3V6FA

Crystal structure of an anti-hbv e-antigen monoclonal fab fragment (e6), unbound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
218
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISSGGNYIYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTREGAYSGSSSYPMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab e6 Heavy Chain
publication title Antigenic switching of hepatitis B virus by alternative dimerization of the capsid protein.
pubmed doi rcsb
total genus 41
structure length 218
sequence length 224
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2011-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v6fA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v6fA01
1KUMA 4Z7VB 5MENB 4P4RB 5HPOA 4LCYB 4CU6A 2EZ0D 2FLBT 2CLZB 5JOPD 3JWOH 1X4ZA 1BBJA 3QULA 4NFCA 5HVFB 1PD6A 3KGRA 3PNWB 3TPUB 3OX8B 1J1PL 4MAYC 1HKLL 3AC0A 3MLTA 5JLZB 3KPRB 2FWOB 3DPBA 5CIPA 1WK0A 1ZT1A 2ATKA 3QQNA 1QA9B 2I5YH 4P2QB 2QHRL 1CZ8H 4MX7B 4QXUH 3NCYP 4OQTH 5DJYA 1JF5A 5GISH 4Q74A 4FQXA 1ZHKB 4JPVH 4GAYB 2FX9L 4LRNH 1N8ZA 1QBML 1DBBH 4OFVA 5H2BB 1Q0XL 4PJDA 1GOHA 1IGJA 1JZ5A 4HH8A 1H3PH 4LLAA 1E0OB 3B3IB 2WWMC 3OTTA 1J0YA 4OV5A 1KTDB 5ETUA 3LZFL 1YEEH 1I9RH 3RKPA 3SPVB 4V1DB 2YPVL 2NTFB 4NO0A 4OKDA 3PWNA 3FO2B 5ENWB 4PV8A 5DJ8A 4MD0B 1EEYB 1TITA 1P2CB 3EDEA 2OM5A 3SKOA 1C5BL 3VD4A 1YPZF 1NLDL 5C0AB 3IDGB 4JEGB 1X5ZA 3QDJE 3BIKB 4XNXL 3KVQA 4R0LB 3OPZL 1OAQL 2ORBL 5FYLD 2BP3A 1T1WB 4U2ZA 4EI5D 3V6OE 1NFDE 4FHBD 3C5JB 2Z93A 3VXMD 2DKMA 3ARDD 1LILA 2DLIA 4GRWF 4M7LT 3U4BL 3S3SA 4OCWL 4H25A 2FHBA 4NQCE 1C1EL 5IGXH 1MJJB 3QDHA 4PRDB 2DQCH 3MRKB 4I0CC 4JRYE 3ROLB 4ALAL 1K4CB 3MGOB 5LG1A 3HHRB 1BREA 3M8OL 5CINH 3RX8A 4DGYL 4C56D 4M6NH 1OP3H 3C8HA 4PJCF 3D39B 2ZZUT 2XT1B 1J1XL 5E1HB 4K8RH 1L6ZA 4E42B 1UM4H 3B5HA 4GBXB 4LNVA 4BUGA 3LHPL 3VH8A 3RVWD 3RP1A 3NFPB 3K4AA 4R97C 1OAZH 1PAMA 2O5YL 3ALXA 4MCZA 4GMTH 3UBXA 4NP4L 3QCUL 4G6FD 3CLFL 5ID0A 5DK0A 3EYFB 3DX7A 5TQ2L 5D6DA 4WW1B 5F7DA 1DL7L 3B2VH 1HWHB 3EDDA 4R90H 3BEVB 5DVOA 3UJJL 4KKLC 4J3TA 2AV7B 1INQB 1ZWIA 5FCUH 2R8SH 1IQDA 3VE0B 4Q9QL 3NABH 2YPLE 4UTBL 2YD9A 3I9GL 1YDPA 2ICWI 3MJ7B 4RZCB 3FMGL 3TWCL 3VFVB 2LABA 4H5SB 4ZUUA 4ESKA 4KDWA 3HAEG 2FCBA 4JY4B 1T3FB 4X0KB 2DJUA 1FL6A 4KZDL 1LO3L 4DN4H 4DAGL 4DZBB 3CC5B 3CDGA 3QFDA 4G8GB 5EZIL 5F7YC 4XMKL 3HLAB 1B90A 4ORGA 4WNQA 4UU9A 3TIEB 4FZ8L 5J1TC 4X8JA 4CVZA 43CAA 3SE9L 2ZG3A 1YNKL 4BK5A 1J11A 5IROC 1U9KA 3MBED 2IQ9L 4PJIE 2IADB 3TO4C 1T7WA 3QHFH 5C3TA 2R56H 3DI2B 3MYZA 5LCVL 1NGXA 5E2VL 2JELL 4KPHL 1I3UA 3SKMB 4CVXA 3BZEB 1GC1L 4L9LA 3ZDYE 4K3EL 2X2YA 3GKWL 3B9EA 3O4OC 1DDHA 4ZUVB 4YXLH 2GTWA 1TXKA 4L8CA 3QFJD 1I7RB 1II4E 1X5IA 2R1WA 3FB6A 2MCPH 1M6OB 5D1QB 2BCKA 4YDJA 3HR5B 2QKIB 1MIMH 3V79C 3IDIB 3FCTB 4UT7L 1QSEB 1KTLB 1A7RH 2HFFA 2NW2B 1DBAL 3BQUC 4P4KB 5HYQB 4ETQA 1LNUA 2KDGA 3SKUD 3B83A 4MWFB 4U2YA 3FOLA 2BVOA 3GMOA 4R2GD 3VJ6A 1JNLH 5E9DD 4I2XE 1YQVL 3GSWB 4HF5L 3MLUL 3VXTA 5HI3C 1G9ML 2OSLB 1T4KA 4JKPL 3PWPD 2IANA 1YEJL 2BNQE 1MRFH 4JFDB 2N56A 3UZVB 2DKUA 2V7HA 1ZTXH 2P8LA 4UUJA 3I6KA 4XCFL 1NSNH 2AK1L 1HZHL 1UZ6E 1KBGH 3FFCB 5EOTB 5DFTA 1V7MH 2GJJA 4Y4HC 4F15B 1Y0LA 4K23H 5EZJB 4CNIA 4J1UB 3V52L 4PJ9C 2DLFL 2F9BT 1C12B 2DL2A 1JIBA 3QRGH 5INDB 1TJGH 3MLZH 5SWZD 4JVPA 4QF1A 4XZUA 1J8HE 2XKUA 4JFEB 3U7WH 5DZOA 2QSCH 5FFLA 5JR1H 5ICZB 1HSAB 1F3DH 2Z31D 4Z7WA 3M17A 3IDNB 4JHZA 2BX5A 3AGVA 5TE6H 4IRSD 4QRUB 3S97C 3RJQB 4ODWA 5FUOH 2X9WA 5HDBE 1IBGH 4N0UB 4GG8B 4YC2B 1A6VH 2A6JB 2J3SA 4KFZC 1FN4A 1TNNA 1OGAD 3GMLB 4JAMB 2I9TB 5E6ID 1P4IH 1FP5A 3LV3B 4JM2C 5FYKE 1G6RL 4DTGH 1P69B 3EFFA 4NHUB 4OCSL 5GGQH 4OBRA 2NY6D 1GHFL 5E94B 2IH1A 2CKBL 5BJTB 4WUUE 4N1CA 5D71L 5HYFA 3L3KB 4FQIL 1F4WL 4ACPA 2DAVA 1RHHA 4JM2F 1HDMA 5K9QI 3GHEH 1S7RA 4OFIA 1RV6X 4M8QB 1A3RH 1RZIB 3EZJB 1KCVL 1SJVA 3RI5F 5IG7B 2E7CA 4ONOA 1YYML 4L1DA 4NQXA 3ZTNH 3TFKD 3O3AB 4EN3D 2ZUQB 3L9RB 2VITA 1DUYB 3QIUD 3H7LA 3SDAC 5EOCH 4PLJD 1MRDH 2AERT 4PY8J 4PBWD 1Z6JT 3IAQA 3MV7E 1CICB 1FIEA 2CPCA 4XRCB 4TQEL 5KVEH 4N0CD 5T1LD 2CDFA 5CBEA 4NM8L 4F7TA 1XIWC 4KKCC 4R4FH 1KN2H 1OW0C 4QYOB 4IMKA 3WD5L 1JGEB 1W0VA 3ULUD 3D0VA 4KKAD 2A6IA 4MLIA 2JE8A 3VXOA 2G5RA 2ZPKH 1P7QD 3HAEH 4JQVA 4WEBH 4H20L 4DOHB 5IFHL 3O41A 3W9EB 1DE4B 3KPSB 4NNXB 3AB0C 3TV3L 2FEDD 1NDMA 2R0KH 5ACMA 1VENA 4PJXB 5ACZB 4JFZL 4NFDA 1OTTC 5FGRA 5I1LA 4IS6A 4EI5B 1YMHB 3CZFB 3S96B 4IRJC 4XC1L 3BWUC 2ZUWA 1MCJA 4WCYH 3L3GA 1UM6H 1I1YB 4U1HB 1P84J 5I1CL 2Q8BH 2G5BB 3VFRB 3IVKA 1IGCL 1S5HA 1FBIL 5GXBB 4G9DA 1X5HA 5C70A 5BS0E 1G9NC 1NDGB 4TNWK 5I73B 3OAZK 2BSRB 3T8XB 4RMSA 1JGDB 5JW3H 1A3LH 1AD0A 4P0DA 1D5IH 5K9KA 4Y5XC 5BOZG 4PRIE 4N90E 2ID5A 5D70H 5DRNB 4BQBA 1QRNE 4PJBE 3FO9B 3GBML 3VWJB 2OMNA 5IVXE 2X4UA 5C09A 2J88L 2R1YB 2V5YA 3T2NL 2PW1B 5DWUH 3UZEA 1KIQA 3C8DA 1T66C 1YECL 4K2UL 2P5WE 5F8RC 4I9WE 5DK3A 1VEMA 1UQSA 4KQ4L 3CFCH 1Q9LA 3PWUA 5FGBA 3HKFA 1CLYL 1I85A 4K7FB 1WCBB 3OG6B 1WJ3A 2JCCB 1A02N 1RMFH 5EBLB 4I5BB 4KGJA 