2C9QA

Cu(i)cu(ii)-copc at ph 7.5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
b'HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER RESISTANCE PROTEIN C
molecule tags Electron transport(copper binding)
source organism Pseudomonas syringae pv. tomato
publication title Intermolecular Transfer of Copper Ions from the Copc Protein of Pseudomonas Syringae. Crystal Structures of Fully Loaded Cu(I)Cu(II) Forms.
pubmed doi rcsb
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c9qA00
4CC4A 1O6SA 2C9QA 3BCDA 1H6UA 1H6TA 4AQ1A 2OMTA 2UZYA 1IX2A 2OMUA 2RA1A 4CILA 2WQVA 3FAWA 2YA1A 1NM4A 2Y5QA 3BZ5A 2WQXA 2WQWA 1M42A 1OT4A 1M9SA 2WQUA 4CC4C 1O6TA 3BC9A 5ICUA 2OMXA 1XEUA 2C9RA 2OMYA 2UZXA 3BCFA 2OMWA 2C9PA 1O6VA 1LYQA 4AW4A 3FAXA 2OMZA 2OMVA
chains in the Genus database with same CATH superfamily
3U7YH 4XVJL 2YPKA 5DQDH 3EJTA 2CWRA 3G6JE 5B4MD 2WCGA 3WS6C 1CYXA 3BUYA 5E9DE 4DP5X 4DW2H 2X4TA 3MJ6A 5FOJA 1PBYA 2AEQL 4QCIA 4R0LB 3VFPB 3WIHA 3DPBA 1WT5A 3RWJB 2C9VA 4GQQA 4XCCH 3O6LH 4IBUA 5AZ2L 3TBYB 1RK1A 4EDWL 4HK0B 4UM9B 4PJGF 2Y22A 1V10A 5LCVH 1B0WA 4JUTA 3KWXA 5ISZA 3HTLX 4TQPA 5FGSA 2XWBB 4PWKA 4FXTA 4KY2A 2DWYA 4JY5H 2P42B 4OFQA 3TWCL 4YHML 1QACA 2MJWA 5HGDB 2HFGL 1IBYA 1QHOA 4U1GC 1J12A 4QOKA 2VAAB 3US1A 3QG6B 3RGBA 4NM8L 4WTQA 1T1WB 5H94A 1X6LA 5C0AE 2PW2A 4PJGB 3SKNB 5B8CB 1A1OB 3DO7A 1NCNA 4BQCA 4YSRA 1BQLL 1U3YA 4IKKA 3LN4A 3ARPA 3OPZL 2C9RA 1BVKB 1AZUA 5DGRA 1MEXL 2A0LD 1U95A 4PJ9D 4TNWK 3CZSA 4FQXC 3LRKA 4NNXA 3V6OE 4FFYH 2IMMA 2WQRA 1TJGH 4D9QD 4NAMA 3F64A 4OI9A 4TNVF 4F7EB 1C5CL 4WEEA 1Z9MA 2FVNA 4GBXB 4R4BB 4LHUD 3V9EA 3KPLA 4IU3B 1S9YA 2PF6A 4P59L 4JFUA 4YDLC 1AY1L 3ET9F 5DMGC 3TH3T 4FQCH 2I60L 1A14L 2G9HB 1U93B 4LSRL 1Z9SB 3BP4A 2UX7A 1J0KA 4LARH 5DC0A 1HH6A 4JHWH 3RIFK 1CF8H 1UM5L 1XGQA 4DEPC 3K72B 1TVHB 2YPLE 2GBAA 3GBDA 3EYSL 4UOQA 3OKEB 4AKQA 4UT7H 2EYSB 4HCRH 3SDCC 1SYVB 4JM2F 2JV6A 3FHEA 5CCHE 1NA8A 4BFIA 1THAA 3DGGA 5F7FA 3VU1A 3SGEI 5AW9B 2EVGA 1YHPA 3T2PA 4EVNB 1QSFD 3B7SA 4N0YL 3TCLA 3FQNB 4HKXB 2J8UE 1DVZA 4XCEB 5HGHB 3VFNB 2HA1A 2XBTA 1GH7A 3M1CA 1IM3B 1T7YA 2ICEB 3VG9C 1HCYA 3JYCA 4LKCA 4WHCA 1T03H 2BWDA 5GIRA 1KSRA 5KSUA 2CGRH 3UTZB 3DTUB 1OP3H 5LXGL 1D5XB 2A4CA 2EDLA 1FL5A 5HDQL 5I17A 4F8NA 3STLB 4ELKB 4R4FL 2KZBA 1XB6A 3FBKA 4C56E 2GW5A 2P8MB 2AFNA 5B3NA 3L5XL 3I74A 3QAZC 4EO5A 3FTZA 2JNZA 1N5YH 1RY7B 2BO0A 5IVOA 4X98B 1T04B 3M88A 3BKCH 2ZICA 4F92B 3CFJB 2H6PA 1ZA6B 2BVPA 5F97E 4G5ZH 2WAHA 4KMTH 1UWXK 3LKRB 3GO1L 4Q6IB 4I1RA 4EEEA 7TAAA 5L7XL 3VXUB 1MI5D 4JO4H 3PDOA 4G9DB 3G5YB 4N5ED 1SZNA 5GIRB 5CWSA 4TTDC 4P9MH 1MCIA 2UX6A 1HAUA 1JNLL 1LGVA 2V17H 2F1EA 4JDTL 3HMWL 3ECWA 4UQ2A 3DX8B 3O4LB 2WTRA 4WNQA 1RUML 3RVTC 4EE2A 5JW4R 2HUHA 4P05A 2FQGA 2BSTB 2ZSWB 2MCPH 2VL5A 3O8XB 4L0PB 1Q9LA 1O7SA 4K7PL 4OY9A 4POZC 2NQDA 4K4KA 2YLHA 4JRXE 1IGTA 3X3FH 3SE4C 3HZVA 4G8IB 4Y2DC 3MJ9L 1GJIA 1HQ4A 4DVBA 1ZXQA 3QXDA 3RWIA 4XPBH 1E67A 3BH9B 4U2ZA 3UZEA 5C0BD 4PJ8A 4QHLA 3DLQR 3M8OH 1ZVSB 3KLHD 3KPLB 4IU3A 3ESOA 1NCHA 2HJFB 1YNLH 4IHOA 1ES0B 1JYNA 1MPAH 3HBZA 2PETA 2K1MA 5EO9B 1OAQL 2CIIA 4P5KB 5EO9A 3WAKA 1ACZA 3OD3A 4J3OF 4JQVC 2I07A 4OZHF 3VQ2C 2Y5TA 3PWLB 4OZHB 3LKOB 3V0WL 4LCUA 3VXTB 1I8UA 2XVBA 5DD5L 4TOYH 2VLKB 4JFDE 2E9GA 1IGMH 1JZ8A 1MRDH 1DBML 4XTRC 4L1BA 3C5ZD 4AG4L 2OMTA 4JQXA 4GIPD 3OSKA 4I9WE 3T1FA 4F37K 4L8CA 3T4AA 1TQVA 5LAXA 1X5GA 5DF0A 1WC7A 4XBEL 5HI3C 3CVDA 4IGBA 1NJ9A 1JPTL 4QRFA 4EI6B 2J5LB 3AWFA 4ESKA 1QX1A 4JG9A 2VLJD 3HBQA 3IXAA 3E3QE 1XF1A 2O6EA 4Z7NE 1MAJA 1BOGA 1IVLA 1KGJA 1R3LA 2H26A 1B4TA 1JJUA 4M7JH 4AYEC 2W9EL 1NAMA 4EZMA 1I1CA 3BISA 4A7QA 2CDGA 2JCWA 3DGDA 3HZKA 4KK5C 4LMQE 3ZDWA 4HDIA 4KWUA 3BP6B 2YD4A 3Q3GB 4TUKL 1Y07A 4QHKJ 4WWKB 4TLUA 4PP1C 4DGUA 2DM4A 3LNDA 4O9HL 4U7SA 4XODA 5J3HD 1WBZA 2AK4E 4ELMA 1I4FB 2EDXA 2A9NH 4FTVD 5T1LB 1RFDH 3ZKNC 4WKZB 2BFVH 2PO6C 4Q74A 3I84A 3MXVH 2CK0H 1OE1A 1S7SA 1ITBB 2VW7A 3PXLA 2VLMD 3RTQC 5K9QG 4KI5D 3WG7B 1QBMH 4R4FH 4NOFA 1A4JB 2X12A 5DDHB 3PXJA 3U7AA 2YD3A 3D69A 3MHZA 2UVFA 1QUPA 2FTAA 4PP1D 2CUMA 4N1EA 3WY1A 2DQJL 2ZXEB 2FIRT 4NRXB 3PHOA 2OLDA 3ZL2A 1B2WL 2XN9E 2WC7A 5KVDL 5I26A 3QO1B 3DGGB 4FQ1H 2YD6A 1BIIA 4FJYA 4P04A 2DB8A 3FO2A 2IAAC 3VXMD 3CQFA 3CFMA 3RVWC 1ES0A 4MBOA 5DQ9A 3WL9A 3O6FA 5FFLA 3P0YH 3HR6A 1AQDB 5DGQA 3TNMB 3IRZA 3P9MA 4I18B 3HN8A 5I30L 2KMWA 5BW7C 3KCWA 4KKLD 3BWUC 3V0VA 1XH0A 3UXFA 4LKXA 5ITFB 4RSVA 2P5WB 1RURH 2ZCLH 4HUCA 1I82A 5LN8A 2XTSA 4XB7A 4H5SB 4NNXB 3TBWB 2ZKXA 5L4JA 4IK6A 1GKOA 5DHMC 4FABH 1LE5A 5I8KL 2V9QA 5J57B 2C4FU 2P5EA 3G6AB 3HMXA 3GBNH 4ZUVB 2VDKB 1E4XI 1SY6H 2W07A 4GRLA 4KI5E 2DQJH 2LLNA 4GMSH 1T83C 4BUQA 3VD4A 4DP4X 2XC8A 4BIKA 1ZTXL 2FO4A 5GGVY 4XMKH 1OK0A 1WFJA 4ZNEE 2IG2L 1W2KT 3QQ9D 3WHXB 4A55A 2WJ5A 4G8GA 4UBDD 3WLWD 3CVIL 4FL4C 5E6ID 5IB1A 4AL8L 4X8XA 2P45B 5SWZB 1MLBA 3THMH 3ZKSD 4AT6B 3L7EA 5D2LE 3SKJL 2DQHH 2VLLB 3L17A 2Z4TA 2IAND 1VA9A 4FQQA 3FO9B 4U3SA 2FATL 3EJUA 1RLBA 5IQLA 4ONGH 4KNUA 1SUHA 4K7PY 3KVDD 3WUZA 1J0HA 3OC5A 3BN3B 2DQTH 3NMEA 3RBGA 2EXWD 3H9YA 1I3UA 2ALWA 1VFMA 1ZHNB 