 4K2UH 1CG9B 1T5WA 1U8KB 5GZND 5DZAA 1QKZL 2R0WL 5EU6D 1HNYA 2C9VA 4CSZA 7TAAA 1RK7A 1JGVH 2FBJL 1NEZG 3CN2A 3O4OC 5E94B 3FQRA 5LXGH 4JB9H 2F8XC 2RR3A 4AKOA 2V7NA 1B0RB 5IJBC 2O93L 4AQ1C 3OD3A 4Z7OF 2P5PA 1AXTL 5AB0A 1ZHKA 3FRUB 2WANA 4M7KL 1SY6H 3AXLA 1E4WH 5F2FA 4OVVA 2ERJC 2ICWB 3SYQA 4A7TA 5ANMB 3H8NA 1MN4A 2Y72A 4OZFH 4YXLL 2VLKD 5EBLB 3UG5A 3WN6A 4U2YA 4X7FC 3V7MA 1M7IA 2RBLA 1U8LB 2CO2A 2D7MA 4YEEA 3TJEH 5D7LA 4YWGL 4QRRB 2EVIA 5CIPH 3WXVH 5I0ZA 2BSDA 5DRNA 3NN8A 1B9ZA 2FWLB 2J72A 3ARUA 1M2VB 3BSZH 1CMOA 1I82A 2FX9H 3FT3B 4UOQA 2RJMA 1U93A 2PYED 3II1A 4HUXB 3VG0L 2QQLL 1LILA 4FHJA 1IZKA 3IGFA 1R3HA 2O5XL 2KPNA 4TSBH 3CDZA 3W39A 1MW0A 1CFVH 3LRLA 1B6UA 1F6AB 1JPGB 4A55A 1ML0A 3D69A 2BCKB 2WXKA 4B6ZA 3KPSD 3SCMD 4OUOA 4LSPH 3SGJA 5F7KC 1HXMA 1GJWA 1CN4A 1GGIL 3TA4D 4FERA 2VDPB 3IGAB 4HZLA 2NY3B 1UJ3A 3NCXA 4YC2C 3GMOA 3IU4L 4DO6A 2W0LA 5FYLD 3MNZB 4U33A 5DC4B 4PTUA 5IUSA 2XQ0A 1DLFH 3EO0A 1JXJA 2GJ6E 3H6AA 1O7DE 3KPOA 1PYWB 2YD3A 5KANG 1RERA 3QDJE 1WTLA 4X6DA 5IOPA 3VGAB 1JPSL 4WCYL 5GRWA 3T04D 1M3IA 2UZXB 3WKPA 5EHFA 4MA8L 5EO1B 5A2AA 1PNCA 3FT0A 3T08A 4DEWA 1CGSL 3VFMB 1YEEL 4J3XA 4F8P