1B2WH 2YSSA 3VD3A 3X17A 4XPGH 5EOQL 1K5NA 2NY2D 5IBUB 1S9XB 1JGUH 4XNYH 3VA2C 1KPUA 2NR6D 3TT3L 3RWCA 4BYHA 3BVNB 1P5VA 1CXHA 2APVA 5BRZA 3FB8A 3NA9L 1I8IA 4M5YL 4DEPB 2DQUH 3KYOA 4GW5A 2EC9U 2ZUUA 3QI9C 2DMBA 3GJEA 3BI9X 4HAGA 5D5MA 4G43A 1IKFL 1NAMB 1ES0A 5IHBA 2V2XB 4K7PY 4XCYA 4MD4B 4P5TC 5LVEA 3S4SA 5TPWL 2DBLL 1OF2A 2VDKL 3BN9D 4LARL 2VZSA 2KPNA 4NN7B 4ZS7L 4I77H 2IBGA 3MLPA 4Y5VA 4Y4FC 3TNNA 2YK1H 1ZLWK 5DD3H 4X5XA 1X44A 3STBA 3TN0C 4F7EA 3JV4B 4EOWL 1UH2A 1MFDH 4LASL 5IFAH 3BH8B 1BIIB 1XMWA 2R9HD 5DJXA 4CMMA 1QD0A 5EWIL 1IM3A 1FZOA 1T0NA 3MYJB 1X6NA 3E3QC 1UZ8B 3QIWB 2IGFH 3FTGA 3ZMRA 3EBAA 1X4XA 2NYYC 4AM0B 1N3NB 5EU6E 1SQ2N 3O2VL 4JDZA 3MOAH 3T4AA 5GRVL 4M7KL 5E9DB 1XR9B 3MV9E 2CIKB 5HPMB 3MR9A 2EDXA 1HHJB 1CDHA 1YN6A 4NYLA 4XPAL 2R2BB 4P4RA 3PP4H 1FVDB 5DJZB 5CBAA 4IDJH 4J4PC 4OFDA 4PRPA 1NGZA 2BHUA 3L1OH 4YWGH 4Q0XL 3QNXB 4BA8A 2IH3B 5C0JB 4KK5C 4GKNB 5CEZD 1Z5LA 1T1ZB 2ADFH 2KKQA 3FQXB 3ZHLA 4OB5L 1RUMH 3B2UC 2FWOA 1EAJA 2AJZB 4S1RL 2AXGA 1QR1B 4KRPD 2H26A 4WHTA 3HS0B 5E8PB 4P2QA 1GIGH 5F93C 4N0YH 5JXEA 3FRPA 3PL6C 2AJUH 1GJIA 2VXSH 1JHTB 2D0GA 3SKJL 4Z77A 4HEME 5SWZB 3S98A 3WFDH 5ITFB 4JVWA 4M93C 1CDJA 3D9AL 1JZ3A 1S5IH 2EXWD 4RMQA 4F57L 2CGRL 3QZWB 1QFPA 4U6YB 5GRYA 1JF1A 5FUZL 3DVGB 2PNDA 4NQDE 4XNUH 2XN9D 3NCFB 4IRSB 5IMMA 4ZUWB 1M71A 1CFTA 1KTDA 3EW3B 3RWFA 1T1XA 3SPVA 1F4XH 4V1DA 3JTSB 5HHMD 1IGIL 1G6RA 2AEPH 5FHAH 3UTSD 3SHSA 3KPNA 1OGAB 2AJYH 3FO2A 4WI7A 1MCOH 5DHXB 5ENWA 2FATL 5FKPB 3QXVA 4PGDB 4LL9A 4LLWA 4MD0A 1EEYA 2CKBA 1P2CA 5ANMB 4L4TD 1TFHA 4MA8H 5D7LD 4Q58C 4YDLC 3MRNA 4M43H 5L88L 5T5FH 3RWJA 2EDBA 4HJJL 4EDWH 1JPTH 2NX5B 3ZYZA 2ENSA 1EBAA 4P5KB 1MHPH 3A0OA 1TLKA 1AFVL 1YZZA 2BVPB 3IU3B 5F7EL 4J3XA 2ADJA 1JZ4A 4R0LA 4HKXB 1T1WA 2GCYA 5GPRA 2RHEA 2NY3D 1HHKB 2NY1D 4AL8H 4O58H 3VGEA 2VIRB 4PJCE 4LVNC 1KLFA 3BT2L 5IB5A 3O4LE 3CFIC 4KJPC 1MJJA 3HZKB 3BGMA 3MRKA 3RY6A 3ROLA 2XY1A 2EH7H 1K4CA 4MHHI 4X7EC 1A6PA 3V0WH 1BP3B 3SJVB 1UADC 3D39A 4YFDB 1XGQA 2DTML 2QTEA 4MS8D 1P4LA 4U1JB 3F5WB 5HY9B 2P24A 2NY5C 4K3DH 1IEBA 4GBXA 4M1DL 1FVCB 3U4EA 5LWYH 3IU4H 4FTVE 1NBYA 3NFPA 4JO4L 1NUNB 4O02L 3QPQC 2XZAH 4NHCL 4V2CB 4Y2DA 5JMRA 1NC4D 4ONGL 2EDOA 1RURL 4WW1A 3S36H 2EIBA 5IFJB 1EVUA 1AY1L 3ESVF 5KVMC 2PF6A 2OR9L 3VE0A 4AEIH 3MTRA 1V3JA 5DJ2A 1W8NA 3QUMH 4KAQL 4F9LA 5F7LB 1I1RA 4HQQH 4RZCA 3SO3C 3RAJH 4LEOB 4OSUH 1EJOL 4NQVA 4TVPL 3IDXL 3TT1H 1LGVA 4I0PA 1T3FA 2EEAA 1EV2E 2RFXB 3IFNH 4PJGF 1I7TB 4DZBA 4HSQA 1NH6A 3CC5A 2XFXA 2AAVA 3W11C 1BD2D 3UXFA 3ARFB 2BXZA 3CNKA 2ZCLL 1S7XB 3QUXD 3OBAA 3S3PA 3WXWL 4JZNA 2VXTH 4FQJL 3TIEA 4DKEH 3BDYL 3LCYA 4E0RB 1DQTA 2FJGA 2HJLA 1YEDB 2QEJA 4HC1L 3MCG1 4Y19D 3ARXA 4PJ8A 5GSRB 5F6HI 4BH7A 4DUWA 2OJZL 1OP3K 1HN1A 3MREB 5E4IA 2BVYA 1CFBA 1A8JH 3BZEA 3V5KA 3HG1D 3MPCA 2NPLX 4HXAL 1OHQA 3IXTB 3SDXE 1GPOL 3UEZA 1I9IH 5TDNB 1M6OA 5IB4B 4TSAL 3HR5A 4BKLB 3F58H 3PQYD 3EGSB 4NKMB 1FZKB 3IDIA 2W0LA 1G0YR 1AXSB 2NY2B 5CP3A 3L7FB 5DYOA 3QDMD 4HHAA 3U36A 5J9PA 3QQ3B 1MF2H 3V9FA 2XRAH 4OV6F 2IBBA 1WT5A 3NPZB 3UJTL 4BSJA 1I1CA 5B21A 4HFWB 4MAYA 3EJJX 5SWSB 4XBGA 1FFNB 3RHWK 2HRPL 1WWAX 2DLGA 3CH1B 4U1SA 3RWHB 3QPXL 4JFFD 4J6RL 4HBCH 4JFDA 4ZFGH 3NOIA 5ERWB 1U2CA 5GGTH 2JJWA 3C60D 3T0EE 3HC4H 2RGSA 3RVTC 5CKAA 1U92B 5CD3A 3P9WB 3FFCA 5IESH 1KT2A 5ALBH 4AY0A 5KJRL 5BO1H 2F8XC 3AU1B 2HLAB 4FXGB 5I6XC 3QRFM 2WBJC 1C12A 2IQAB 5HGHB 5F7UA 3QH3B 2KZ1B 4CMHC 5KAQG 1FJ1B 4PJ5D 2DWDA 2PO6C 1J0IA 3FQTB 4KMTL 5LGHH 1NMAH 2APWA 1A1MA 2XPGB 1G7PA 5ICZA 3VH8G 2RR3A 2V2WA 1VPOH 3UBXG 4QRRD 1URLA 2Y23A 4QRUA 3HI5L 3HNTL 1IGFH 2AXFB 1SY6L 4JLRB 1HXYA 4HD9A 5GGVL 12E8H 3AXLB 4MA1C 2NY7L 2A6JA 5B39G 3LDBB 3MFGB 5HHOE 4UNUA 4I18C 4DZ8B 2X7LB 4W81A 2VZ1A 1HH6A 3IDMB 4WI5A 1OTUC 3RUGF 2VXUH 2J6EH 1NBZB 3BUTA 1H3WM 1IE5A 4RAUB 5L0QC 4YHZL 1LO2H 3GBLA 3VXRA 4LMQE 4LLYB 3PP3H 1G1CA 4Z7VF 3DX6B 5E8OA 1N59B 5E8DL 2NY0D 4MQ7B 1CFSB 4HUVA 1G9NL 3MV01 4MJ5A 1R3KB 2GJZA 3MRBA 5ICXB 3GSVB 2XIDA 4KRPB 1AKJB 5IG7A 1MCSA 3C09C 4JHBA 5MHSD 2EO1A 1F6FB 4D0BA 3O3AA 3OHXA 3QA3A 3UYRL 5T3ZL 2BOBB 1VEPA 4KVCL 4PJDE 2D7OA 2DN7A 2QQLL 1Z3GH 2IALA 4WIQA 1OM3H 1CICA 1NCBH 3OKNA 5JORA 3LN4B 3WSQL 3HE7D 5I16B 1MFBL 1MWAH 2CO7B 3FRUA 3H9SE 3O45B 3CSBA 3QEQD 2VQ1B 4TUJA 4KUZL 1BQUA 1XCQB 2WK2A 4QYOA 1JGEA 1B0WA 5IBLD 4KXZH 3ELAT 4PB0L 4NZDA 3UTSB 4OGAD 4OJFH 3SE8H 3BSZL 5IHUH 3FN3A 5FXCH 1RFDH 5D7LB 5HVGB 3KYNB 4K3GA 1X5JA 1UB6B 3KPSA 3P9LB 5D7KE 4JY5L 3O2WH 2X4OB 2WWKO 1CGSH 3E2HC 1KPVA 1FFPA 5IP4A 3MUGB 4YXKH 2A9NL 2JB5L 5BVPH 4P46C 5CIPH 2NY1B 1M7XA 3DMMA 1DQLL 1I1YA 4HW6A 2G5BA 1REIA 2FBJL 4PJAB 4ODVL 5CEYB 3AREB 3VFRA 2C5DC 2HA1A 3RIFF 4NN5B 5EU3A 5IBTH 4OT1L 1PBYA 4LBEA 3L3HB 3MZTA 5I76A 2FNBA 4X5LA 1CR9H 2X40A 1Q9WB 3J8F7 2H6PA 5BXFB 5LXGH 3MLYL 3WS3B 4MQSB 4CAGA 3SQBA 4Z95L 3PWLA 4KJYB 5GRJL 1DBMH 1MOEA 2HWZL 5DRNA 4A6YB 1D6VL 4OIAA 3MBXL 2Q20A 4Q7DA 2DM7A 3DXAD 2AW2A 3F7PC 1XGTA 1E4JA 1BWMA 1AQKL 4I3RH 1T7ZA 4Z7QF 3ZDXE 1UCBH 2BMKB 4KY1H 3SDCA 