4XP4L 2NZ9C 1A1NB 1X7SA 5IG7A 3U83A 1KPRB 3NZHL 4FE9A 3AW5A 2W9DL 4YDKH 3LXBA 3KLQA 4O02A 4PGZA 1G1CA 4GQRA 1NM9A 4UOW1 3O3BB 2K6YA 5FYJL 4HC1A 3OR7B 4PQXA 5D1ZI 4XN9A 5I5RA 5HI4C 4HQQH 3RL2B 4JFDD 1A2YA 3VFWB 2AXGA 2R0KL 3X3GH 3VI4B 4BUHA 2P1YA 1EAOA 1DLHA 1W0WB 1L0QA 3CC5B 3RHWK 3IMWA 3WLBA 2BWIA 4PJ9A 4QHUB 5CGTA 1FFPB 5KVFL 3F5WA 4FFTA 1Q38A 1YUKB 4KDVA 3ZDZF 3ARFA 3T8VA 4YE0A 4YSQA 4TQIA 3L1EA 4G9FE 1Z5LA 1WZMA 3FMGL 4DJMA 4EDXB 1C12B 4FFYL 3V6FB 4KKAD 2D2OA 4WNQB 2Q76A 5ICYB 5IBTL 2R1XA 1FL6A 5JNYB 5JOPD 1CL7L 3U36B 5T1DH 4UTAA 4OZGB 4ZO6A 3WIIL 2J8UF 1XSJA 3LRSA 1TQCC 1ZGLP 2ADGB 2AMUA 5EBMB 4RAHA 2R23B 5AG9A 3FTVA 5C0JB 4L4TA 4JS7A 3ZTCC 5C7XH 3AITA 5I6OA 4XNDA 1DCLA 4EPSA 2DYPD 3QXTA 4NQVA 3GJFK 1CF8L 1XH3A 3FCBA 4NNPH 1NCGA 1A7PH 2WANA 3EADA 3TXAA 4ZZKA 1PLBA 2EP6A 2VC2H 4DGWC 1EHNA 5FWQA 4NIYE 2DYPA 2YAQA 5JDJA 3GMNA 5DK0B 4RRPA 2DY2A 1ZS2A 4HJGA 3WO3B 2ZUXA 1F4AA 2X7LA 3CFEB 5TQ2H 1T2JA 2ORBH 5KVGE 5T5NF 1NFAA 1ANUA 4OCRH 2EVJA 1L3NA 5J6HA 1N70A 2Z9TA 2BH0A 1CFQA 1ZAGA 2FEEL 2AAAA 2UWEB 4N28A 5AAPA 5C0IA 3FO1B 3FT1A 5DRWA 4F8PA 4P23D 3BSGA 4R9HA 3A3YB 3SPCA 4NS0A 5E5UB 1FFQA 5LXVA 4PVLA 4PJAE 2H0EA 1I9RH 3F62A 2B08A 1BFSA 1IAII 2OYPA 3UTTB 2LTQB 4K3EH 3MLUH 1BG9A 3FQTA 2VDQB 2ADFL 3ZHFA 4H8QA 2CH8A 2B1AL 4HJJH 1E8WA 2DQGH 3BMVA 5JHLA 1E0OB 1YNTB 3MMEB 4AUJA 3MUJA 4PW4A 4P23C 2X4OA 3K4DA 1G6RA 3IFLL 2JKJA 2Z1KA 2ZSVB 5FDYA 1TLMA 5E9DB 2IALA 2R23A 4GP8B 1JFHA 1R3HA 2Q10A 5I19H 3NOIA 1ACCA 1HEZA 2HH0L 3FC8A 3LRSB 1X7QB 2K6ZA 4JZJC 5IMOB 3FRPG 2AEQH 4R83A 3S0PA 5D1XE 1F42A 2FYYA 4XMUA 4L3AA 1CDYA 5MEOA 4JREB 4HFUL 4YX2L 2YGOA 1AGFB 5HGBA 3JWNH 3K71A 2WN2A 4N90D 4NPYA 1FH5L 3OLEA 2DTML 1XIWB 4LLMB 4AQAA 3CN2A 3ZDXE 4WFGD 5IB3B 3O4OC 3PDGA 4E41E 4ACTA 4WW2F 3GGWA 3D5OF 4I3SH 1I3VA 1LDPH 2GTWB 2AZUA 3S88L 1QEWA 5CN3A 5IOPB 2I25N 4M9OA 1PU0A 4MX7B 3V8OA 5JOFA 2AS5M 1HI6A 2MHAA 3MV7A 3CBKB 4LEOB 1OSYA 2X41A 3JVFC 3O9WD 3QIUC 4NUQA 3ROOB 2OXGA 4Z7NF 4XGZA 1Y1DA 4B9ZA 1EZUA 5C0AD 3FH5A 4LHQB 5ADPL 4JRXB 2DQFB 3ZE2B 2WUCL 2MFNA 2AAVA 5KVGH 2R9HD 3C8HA 1OAYH 2HVKA 3NCYS 2VDML 1QFWM 3ALPA 1PEZA 2HTLC 1OCRB 2D73A 2QHLA 1CC3A 1VKXB 2FX9H 3OQ3B 4AEHL 4KO7A 5IREA 4UQ9A 5G4NA 1VHPA 5IY5B 1BFVH 3EFDL 4IBLT 5L2KA 1GY1A 1ZT1A 2BSSB 4X8JA 4RMRA 3QAZB 4G6JL 4NM4H 3GBML 2ZJSL 4L37B 4BGLA 3JV0A 4G6KH 4Y9BA 3PGDA 3STBA 2OMVB 2J56A 5AAMA 1MKFA 1YY8B 4K7FB 5HJGA 3LH9A 2JFCA 5DZPA 1BF5A 5AOKA 5ESAA 4P3CH 5T8IA 1U8LB 1FAIL 3MRPB 1KF9B 1UKSA 5KOVC 4XP9L 4JMNA 2UY6B 3MYJB 3PJSA 1NCTA 3RIAK 1KDJA 3HZVB 4QRRD 4P57B 3T3MF 2N1KA 1U58A 4XCNB 2R4SL 3AG4B 2G0LA 2RJMA 4F7PB 4I0PC 1JDDA 1ZRUA 4D0BA 3QC5X 2X10A 1ZWIB 5GZND 1MRCL 4Z95L 1Q4NX 5GZOA 2H1XA 5CR8A 3TTSA 1D6EA 4ODSL 1DJIA 3C2SA 3NCXA 4D7PA 2BNQB 4JR9H 4KZ0A 1PX8A 4IHOB 4H26A 5HDQH 4LLWA 4UB0L 3PL6B 3GI9H 1IU1A 1XSOA 2R69A 3O4LE 4E2OA 3RIAF 4LSUL 3VD1A 4PJBB 2GCYA 4ES9A 2ZCHL 4Z78A 2ADJA 4KVCL 2EDBA 4HISA 3MNDA 4HUNB 4WUUA 5DFAA 3QUYA 1BXUA 2HVJA 1T1YB 1SDYA 5EZLA 4P4RB 3RBSA 4AYFA 2V2XB 3QQ3A 3VW3H 3RU8L 3SDCA 1IGIH 3SDAC 3E38A 2EDNA 4GRMA 3KPSE 5EUKA 1KELL 4XO3A 3OKYA 1BQ5A 4LAQL 2VL5B 3O8XA 5EN3A 2ZYIA 5AOJA 2AKRA 1V54B 2YJQA 4JZNB 2A6JB 5DEGA 2QZ5A 1TNMA 5TE4L 4ZW5A 1RL1A 3HNVH 4HEME 5E8PA 3TYFA 1MXDA 4NO3A 4BRJA 4AVIA 1NDGA 4FQ2H 2R2HA 2Q7AA 5F88B 2OP4L 1N0LA 2A9NL 3OF6A 2A83B 1MFVA 4HIJA 3S35L 2IBZY 4OGXH 3F2LA 4UU9B 2P24B 2GC4C 2VN5A 2NNFA 4GAFB 3LZFL 1EO8H 1CFVL 4O58H 3MRLB 2YK1H 4GSRA 3WIAA 3GXDA 1JPFB 2YD8A 5LNDA 4Q0XL 3FQTB 2FSDA 4I5BB 1FVCA 4X50A 1P84J 4PWFA 4JPQA 1HNYA 4HWBL 4F15B 3BKCL 5DJ6B 3BZFB 3B6SB 4NQEB 1BGXL 4M43H 4RH4A 2JKLA 2WWMC 5L88H 1LMKA 4ZPVA 4XCEA 4P99A 3MRIA 4MZRA 4BZ2H 4LAQH 3VDCA 1CURA 1WYJA 4JFEE 4J7RA 1AO7B 1HHJB 1E9OB 4DPBX 4K94H 4EUPA 4GFXA 4DN3L 3A6BL 4AI7A 3ABGA 5DHVB 4YHLH 3HEIB 2OMNA 1CE6B 2YIHA 5TH2A 1RZIB 4M4PA 4FMVA 1E4JA 3OGOE 4IOFC 4ODTL 4WI9A 2GI7A 1MFAH 3DYPA 3NTCL 3L4VA 1M9SA 2GPZA 4RFNC 4U1NA 4Y89A 1ACXA 2Y1VA 5DEFB 5ANHA 3RY4A 1HE8A 3E6FA 2G5BB 1JFQL 2WIMA 1OP4A 1PLCA 3EBAA 5A2IH 1N6UA 4LEXH 3RFZC 4JHWL 2WINA 3QXUA 2GT9B 2J1ZA 4YBQC 1ZVNA 2XT1B 5B38B 5BUPA 4G8AC 1HHHA 1W91A 1BVLB 4HV8B 1OF0A 1UM4L 2X9YA 5I15H 5CJBA 2FYYB 4N2GA 3TWYA 35C8L 2Q8BL 3QDJE 1MAMH 4D9RD 2B9BA 5FB8B 5L0QC 5J12C 2W9DH 3HB3D 1U91A 3HPLB 4QOKE 1UQSB 2FZ3B 2Y23A 4W70A 5K9JL 5C0DB 3TURA 5C0AA 1KNOA 4KXBA 4QRRE 4AGLA 1AXTH 4G7RB 4YHYB 4YEEA 1TEYA 1I1FA 3G5WA 4F80A 1KFAL 5E5RB 5LXGH 2OL3H 3VU2A 3FTWA 1HCZA 2GB2A 2OZ4L 3GRWA 1F6AB 5IESL 2XQYK 2YXFA 3VXPA 1AIFB 5AEAA 4Y5VC 3NCYP 5EOQH 4GQPH 4AG4H 1ZLVH 4OLEA 1MHPH 3MBWA 4LOVA 1V7ML 3CH1A 1AQKL 1A2YB 3FU5A 3M17B 3VFWA 4JHVA 2XVGA 1ZJBA 2BY1A 4G8IA 2V3DA 3PHSA 3APNA 5F7LB 4XXDB 2XTJB 5HDOA 3PV6A 1L9TA 1IGIL 4WTZA 1MHHA 1IL1B 5F7BA 1JFQH 2PO6D 4LRNH 3S3PA 4ONGL 1IGYB 3CZFA 2AJYL 1GL4B 2NR6D 2Y1ZA 1KTDB 2C1OB 2E7CA 1W72B 3EYFB 3K6FA 3O3DA 3QDGB 3QZWG 1J1OH 4PTTA 3TN0D 3FFDB 2OSLA 2NR6A 3AMLA 3RJDA 3IE4A 3QHFL 4IRSB 2L7JA 4F33B 4FL4B 3T5WA 3N6YA 3L4XA 4K7PH 2NCEA 3CDCA 3MV9E 1ZTMA 5D55A 1MCBA 3QEHA 2O93L 3HUJF 5INDA 3RFRA 3Q5TA 3RI5F 5C0CA 