3U0PB 2A83A 4HK3N 1JPGB 4KK8C 3LMJH 3WMSA 3G04A 3LQAC 3TH3T 1FORL 5GSVB 1KC5H 5LKNA 3JWDH 4M62L 1L0XA 4HUXA 3IDJB 5EBLA 2E7LC 2EDEA 4YDKL 5BV7H 4J2XA 4K7PH 1K2DB 5DT1H 1EHXA 4NBXB 2ADIB 3QUKA 3DROA 3GMQB 3GIZH 1CGXA 4HGWB 5I15H 1KENH 1BD2B 2JTDA 4N9OB 4X98B 2K3TA 2ARJQ 1P6FA 4L8SA 4HC1A 5DSCA 5E95B 4F37F 4AIOA 1OD7A 4PJ9A 3AM8C 1A4KB 3EUUA 5EC1B 4Y19B 4NRYA 4F7MB 1EBPA 2W0FA 3DOSA 5ESQB 4NRXB 4K07A 4YFLI 4TTGA 4E41B 2QSQA 5I1JH 3HI6H 8FABA 3UTTA 3GJFH 3KWWB 4HMDA 1PJ9A 1K6QH 3BP7A 3RVVC 4QXWA 3DRTA 5DMKB 3D3VA 5BMFH 3HG1B 5GHWH 4LDLB 4JN2B 4NC1E 5I2IB 3Q6GH 1EUUA 2C3HA 5IB3B 3PV6B 1QYGL 2HTKC 1A7NH 1FNGA 4HLZG 5F8QC 3LKPB 1P4BH 3PQYB 4MZ2A 1UZ8A 3ZE0F 2BSED 5D2NB 5EIIA 3QIWA 5KW9H 3BKML 3MNWB 1AI1L 4OZHA 5AYQA 4N68A 4NSKA 1XZ0B 4K9EH 3MOBL 1JWSA 2DI7A 5F9WC 4GAJL 1KELL 3FT2A 2YUWA 4MNGB 1EUTA 4QCIB 4TRPH 3TJHC 1XR9A 5DO2C 5HPMA 3EJZC 1HHJA 3PHOB 3QCVL 1OPGH 5IMOB 4HPOL 4TTDC 5F1IB 2V5MA 3K2UH 2CXGA 2HT4C 5C9JB 3U7AA 3GSRB 5K9OA 4JFFB 4WI6A 1ZGLB 4QRQA 3HPLB 2DIAA 3ARBD 3NCCB 1F4YH 1MFNA 2V5TA 3C60B 4NZJA 2ICWB 5C0JA 4H8WH 3SDAA 4YHNA 3QDJD 2X44D 2PXYD 2OXGA 4Z0BH 4XVSH 2XZQL 4BK4A 1JI1A 4E5XA 2CLRA 3WKNA 4LLMA 2BHZA 2V9RA 1L9MA 5IF0B 3HS0A 3SDDD 4F15C 1XIWA 3O9WD 3T0XA 1QOKA 4DN3H 3GI9L 5FO9B 1MAKA 5C0CA 5HBBA 4IIQC 4NOBA 4NQCD 4KJWC 4KHTH 5D1ZB 1LK3H 4XTRD 1AGDB 1JRHH 2NY5L 4JRYD 3TZVC 4HIHB 1FG2B 4Z7WE 2VOTA 5ITFA 5SX4H 3BD4A 2G60L 1HHHA 1WEJH 5D4QA 1DBKH 4YBLB 3QZWA 9CGTA 1SY6A 3QDGB 1WFNA 4QRRB 1A9EB 1UB5B 4Z7UA 4D0CA 2JJVA 5EU5A 4X6FB 4GSDL 1CLOH 1JGVL 3KLHC 2FH6A 3JTSA 1UA6H 2VR9A 4KK9D 1HINH 1QFWL 5SX5H 1SBSH 4F3FB 1A7OH 1RY7B 1JTOA 4TULL 1N7MH 4UQ3B 5TQ0L 1Z9SA 3SN6N 1BX2A 1TQBB 4P3CH 5ANMA 4G8FA 4OKVB 3SDYH 2EZ0C 5J7CC 3SE4C 1T5XB 5C08E 4KZEH 1KN4H 2YPLD 4G8IB 4X6DF 1WBXB 5AD0A 5E2UH 2BVPA 1KJMA 1RULL 4J3UA 4X7FC 5D8JH 1WFUA 4QHUA 4XH2B 1HHKA 4LEXH 2IG2L 1AHWB 3H9YA 4NQEA 2WM0A 3T0BA 2UUDH 1NMBL 1HH9B 5AWNH 3HC3H 2ZUQC 1BFVL 2OI9C 4X6CA 4ZNEA 3CK0L 3WNOA 3S4SG 3G5ZB 1LEGB 4X7SL 1CTOA 5MI0C 5K59F 4W4OC 1MFAH 4OLXH 5DK2B 1FDLH 1BZ7A 1Z9OA 3SJVA 4JFPA 3U30B 4HIXH 3U4AA 2EEDA 2HN7A 1XGRA 3QEQB 2IJ0C 1RI8A 3BW9B 3PUCA 5JDJA 3KJ4B 1KPRA 2IFGA 2OL3B 3VI3E 4DKAA 1PSKH 4TUKH 3ETBF 4Z7OE 4YAQA 2XXMB 2IPUK 3TA3D 3BAEH 3D25B 1HHIB 2XTLA 3AMKA 4ZFZB 3LQZA 4M4RA 4YQXL 3DVNA 4ZFOL 5I8KL 1T89A 5B38B 1B0RB 4I1NB 1MLCB 4WWKB 1ORSB 4JFQB 1J1PH 1DVFD 1HKLH 2AK4B 4LMQI 3P0GB 1R0AL 4JJ5A 5IMKA 1IT9L 4XAKE 1UGNA 3PGDB 4CBPA 5CS7A 3G08B 5IK3B 3HNSL 1WAAA 3P4OB 4AEHL 3MACH 2QHRH 4QKXB 3B9KA 3WV0A 5KSUB 2RFXA 1D9KD 4FRWA 3LIZH 5GGSB 5I1KL 3BJLA 4PJXF 5DD6B 1TZIB 3ARDC 4JQIL 1G84A 2FX9H 2MKWA 1QBMH 4GRLD 3WUWG 5KSBB 5JIIA 1MI5A 1Q1JL 5A2FA 4E0RA 1CGYA 3LKNB 3TN0A 1RIVH 2BNQD 2H3NB 2UYLB 2FECI 1QP1A 5DS8B 3O6KL 3O3BA 3V2AR 3I6LE 3KPQA 3QT2A 5GRUL 4HLZH 4LFHG 3T2QA 4BFGA 1TIUA 2VZVA 4IM8A 1CU4L 6CGTA 2GSIB 3FRPG 1A22B 3RVWC 3HE6D 1T20A 1QPXA 4N5UA 2DLHA 3FT3B 3AS1A 4QHKJ 3LKRA 3BHBA 4LNRB 3OR7A 5JDSB 1RJLA 2VZUA 2AABL 1C5BH 2VDNL 2R0WH 1QSFE 1I8LC 3IXTA 4NCDA 4OD1L 1J8HD 4XNXH 4YPGB 2UWEA 4TOYH 5C0BA 5DVKA 3OPZH 1NMCC 1H5BB 2ORBH 3LPGA 4P23D 4NKMA 1FZKA 1PQZB 4J4PA 5FHBL 1AXSA 3RDTB 4MNQE 3L7FA 4XPTL 1KJVB 5INCA 2JCCF 3I6GB 3N0PB 1IRAY 3BWAB 2HKHL 4XCCH 1IM9D 2R2EB 4OCWH 3W5NA 4HFWA 4H0HB 4U1NB 1IILE 3Q1SH 3KXFB 1C1EH 3Q5TA 4K71C 4DEPC 5D5ME 2DQJL 1ZOXA 3MLVL 5FYKD 2NY4B 4JFYA 3RWHA 4DGYH 4Z18A 4N5ED 5T3XL 3WS6C 1GZQB 1IZKA 4WUUD 1IGTB 3PL6A 1J1XH 2P8MA 4WFGE 1YNTA 5ERWA 3RIAK 3MO1A 5EFIB 3T1FA 4UQ2A 2VLLA 5HJ3B 3NPSC 35C8L 3T65B 1S7VB 3MBEC 3ZO0A 1BAFL 2VR4A 2J5LC 2O5YH 4NP4H 3QCUH 4L8DA 3CLFH 3UBXI 4R9HA 3MV8A 5DZLA 1ZANL 1LEKA 5BVJA 2GITA 5TQ2H 3RWGA 4FXGA 1KLGB 1DL7H 3UJJH 1T83C 2VLKA 5DD1L 1D6EA 4Q9QH 3QH3A 2UVEA 3C5ZB 4UTBH 1KCUH 3C6LB 3QO1B 1FJ1A 1G0DA 3I9GH 3MV7D 3FQTA 3FMGH 3TWCH 5GZND 1OQOA 1FFOA 1A5FL 1DEEA 3RZCB 3D48R 2FX7H 4BH8B 5JA8B 5C2BH 1AE6H 1RJZB 2DMKA 4JLRA 2X4PA 5EZIH 5MENE 4XMKH 4R2GC 3SCMD 1BQHA 1OARL 5E99H 2R1XA 3CDCA 5GGRA 3TBVB 1ZVSB 1JK8A 4FZ8H 2H2SC 2BSTB 2R4RH 2X7LA 3SE9H 3B5TA 2QR0B 3FB5A 2Y4SA 3RVXD 4LPUA 4HUUA 2PXYB 3RPIA 5LCVH 1WISA 1RZFL 5E2VH 2JELH 3KPRE 4KPHH 1R3KA 4KROD 4F2MA 4KV5E 1S8DB 4JDTL 2C1OA 5E2TL 3WE6A 2BSSB 4LF3B 1QNZL 3VDAA 1GC1H 4P2QE 1JWMB 4K3EH 3JUZA 4I13B 3SDDB 3GKWH 5I1GL 5TF1L 3IFOA 2E5EA 3VI4F 4TSCL 5GGUB 5BS0D 4NQCB 4OLYH 4YE4H 1JRHI 2BOBA 4OZFG 1HYRC 2EDLA 1U8QB 2P46B 3PIQB 3TIDA 5SX4I 4PGJA 3AY4C 2EICA 5AUMB 1FSKB 2B2XL 3MLXL 1DBAH 5C0IB 4PRID 4N90D 5I17B 2Z31C 4PJ7A 3O45A 4HWNA 2VQ1A 1QRND 4V1DE 3VFSB 4IRSC 3L95A 5JW4R 4RFNC 3MGTA 1TQCB 4HF5H 2MKLC 5F6IC 3MLUH 2OLDA 4DCQB 1G9MH 1R3JA 3HTLX 3QIBC 5D93B 4GOSA 2P5WD 3ULVL 4I9WD 1U93B 2JB6B 1YEJH 4LCCB 3RBSA 5E6IC 1KYOK 1U36A 3O8XA 3OXSB 3VFPA 1Q94B 5C0AE 4CW1A 1UB6A 4PJFA 2NY6C 1TNMA 4XCFH 4NJAL 2AK1H 1HZHH 3ULSB 1BLNA 1PLGL 3JZ7A 4DKFL 4C83B 2ADGA 5F7HA 3VDBA 1D5XA 1H3TA 3PP3K 3V0AC 2RB8A 5JQ6H 3VWKD 2BDNL 2ERJC 4PJAA 5CEYA 3AREA 1Q8MA 5HGAB 1A7BA 3TFKC 5EC2B 2OJEA 4EN3C 2PYED 3SGJC 2GQHA 2Z91B 3QIUC 4PLJC 1DANU 1IEAA 3D39E 3JWOL 1ZT7A 3CMGA 3TBTA 3VFGH 5KZCB 4N1HB 5J12B 4N0CC 2G2RA 2WP3T 4U05A 4D9RE 5F1OB 3ZKXB 4ODXA 5EO0B 1JN6B 1F58L 5C0EB 2HG5B 4PR5A 4O2EA 1AP2B 3TA3B 2DS4A 3H42L 3OB0H 4KKAC 1HQ4A 2I5YL 3HCVB 4QRSB 1G6RH 4ZFOA 1YN7A 2FRGP 4XWOD 1CZ8L 2BMKA 4OQTL 3TM6A 1GHFH 1MJ8H 2P44B 4G6KL 4JFXA 4OZIA 5D71H 1H0DA 3ULUF 1P53A 2AV1A 4FQIH 1F4WH 4XCEB 1N6UA 5GSVA 1DBBL 2C1PB 1NPUA 1DVFB 1U8MA 5GGVY 5IEHB 1EA9C 4J23A 1T1YB 1KCVH 1K2DA 4P2OD 1MCLA 1YYMH 3DURA 1I8KB 2ADIA 3IFPB 3C08H 4RMVA 4U6XB 5EU6D 4OCRH 5F89A 2WZPD 5EZLA 4YK4B 3IAGC 3QDAA 4ZAKA 2WAHA 2JJTC 3MV9D 4B7IA 1BFOA 3UPAA 4LK4A 4GRLB 4X98A 1YUHA 2WBKA 2CRMA 3REVA 5CSZB 2R39A 1UWEL 1YA5A 2YD4A 4TQEH 4PYHA 2BNQB 1A4KA 4NM8H 2WBJA 3ARRA 5A16B 5EUOA 1OB1B 4NRXA 4FOMA 4M1CC 4IMLB 2F74A 4YIQB 5DFWH 4AQOA 2ZOKA 5E7FA 5C6TL 5DI8A 4FFYL 3NIDF 5GS1C 3TLRA 3HE6B 2YR3A 1UVQB 3ECBA 4NC0B 2FGZA 3KWWA 4H20H 4YX2H 5J6HA 1W72L 2DQCL 4NKOB 2NXYD 5CHNA 4BZ2L 4XXCA 4M61B 5IEKA 4JFZH 3ET9F 1QSEE 4I18A 4N0FA 3BKJL 1AXIB 4P23B 1ZK9A 5D2NA 1ADQL 2YD1A 3G6AB 4NQDD 1IL1B 3MNWA 4Q2ZA 4XC1H 1KB9J 4KKNA 4K8RL 3BPLB 3L3IB 5I1CH 2NY2C 1FV1A 3VFUA 3GGWB 1UM4L 3O3DB 1IGCH 5FO8B 1CIDA 1FBIH 5FAAA 1MH5A 4W70A 3S9DB 2NR6C 4CDGC 2FJHB 3HAEB 4R4BB 2X4NB 1MFEL 3PHOA 3H9HB 1NGPL 5K93A 1PZUB 1P9MC 1B3JA 5C9JA 3OR6A 4JFDE 4R90L 5DJDB 3V7AG 3QXTA 1TDQA 3HPLA 4WUUB 2WINB 5FCUL 2DYPD 2BNUB 3TBYB 2EE2A 4OZFH 2VLJB 5E1AB 4XWGL 5D7IF 2MPAL 3FFCE 3BUYB 3GBMH 2R29H 3ZSTA 3BN9C 2J88H 3T2NH 4HDIB 3W0WB 4K2UH 1YECH 3K8LA 2F5AL 1VFMA 4KQ4H 5IKCA 4EDXA 4JKKA 1CLYH 3BH9B 2CUHA 3H7BB 1KXQE 3O4LD 4WW2C 3GDBA 3GJFK 4FQ2L 2R9HC 3KS0J 2NW3A 4HIHA 1FG2A 3E6FA 2B4CC 3W39A 2X70B 2CR6A 3MLSH 1AC0A 4BSVA 4H0GA 4WU5B 3TT3H 3QDGA 1S7TB 1UB5A 5CP3H 5E2JA 4N0UE 2R56L 3NA9H 4LLUA 4OLUL 2IFFL 2XWBB 4C4KO 4FTVD 3BPOB 4MVBD 2LAAA 2FZ3A 1ZHBB 5KS9F 4S2SB 3SCMB 4M7ZC 5FECB 5C0GB 4PLKD 2A6DA 4F3FA 5F70A 4RNRB 2E8YA 4MQXD 3LDBC 1ZS8B 1IKFH 3RTQD 1NBQA 1KCSL 4Q9RH 1QUNA 1QFUL 3VXRE 1E28B 1U3HD 1LP9A 2VDKH 4LARH 2NXZD 4LHUA 1MIML 3KYKL 4YHKL 1RIHL 3C87A 3EZ8A 1CGVA 5ICYB 2I07A 1LEIB 1NC2A 3VXQB 4B53A 1X4YA 4XH2A 4PGEB 2IWGA 5FKAA 4LGSB 1AHWA 1W0YT 4KGLA 5FDWB 1JNLL 3S37X 3UCRA 1YEIL 4LASH 2VN4A 1SMOA 2H2PD 4Z78B 1ZSDB 2Z8WC 4Q6IC 5EWIH 3PGCB 4UOJA 5E8EB 4ZNCD 4PJEB 4TPRL 4Z8FL 1FYHB 3ZSSA 4XBPB 1LEGA 4HBQA 3EFDL 5DK2A 3EOBA 2Z35B 1ZTXL 5I1DA 4PRIB 4YGAB 2EXWC 2Z4QB 2BK8A 3FL7A 3BW9A 3U2SA 5DUML 5FB8A 4M7KH 5D72H 4JY6B 4XPAH 5IVXB 2JIXA 3WFEH 4QTIH 3RIAF 1I1FA 4HUWA 3NZ8B 1KG0B 4DOHE 4YHML 4XPBL 4X4YB 3QRGL 4S1DD 4OIBA 5AYUL 3MLZL 4W6XB 1T22B 3KPSE 3V7AE 5J06A 5L6YL 5HGDB 4WWKA 3C5SA 3WFZA 4JFQA 3NCYS 1T04B 4OB5H 3X3GH 5EPMA 3HUJB 3PGDA 4ZTPL 5TE6L 3GMNB 1NFIA 5FUOL 5D1XD 1IBGL 2F53A 3VWKB 4LAQL 2NY3C 2NY1C 2FIKB 3CFJB 5KSUA 5GGSA 5EO9B 4RMRA 5EA0L 3SKJH 4HJGA 2PYEB 3EOTL 1YEKL 3BP5B 3WIHH 3I02B 5I74C 2HRLA 4EI6B 4OD2A 1AGFB 1HHGB 3D9AH 3FZUD 5E03A 1MCCA 3VRJB 5GGQL 4F57H 4JO1H 1NJ9B 2UUDK 4PLOB 4XP1L 2H32H 3ZL4H 4U1KA 3T0ED 4M7LH 5I66A 3OQ3B 3U7YH 1UWXH 2QQNL 2WNGA 1IGIH 1NGQL 3MCLH 3ES6B 4MS8C 4RAVB 3DSFH 2GSIA 1JUFB 4HIEB 2FATH 4LAJH 4OQTA 3IKCA 3KPMB 1AGEB 3ZTNL 2ZWLT 2YMXL 4LNRA 5TE7L 4OLZL 2IPKB 5I8CA 2B8OT 5T1KB 1UKSA 2VWEC 5L88H 3LKOB 3QHTC 4HJJH 4GW4A 1JNNL 5DJAB 4M3JA 1J1OL 1J05B 5F7EH 3VRIA 5KVEL 5KSAD 1TZHB 2FHCA 1S7SB 3K4DA 4P2OB 2CLVB 1WCQA 5TDOB 4HG4K 1H3GA 3IETA 4MA3A 3BT2H 3BWAA 3SQOH 1I4FB 4BZ1H 3BZ4B 1EHLL 4PJHB 3BYTA 5HHOD 4HK0B 4WEBL 1M7IB 3QUXC 1IGTA 4APQB 4IOIB 4N8CH 3I75A 2DTMH 2QL1A 4M1DH 2XWTA 3T65A 4WFEE 3HC0B 3CVHH 3UTTE 3TZVA 4JO4H 3DO7B 4O02H 4EIGB 1KXTB 4NHCH 1WBZA 4WCYL 4ONGH 1W72A 3HPJA 1RURH 1MY7A 2Q8BL 3Q6FB 3U0TB 3DBXB 3D3VE 2I25N 2BNRA 3MLWL 1AY1H 4FQXD 4Y5YC 4N8VG 2A9MH 1AGCB 1AO7B 4G8EB 3C5ZA 2XNAB 3GMMA 1ADQA 3QO1A 4N9GA 1D5BB 3CXHK 4Z76B 1KB5H 4OZHE 3R1GL 1I7UA 2X1XR 1EJOH 4TVPH 4RISL 3TYFA 3RZCA 4LIQL 3IDXH 2HJKB 3N50A 4BH8A 1RJZA 2P7TB 1A1NB 4NO0D 1C7SA 1EAPB 4OF5A 2FGWL 3DLQR 5DWUL 3PV7A 1PG7W 2ZCLH 4OM1H 3MRJB 1MCIA 3WXWH 5JUEL 4O2CB 3U1SL 3F62A 1QBAA 2QR0A 1MVUA 3IS0X 3P4MA 3QAZC 2VDLL 3QUMB 1KJ2L 3RL2B 1RZ8B 4DVBA 2CQVA 5D7KD 3E6HB 5L2KA 3BGFC 1G7JB 5EBWB 5I1AA 3C60C 1DN0A 3IT8D 4JB9L 1WFOA 3VCLB 1JGUL 2F58H 2Y5TA 5CLWA 4ELMB 5KANG 1INEH 3OJVC 5J1AA 4HXAH 3MNZB 4OZGA 5EZOL 3O4LB 1NCWL 1Q72L 5GGUA 3QQ4B 2MCG1 1S7UA 3HZMA 1F6AB 5LGKA 4HUKB 3QHZL 3MGAA 3AVEA 1AJ7L 1A2YA 4G7VH 1N6VA 5I17A 1UG9A 1GGIL 1HQRB 3VG9C 2Q1EA 1VFAB 3UJTH 4F7CA 3Q0HA 3BX7C 4FTVB 3BIBX 5DD3L 3HMWL 5T1DH 3FHQA 1I3RA 4DCQA 4ZPTA 3R8BB 5ANME 1MQKH 3QPXH 4XCNA 1XCTB 4J6RH 3RTQB 3N1QC 2D9QB 5IFAL 5EULV 1NGWA 4G7YL 1JNHA 3SY0A 4X83A 1K9TA 2NX5E 4KHXL 1X5LA 3VXMA 1UACL 2NXZB 2O61A 4OFPA 1EFXA 5IW6B 4XAWH 3C8KA 2YN3A 5K33A 4JHAL 4R96B 4WTWA 3ULSA 5KJRH 1JGLL 3KPTA 3F8UB 4QRTB 2NY0C 4NKQB 3S35X 3KG5A 4NQEE 1N2RB 3WFHA 5T3ZE 4C56A 2AJVL 1IJ9A 1E6OL 1SMAA 3N1PC 3S7GA 2QV2A 4X6CE 4JFHE 4ZNEE 5E24E 5B4MC 3H2WA 