4QLRA 2R0KH 3X3GL 2QPUA 1XCWA 3VFRB 1SYSA 2SEBA 2VDQL 2YUVA 1ET5A 4QXUH 3GMRB 3QUYB 4LO9A 4TQEH 3G5ZA 3EGXA 3I3BA 4ZAKC 1CGVA 2EEFA 3TS8A 1I8KA 4PJIB 4YSOA 2DIBA 4F57L 3X12B 3QA3A 4FFWD 1UKTA 3P3UA 1HILB 2EZ0D 4APXB 4I9XA 2X6CA 2ZCKH 2Y69B 1GZHC 1S7XB 3H7BB 3DX2A 3DDGA 3N9GL 3KJ4B 1AE6H 1AFVH 3Q6GL 4EQ2A 1IEBB 1JGEA 2WLIB 32C2A 3KWWB 2XWDA 4NZRL 1YEDA 5HJ3B 2XXFA 4UQDA 3LQZB 5JORA 3U0PA 2NY5H 4ZI8A 3BD4A 1PKQA 2WLLA 1O0VA 4H2AA 1NSNH 1YEEL 5DO8A 5EUOA 4EOWL 1MNUH 1WAAA 3MLZL 1NUNB 4PJAF 3G5VB 3S8FB 4BUGA 1KJVB 3BO8B 4OZIB 3CAFA 3C2AL 3LN5A 5EO1B 1UWEH 2FGZA 2F19L 4TSAH 2DQEH 2B16A 2Y3AA 4AH2B 2F5AH 4EI6A 4KRPB 4TUJB 2JF1A 4ZO7A 1SXBA 2A6KA 3P0YL 3RVWD 3IKCB 8PAZA 4L8CB 2FWOA 3ZT6A 5ISZD 2ADJB 4WUUB 4TM9A 3SQOH 1AHMA 1HHGB 2OYLA 5KSAB 3KXFE 4V2BA 3TNMA 3CVHA 3GLZA 2I9LB 2XY1A 5CJQL 1HIMH 1R3JA 4D9LL 3GMQB 5K69A 1JVOA 1U21A 4L4VB 3NP3A 2BP0B 5EBWB 1A4KB 4NQED 2D2CC 1K6QH 1QFUL 1E90A 3BKMH 4LDEB 4GNKB 1F90H 1R34A 4RAUA 3ISWA 5IGXH 3VD2A 2APVA 2ZXCA 2EH7H 4PRHE 2HJKB 2NUPB 1FZKA 5E8OB 3O3EB 5AB1A 1CLZH 5HGAA 3ARZA 2NXZB 3D4YA 2DLHA 4LEOA 3ROOA 4U1HA 5E1AA 4HIEA 1AGDA 3L7EB 4HPHA 4M8UA 4W68A 1MNUL 1WITA 2D0FA 5A1AA 5B3JF 4E68A 3L1GA 4KVPA 4U1SA 3QEGH 4LCCB 4PRIE 3UPCA 2VXUL 2WZAA 3J7HA 3CUPA 2VN6A 4HOMA 2PXYA 1I7TB 3BVNA 4NUPA 4E0RA 5E94A 3WXWL 4NPKA 4HXBL 2VM3A 3OJVC 4G8FB 1NMBH 1Q9LB 2BIMA 4WUUE 5K5YA 5HBBA 4MMZA 2DQIL 1JNHB 2ZD0A 3F85A 4X8JB 4NWTH 1DVUA 4RIRA 4FZ8H 3F84A 4E5XA 3UC0L 4YSUA 1U41A 3IFPA 5DR5H 5DUJA 3LV3B 5GGQH 4G9FD 5F7UA 5IHLB 4U4IA 3V6BR 4JO3H 3RYMA 2DMGA 4IIZA 4K2UL 4PB9L 4KOCA 1DFBL 1EEQA 3W56A 1X5AA 1IGCH 2ZWKA 4JPSA 5IFAH 4XC3H 3OKNB 1B90A 2IPUK 5H37G 5H35A 2UZXA 1A4AA 3DVGB 1SDDB 4J3OC 4QF1B 2CA4A 4UILH 3RHWF 3QJZA 1YNKL 3SDCD 4AVJA 1JVKA 3HHMA 4MRBA 5EA0H 4X7DC 3C5SA 4J3UA 1AHWC 2JIXA 1MCHA 2HTKD 4NN6C 1XAKA 4WO4A 3NUKA 5J1AB 3TV8A 4M3HA 1X5FA 1DN0B 4R4NC 4I8DA 3RG1C 5AKTA 1AXIB 4KKRA 2JKXA 5T3ZH 3WJLA 5LGKA 2ZUYA 1X5HA 1MNNA 7PCYA 3W0WD 3ZX1A 2B4CC 1T2QL 2DLFL 2C1OA 1XIWC 4XNZB 4ISVB 4PSPA 5AOMA 3UTQB 2N7BA 4ZODA 3ZTDC 1CFSA 4G42B 3KGUA 3SCMA 1HJBC 1KIPA 4JPIA 5I71B 3ARDD 4N2BA 1GGBL 2BP0A 3KGTA 4O51B 4GMSL 2VDNB 4LSTL 3VH8G 4AIZB 4HJGB 5E24E 4N2CA 3A24A 1AKPA 5DK0A 2AQ3A 3NZ8B 4WO4B 1B3JA 4KTDL 3DSFL 1G7MA 3VXRA 1TKWA 3VD3A 3FSAA 1JNJA 4HMCA 1F6AA 4MQSB 4K94C 4XNQA 2VRKA 1S7VA 4LFHD 2IAMD 2KQNA 2QGDA 2AQQA 2XQBH 4L8BA 2J6EA 2R69H 4G7QB 2D9CA 1DBBL 2YZ1A 2ZX5A 3MRQB 2AI0H 4OLYL 4RAVA 4C56D 3SD2A 2FT6A 1P6WA 1UXWA 2CO4A 4HBCH 5LBSL 2WJ7A 5F0LB 3LPPA 2C1PB 1LO3H 3OMNB 5FYLL 4L3EA 4ZT1A 4G7VH 5I23A 5AB2A 3N42F 4I88A 3MV11 1I9EA 2Z4QB 3HG5A 4GB9A 4WCYH 3IDMA 3RJQB 1YNLL 4B97A 1JOIA 3BUQA 4FFVD 3LQZA 4JFXA 5JORB 3PQYB 3RWHB 4YDMA 3T0ED 1MPAL 1VZGA 4AJVA 4H8WC 1IEBA 4JAMA 3U46B 5T5NG 2G2RA 3K5SA 4RIRB 1NAMB 4M6NH 4HLEA 1QSFE 2ADIA 4APQC 4C56B 4EBQH 3NRQA 5CMAB 3JT2A 4LSSH 1HWWA 3BAWA 4PJIA 3CDFA 3V0AC 5A43C 1IGFL 1RUAH 1GOGA 1KXHA 3D3VE 1KJ3H 5EC2B 5ISZB 4ES8A 3S5ZA 4X42A 3IDYC 3Q8AA 4FOMA 3L5HA 2YQ3A 3SYAA 5CD5C 2VDNL 4FZEH 3WKML 1FL5B 3DKHA 1MFEH 1PYWB 5FGCB 2KC0A 4NUGL 2FJGA 1ML0A 2CGYA 2V17L 4FNPA 5AW7B 3RGVB 2IFGA 5JNYA 4F7MA 5T3ZE 1BFTA 1CI3M 1TCMA 3MV9D 1QBAA 1S2EA 4KK6C 4BINA 5ICYA 1MJ7H 2CAKA 1NEZB 3WDJA 5GGQL 5T5FA 4Q14A 3NJLA 2ISDA 3WIFB 5DEZA 5I1AB 4G6KL 2OTUA 3MI6A 4OGXL 2NY3D 4Q4IA 5DU7A 1F18A 2EO7A 2MEJB 5B8CC 4AT6A 1MFNA 3D18B 4W9IC 2CBOA 5D7LB 1NH6A 3FUHA 4M6OL 1JV5B 1JWSA 3VMNA 1K8IB 1IIIA 1L4IA 3FOMB 2DMKA 3KBHE 3VRLF 4R2GC 4CU8A 2FO4B 2DLIA 2HT3C 1AD9B 1EDQA 1ORQA 3NIDF 2J1WA 1XFPA 5IHUL 1RZJC 3AU1B 5EF1A 3WFBH 5L0QB 3B5TA 2VR7A 2WMPA 4YDLB 3DPDA 1WWBX 2WTRB 1SBSL 3KEHA 4GRWE 2HG0A 3HZYB 1DJGA 2H4EA 5BS0A 1G9NL 4PN6A 5LKNA 4UV4H 2VZVA 1S78D 4ZFGL 3LN4B 1BJ1H 2LGNA 1TF4A 3IFNL 1N8ZB 2VLJE 3QPQC 1JI2A 1FUNA 3FO9A 4JN1L 4YBLB 5IMKA 2YJLA 4F9PA 1SDAB 3IT8D 4QOKD 3UPRA 3P77A 5D70L 4Y5XB 5AVUB 4ZUWB 4PJHA 3ULUC 5EUOE 1UJ3B 3ARQA 3CG8A 1LNUA 2G4GA 2H3KA 2KPNA 3BZ4A 4PHXA 4QRBA 4EN3C 1UG9A 5CAYB 4EI5D 1ZS8A 1R5IB 4QTIH 4KZDL 4R8WH 1OPGL 3HKFA 4O2FA 1R4XA 4ELKA 1MH5A 1WA1X 4AIOA 1CICA 1U8NA 2XWJA 1TMQA 4F33A 1WZLA 4NLHA 4PRAB 4JANA 1RSYA 1I8LA 5KG9B 5IROA 3RTQA 2DL9A 1P5UA 4UUJB 4KJYA 2K70A 1MFMA 2YZ8A 1DBAL 1JN6A 1P6AB 1FHGA 4MAUL 4PJ7A 5JO5B 4NQCD 4JM4H 2F7IA 4JM2A 5L4FA 4TVPL 3Q8CA 4XNYL 5DT1L 2Y6SC 2MOVA 3BVXA 4UAOC 1O75A 3VD7A 1UCTA 4IBZA 2NYYD 3P4OA 2X0VA 3MKKA 4N3TA 4OJEH 3WO4C 5JW4M 2GY5A 1EZVX 1RMFH 1A3LH 3FB6B 3S3SA 3DV4A 1H5BA 2YK1L 4OB5L 3SB3A 3QIWA 4LLVA 4QRRA 4Q9RH 2VUKA 3T1WA 1QP1A 3ARFC 5FO2A 1M6OA 4FQJH 3E9UA 3ZKXB 5J7CC 4A1RA 4M8QA 1E50A 4X6DF 4FYTA 3PAUA 5E8NA 4FHJA 5C07A 1NCBH 5LVEA 2IAMB 2FDBP 4QD2E 2JELL 4NQVB 4E5XG 3QUXB 4JG0L 3WTWA 4P3DA 3QC6X 1LEIB 4KQ4H 3GI8H 2XX1A 3K6SB 1S7QA 4AZ8A 3IDGA 1N8ZA 4NSKA 4Y4FC 2VRAA 4G71B 4UYQA 4YL9A 4DZBB 4KRPD 1DO6A 4I3GA 1B0RB 4FQ1L 4B53A 2X4NA 4UTBL 5TFSH 3LD8B 4S2SB 3QQDA 2C8NA 1IGML 5JW3H 2HT2C 1A4CA 2EXYC 3O3UN 5DUMH 5CD3A 4P5RA 3LIZH 1JE6A 4JHAL 3MUUA 3MQIA 1BQHG 3VWKA 4CMHC 1L6ZA 4YLQT 1IQWL 2B3RA 2OSWA 2F2HA 2E4FA 4Z8FH 2HKHH 4YIQA 