1BOYA 3KR3L 2H8PA 4HZLA 5IJVA 2Z91A 4KMTH 1R5IA 4X9BA 2P45B 3SJVE 4JCMA 2BJML 3HNTH 4NKDB 3HE7C 1SY6H 4HKJB 5GGVH 4ZUSB 5MEPB 3V4UL 2I24N 2JJUA 3IJYA 5EO0A 5JPNA 4JPKL 2OQJB 4U0RB 4GW1A 1G7LA 2LFGA 4YJZL 1KXVC 5CILL 4QRSA 4CJ0A 2W65A 3ZDZF 4N0YL 5FA3B 4OGAC 3S88L 4LKCA 2PW2B 1EIBA 4YHZH 2GKIA 2ITCB 1VDGA 3WFDL 3HRZB 4F9PC 1Q9KA 5H94A 5I30L 2C1PA 3BEWB 5E8DH 1G9NH 4HK3J 4LVOB 3WO3B 4I4WB 3VRLE 1XH3B 2XKNA 1WAAE 1T1YA 3FFDB 4Y4KB 4RGOL 1BQHG 2HFEA 1MHCB 3QUYB 3OAYH 4XHQA 1Q38A 5FHAL 3MBEA 3UYRH 1AD9B 3B6SB 2AJYL 5T3ZH 5JW5B 4KVCH 1MCOL 1NBVL 1MI5E 1T21B 3G6JF 2QQLH 3F7RA 4R7NA 2Z8VC 3D18A 1XT5A 2CR3A 3GRWH 4MA8L 4OLVH 4YHIB 3JBG7 1I8MB 1P7KB 5E70A 1FFRA 4L3EB 3MA9H 5T5FL 1MFBH 2IC2A 3P4LA 1T83A 5J11B 3L3JB 1YEFL 1FQ9C 3BIAX 4KUZH 4XPHL 4JHWL 1C5DB 4YIQA 5KSBF 1RJYB 3QFJA 4Z5RA 2HT3D 4PB0H 2FSEB 1IFHL 3QUZA 3WKMH 1U3ZA 1MCEA 5I8EB 2C3GA 3TJEH 1UVQA 3BSZH 2B4CL 5D9SB 1K8DB 4UIMA 5HDQH 5HHNB 3PHQA 4L4VA 4MA7L 4FZEL 4NBYB 1WUNT 3GUTA 4JY5H 4NKOA 5C0BE 2X4SA 2PYFA 4FQQB 4KQ3L 2MQCA 1EO5A 1HEZB 2A9NH 2LE9A 1BZ9B 5EU7C 3L3IA 4FXKB 2FBJH 4ODVH 5FO8A 3VFUB 4WV1B 5SWSE 3NIFF 4OT1H 5DMGD 3RZWA 4ZOEA 2V2TA 4PG2C 1KCLA 2UZXB 3K8KA 3RY5A 2J8HA 4Z7NE 4UTAL 3S36L 4I48A 3MRGA 5DJDA 1MCWW 1BBJB 3MLYH 1F8TH 1MAMH 3WN5B 2DI8A 5ID1A 5C08D 5GRJH 2HWZH 3RGVD 1D6VH 4KK6D 3TBYA 2XACC 3MBXH 5CWSA 5CIPB 3GSOB 2VO5A 3G6DL 1G6VK 3WFBH 3MV8E 3W0WA 1FG9C 2AEQL 5LBSH 1AQKH 3V5DB 3BH9A 3WXVL 2IMMA 4FQXB 4GQ9L 1QACA 5JPMA 1YC7A 5E5RB 1DFBL 4M62H 1IGJB 3AUVA 3H8NA 4J12A 4TYUA 1U2HA 3C2SA 3QIBA 4YDKH 4OV5B 1N26A 1PW3A 4MAUL 4DKDC 3EDFA 5ETUB 4JPWL 2JKXA 5F9AC 3UO1L 4NO0B 5J89A 1MVFA 3PWNB 2XWBA 4PV8B 4GG6A 3UPRA 1ZHBA 5IW1B 3MJ9H 4OF0A 5I1EL 3HR6A 3SKOB 1KJ2A 3GB7A 1NGYA 5BV7B 5FGCB 4U7SA 4BSWA 4HJ0D 4I3SL 4EN3A 1NEUA 2DJ4A 3ARBC 1S78D 3ARGB 3GSXB 3H3KA 2GUOB 3ARWA 4XAKD 4R4ND 3FB7B 3GM8A 4MDJA 4H25B 2RBLA 5FDWA 2P48B 2K7PA 4QGYA 5T1LA 4PGCA 5I1IL 4Z78A 3SDDC 3UP1A 4X80H 3D85A 2H45A 3O9WC 4YBQD 1QYGH 1EO8H 4QRPA 4KKBC 1VFBB 5ADOL 1NFDF 1TVHB 4XTRC 3QWRA 1ZVYA 4K3HA 2BY2A 2W60A 3BKMH 4BQ9A 4XX1E 3HC4L 3I6LD 3MOBH 5FIEA 3VH8B 3BXNB 1KELH 3UBXB 4MCZB 5HI4C 1U8PA 3REWA 5ID0B 1JV5A 5DK0B 3DX7B 5B8CC 3V6FB 2YRZA 5F7DB 4KK9C 4TNVF 4O51A 3VFOB 3FONA 5B39B 3NZ8A 1EJ6A 4PRHB 1ZLVK 4X4YA 5FM5M 1ZWIB 1QSFD 2EDRA 3W9DA 1Z0MA 4DWHA 3VXPB 4NGHH 1DUZA 5HGDA 1YDPB 5LGHL 1JP5A 3BISA 1NQBA 2XZQH 1NMAL 2ZNXA 1T04A 2A1WL 4CN4A 4ZUUB 5FV1L 2HYMA 4ETYA 4MNQD 4PB9L 1FL6B 4B50A 4PJAE 2AVGA 2APXA 3CDGB 3QFDB 1R5VA 3CFJA 1YEHL 1GAFH 5GS3A 2ILLA 1I3GL 2F19L 5EO9A 3NFNA 5GS0D 4WNQB 3P77A 4ORGB 4UU9B 4U1LA 2BVQB 2NY5H 3CVIL 4X8JB 3NH7L 4CVZB 4YNYA 5GS1A 4EI6A 1AGFA 2G60H 3T0DA 2X10A 4DUXA 1NJ9A 2PTUA 4WFGD 2NNAA 4WEMB 4GSDH 1JGVH 4CVXB 3X3FL 1QFWH 3ES6A 1HOCB 3VMNA 2EDDA 4L9LB 4GLRH 7CGTA 3NA4A 2OTUA 4TULH 2FDBP 5TQ0H 1KF9B 1L4IA 3TA3C 5ITBL 4OZIE 5I1HL 5HXMA 4NO5B 2FD6L 2GTWB 1WBYA 4L8CB 2IPKA 5T1KA 2R1WB 2RIKA 2BCKB 5IVZA 3EYOA 5I19L 1Z3GL 2PTVA 4LLDB 1OM3L 3QXAA 2HFFB 2RCSL 2B5IC 4P9HC 4HKBB 4ETQB 1MFCL 1LNUB 5CEXA 1MWAL 2CLVA 3L7EA 5F88A 3FOLB 5FA4A 1KEML 2BVOB 2IG2H 3GMOB 4MLSA 1BIHA 3PXHA 2M2DA 4JM4H 4IBLT 1PEWA 4FQLH 1I4FA 1NMBH 1FPTL 3CDFA 4IJ3B 1XR8A 4PJHA 1BFVH 3SE8L 1D9KC 1T4KB 2CDGA 3CXHJ 1V05A 3CK0H 5IHUL 2IANB 1OT1A 4X7SH 4OD3L 1A9BA 4GRLC 4LHUG 3PWJB 4LVHB 2P1YA 3TCXA 2V7HB 1DQDL 1UH4A 3V7MA 1CD0A 2P8LB 2CH8A 5EUOE 1XF4A 3EOYG 5BOPA 1RIUH 4ZS6D 3I6KB 4ZXBA 4PFEA 4WW2A 2VQUA 4QOKA 1CGSL 3KPLA 1VFOA 3QSKB 4E41E 3KPRD 3EDJA 1I75A 1E6JL 3HC0A 3OKKA 4CL7A 1Y0LB 4CNIB 4P2QD 5JXED 5FM4A 3HE6C 4JG1L 3DBXA 1J0JA 1F13A 2WQ8A 2OR7A 2B1AH 1UZ6F 4XZUB 1NUGA 2AJXH 5DLML 4FFVC 1AO7A 2VKWA 5LQBL 5FOBB 1F5WA 1EEQA 1BJ1J 3PJSA 4Z7WB 5D2NE 1R0AH 1E4KC 1G1YA 5BZWA 5D2LB 3BMVA 2FECL 2Q6WB 5IQ7L 1UH3A 3HNSH 4ODWB 2VAAA 1DBML 2VTFA 4P23C 2HJKA 4V1DD 3ZZ1A 4MNGE 2P7TA 1A1NA 5I1KH 1FN4B 1R24A 4ZOBA 3CFKA 1F3DJ 5T3XE 3MRJA 2VLRA 3EFFB 1Z9LA 5KANI 4IHOA 3MRFA 1Q1JH 1T7YA 4ZPVB 2DI9A 3G9VA 5HDBF 3LMJL 5C0AD 2LQRA 3O6KH 3UX9B 1MCBA 1XGPA 4N5EC 3QUMA 3JWDL 3RL2A 1RZ8A 1S7RB 5GRUH 5EBWA 2BY0A 5LAXA 4B0MM 2RJMA 5IIEB 4P57A 5C0ND 3OAZH 3VXUB 1DJSA 1SM3L 4NQXB 3OJDB 4ELMA 3O6FB 4UDTB 2VITB 2AABH 3TVMB 2VDNH 2Z8SA 2D7TL 1RZJC 2F54A 2K9UA 2HVKA 4OD1H 1CFNA 4M7JL 2ZSWB 2GIYA 1U3JA 1NANH 1ZA6B 2CDFB 1IMHC 5CBEB 5FHBH 3QG6B 1UFUA 1BMGA 3D39D 3LB6C 1I1AA 3QDGE 4F7TB 4XPTH 2BVEA 5GZNC 1N5AB 2X5PA 4HXBH 4D9RD 4GBXD 1W0VB 4NKIL 3D0VB 2HKHH 2A6IB 2RAMA 2ESVB 1Y6MR 3NIGE 4R7DA 3HI6L 4ZO6A 4Y2DD 4IOSD 5F44A 3QEUA 1ACYL 2DQJH 4G80A 3MLVH 3RBGA 4X4ZA 3SCMC 3HN3A 3CMOL 1DZBA 5SV3A 5BMFL 3FQWA 1EK3A 4UBDD 4AK1A 5M7QA 1NDMB 1PX3A 2EYRA 4LOUC 1C8PA 4OQ1A 3CUPA 1IVLA 35C8H 3PG2A 5I1LB 3RVXC 1BAFH 1ZHNA 5KW9L 3L3GB 1XF3A 4I0PD 4KDTA 1MLBA 3T2OA 4KROC 3IVKB 1S5HB 4G9DB 4M6ML 4TRPL 1KLUA 1WIUA 4QNPE 4QXGL 5DD1H 3RWEA 1WC7B 1OPGL 2APBA 4GO6B 3PHSA 1SEBA 1XGUA 1AD0B 1KEGH 1GH7A 5K9KB 1ZLWH 1T2XA 1TJIL 3P9MB 3W81A 1VKXB 1AXTL 1OAYL 5I0DA 3QEQE 2YOCA 