4Y4HA 1KYOJ 1NCJA 3QEQA 4N0UB 5C0CE 1XMWA 3T4YA 3CC5A 4LF3A 1YEGH 4TULL 1R5WA 5I16A 3VXNB 3F7VA 1SXSA 2EXWC 4XPAL 4XN5A 1F11A 3QZNA 1HHKA 2OM5A 4I2XB 1W8NA 5TDOA 3VWJB 1WHOA 1WBZB 4ELMB 3QHZH 4PRIB 3HNSL 2VH5H 3HI1A 3IGKA 1JD9A 1MFDH 5DA4A 5DS8B 2OKMA 2Y5TB 3PWLA 4OZHA 3SY6A 2E47A 4A66A 5G5DA 5K9JH 4HWBH 4WIQA 1UXSA 5DFWH 1XBRA 2NY5L 1AR1D 4HDIB 3V95A 3H42L 5EU4B 1QRNA 1A4KA 3BZFA 3QUGA 5DJ6A 3HG1E 3IDXH 4ODHH 5E6IC 5HHQB 5KYXB 1OF2B 2EJ1A 3K3QA 1IC7L 1XXFC 2FYVA 4V1DB 1CL7H 3C8KB 1UM6L 4PI0A 5CGBA 3WIIH 4OBRA 4BYHA 2XWRA 4UTBH 5TFSL 2H6OA 3I6SA 3MJ7A 4GG8B 4DP9X 2D03H 1QZNA 3SKOA 1FH2A 3X1FA 2WW8A 3HHSB 4UDUA 4UDUB 2DQIH 1J7VR 5C0EA 5CUSL 1KB5B 1NM4A 3F12A 2OMTB 1L7TL 2F9BT 1D5BA 5JW5B 5FUCE 3MXWL 1KJMA 2FRGP 4IRJA 3HVDA 4DUXA 1BZOA 2FUQA 1J05B 2YFNA 1VPOH 1CICD 4M7ZC 1CVRA 2XV6B 5E1IA 1FBIL 2YAMA 5GRVK 3IU3A 5DMKA 1BCIA 1E40A 2D7PA 3COOA 2NSQA 5AW2B 2YPVA 4FNSA 5DYOB 2CUAA 1JRHL 1QWHA 3GMLB 3D4GA 4NC2B 4DPRA 3IJEB 1GW0A 2A6JA 3DOHA 4OU3A 5TF1L 2IOMA 1RZKC 3ZZLA 3WU1A 3W9EA 4OIIL 1ET8A 4MXQC 3A4EA 3H9HA 2XYBA 3HAEH 4XVTL 3BRGC 3GBEA 4LASH 3L3IB 4P07A 2PP9A 5EFIB 4L4VE 4Y5YA 1QZ1A 2PABA 1SMAA 1M9WA 2KI6A 1F11B 5CLTA 1BEYL 1IAKB 5D5ME 4OM1L 5IBLC 3MRHA 3EDDA 4MVBD 5JHLL 3B9AA 2K8QA 1P4LA 5I1LB 1UB5A 2MCG1 1YEHH 1CIDA 3PNRB 1Z2KA 1N5AA 1Q9OB 5GGRB 3B3BA 2QKSA 1L0PA 2K45A 4YO0B 3RA7H 5T3ZL 1UH2A 1I8IA 5IESH 1YMHB 2IXQA 1T20A 2AQTA 2MNJB 3ELQA 1CD8A 4PBXA 5JHDB 3GSNL 3FTGB 5BO1L 4IRSA 1CDUA 3UAJC 1WWCA 5EIIA 4CVUA 1J5OH 1YA5A 3UROR 1FC1A 4WO4D 1W15A 1SEBB 1YMMB 2WXJA 3WN5B 1BIIB 2B1HL 3APFA 4F2MB 3KPSA 4NKMA 1V3KA 1I1RA 1RJZA 3D85A 3WHE1 3A23A 2VKXA 5GS0L 3O3AA 5ILTL 4F7PA 2PPDA 4KTDH 4UMSA 4XCNA 1LO2L 3QEUA 5EF2A 1OZUA 3E1ZA 1QPXA 4HIXH 4AM0Q 4XP6H 3ZKMD 1MREL 5I1IH 3T0VA 2NT1A 2K8MA 2MMXA 5F8RC 4F7TA 4MMZC 2YUXA 1TJHH 4W1TA 4OH2A 1S5IL 3HCVA 4NKQB 2APWA 1AGEA 1F56A 1AIFA 1TOXA 1U93A 2AEIT 2E6QA 2QTEA 3B56A 4XPTL 1DSYA 1P7QD 2BCMA 3SBWA 3BUBA 1WZ1L 1YRKA 1MW1A 1LP9B 4OUUB 2V8LA 4TNFA 3IGUA 3SPJA 4L1SA 4TQEL 4D0DA 2ORBL 2GHWB 4PMFA 4DEWA 4J3BA 1PFOA 4NJAL 2IQAB 1FFTB 3Q8FA 1MUJB 3RWDA 2YARA 2EYRB 4X7SH 3I6GB 1ODAA 4DEPB 4M4RB 2J6EH 3BZ5A 4BK5A 3C5JB 3L6FA 2WWKO 1A9BA 4DETA 4L5FL 1DQKA 2OQJA 4AE1A 1GAFL 2WCPA 2GJZA 1LK3H 2PNDA 1EHAA 3CLWA 4J4PD 5M95B 1XGQB 2CLVA 3G7TA 5GGVH 3VSTA 5EEXA 4F15C 1VERA 3VFTB 4P5MA 5GZOD 3NFSL 4LP8A 5AD0B 3N0PB 1KENH 4MB1A 1D7FA 4RQQA 4RGMB 4Y1AD 3QORB 1UXMA 1ZA3B 2BHYA 3LZPA 3DYOA 1INEL 2X9ZA 1C1EH 4G70B 4OGZA 3VRLE 2B2XL 3NIFB 4N1CA 5J1TC 4PP2B 3VSQA 1MHCB 4Q9QH 1H8OA 2HH0H 2PCXA 2WNWA 1FZKB 1OQXA 3LPOA 1J0YA 3P9LB 4N2IA 5T1DL 2F58L 1HIML 2YGQA 4XHJC 3OL2A 2RD0A 1HZLA 4X5QA 1NLBH 3GJEA 4OFYD 3BAKA 5EU6B 3KNBA 2G60H 5IFAL 1NUFA 3H9SE 1I9IL 1MELA 3G5XA 2Y7LA 3IK2A 5B8CA 4B6ZA 1C12A 4YLBA 3GSRA 2K78A 5LDSA 1OAKL 5DD0L 1QW9A 1YNKH 2IIJA 3R19A 3ARBA 1WJ3A 1EAPB 2EIMB 4MJID 3G6JB 5IB4A 1UA6L 4ZMOA 3V79C 2ODHA 1J1PL 2D31A 3UH8A 4QHUA 4ORZC 3O2WH 4ZFOB 1B4JL 1DDHA 1WWWX 3O6KL 3MAWA 5T5FH 3TWCH 3EO0B 2L7UA 3JV6A 3L1OL 1S8DA 4MA8L 5AVZB 1E9QA 2X6UA 1INDL 4HWZA 3BLPX 2ENYA 5AOIA 5F6HJ 2ZP8A 3Q0HA 1KJ2H 4LCIH 5IP4A 4H88H 1ZGLM 4N5EC 3RU8H 4J4PC 2ZCKL 4M3KB 4IKNA 4LGSB 3KAAA 5I74C 2WLLB 1MY5A 4QY8B 2NDGA 1YYMH 3MCKB 4JFEB 4OR1A 5J6HB 3OTTA 2CDFA 1Q9WA 4Y1AE 1C5BL 1A6WL 2N4IA 5TPWL 4OV5A 2GJ6A 5CZVH 3V4UH 3PHQA 4NGHL 4YFLI 4F5CE 3TO2A 5FUOH 4PJXE 1YJDH 1SXNA 2M8XA 5TDPA 1LEGA 1PZDA 3UJTH 1CTNA 4LSPH 3QDAA 5FOBA 1JXFA 1RUKH 3ABZA 1XCTA 3HS8A 4PJHB 4TSBL 3DX6A 3BGMA 4TRPH 4A63A 1G7QB 2A3TA 4E9QA 3BEWA 2ZUTA 5IUSA 1SHXA 4Q0XH 5C0ND 1K5NA 2X40A 3QEQE 3IVKB 3B43A 1IQDB 4GO9A 4MA8H 2JIXD 5F1OB 3RAJL 4KHTH 1EVUA 2WTPA 1D9KA 3L9RB 3ZIYA 1G0YR 2WUBL 3K91A 1MJ8L 3W0WB 2NNCA 1EVTC 1IEAA 4P2QB 3HE6D 4OM0H 2P47B 4DKAA 2UUDH 3HZMA 1RZFL 4GJTB 5F7DA 1K4CB 3B8SA 3GQFA 4CC1A 1NIFA 3D30A 3MLSL 3OKLB 2PR4H 1CDCA 2V5RA 3ARFB 5F44A 4P2YA 3QQNA 3OHXB 3MJ8A 5EZJB 3ULVF 1XF3B 2ICWA 1MWAL 1S8DB 2P80D 3RZCC 4AGNA 1WWAX 3Q8EA 3UAFA 4IMLB 4Z7QF 1Z9SA 2JTDA 1CK0L 4H1LG 4YZFF 3E2HB 4X2UA 4OCYL 2X2YA 4UQEA 3OG6B 1G7MB 4KROD 1B0IA 1RVFL 4XB3A 5IVXA 1R3IH 3G6JA 5FCUH 1DUZB 2HPTA 2DBLL 2EABA 3K2UL 1RZKH 3RWFA 2FD6L 3AABA 1MJ7L 2K6WA 2V7HA 3IJSB 2Z8WC 4GQZA 4NQCA 3RGVD 3WFDL 4A2MA 3OXRB 2O6DA 1V7NH 5KSBB 2DH3A 4Z7VB 1IVTA 2EAEA 1DBKL 1XMEB 2OMXA 3V4PL 4JRXA 5FB8A 5IEKA 4Z1PA 3UGUA 3Q8BA 3DXAB 4EN3B 3ZJAA 3VYPA 5LBGA 1H6TA 1U3NA 3BKJH 1HHGA 2A9ML 1JZ2A 1YEGL 4TULH 4PLNC 1PLAA 2BFVL 1FNFA 1N4XH 4BH8A 2Q87A 2BMKB 3FFCB 1CBVL 2CK0L 2KLRA 3NVQA 1QYGL 2ZG3A 4MRCA 4NKDB 5JXEC 3VFTA 3LEVH 3DX9B 2J1KA 5J6GB 3VCLB 5GGRY 1I53A 2PYEE 3H1ZA 3F04A 2DYRB 1KEMH 4GI9A 5LG1A 4N86A 3UYOD 2AF2A 2XV3A 4LSDA 1IE4A 3ZE0E 3BN9D 3LZQA 3IAGC 1KJ2L 2WGNB 4QXVA 5DZLA 1H6FA 3IDXL 5I1HL 1KLGA 4F8QA 5MEQB 3IAPA 2DIEA 4KV5E 3HE7B 4UI2A 3RWDB 3RWEA 4KK8D 1JK9A 1HILA 4APXA 4J6RL 5I8OH 3VVVA 4PB0L 1KACB 1H3UA 1MQKL 1P7KA 3SN6N 2VOTA 4MXWH 5LGJA 3RKPA 2V2TB 4I2XE 1JPTH 4HWBA 1NTDA 1Q1PA 2NX5B 3KW8A 4LCWA 4XO5A 3VXOA 5CBEB 2ICEC 3VG9B 4ZMXA 3HR5B 2CO6B 1QSEE 2XWXA 3MNVA 4CSTA 1GGIL 4HHWA 3I02B 2E74C 2VXQH 4M6OH 4NKIH 4DKDC 4UTBA 2IDTA 2IANA 1QLRB 3DV6A 1K3ZA 4V33A 4TRPL 1KGCD 1L9PA 1OAUH 3RUGE 3I2CH 1MZZA 5I1KH 5ERWB 2NY4D 3M6DA 3O6FC 1YPZF 1AI1H 4UM8A 4PJ6A 4GAJL 3LS4H 3MRJA 4FKEA 3ECVA 5LN4A 3T65A 4TLKA 2FEDD 5HDBE 4AQ1B 1GHFH 1RK7A 4XNMA 5E8EA 2WBJB 5EO0A 1KEGL 3AXLB 3QDHA 3V4VL 1U8NB 2R59A 3BDXA 1LO4H 4K71C 2AXFA 5CILL 1ZLSH 2RGSA 1QI4A 4U6HB 2MCMA 4JQIA 3MXVL 4GW5B 5AOLA 5EF3A 4AYFB 3IMTA 3FBQA 1UFGA 4F20A 3WMQA 4ZUWA 1SDDA 3B83A 2DLGA 3FUEA 3IJYB 1NFDF 3U6RA 1DQIA 2WBJD 4FXKC 3T04D 3UMNA 4HPOH 5AENA 1YAZA 3BIKB 2N1TE 3NCEB 4V11A 1F4WL 4BCYA 3HUJB 3TPKA 5I6MA 2P4AB 2Q3AA 2WLJA 3ZLQC 4ZAKA 2K3HA 3GF8A 3MZTA 4IBYA 5DYFA 5KN5B 3VX0A 3IJ7A 5KVDH 3N44B 4HJ0C 3DVFA 1IAIL 3DUSA 5AAWC 4DZ8B 4PRPD 1L9MA 2ZOWA 3IU3B 4P23B 5DMKB 2JB5L 1ERNA 1BYPA 3PDOB 4FQXD 1BECA 3LKRA 4Q6IA 5KVFE 4PGEB 4XHJD 3EOBA 3QRFM 4H0LC 1J5CA 1JV2B 1WO2A 2E59A 2Y4SA 3VM5A 1I8KB 2Z34A 3EOAA 4NIKB 1W80A 1PAMA 1S9KC 1UADC 1ZLUK 1JGUH 4PYHA 1XAUA 4U6YA 1RIVH 1TQWA 5K1VA 4MA1C 3SZ6A 1TZOA 1QR1A 3KYMB 3RNQA 3EBHA 3VE0A 4CC4C 5I17B 5D7IB 3MNZA 3DWTA 5CLZA 4X83A 1PQZA 2A5UA 5AW3B 3W0WE 2CBPA 3C87A 2I69A 4RESB 3NJFA 4I1NB 2VMDA 2EUVA 1SLXA 3OLIA 2IPKA 3QPQD 3GBNL 4I0PD 3ULUH 1C5DB 2YPKB 4OGAD 4U33A 3UTPD 1E28A 4Q89A 3OKOB 1HWGB 3DGCR 2AITA 3QJHA 1OE3A 1JZHA 1FZOB 4M61A 2HP4A 4U3SB 4B50A 4FXGA 3NFSH 3VGDA 2ENPA 1MQ8A 1FJ1A 3FOLB 5ACMA 1A14H 3S7GA 2EIBA 1A7QH 1CU4H 1UASA 2Y25A 3EGSA 1Q0XH 3FN0H 5T1KA 2FSEA 3T2QA 2QVFB 2CNZA 2VLRE 3DVNA 4RMSA 3P2DA 4Y7OC 4J4PA 4LCWD 4QR7A 5EU6D 3MVSA 3VWKD 3ILPA 2ZYRA 4PHZA 3T6VA 4AGQA 2LTQC 3NESA 4W93A 3ZYIA 2APBA 1MCQA 4UV7L 3X17A 5JHBA 1J8SA 1T0MA 3X1GA 4OKVA 4F2MA 1UOWA 2B5IC 1PKQB 4IDLA 2XXGA 3MOQA 3O9WC 4X6BA 1KIQA 4H20H 4H0GA 3D4ZA 3WJMB 2XJLA 3P3SA 12E8L 1F8TL 3NJMA 4XN7A 4DVRL 5JMRA 4RFOL 2Z8SA 4B9GA 3NGBB 3TZVA 1M56B 3QR0A 4HEPA 4R2GB 3W57A 1UT9A 4QXUL 2BDNH 4J3WA 5BS0E 1PGRB 1ZLDA 2QADB 3QJSB 5GGSY 1CDHA 1RHHB 1E8ZA 1XGTB 2DD8L 2ICES 4Y9FA 4ZTPH 3B7RL 1YZZA 2EE2A 1K72A 5ABAA 5C7ZA 3CFBA 1F00I 2YD7A 2YWYA 4QHNA 3ATBA 2NDFA 3BP7B 4LSVL 2GC7C 1OSPL 1EBPA 1IBFA 1J5OL 2IDUA 3F6LA 2Z35A 3TO2B 3WTSA 5F7EH 1FP5A 2VLKD 3NSFA 3O4OB 1UWXH 3QJHB 3QJFB 5CF3A 3EOYG 1T1XA 3IFLH 1ZE3C 3EJSA 1JYWA 4MA3B 3VFPA 3ZQWA 4M7LL 1NSNL 1YEEH 4IBWA 2OMWB 5DQDL 2ESVB 3HMXH 3TCLB 2W8CA 1U8JB 3MROB 4I77H 4RBPK 3KPMB 1DVFD 4HT1L 1OL0A 5CSGA 1FQ9C 4ALAL 2ZONA 5E5LA 2ZUWA 4ANUA 4CAGA 1KULA 3ARWA 4X4XB 4XP6L 4FRWA 4KXAA 3ULUF 3CMOL 5ISZE 4PJ7E 1E5ZA 4JPWH 1IKOP 2CRZA 2J1XA 4XVTH 4Q8BA 1FH5H 3NIDE 4KHXH 2XSKA 4PJFE 4HMEA 4WJ5B 1J9CT 4LASL 3TNNA 1ETZA 1NFIA 4RFOH 3WNIA 1WTLA 3O2WL 3T0XA 3HLKA 1JTOA 2Q2LA 5TTRA 4Z77A 4PV9A 3D06A 1IAOB 1KCRL 4CSZA 5IFJB 2TAAA 1EGJH 2P24A 5BW7A 3BW9A 3SGKA 4KZEH 1VEPA 3OKNA 1FI8C 1HWHB 1PNDA 4LCIL 4WV1B 4QRSA 4P2RD 4FULA 4X9YA 2KZ1B 2JE8A 3P73A 5HYSB 2O5NA 2Y36H 1UXSB 3NFPB 2B14A 1BQLH 3G3LA 5EU6A 5C07E 5KYUB 2ED6A 3X11A 3MLSH 1SXAA 1UZ8B 4QPEA 5ADPH 1I1AA 3V4PB 4A37A 2RAMA 2IFFH 1DQML 1A3ZA 2XN9B 2VT0A 3DIFA 3B2VL 2EDTA 1AD0B 4S1QL 5ALCH 3GXFA 3RY6C 1ED3A 3RKDD 1LILA 2MPVA 3VGHA 2R0WH 1N59B 2L7EA 1ZHLB 1EFXB 2WINB 4OZFH 1KENL 5F9WC 3MLXH 1GGYA 3LKSA 4JY4B 4NM4L 2Q6WB 1TETL 3RX8A 4CDGC 1SN2A 1KTLB 4KJPC 1NMBL 4Z7WE 2BFGA 3QCVH 1J9SA 3EJYC 1DLHB 1A4BA 1Q0XL 3FN0L 3O41A 1TXKA 3GSQA 3U7WL 5HJBA 4BQ8A 5J4MA 3LD8C 2WXOA 5B39B 1RK1B 4XNZC 1KMGA 5I74B 1KGYE 1JGLH 3FB8B 4Z0XB 4P4KD 3GK8H 2V9RA 1EJOH 4PPTA 2BNRB 3BPCB 2H1LM 2K9UA 4N0FA 5FM5O 3OPUA 4ODWB 1SY6A 5SX5K 1FBIH 2N0MA 3V0IA 4EIUA 4RAUB 5C8JA 1A1NA 1MJ8H 4O9HH 2BSED 1G0DA 2QHRH 4XO4A 3U1SL 1EXUB 1P9MC 5K9KB 4XC3L 2F53B 3F3HA 2QSCL 2BOCA 1ASPA 2HT2D 2IQAA 5EBWA 1WIOA 5EN2B 3BDYH 4XBPA 2YKLH 5EZPA 1XTMA 1H15B 2NW2B 3ZE0B 3A4DA 2C9PA 1DVXA 5CEZE 4MXVF 2NXYB 3OB0H 4OCXH 3KM2A 5EBGA 2ZKYA 4HWUA 5HI4D 4GBXC 3MLWL 2QBWA 3HG1A 1H3XA 2Z31D 5D4QA 3MREB 1PDKB 2R0ZL 4NXSA 2BY2A 1BZDA 1C7SA 4WEBH 3TASA 2E0PA 3OHXA 5FPIA 4DESA 1N0XH 1MVFA 4ETYA 5KJRH 3CC1A 3FSZA 3MRFB 3SGDI 5DD1H 3CFUA 2QELA 1UOLA 3QDJD 4LLQB 3MLTA 1QFOA 3QT2A 1FN4A 3FH8A 5IQ9B 5EZOH 2YAHA 3H6JA 4CJ1A 5D4IA 4KKBD 5TGBA 3ZDXF 4NPJA 1P5UB 3BQUC 3TA4D 3WFEH 2DMBA 2IH9A 2Z1PA 2E27L 2FBOJ 3IPEA 3L5IA 2VDPL 4LSTH 5D6CA 1D3CA 4PU2A 5TK4A 3AM8C 1NLBL 1FO0L 1LD9B 1Q1JH 2D0HA 2FB4H 4KTYA 3FCGA 4G7YH 3X12A 4JKLA 4C4KT 1SRDA 2OCFD 4BCXA 1Z5HA 2OI9C 4HJSA 2PP7A 1RHHA 3H3KA 4MCZB 2WWKT 4E9XA 3CFCH 2WSKA 3CSBA 2WIIA 4HZAA 4MYPA 4KJWD 1I7ZA 2R29L 3VVWA 1G6RH 2CO1A 1ROCA 2CR3A 3NZ8A 3SBQA 3JVGA 2Q7YB 4CA4A 4EI5C 3RZWA 5D7EA 2Q20A 2NY3B 4ZXBC 5LGHH 3UBXG 1MRCH 4U0QB 4HU2A 1HKLL 2CA3A 4OLVH 3O2DL 4PJCB 3HZYA 3JTTB 1ZANL 4R4ND 3S35X 4YFLF 2ZWZA 4OKVB 2JKSA 3D48R 5DRZA 3WUWB 3ZIMA 1E3FA 1ZD6A 2A6DB 3IFNH 5H2BA 1WFMA 3GSNB 4BZ2L 3NAAL 4HXAL 2VNCA 3FTSA 3DYMA 5JHDD 1U2YA 4P5TA 3R06A 1U36A 1FNGA 5A16B 1ZVHA 2A77H 3V5DA 1PG7H 3L3KB 1HOEA 3DVNB 3QUZD 5J1AA 3VW3L 5J89A 5GISH 5IHZB 5D2NB 5D6DA 1WFUA 3OR7A 3MOAL 4X6DA 1RJYB 6FABH 4M5YH 1EAPA 2ZOOA 5DJ8B 1VFOA 3OKLA 4YK4B 2DN7A 4XN1A 3WIFA 1M3JA 5I1AA 4IEFB 5CINH 1L5GB 4DKFL 1YO4A 4AW4A 