3N06B 4XBEL 4PJEF 4NKDA 5CJXC 3RNQA 2F5BL 4HKJA 5C09B 2X4UB 3DI3B 2BRQA 4EQ2A 1N0XL 4KUCD 3ULVE 1KIQB 2N1KA 4NIKB 2Q3AA 1OARH 1ZHLA 1UQSB 2DM4A 3PWUB 1ZKAA 3ZYOA 4QEGA 4ODUB 2EXYD 5DEZA 4ODBD 1NCTA 1EGJH 5F6HJ 2X4QB 5JNYA 4KHTL 3RI5K 1QEWB 1LK3L 5AZEL 2L4OA 5I71B 3QJHA 2ITCA 5D1QD 5IVXF 4X8XA 3OMZA 4NM4L 2APFA 2YSSB 3CCHA 2AK4E 3FJTA 3HRZA 5GZOD 1RZFH 5HDOA 4KJQD 1QSED 4RX4D 1WEJL 1DBKL 4Z0XB 1PVHA 3K8MA 4JDTH 1XH3A 1KPUB 3QUXA 2EE6A 4XP9L 5E2TH 3FFDA 4NUJA 1RZGA 1QNZH 4IRZL 4Y4KA 1S9VB 3KPPA 2F53E 5BRZB 3FB8B 3ZKQD 1I8IB 3NFSH 3MXWL 5E0QA 5I1GH 3OXRB 5TF1H 4MAYD 3KYOB 4GW5B 3QUYA 1RK0A 4TSCH 5T33L 1TZGL 3VWKC 4MSWA 2IAMC 3GJEB 1AD9A 3SBWC 5JW5A 5D5MB 3HUJF 4G43B 4Q9BA 1VFUA 4HFUH 1ES0B 4JFDD 4XCYB 1N5YL 5CZVH 3MLXH 3S4SB 1OF2B 4M9OA 4Y5YA 1FVEA 5CZXD 1FIGL 3L3JA 4MMXC 3KLAA 5FCSH 4EUPA 4Y5VB 4G6MH 3TNNB 3FFCD 3LQAH 3I3BA 1QFWI 4X5XB 1INDL 4GLRI 2Z8RA 4G6AD 4LEXL 4F7EB 4KH2A 3M1BA 3ULVH 3BPNB 1IKNC 4O5LL 3VGBA 5DJXB 4CMMB 4JFOA 4YZFE 5HHNA 1IM3B 2A38A 3BKYH 2OS7A 3CPLB 4XWOC 3OKMA 4JQXC 4MB3A 1OLLA 1T0NB 4U7KA 4CKVX 1UEYA 2FLRT 4RGNB 1MWAA 1LE5A 3FTGB 2AQ2A 1DLFL 1PLGH 4DKFH 4LSTL 1HEZA 1X5FA 1HIML 4HMEA 1BZ9A 3V5DA 3FQNA 3T4AB 4P2OC 2WBWB 2BDNH 4LSQL 3MR9B 4NYLB 3LD8B 5ECJE 4WV1A 2QJDA 3KXFE 4H1LG 4UIKH 3BAEL 3R4DA 5HHVL 4UV4L 4UI2A 5CBAB 1B6UA 1U95A 4PRPB 1NGZB 3PF2A 3O81A 4RAHA 4D9QE 2VH5L 3S35L 3OAYK 1JWUA 4KRLB 3VXRD 1ETZA 4L8BB 3WN5A 4W4NA 4P48A 1Z5LB 4ZSOB 3O6ML 1J86A 3GSOA 2D7MA 2AXGB 3OJ2C 1F58H 2H26B 3GZKA 3KHQA 4Y88A 2VE6A 3H42H 4UINH 4WHTB 1ZGLM 3MACL 4HH9A 1QHOA 2BNRE 1HCVA 4LSVL 3LIZL 2UY6A 4G6KH 4X4XA 4MD5B 4Z77B 4OCYL 2DQFB 4TUOA 1JZ8A 5IT2L 2WLYA 2J8UA 1CICD 2XQBL 2WMPA 1RIVL 2VABA 3BZFA 1JF1B 2NXYC 5HD8D 4M48L 5IMMB 1CBVL 4D8PA 1BM3H 1M71B 1CFTB 1R3LA 3RWFB 1HK6A 1T1XB 4NNPL 1V3MA 5E8NA 1VESA 4G42A 1G6RB 1OCWH 5F3HB 4YHLH 3KPNB 5IBUG 2EDJA 5E6YA 5FYJH 4LLWB 3SE3C 5IW1A 2CKBB 3T08A 5GJTL 5JXAH 5LGJA 1UWEH 1QFHA 1QLRB 5DA0B 3MRNB 2R0WL 3RWJB 3KPSD 1S3KH 4XMPH 5L2KE 4PRBA 3P2TA 2I9LA 1KNOA 4LU5L 3V4PH 2E9BA 4NN6C 4TOYL 2DKSA 2ADJB 2DBJA 4X9IA 3OZ9L 5C6TH 2GSGB 3ARGA 3GSXA 2GUOA 2GCYB 4FFYH 1WTLA 1IAOA 1SVZA 1U8OA 3DMMD 5I75B 4EJ1C 3FB7A 2GK2A 3N9GL 3DHMA 4XCCL 1OGTA 2MJWA 5IB5B 1A4JA 4OZGE 1W72H 3ARTA 3HE7A 3BJ91 1NEZG 3Q1SL 3ORJA 1JTTA 3MRCB 3BGMB 3V0VB 3LRSA 1V7NL 4BZ2H 3FO1A 3NCEB 3RWDA 1VFBA 1TVHA 3T2PA 4M5ZH 3BKJH 4S0SD 1RAMA 1ADQH 1XGQB 5DJCA 1P4LB 2P24B 1IEBB 5F7WC 3U4EB 1RZKC 3BXNA 1IAMA 2CXKA 3VWJD 1NBYB 3GJFA 4P2RB 1OT2A 4Y2DB 1ZA3A 1MFEH 3QO0B 1NGPH 3V5HB 3V6FA 3SDCD 1MJUL 4HWZA 4YFLF 3VFOA 5B39A 4PLKC 4RGMC 4PRHA 3P73B 4YHPA 4MQXC 2DIJA 1KJ3L 3RTQC 4O9HL 5DJ2B 1KCUL 3VXPA 5TFSL 4XWGH 2MPAH 2LU3A 2UY7A 4Q6YA 1U3HC 4NQVB 1R3IH 2F5AH 4I0PB 2FX7L 5C2BL 4LHQB 5DHVH 1AE6L 5HI5D 7FABL 4RMTA 3OKLA 2XFXB 3OB8A 4WO4A 1FH5L 5E99L 3B8YA 4JZNB 3L5XL 3T77B 2H2PC 3Q5YA 2BVQA 4FQ2H 2R4RL 2FJGB 2VDML 2HJLB 2HVJA 3DXAA 4PJ9D 1T03L 5C6PB 4XNZB 4OZFB 5IOPA 4WTXA 1PYWB 3H9ZA 1M7DA 1GGTA 4PJ8B 4UMGA 4BH7B 4OI8A 1VERA 4YDVA 1WIPA 4OLUH 2IFFH 2VL5A 4WFED 3UTTD 2C4FT 4YHYC 1EEUA 5I18L 1HOCA 3U46B 3T3ME 1HE7A 1LO0H 3DV6B 3X12A 1CK0L 2EYSA 3CFBB 4U0RC 3D3VD 3V5KB 2VUOA 4U3HA 1KCSH 4L9DA 1QFUH 4NO5A 3KLDA 3IGAA 3IDYC 3ZYJA 2W9LA 4OLYL 5D7JA 5FYLH 4YE4L 4H1LH 4RIRA 1T7VA 4JDVB 4P5MA 4S1DC 2V17H 1Z2KA 2VDOH 3KYKH 1ONQA 1RIHH 4YHKH 4LLDA 3QIWD 3G9AB 5DYOB 4LCWA 4HHAB 4HKBA 3U36B 5J9PB 1JFQL 4LCUB 2X1OA 1MJ7L 1YMMB 3MQIA 3SDXF 1U8IA 3LSOA 1T2QH 1YEIH 4MAYB 4XBGB 5D1XC 3WJLA 3INUL 4M8VA 4TPRH 4U1SB 4Z8FH 1WZMA 1OL0A 1F2XK 2L7UA 2VDPH 3PWJA 2DRUA 3EFDH 4PG9B 4PREA 3NN8B 3FZUC 3QNYA 4DGVL 4O00A 1FNHA 5DUMH 5CD3B 4LP5A 1KT2B 1JE6A 3T0EC 4NDMA 1RZJL 1F00I 5H35B 1I7ZA 3X11B 3IAPA 1JYNA 3OGOE 5IWLA 4N1EA 5JQ6L 4YHMH 4XPBH 4L4VE 4OI9A 3BFOA 5AYUH 3DX8A 5F3BA 4EIZC 1GGBH 5L6YH 4Y16C 2DWDB 4X7DC 5FOBA 3U9PL 1A1MB 5BW7C 1G7PB 1KCRL 4F58H 3JVGC 2V2WB 1JYXA 2D03L 5A2LH 2Y7QA 5D2LA 4ZTPH 3VFGL 2Q6WA 4G3YL 5KSAC 1VADA 4WTZA 1HXYB 4LAQH 1A6AB 5C6WH 2NZ9D 1EZVX 2DTSA 3Q3GA 5EA0H 3QDJA 3EOTH 1YEKH 2VC2L 1HH6B 1U58B 2PKDA 2DF3A 3BP4A 4ZPVA 1MJ8L 4GXUN 2W9DL 2XTJE 4XP1H 4LSPL 3VXRB 4MMZC 4JZJC 2NX5D 4BQ6A 5E8OB 2VLJE 4UB0L 4JANB 3O9WA 4HUVB 1GGCL 2QQNH 4MJ5B 2F15A 4ZG1A 2GJZB 3MRBB 3EYQD 1NGQH 4AIZB 3U83A 1J18A 5IIEA 3W0WE 5EUKA 1ND0A 3RWIA 5HDLA 1KACB 3HZVA 3D0LB 3VXUA 1OWRM 2GJ6A 3VGAB 3VGHA 4D0BB 2XQYK 3C08L 4NQED 2VZ3A 3OJDA 2YMXH 4OCRL 1FAKT 5T3ZD 2CRIA 1LE9A 3O6FA 4UDTA 3OHXB 4OLZH 2YA0A 5TE7H 5IB2B 3TBSA 1H3XA 4MNHA 3TVMA 3QA3B 1K85A 4JFHD 2IALB 4X5WA 1JNNH 1MCPL 3QXUA 2ZSWA 1J1OH 3HZYA 2H32B 4U0QB 3LKQB 1RD6A 4LIQE 1CD1A 3VGDA 2BFVH 2ZUYA 3OKNB 4F7PA 5JORB 1ZA6A 4URTB 4GUPA 2YEZA 5EN2B 3BPCA 3QG6A 3SJVD 3FRUB 4HX1B 2DQGH 4JCLA 5J6GB 1YC8A 4N0RA 4TUJB 5D96B 5AAWA 3KYMA 1N5AA 1YJDL 1NKRA 3LN9A 4PJDF 2ESVA 1ZT4A 5DGQA 1EHLH 3HFML 3UTQA 3WIIL 2JLLA 4WI8A 3GKZA 4YX2L 1IQWL 1RUPL 5TJWK 2IPUG 4AEFA 1MCFA 3BRGC 2W0KA 2AEIT 1RUQH 4RQQA 5LJYH 3OAUL 2ZSVA 1KPVB 5JO5B 