3ISYA 3CHPA 2W9EH 5CCGE 1E4XL 2OTWA 4R84A 4RX4D 4NRZB 1I1YA 4K23L 3TBBA 3FZUC 4IGBD 5CU5A 5SWSE 3UZQB 4PS4H 1GXEA 2ENJA 2JTYA 5DS8A 3ESUF 3ZE1B 3TP4A 3IVKA 5JUEL 4IU2B 4WI4A 1EX0A 5J0BA 2CJTA 4J8QA 2E75C 1NKGA 2OXHA 1SJEB 2YEVB 3LVTA 3RNQB 4YC2B 5GSRB 4K3HA 1ZSDB 2OFQA 2WVUA 4DTGL 4MS8C 1JHTA 3U30B 4MS6A 3C9NB 4GW1A 2G5BA 1P4IL 3DARA 4ONOA 3ZSSA 1DZBA 2Z91B 1AGBA 5GJTL 3G08B 3G08A 4IGBB 3QNXA 1D2PA 2HZHA 2A4ZA 3A4FA 4GS7C 5E2UL 4K73A 2XNAA 3B7YA 4N25A 1DZ0A 2GFBA 2NY7H 2FX8H 3TBYA 3L13A 4LLMA 1AGDB 4HPOL 2MNWA 2VXSH 1TPXB 1T5KA 4EXPX 3RWJA 5GS0C 2QKIB 3MR9B 2HAZA 4M29A 5IBTH 4Z7IA 4PJDB 2V7NB 2XN9A 4HPYL 1NCOA 4IS6B 3OKDA 1BGXH 3C09C 4M43L 5JIHA 3RNKA 2Z4QA 1B88A 3LKOA 1VPOL 1TVBA 2A74A 3P02A 5ELIA 1MCOL 5KYUA 4APQD 4P5KA 1NC4A 4HD9A 1A02N 1RJLB 1TO5A 2QSVA 4AQ8C 2YD0A 4NUJA 4MQ7A 4RBPH 3SSGA 4U1IA 5E70A 4HWNA 4KAQH 4E42A 4CN1A 3KPRE 2IOOA 4EN3D 1Z32X 2WO2B 2OZNA 4XH2B 4YDKL 3SZKC 1FNHA 3HFMH 3TT3L 2JWYA 4A7TA 1R46A 1JNNH 1X4ZA 4U1LA 2WB1A 3GSXB 4XVUD 4N68A 1OAXH 5AVWB 2VM9A 3IGAB 4HETA 4Z6AT 4Y19A 3TF7C 4J1UA 4ZDHA 4FFZL 2P8PA 2WXHA 1Q0YL 4TSBH 5I0YA 4OSUL 4M1CC 3JWOL 1NL0L 1T66C 3HJ0A 1C8PA 4GMTH 2WBJA 1C08B 4JM4L 3LNIA 1CL7I 3LH8A 1OY3B 4L0YA 4H20L 4IHBA 2VISB 3STZA 2L8AA 4N2AA 4Z23A 4YNYA 1JZGA 4EQ3A 3PHOB 1F3DJ 1QUNA 1YSOA 3HZMB 3O0RH 4U6VL 4PJEB 3FN9A 5MENE 2EIJB 1DR9A 4RCAA 4JZNA 4KJYB 5CKGA 4G9FB 3W0WA 1RZJL 4R5TA 3ELAT 1MHCA 3FRUA 3MCG1 1KFAH 3T3PF 3UCQA 43CAB 1P53A 1KLUA 4YE4L 3Q2CA 2Z35B 2ZX6A 1BSIA 4R26H 1DEEB 3QCUH 5LHDA 4O4YH 3UOAB 3UBXA 3QA3B 5T3ZD 1TTFA 1FRGL 4TKWA 1NIDA 5DK3A 2Q5BA 1W9XA 4MCZA 4ILDA 4WO0A 4P06A 5CJ8A 2V2TA 3PUCA 4OLUH 3VNYA 5I24A 5ACZB 3KMDA 1FFNB 3VB9A 1BFOA 4MLIA 1RQ5A 1XCXA 5FO9A 1FYTE 4LLWB 4H0IA 7PAZA 4HKBB 1UWFA 2RFXB 5F3BA 3CDGB 4WEUD 2GJ6B 3SDAA 3L3GB 3Q1SH 4WI0A 3LV3A 2EDJA 4DKEH 4S1DC 5DUML 3MA7B 1KV3A 5IHBA 3GRGA 3V4LA 1AS8A 1U8CA 3FQNA 2ZKHH 1ZSHA 2PO6A 2L0DA 4PS4L 1FDLH 5F7NC 5DJYB 3Q48A 4KNQA 4C8XA 4IRJB 3LSOA 1BMWA 2CBMA 3AUWB 1BA9A 1JGUL 1JDCA 3W9DA 1P7QA 3FFCA 4XAKE 4DAGH 5BV7C 5C0EB 2IPTL 2QGCA 4M7ZB 5F6HI 2V5SA 4N22A 4XZUB 3VX1A 1BF2A 2D4FA 4BSVA 3P4MA 2CKBB 1DE4B 2OMVA 4Z7WF 3FT2B 1PZCA 3CU1A 4B3EA 2Y9RT 4B9KC 2GEQA 2OSYA 3OPZH 4QRUA 1PZUB 3QRBA 1FZOA 4M61B 3IE9A 3EXLA 1HSAB 1OXYA 1IFHL 3F7RA 5FGCE 2VE6A 1VACB 1DJZA 2F15A 2VXQA 4O2CA 5JXEA 1A6ZB 2CM6A 4RMBA 3ZGIA 3BAEL 4NN6B 2FX9L 4DO5A 1T5WA 3LKPB 1WLHA 5E4EC 1T2XA 5MERA 3VFSB 5ILTH 4HOXA 3TA3A 5IEHB 2HFFB 3VTMA 3HE6C 4MJ5B 4Y9CA 2XZQL 3IMVA 3KLLA 1T3FB 5JHDA 1OHQA 1T1WA 3SKNA 2E9BA 3HN3A 4XCYA 4Y16B 1MWAA 5CZXD 1AJ7L 1CGUA 2OMUA 3LN9A 1O5PA 4N0UA 4NWUH 3T4YB 5IB1B 1KXVC 3DETC 2JCCB 1NIAA 5ABDE 4AQOA 3MO1A 3WJLC 4LK4A 4FA8A 3L2MA 5DUPH 2PWFA 3EOBB 2F18A 4DGYH 5CIPB 3QDJA 4MZIA 5KSVA 1YDPB 1KJVA 2AXJA 3ZHNA 2K4AA 4JZJA 5KVEE 1OSEA 2J6WA 3IGFA 5IQMA 4YSAA 2BOBA 5KYNA 5FR3A 2BC4B 3QQDB 4TVSa 2O5ZL 1CR9H 4UOJA 5IMOA 4K5OA 1F8TH 1QWNA 3QW9A 4ZFZA 1ADQL 1YUHA 2EDHA 1S7XA 3E6HA 4U3CA 2DL2A 3O0RL 1EA9C 3LCYA 4KNSA 4XPHL 1J05A 4ENZA 3DOSA 5KJ4A 1TR7A 4K3GA 2G0KA 2ZAIA 2HX9A 5GQBA 1U3HA 2CCVA 5I5JA 1CXKA 1KIUA 4JCLA 3J2PA 2YSSA 4HCGA 1C5BH 5FYKU 2XBZA 3UG3A 4G1EA 3HHSA 3W39B 3HS0C 4Z77B 1TSRA 2ERJB 1A3QA 4WI5A 4L8SB 4KI5F 5BJTA 1XB8A 5KJRL 3FCTB 1RU9H 2C9QA 2WAQA 1V27A 4QNPF 2X5PA 3WGUB 3NCFB 4ELDA 4A2EA 5DD1L 1TLKA 2C3GA 3FO0L 5D7JD 4HFWB 1SXZA 3UTTA 3R4RA 2DQDL 4POYA 1U2CA 3KBEA 3VXUD 3MRBB 2IH1A 2OW7A 1DVQA 4G6AD 4XP9H 1NGPL 1ACYH 3UADA 1DBBH 2AQNA 2R1WA 1DQLH 3II2A 5G5DB 1R19A 4X99B 1JHLH 1EHKB 3WEAA 1KCUL 3SDAD 3ZRFC 2VWEE 1Y18A 3IDYB 1BLNB 3MV9A 3OXSA 4HH9B 5B3JE 2IANE 3ZU8A 4HS6B 1ETB1 1SEBA 1YMMA 2BNRA 3BPCA 3DHMA 4JKPL 5FKPB 3GIZL 3IPBA 1KY6A 3MJ9H 1I9JL 1GGCL 4JHZA 5CEXB 1FORL 1F4XH 3LKNA 2C3VB 1VIWA 2FH6A 5EA0L 3QJQB 3NRFA 4HFWA 3HR5A 1UYWL 5CN2A 5HHVH 3GI9L 4X9GA 2A9DA 4DSYA 3AWEA 1N5AB 1Q9OA 3CFDA 2CUIA 5GGRA 3L9BA 3PWVB 4NO5A 5D1XD 4EI5B 5HJDA 3D3VD 4GXUN 2Q8AL 4AQ1C 4RGNC 3QQ4B 4H88L 2P7TA 2VQ1A 3VRJB 5T3XE 4XVUC 1PS3A 3N1MC 3JV4B 1RVFH 4M6AA 2DQDH 3E6HB 3NIGF 4HJEA 4OCSL 4WWID 2CO7B 4LLDB 4OD2A 3LZRA 2XRAH 1BVZA 4ZPTB 5AW1B 1EFQA 3WFEL 4JJ5A 2WQWA 3K2UH 4DH2A 1J8HE 4EZKA 2UWEE 3MBED 4YXKH 4E5XB 5L2KE 4J5VA 4KQ0A 4A6YA 4ZSOE 2DM7A 5AW0B 5I0WA 3CIAA 2HX7A 4Z7OF 1NLDL 1GZPA 3K1DA 5C2UB 4JFHD 2YBRA 1IBBA 1CFMA 2NNXA 4P59H 3GS7A 5DJAA 2WXQA 1DVFA 2VXTL 4Y4FB 2BWQA 5E7BA 5ANME 5F9JA 5AVXB 3PGFL 4XAWL 3SO3C 3UJIH 2XQBL 4YBQD 1U8KB 5HYJA 1JGLL 2V3EA 4AOFA 2ZAGA 3MBEB 3L9EA 3PNWA 2BNUA 3D1MC 4PD4K 1GPOH 1OT4A 3HLAB 1SJEA 4GAYA 1KT2A 5JR1L 2VLKA 2Q8BH 3M07A 3VXMA 1M4KA 4P2QE 1HS6A 2QGEA 3QZWA 3OX8A 3J27A 5KANG 1JUFA 4CMHB 1CDJA 4EUPH 3MRIB 1U2HA 2PTUA 3FPYA 3L54A 2ZT9C 2QSCH 4WW1A 5BOJA 3F7YB 4IDJL 4IIQA 2KH2B 1T21A 1T21B 4WFHE 5C2BH 4W4NA 3PGCA 4S0TD 1QSFA 4MASA 3QNYA 4PV8A 5B1AB 1CZ8H 3EO1A 4K5PA 1OTSD 2FBRA 4GRWB 5DC2A 1CLOH 4PRIA 5KOMC 1Y6KR 3SE8H 2ESVE 3MLVL 1TG8A 4I4WA 3SYOA 2QQLH 4OUOA 1M42A 2I9LA 1UB6B 4FI8A 3D3VA 3FQRA 1KN2H 1IGFH 1C5CH 4ZD3L 1YEJH 3VFVA 5J1SC 4ICXA 3MUGA 5EWIL 4IMLA 1XXDC 3AWGA 3MLRL 3RKDC 2P3YA 5BUGA 5L8LB 2V3FA 3WHXA 2XQYG 1AG6A 3EYQD 5F7YC 4WHYG 3II1A 1TETH 5I1EL 4FDWA 3LKSB 4JY4A 6FABL 2ZXGA 4W81A 3FW6A 1LHZA 1JGVH 1ZT7A 1A7BA 3TEUA 3TJEH 4KQ3L 2ADIB 1TEGA 1OT2A 1OPGH 4PJ5B 4QGTA 1XGZA 4NDMB 1QEXA 2AEPL 2CLZA 3PABA 4FNTA 1EEYB 3I9PA 5T3XH 5DWPA 3VGGA 1O9VA 1NGPH 1QSZA 4OF8A 4XMZA 2FLRT 1UZ8A 4NFBA 3I2CL 1RUMH 2O5XH 1ZLWK 1LO5B 1U3ZA 3G5YA 1PF3A 3T2OA 1PCSA 2BVEA 2WKOA 2BP5M 3GTNA 3HC0B 4HT1H 5C09E 3VQMA 4CSSA 5D2NC 4XB8A 5LGYA 4TPRH 1ZGLB 1XF5A 1QO3B 3ASNB 4MJ6A 2P43B 5MP6H 2VAAA 4I9WD 5KUMA 3CX5K 3CZGA 3VMPA 3I6KA 4M6ML 1TU2A 4F57H 2FX7L 4LT7A 1CDGA 1KBVA 3B9EA 1HN1A 3SJVE 1JL8A 4ZD3H 2LV4A 2OJEB 2H0JA 1OAJA 3WMSA 3H7LA 4UM9A 3WIHH 3HI5L 4FNQA 2VKWA 2FWUA 5CLYA 3MUY1 4FNUA 4WI6A 3EO1B 1WTGT 4L2YA 5JPMC 3F58L 4RISH 3DBXB 1SEQL 3LVEA 1QSFB 3CXHJ 4GXUM 2YD1A 5KS9B 1CPUA 2R1YA 3CLFH 3M1OA 4JFEA 1GC1H 3T0EB 1KELH 1S9XB 1XHHA 5ICXB 4FNLL 4PBWD 4GW4B 2R1WB 3LDBC 1DO5A 4N9GA 1TEFA 1R9FA 4XMLL 3I9IA 4PLOB 1YN6B 3EJJX 4O5LH 2C4FT 5EH1A 3EJPA 3OZ9L 4DP8X 2RR3A 3BQUD 4MDRA 4NQEE 2J71A 5D70H 4MQXD 3VJ6A 1S6NA 3JV6B 2OJEA 3LIZL 5EPMA 1KCBA 3GXNA 4ZYKB 1D7BA 1XWVA 1TPXC 3NEEA 4Y2DB 3X3FL 1NC2D 2WKGA 2PCPB 2PW1B 3ZL4H 3QAQA 2MSPA 4KKLC 3F8UB 1UCBL 3R4DA 4WJG3 1VFAB 3HE7C 1OGTA 3KR3H 4PJFA 4KKAC 1Y6NR 5D8JH 1NFDA 3GUFA 3I3EA 5IHWA 3V4PH 3O2VH 1U8QA 3D7PA 4JL1A 4FJZA 4ZX3A 4NHCH 4LLDA 2AANA 5FK9B 4UNVA 2DTSA 3L3JB 4IRZL 4QJ4B 4LPVA 1AKJB 2V6HA 3BP5A 1NOLA 3SO5A 5DVKA 4MKTA 4NDMA 2JQMA 5H94B 4MMXA 3WEXA 3LZOA 2IVFC 2V2WB 2WQ8A 2EEBA 4HCRA 1LQBC 2H32H 3K8LA 2EINB 3DMMC 4Q9RL 2H3NB 2DEXX 2VR8A 5DTFB 3F5WB 4ZTEA 3IS0X 1L3WA 3E1F1 1E2VA 4IMKC 1MCSA 4U1NB 1P6FA 3K2IA 4QRAA 5DO2C 2F19H 2VC2B 1MVYA 3ECQA 2XN9D 1NEZG 3GI8L 1VSCA 5KBNC 4XT1C 1XV8A 3RVUD 2J5LC 5L2KD 1UATA 4JG0H 4O51A 2FCBA 4L48A 1N0XL 1OLLA 4KKNA 3BAEH 4MQXC 5CP3A 4XI5C 4Z7WA 3ZL4L 1FFOB 4XMWA 3PFQA 4KKZA 4HH9A 4AC4A 4LEXL 1P69B 4DW2L 5EIQA 4PJ7F 3HRZA 4LL1A 3PG2A 2ZKWA 1SMDA 5DLML 3Q43A 2ZE0A 2K7PA 2MWCA 1NCDH 4EMZA 4O2CB 4HFUH 3VRIB 2RHEA 4OJDH 1D5IL 5I0XA 1RSFA 2R0LL 2JQAA 1GJWA 4I48A 5DZNA 5DI8A 5DJZB 1QABA 3K2MC 3OKKA 1LJMA 3CSPA 5F7AA 3U79A 5ID0A 5DJ2A 2FB4L 4A68A 3ARGD 3DJ9A 4BFEA 4CW1A 3D0VB 3QFJB 1JK8B 5T1JA 4FTVE 4BFGA 4G6MH 3D2UB 5IHZA 3RVVD 2EC9U 3RB7A 1ZCRA 4RX4A 2AK4B 5DD6B 4M6MH 1NAKL 1TQBC 1BDYA 1AMXA 3HZ3A 4EIZC 2VERN 1FNAA 4J3OH 4Y5VB 3S5LA 3DSNB 5BXFA 3LS5H 3D33A 4C56A 3NA9L 3QFJE 4YXLL 4IJ3C 1G43A 4MNQD 2WTOA 3O3AB 1NDGB 5DMIL 2GITB 2NXYC 1QRNE 4XPHH 5I8CA 3FCUB 2PYED 4PRBB 3L81A 4PRHB 1N7ML 2JI3A 3CFQA 1A6UH 3H3PL 2ARJQ 3JTTA 4K5NA 3SGJA 3V4VH 3VFUB 1GGBH 3UFIA 3PAVA 2XFXA 1DN2A 3H7BA 3EYOB 3S34L 3TBWA 4XPGL 1QA9B 4NB7A 4K9EC 3VXUA 2QPFA 2XXCB 4NXKA 4I77L 2FIKB 1CU4L 3BGMB 3S8GB 4GG6F 4NO0A 3QUKB 4ZSOA 5IT2L 3UAEA 4IRSC 4LCCA 4FS0A 5C6TH 2G3XA 2NXZC 3QDME 2A2QT 5DUPL 2IGFL 4U0RB 4N0UE 3SKJH 1ESOA 3DRTB 3VA6A 3EDJA 4Y5YB 5BVPL 1KBGL 1QKZL 3DXAA 3RQ3A 1ID5I 2FJSA 4LCCC 1AXSB 2YAPA 1MDTA 4RA3A 4X80L 1RZ8B 4E41D 4ZRGA 5DURD 5F7HA 3QJXA 1OTSC 3EKCA 3NIGE 4LVNC 4TNEA 5DK2B 3OWEA 1N26A 4POUB 4D0BB 4EVNA 5JDSA 4F24A 2OAAA 2ITFA 3RVTD 1F3DH 1S7UB 1KZQA 4L4VA 2VISA 1Z5LB 1VZHA 1T5XA 3ZW3A 2YXWA 5J56B 1F0LA 4QO1A 4KO9A 2ITCB 4M93C 1A0QL 1YEKH 2HSIA 2QVTA 4Q2ZB 3PAZA 5ALCL 1F86A 3S34H 3MRPA 3VUAA 1ZTXH 3H85A 4TUJA 3APDA 1ZLVK 2EC9T 1A7OH 4AEEA 2XZAH 4G5ZL 4CBPA 2LAGB 1OHZA 1L0YA 3O9WB 4NOBA 4NQUA 4P2OC 4P9HL 5DJYA 1MI5A 3WENA 1ZHKA 1U8MB 4N2MA 4OT1L 1P7KB 5D96B 4FQXB 4W6XB 3UTTE 3WN6A 2FJHA 2MTPA 4NWTL 4AXWA 3CHXA 4MNGB 2FGWL 3JWDH 3V7MA 3QR1A 4M1GL 1ADWA 3HRPA 4OJFH 3EYUL 1ILSA 2I7OA 2WLYA 3GD1C 3N06B 4MAYD 1OTTD 4HKBA 4XO8A 1MG3C 4I89A 4BDVB 4PFEA 4XCCL 3HLAA 4GAYB 1HZHH 3QG6A 1R75A 4XP4H 3GHEH 4LRIA 4OGQC 2ZKHL 1MFBH 5EEZA 2VAJA 3NZHH 3SO3B 2XTJE 4WVRA 4XAKD 3D39A 4YPGA 3EYSH 3QEQB 3U6XS 4PY7A 1CLZL 3RPIA 4XX1G 2FEEI 3JTSA 1KB5H 1NICA 3F00A 1CD1B 4KI1A 2N56A 5D1XB 2H3NA 3F6IA 1S7RA 2G3NA 3T4AB 2NY5C 4F9LC 5DZVA 1MWOA 4HIEB 5D7SL 3TO4A 4N6RA 4CVXA 2WQXA 5E1QA 3ERXA 4PLJD 3FFDA 1QLFB 5D1ZB 1R3KA 4HKZA 1XD1A 1U8JA 4HA1A 3HBGA 3U30C 5F72S 2KZKA 1K2DA 3FT0A 4YNYB 3MRNA 5FA3B 3OSVA 2FO1A 1CT8B 2OJZH 3FCSA 2CIIB 2J6EL 2V0AA 4JFPB 1MY7A 5CSZA 3HAEA 4ZW8A 3S8WA 4KDWA 4GS7B 4ZO8A 4MJIA 1A25A 4M03A 4ZTPL 4XVOA 4FG2A 2ZXQA 1YLBB 3CCHA 2B59A 5KBPA 1ZVSA 1DBJL 1XF4A 2D7QA 2F68X 2QQNH 1FO0H 4YL4A 3HKZA 3ZTNH 5AL8A 1P4UA 1PZBA 3B9DA 3FO0H 2JQZA 4KUCD 5DURB 1M7IB 3TCXA 4Q6IC 4JO4L 3GHEL 4U31A 5DZOA 5LB1A 4HJJL 5E6ZA 1ZTXE 3FHQA 4L29B 4APQB 4F7TB 2R15A 4ECNA 4PBVC 5I82A 1NCWL 1RH8A 1RUPL 1XCQB 2IV9A 1JNLH 3R06B 5IVXF 2EILB 1X5LA 2H6UA 3UBGA 4K8RD 5DJDA 2W81C 1T6VN 4J3SA 2FECI 5JZ7C 4WK0B 4W9CC 2R7EA 5CSZB 2YMOA 3VSUA 5BQ7A 3L5JA 1BM7A 2EDDA 3MRKB 3OM3B 5F96L 3U4EA 1L9RA 4GKNB 1GS8A 1H6EA 5LGHL 3U0TB 5IJKC 4OCRL 2WUBH 1OAKH 2O5ZH 3BPNB 4H2CA 3EUDA 1FSKC 4AK2A 1S7WB 5DHVH 1JZDC 1FDLL 3H6AA 3SOBL 2QQLL 1MJUH 2GHZA 1PL3A 1G7QA 1GS7A 1F97A 2RCSH 2CJSA 4OGYH 3CFBB 1A7RL 4GAGL 1YEKL 3KPPA 4MCNA 4Y4KC 2FSEB 5DCCA 2UZYA 3K74B 4X4ZA 5K1JA 4D8PB 3X14B 4PGBA 5C1MB 1L7IH 3TM6A 2A9AA 3VSVA 1EXHA 