1FFPB 4AG4H 5BV7C 3RNKB 1P5UA 1MRCL 3DMMB 3B9KD 3TO4B 2WUBL 5DUPH 1BF2A 5CJOH 5ILTL 5EU3B 3NBNA 1I9EA 3MLWH 1VCAA 4WJ5A 4LBEB 3ARFD 4PJEE 4PJIA 4QRPE 4NO2A 1WC7A 2VJXA 3PGFH 5I76B 1MI5D 4YGVA 2APTA 4ZDHB 3BE1H 3TN0D 2H6PB 1A6TA 1B4JL 3O4OB 2PR4L 1ED3A 3R1GH 1RVFL 3P9MA 2NLJA 4RISH 3PWLB 4AENA 1VKXA 1A6WL 3LKSA 4LIQH 5A43C 3CVHB 3OSKA 3OKYA 3DECA 4ZYKA 5FUCE 2R29L 4H26B 2FGWH 2KUTA 1XGTB 4ODSL 3QBTB 4CUCA 2ZUXA 5KAQF 3UC0L 5C2UB 5JUEH 3SDCB 1NCAL 3KNBB 3U1SH 2VERN 5IHZB 2A83B 4ODUA 2ATPB 5D6DC 3TGXA 4KVNL 3G04B 5ADPL 2X4QA 2VDLH 1KJ2H 1QEWA 1IEHA 1WWBX 1F2QA 2P47B 4HUXB 4QHLA 3CX2A 1EHAA 5C0BD 4XXDB 1KSRA 2G75A 4JB9H 3HUJE 3ZDXF 4P9ML 3MLSL 4Z0XA 3P0YL 3QUKB 3DROB 1CN4A 1S9VA 2GFBA 4MXWH 1EMTL 3OXRA 1LVEA 5SWSD 3UAJD 2YXFA 3MCKB 5EZOH 1NCWH 1Q72H 2PYEE 2E3VA 4L8SB 1IZJA 2FEEL 4PP2A 5DSCB 4PJ9B 1U8HA 1ODAA 4Q9RL 5HYSG 3VDCA 2EC8A 3QHZH 5DXWA 1L9NA 3V6ZB 1AJ7H 4NRYB 4H8WC 2H9GB 2W0FB 5I9QB 1GGIH 4KWUA 2NTSP 2MWCA 8FABB 1RHFA 3KAAA 3UTTB 3HMWH 3NZHL 3MV8D 4QT5B 4BUHA 3KHOA 3BP7B 1A7PH 1B0GB 5EU4A 5JHDB 3DRTB 3D3VB 4HS3B 1Y18B 4OLWL 3I2CL 4NO3A 4G7YH 1DR9A 5JOEA 3CPLA 4KHXH 3ARVA 1FNGB 1PG7L 1UACH 2DLEA 4NC1C 3CDYA 4JM2B 3RVUD 4ZO8A 1DQJA 5EIIB 3RIFK 5EH1A 3ARYA 4JHAH 1YNLL 3MRPA 1TTFA 4OZHB 5JA9A 4OAWA 1JGLH 1GL4B 1QHPA 4NSKB 1JWSB 1O7VA 3LVEA 2ED7A 3TEUA 3FT2B 2AJVH 5L8JB 1E6OH 4QHMA 3MFFA 5D72L 4MXQC 4PJHE 1X5AA 3WFEL 4QTIL 1J88A 4V2BA 1WQVT 3KR3H 3DNKA 4XVTH 2X9XA 4W68A 4JREC 3DETD 1WITA 5K9OB 4QRQB 2HP4A 3FHAA 1UM5H 3ARZA 3KS0H 3GNMH 4MJ4A 3WUWA 3QNZB 4CVUA 3SDAB 5JTWA 4YHNB 4LVHC 4KJPD 4L8BA 2R2HA 2BJMH 3DX9A 3BDXA 4KTYA 3C6SB 4LGRB 4ZSOA 3AAZA 3O2DL 3V4UH 4Y0GA 2CLRB 3L3OB 3X3GL 4E5XB 4JPKH 4LLMB 1A7QL 1J0ZA 1AKJD 4HULB 3F6LA 5CILH 2HT3C 1XIWB 3I50L 3FT4A 3S88H 1H15A 5C0CB 2QSTA 1N6QL 3SKNA 5KG9A 4JO2L 4MD5A 3ARSA 1AO7E 4BELD 2DQFA 2Y6SD 1AQDA 1C16B 1RZKL 3WIHL 4OM0L 5ESAA 1L7TH 5FGSA 5I30H 5F96L 1HHHB 3IKKA 5DD5H 4PGZA 5F7MC 4JO1L 3TF7C 5AG9A 1RQ5A 3ZL4L 4Z7UB 4RGOH 4D0CB 4HT1L 3AB0B 5EU5B 2DICA 4M7LL 3U7YL 4F37K 4L1HA 4FABL 1R3HA 3MCLL 3DSFL 5F3HA 4GAGL 2EEBA 4NOFA 4EXKA 4Z7WF 43C9A 2VLRE 5CMAA 1NBVH 4Y1AB 1BX2B 4G8FB 3QEGH 2MHAB 3O8XD 1QLRA 3UTPE 3WNMA 3TYGL 4OCLC 3R06A 2GT9A 1BPVA 2LV4A 3A67L 4HEPG 5AD0B 1YEFH 3P4NB 5DF0A 4XPHH 1ZAGA 2LAGB 4JHWH 4P3WA 1RUAL 2GSGA 3DYPA 3RGVC 1KJMB 4KK6C 2X41A 1IFHH 4QHUB 4Y5XB 3IJSA 4ELME 3U9UA 4NQEB 2B4CH 3ARED 5C0DA 5BQ7B 3SQOL 4BZ1L 1DLHB 4MA7H 1DTUA 4FZEH 3Q5OA 3DTXA 2HLFD 4FQPA 4S1QL 4X6CB 3RFZC 3IF1B 3MRCA 1QRNA 3V0VA 2FB4L 1UYWL 4PJBA 4N8VB 3JTTA 3I3EA 1JPFA 1KV3A 1BZ7B 4KQ3H 5E00A 4EUPG 4JFPB 4Y7MA 2HN7B 1XGRB 1D5MB 2NMSA 1XF2B 4N8CL 1KPRB 2VAJA 2P42B 3GBNL 4YAQB 3CVHL 5DMYA 1NCNA 4P2RA 1RK1B 3QO0A 3S5LA 4IDLA 3V5HA 2FO4A 3LQZB 1HNGA 4UTAH 5CEZH 3DVNB 4JQVC 2AQ3A 3WNPA 1YY9C 1ZLSL 2VMFA 3VI3F 3P73A 2A9ML 4FG6D 4Z7OF 2Q86A 2IAMA 2OTPA 1BQLL 4WI2A 1D5ZA 4JJ5B 5IMKB 3BO8A 1UJ3C 3G6DH 1KB5L 5HHQB 4HJ0C 4FFWD 2VN7A 1FL5A 4PTUA 2AEQH 1WWCA 2YKLL 4P5TB 4UV7H 5IV2A 1PDKA 4LLQA 3B9KB 4ZAKD 4R4NC 3DUSA 3WXVH 3MODL 4GQ9H 4Y4FB 3BRFA 4NPYA 3OKDA 1UXWA 3ZE1E 1KIPA 4OM1L 3FQRA 1DFBH 3CX5K 1MI5B 3T77A 2VISA 4D94A 3TN0B 4YBQC 2LU7A 5JQHC 5IW3A 2WBJD 1ZV5A 5L2JA 1HYSD 4OZFA 3O3BB 1IAKA 2VWEE 3KPQB 1PYWA 4MAUH 4P59H 1CVSC 4JPWH 1S7QB 1RU9H 2EC9T 3ILQD 3UO1H 4U4BA 4WVRA 4E41D 1XGYL 1MHEA 5TDPB 2O5ZH 5FF6B 2F58L 1T20B 5GRWA 2PCPA 3U46A 3LKRB 2Q7YA 3BHBB 3BMWA 5E4EC 5F1NA 3OR7B 1INEL 5TH2A 1RJLB 4MGXA 5I1EH 3OJMB 3DV6A 3CFBA 3RJDA 2FX8L 5C07A 2HFTA 5FGBC 1I85C 3H3PL 3EHBD 3OKOA 2C3WA 1EHNA 4XMLH 5EU6A 4JDVA 4I3SH 2UWEB 5C0BB 5I71C 3ZT7A 3MV9A 4POZD 5E08H 5INCB 4WHCA 4AZ8A 4RDQF 2EECA 4G7VL 4LCUA 1YMMA 4X9FA 2QSVA 1F4HA 5I1IH 3P0VL 4U1IA 1KOAA 1IAIM 4W6WB 4RSVA 5T1DL 4RMWA 4J8RA 5HYJA 2A74A 5T3XD 3QYCA 3RX5A 5HVHB 1MNUL 4JFYB 5ADOH 2XZCL 1MQKL 1LO4L 5GS0C 4GFTB 2Y06L 2LVCA 2YUZA 5JZ7D 3PL6B 2P8MB 4L3EE 1YNTB 5GJSL 3MO1B 3T1FB 4PG9A 4UQ2B 3NN8A 2VLLB 1CLZL 3MRRA 3IXAA 4ENED 2GEEA 5D5MF 4XAWL 4OUOA 3T0VA 4M93B 4L8DB 4OCNC 5H35A 4Y5VC 1JMXA 3MV8B 3I3DA 1LEKB 4G6JH 2HJFA 3X11A 2GITB 5BVJB 2W9EL 3U6RA 3RWGB 2CD0A 5EG6C 1JZ6A 1QR4A 4DUVA 1J5OL 4LRIC 4NQDA 2CDEA 2VLKB 5D1ZD 1D6EB 3MJGX 3N1FC 1CI5A 4C58B 3J7HA 2D4DA 1YPZA 2ZUSA 3MUZ1 4KRMB 5EO1A 1CFVH 1FFOB 2A1WH 1DEEB 1S9YA 3KLSA 1IGML 1C08A 3CH8A 3CU7A 3QDGD 4I0KA 4YDLB 4PB9H 2Q8AL 3GHBH 1EEZA 1LO5A 4HIIA 4PUBL 2X4PB 3DSNA 5A3ID 3GO1L 1YEHH 5C1MB 1A6AA 1I3GH 1HSBA 1BQHB 2F19H 5GGRB 2R1XB 3TO2A 2OZ4L 1JK8B 3FN0H 3CVIH 3NH7H 4HGKC 1U58A 2X09A 3FB5B 2DLTA 4LVNB 1CD9B 1N4XL 2A73B 32C2A 4LPWA 1EVTC 5MEQB 4HUUB 4U6HB 4PJCA 3RPIB 2AS5M 4JANA 3THML 4XNMA 4ZS6C 4F2MB 2C1OB 3X3FH 4AIZA 1TETL 3WE6B 4EUPH 4ZFFA 5K9QG 1C5CH 4KI5F 3D0LA 4Q97A 1CS6A 3IFOB 5ITBH 4HS8L 5I1HH 2FD6H 5IB2A 2GK0A 3WIHA 5JXEC 1QLEL 1A1OB 3TIDB 3VA6A 5I19H 4KV5F 2H32A 3CD4A 3LKQA 2RCSH 3GRWL 4OGYL 4D3CL 4OLVL 3VFWA 4BFIA 2IPTH 3B9DA 1FGVL 1IARB 1MFCH 5EN2A 3LPFA 3MA9L 1BEYL 3LRHA 4PJ7B 2R23A 4HX1A 3MA7A 5J6GA 