3D3VB 1BIHA 2YHGA 1WGOA 5GS3A 2AJZB 5GGUA 4DP6X 1G87A 1KZYA 4LRNL 3WKMH 4M1DH 3T0EC 4K71B 1FIGL 2BCKB 2FJUB 3HN5A 2GJPA 5EZOL 4HC1H 3ZMRA 3DROA 3JUYA 4NZUL 2GBTA 1KLGB 2WUCH 2CRIA 1J1OL 4S1QH 2HXAA 4S10A 4BSWB 2V5YA 5I1CL 5JW3L 2LU3A 5I8CB 3HB3B 1OANA 1W72A 3EYFA 4FFWC 5C0BB 2MCPL 2VDLH 4JZJB 2PP8A 3ARBC 1MCLA 3ARRA 3E9TA 1FVCB 1KJMB 4ZUUA 5SWSB 4XN4A 5DMGD 4BXSV 5CCJA 2AJ3B 2YXVA 3OQRA 5BO0D 1WK0A 3N04A 2OL3B 2PR9A 2LFEA 4LQFL 3SDYL 1HH6B 3REVB 4YQXH 3T1FB 8CGTA 1DDHB 1HL4A 2MTAA 3KGRA 4YHZH 1LE9A 3VQLA 3TEXA 3BAJA 4OF5A 3TU6A 2EDEA 4X6CF 2LVCA 4GAGH 1OAZL 4EZJA 2WVSA 4MVBC 3VG0H 4PW3A 4KHTL 5FW7A 2IBZX 4WW2C 2KDGA 1HNFA 3QIUB 3FQUB 3WNNA 5CZKA 4KMTL 4L3FA 5IV2B 4HLJA 3TH4T 2HLFD 2L04A 2Q86A 3N1GC 3QE5A 4OM0L 3UAAA 2N59A 2HRPH 3LZLA 2WQSA 4LLAA 2XCMC 3JV4A 5DD5H 4A67A 5IVNA 2QMJA 5D7IA 1PYWA 3HC4L 2HN7A 5GRUL 1CGXA 5FUZL 4TL4A 3BQUA 5BRQA 2WK2A 1KT2B 3CVHB 4ZFFA 4JVUA 4J6RH 3IDUA 4QRPB 4AW7A 1A6TA 1LE9B 4L4JA 1ZDSA 3PNWB 3KDMA 2JK5B 3MJ9A 4BK5C 4PGBB 1HKFA 4BZ1L 4OFKA 3W2DL 4DP1X 3QORA 5I1GL 2VABA 1OQOA 1A22B 1PFCA 2XA3A 5I0ZA 1RD6A 5JHDE 3C5ZA 4F3FA 1KN4L 1J5IA 4Z5RB 3IN2A 4DERA 2AGJH 5E08H 1IZKA 1OGAA 5SV3A 4G7SB 1TO4A 1TZIB 1YEFL 2WPGA 5DHYA 5DS1A 3HC2A 1OCWH 1IAMA 1B6UA 3G6AA 2GK0A 3GXMA 4Y16C 5EC1B 1Y18B 5I19L 2AXWA 3L9RA 5KN5A 1Q1JL 4I0PB 1NFDE 3HA0A 2PCFB 4GKZA 4G7YL 4K55A 4BA0A 2AK4D 3GMOA 2AJZA 1BAGA 1NFDB 2A6IA 3ZE2E 4R7LA 4I18C 4WWOA 1MAKA 3HPJA 3IGLA 2CM5A 1Q94B 3FONA 1USQA 5E0FA 2J12B 1RIHL 1S9VB 4TNWF 4WU5B 3SGJC 4E9TA 1T66D 4LB8A 1A6AB 4LLYB 3MLVH 2QT6A 2R27A 2P80A 3MGTB 5HY9B 1AP2A 1AP2B 2PYEA 2PYEB 4NX0A 5TDPB 1JD7A 2BY3A 4JG5A 4NCDA 3P9MB 4I18A 1I85C 2BVTA 2XICA 3GSNH 1YG9A 4NFCA 5DS2A 5GS1C 4J2QA 5LDUA 3Q13A 4XMVA 4N0CD 1UZ6F 5LGJB 1J86A 5EU7C 4ZBJA 4NZRH 2X4PA 4UAHA 1RULH 2W80C 1IM3A 1E42A 2F7OA 2Z92B 2LLLA 4LCYB 5C0FA 4GKSB 4HOWA 5F8QC 1OOWA 5FDWB 2W65B 3FU8A 2DH2A 4KUCF 1LEKA 4NBXB 5I0DA 1CFQB 3EBGA 2W9LA 4KFMA 4N6QA 4DO6A 1FNEA 3T3MB 1BBDL 5C9KA 2VDMH 2P5WD 5D7KD 3QJFA 2VTFA 3OJDB 5DJ0B 2QZQA 5TF1H 5AW4B 3M17A 1AYRA 4ZOBA 4FP8L 4KO6A 1XQ4A 2I85A 4F27A 4ICWA 4LF3B 4HLZH 4QIRA 2XLLA 4J1UB 4ZDHB 5HHNA 1T80A 1CD1A 2IGFH 5D1XA 5F3HB 3V0JA 4U0RC 3MU3A 1D5MA 3NSDA 1AQ8A 1GIGH 4GXVH 4RWHA 1LNUB 1UB5B 1ZY9A 1FLRL 4QYOA 5MI0C 3NSYA 2G5UA 2ZP9A 4QRPA 3TV3L 3MZGB 4NQTA 3VXSB 3VI3E 1DYZA 3DIFB 3GUTB 4JJOA 4EI0A 4KKCC 2J2ZB 1MW0A 3MRRB 4CVZA 1SM3H 3M1BB 3HAEG 4OZGA 3PS6A 4Z7NB 1MW2A 4N85A 3LNFA 5DC4B 3IJEA 2R4RL 3T8XB 1IFHH 4HIIB 1SY6L 4HS3A 4HUMB 1QFHA 2NYKA 4U6XB 4OBSA 3T2NH 4Z0BL 1VENA 4R26L 2AEWA 2HRPL 5KW9H 1MI5B 4B41A 2X53A 4IW4C 1HQRB 2XPYA 1AZNA 4HEPG 1YYLH 2B5IB 4RZCA 5IJVA 1X9QA 1EMTL 2BIQA 4E0RB 4MKMA 3WBDA 1F02I 3WNJA 4PMEA 4LOUD 1MRDL 1A7QL 3QCTH 1G7JA 2TRHA 5ENWA 3U9UB 5CNHA 3QFDA 2B2XH 3CVBA 1S5IH 4XBEH 5D1QC 1Q0EA 4Q9QL 5I30H 1G4RA 2OR8A 4L37A 1KXVA 1GY2A 3CHSA 3LX9A 3MGOA 3UTSD 2EDMA 4XI5D 5DI8B 2H47C 4AGMA 5GZNC 3UERA 3MYZA 3I3DA 1E8XA 3QWQB 3T0EA 1T1ZB 4P2RE 4H13C 4R96A 3WKQA 1FV1B 1M7DA 2F7RA 3CN3A 1OTUC 5ETUB 3VYOA 1CXHA 4S0SD 4N8VA 1DFXA 4XP1L 4ERSL 2D8KA 1O7DE 4HUWB 3MBEA 4PY8J 3KWVA 1TU2B 1GMEA 4Y8AA 2Y3NA 3OMAB 2WXFA 4XZUA 4H8WL 3TA3C 4Y88A 2YGVA 4BWTA 1WAPA 1FYTB 4R7XA 4FXLA 2DD8H 3CDYA 4X6FA 2FT8A 5DMYA 5DJAB 1E4KC 2PKDA 3JT0A 1XL4A 3U4BL 2YBRB 4L4TD 4PJFF 3PWJA 1XGRB 2NY0C 3BJ91 1ZIAA 4PWJA 2X4UA 5FECA 4X6BB 4U6XA 3AQXA 1PD6A 1WZAA 4LEBA 3V6ZB 4A38A 3H2QA 2HMID 1UOVA 2B39A 5JPMA 1RK0A 3BAXA 5BVJA 2X0UA 2OCCB 1BFVL 3EFDH 1BAFL 3VGAC 4EDXA 3F7QA 4FERA 5GSVA 3AU0A 3OG4B 4Y7MA 2QQNL 3PJLA 3BSHA 3PJNA 3TFBA 3PL6D 1HZHL 5DJDB 3S5LB 2F8OA 1L9QA 1ZA6A 2BVPB 4PJEE 3ZGHA 4OIIH 3WE6A 2J57A 2WYTA 2JI1A 2QVMA 4X9FA 1TTCA 4HJUA 1P4LB 2PCPA 3GMRA 2P8MA 2NY0D 1MCFA 3D18A 2IDFA 4L0ZA 4GW5A 4IBQA 4FKHA 3IJHA 3ME0A 1KIRA 2YN3A 3QUHA 5AUMA 4AV0A 5AWNL 1RPQA 3DBSA 2CALA 4HK3J 5F96H 3WL9B 4P5TD 2R2EA 4ZG1A 1NAKH 2XFXB 5FWRA 1I8AA 1JWMB 2VYRE 2YS4A 3WNMA 2W92A 4ZFQA 1A7NH 1U8IA 2JJSC 4UIKL 4LPUA 3T65B 3KPMA 1VDGA 3EXJA 4JREC 5FHAH 4ZFOL 4JEGB 1LEKB 1MXGA 3ZYZA 2ODIA 1PQZB 3HJEA 1RZGB 5IGXL 2VJXA 2WSDA 4NCC1 5TE7H 4FG6C 4R7NA 2XRAL 3A47A 2CDEA 1QLRA 3QFGA 4LU5L 4GYBA 2BPBA 1MHEB 5IB5B 3T9WA 3MYJA 4IYKA 2QDWA 4HWZB 1SOQA 2XWJB 1T7XA 3GEWB 4ZXBB 1GR7A 1OIOA 4ZMLA 1U8LA 3HFFA 4ABQA 2GSGA 1X5MA 5D7IE 4GRLC 3D2UA 2P28B 1UKQA 1ORSA 1ZPLA 4WSKA 3BSZL 3A4AA 4ZMNA 1MFEL 8FABA 2ZUUA 5D93B 5DJ2B 5TQ0H 5ITBH 4AL8H 1UA3A 4NZUH 3WEMA 5ACLA 3MRDB 3UTPE 2X6BA 2X70B 3QGVA 2BK8A 1MIEL 5E99L 4QWWD 5DLLA 4C83A 2W88A 3I50H 1A5FL 2X42A 4OTXL 2F7PA 2X2UA 1SJXA 2ZJSH 3Q3GA 4P5TC 1BVKA 2J2ZA 4X5RA 5I8EA 4HUUB 2XBDA 1M53A 4E9LA 4OFIA 4L8SC 4RFEB 4UTAL 3BIKA 3DX1A 3V0EA 1HHKB 3IMBA 1SF3A 3V4VA 4MDJA 5E2WH 5D6DC 5INCB 1HJCA 1B3IA 1CFVH 1YDPA 1HK6A 2YKLL 1NOAA 3R8BB 3TT1H 2XIBA 1FGNH 4H40A 4OF6A 3UO8B 4KK9D 1QSEB 3LQAC 4K7PX 4JVWA 5DEFA 2J8OA 2IQ9L 2CLRB 3HCVB 5T1KB 2E46A 4DK3A 4YFEA 3WFBL 1JZ4A 2IGLA 1KPUB 5F7MC 3DA0A 4Y16A 1NKOA 2FJFB 2D4DA 3DC0A 1IM9A 3QI9D 3KWUA 5I1EH 5AW8B 4HUUA 2X1XR 2DQGL 4BDVA 4LCUB 4OCSH 3UTOA 4HC1L 1T5WB 2OMXB 2KPWA