1KEMH 4GXVL 3L95B 3MGTB 3ULVD 1FPTH 4LCIL 1U3HA 3D2UA 3WKML 3SO3B 1R3JB 3TJEL 4ZODA 1X7QA 4OD3H 2V5RA 3PABA 3L5JA 3O8XB 1G7HA 1ORQB 3VFPB 5HDQL 1DQDH 1EH9A 4CW1B 4PJFB 5FGCE 3FQUA 5CJ8A 3S37H 4J7RA 2Z0BA 4WWKD 4XHJC 3BESR 5H37G 4OCXL 1OAXL 2AK4D 5JO5A 1EXUB 1DSFL 1BLNB 4P2CG 3MROA 1E6JH 5DQ9A 2ADGB 1D5XB 3RNKA 4R0LC 5IB1B 5IROA 1MHHB 3UROR 5I8OL 2F53D 5C0NC 2FYYA 3TO4A 4JG1H 4MCYB 5I75C 5DUBA 1VGEH 3DARA 2B0SL 2OJEB 4LPTA 4WU7A 3VXNB 3STLA 1QSVA 5DLMH 5LQBH 1U91B 4CN1A 4NUGL 1IEAB 4ZDHA 5F71A 3RY6C 1ZT7B 3TBTB 5DRXB 5IQ7H 1F8TL 3MV11 1MAML 1X5GA 1AIFA 3OGCA 2G2RB 3GSNL 1W0WA 3CVHA 3ZKMC 2DQTL 4MJIB 1M1SA 4ODXB 5HHPA 3VXSA 4H26A 4HV8B 3L3DA 4PLNC 4GBXC 4O2EB 4PR5B 3WFBL 3IJHA 1HQ4B 1L7IL 5LBSL 3BQUA 1FZMB 4ZFOB 1YN7B 1IC7L 1LDSA 4DFHA 3KNBA 5IHZA 4PRHE 4L3AA 4WI3A 4PBXA 4JFXB 3NAAL 4OZIB 2ATPA 2WV3A 1H0DB 2AV1B 1BHGA 2DQDH 2GTZB 2W1NA 1EFQA 1RSFA 2G9HB 4NWTL 5D1XA 1WV7T 3MRIB 1KB5A 5B22A 1U8MB 4UBDC 1OWWA 4BQ8A 2EDHA 4XXDA 5ISZB 5DURB 3WIFA 4WTZG 4ODHL 4KMQA 3RDTD 4F9LC 4BM7A 3DURB 1SM3H 1W8OA 5F89B 5DQDL 5EZLB 4OZ4A 4UILH 4ZAKB 2ZNWA 3G5VA 4GKOA 4I0PC 1TVBA 1BFOB 1VA9A 4UAOB 3TPKA 2ICEB 2WQRA 2D7TH 3KXFD 3MCKA 1YUHB 4YBHA 3MJ9L 4M7JH 4JPIA 4Y4HA 3REVB 2NY4D 1U6AH 3K81A 4D9QD 5I6XB 2A0LD 2QHLA 2WBJB 2VXQL 1JF6A 1MIEH 5EUOB 3V6ZA 1AGBA 2H9GA 2F74B 4NKIH 4CMHB 2ZOKB 1CIUA 2GY7B 4Y16A 1NAKL 1HXMA 2PO6B 5DI8B 3TZVD 1NCUA 3ECBB 2X1WL 3JVGA 5M95B 5ABDE 1ACYH 3NACH 4QT5A 3ILPA 1KCKA 2E9JA 5J6HB 1B0GA 1FAIH 2BNRD 5JHDA 2YZ8A 3CMOH 4HS3A 1MPAH 3RUGB 1Y18A 2EDQA 4DW2H 4XVJL 2FHFA 4X80L 2EXYC 1G7MA 3ABZA 4KUCF 1EO8L 1ZMYA 3C5ZD 5CHNB 4CU7A 4EZMA 3C6LD 5IEKB 2VR5A 4I18B 2XXCB 4N0FB 4K8RD 4JM2A 4OF7A 2EIZB 4LCWE 5D1QC 3UMTA 4Q2ZB 5GZOC 5HHOA 3RZCD 4KJQC 3MRDA 1FV1B 1NLBH 1PEZA 2DQEH 5L0QB 3T1WA 2EKJA 4XGZB 4P4KC 1MH5B 1QO3A 3BD5A 4JZJA 4M6MH 3X14A 1O7SA 3QWQB 1WT5C 4QXGH 2ZCKH 2IANE 3EYVB 5JOFA 3X13B 3C09B 3F7YB 3OR6B 1UWGH 3U0WL 3ZKSD 4S1SL 1TJIH 3P40A 4ZO7A 1AXTH 1N0LA 1OAYH 2C7UA 3QNZA 4G9FB 2YC1A 5L2KD 3QISA 4NGHL 1WFTA 3O3EA 4XBEH 4NWUL 2F5BH 3C6SA 5CZXC 1N0XH 2P5EA 4EBQL 4ISVB 3L3OA 3BKCH 1MUJA 5IKCB 4EDXB 1S7WA 5D6CA 1KB9K 5JW4N 5TF0A 4G6AC 5CGTA 1OW0A 5C0FB 4PP1D 1GAFL 1CXKA 4OFKA 3H9SA 5ACLA 5AZEH 5MEOA 3SGDH 4PRNA 1IGYB 1LK2A 1JPST 4NM4H 2WIIB 1C16A 5SWQA 2NW3B 4Y8DC 3E6FB 3W39B 1OTSD 5D2LE 1JMZA 4BSVB 4U1GB 4XP9H 25C8L 2EH8L 15C8L 4IRZH 5DTFA 4M1GH 2AKRA 1CXFA 1FC2D 4RWYL 4JR9L 4LLUB 3MXWH 5H37H 3MRLB 2X89D 3E2HB 2OZ4A 4LPCA 1KFAL 2FZ3B 1U8NA 3G5XA 5T33H 5DD0H 1TZGH 1FFQA 2A6DB 4YC2C 1JJUA 4JG0L 3VD5A 3CSGA 3CIQA 4Y1AA 4P46B 4IRJA 5DHYA 1NCCL 4X99B 2MHAA 4G5ZL 4QY8B 4NQUA 1N5YH 5J3HD 3NCJL 4AIXA 1LP9B 1BVZA 1VGKA 2ITDA 4LHUB 1FIGH 1EFXD 3P4NA 4LLVA 3L6FB 2I07B 2XWJA 1CXEA 3VXUE 1INDH 1NC2B 2GJ6E 4Y5XA 2XICA 5FKAB 2EYTA 4M9PA 4WWID 3TNMB 4JM4L 1GGYA 4O5LH 3VGAC 5BQ7A 4FQLL 3QJFA 4JN1H 1DLHA 4YR6B 1PZ5A 3GRWA 3IFLL 3IF1A 1WZ1H 5DEFB 3WEXA 4OGZA 4N8VA 4QXTA 4ZMAT 2R69H 4YEFA 3EOBB 1DLFH 1CICC 4LSTH 5I1DB 3QXDA 5KZCD 3QQ9D 1DQMH 3CSYA 2C3VB 1D5MA 1XF2A 1HIMH 1RIUL 3JV6B 4MHHG 5HD8C 3U2SB 5FB8B 4PV9A 1G9EA 2ESVE 1SYSA 4LSQH 3QCTL 1IC1A 3ZHDA 4KXZI 5D96C 2JIXB 1E27B 3CX5J 3LY6A 4MJ6A 4OGXH 3E8UL 2VKXA 3GIVA 5JIHA 1QSZA 2FR4B 1RK1A 5HHVH 1I1FB 1QFOA 4HUWB 4UV4H 5T5NF 3G5YA 1BOGA 2VH5H 4XP6L 2YS4A 3S35H 2B1AL 1PFCA 3WLBA 1SJHA 4UT6L 2AJXL 3C5SB 4NJ9L 3QI9A 3F7QA 3O6MH 4YO0B 1LD9A 5EPMB 5F9DC 3C9NA 1CQYA 5GQBA 5HHQA 2Q87A 3WL9A 5BZDA 1NFIB 1MEXL 4RFOL 4P5TA 4EI5C 5GS0L 5KSVA 4PGBB 5CGMA 2F53B 3FAWA 4AMKH 2AJ3B 3DMMC 1CXIA 4LSVH 3MRHA 4D0DA 4GKSA 2VSCA 4HJGB 4OCYH 4Y4FA 1XF5A 5IT2H 3CGTA 3K1KC 5HGBB 4OD2B 2XQBH 5I73C 1OSPL 4EQ3A 4WFFD 3GSNA 4M48H 4U1KB 3GEWB 1D7FA 5CFHA 1QPPA 2V7NA 1A21A 1CBVH 3LEXB 4UZGA 5I66B 2HTLD 1NKOA 1DBJL 1S7QA 4NNPH 3DWTA 3P30H 5C09E 2ZKHL 3QEHA 5F7NC 3QUZD 5TDPA 4X6EA 3VWJC 5FF6A 2C26A 3IKCB 5GJTH 5TE4L 5DA4A 5I8CB 4MQTB 4L4VD 5F9WB 5E2WL 2F8OA 3SDCC 4JO3L 3JSSA 1RUKH 2GI7A 1H8OA 4D9LH 4GW4B 4LU5H 3K80A 3MRMA 5KN5B 4PD4J 3VRIB 1BBDL 2H2SD 1K3IA 3OZ9H 1J8KA 2D31B 1TJHL 4K3JL 3R0NA 2Z92A 1FNEA 3IETB 4MA3B 1F45A 5BRZE 4HXBL 3N9GH 4HZAA 1MELA 3MJ9A 5HI5C 2VXVH 3LH2L 1V7NH 1U8KB 4KC3B 2P8PB 1KTKE 4L8SC 5DQJA 1BJ1H 2GHWB 2XTJD 3I75B 3EYUL 4IIQB 4WHYG 2VLJD 2XWTB 4L4JA 1WICA 4DVRL 3TZVB 5I9QC 2D7QA 4NN7C 1WBZB 3W0WD 3K4ZA 1W72B 3HPJB 1ZE3C 5L8LB 1MJUH 1K4DB 4P9HH 2BNRB 4NNYA 1FYTA 1N64H 1JTPA 4XPFL 4AEEA 1KJ3H 1LQSR 3PDDA 4O9HH 3GMMB 1FGNH 5TFSH 3QIBD 4N9GB 4RGNE 4UOW1 1KEGL 4X6DB 1I7UB 1OSZA 3S3JA 5TGBA 5DEGA 4CADA 3EO9L 3TYFB 3QIWC 3SGKC 5J56B 7FABH 1JZ2A 3S5LG 1F3JB 3TP4A 1FH5H 3PDOA 5EBMA 5C08A 4HCRH 3RGVA 3L5XH 1CE1H 4OZHF 2DDQL 4PRPE 4LDEB 2OTWA 1ITCA 2VDMH 1T03H 5DFVD 4HUMB 1MVUB 1EGJL 4KI5E 4XNQA 1PKQA 2A73A 3P4MB 3GMRA 1P1ZB 1PY9A 5KVGH 3MLRL 1F02I 4DVBB 5L2KB 5MEQA 1V3KA 4U6HA 2CO6B 1E4XL 2OI9B 4ZSOE 5I1AB 2HAZA 1DN0B 4HKZA 4EEEA 2Y5TB 1VHPA 5DHVB 3UTZA 5MI0B 5I18H 1AR1D 2M1KA 4NT6A 3F7VA 1CE6A 1V8HA 2EKSA 4FNLH 3NFSL 1CK0H 4PPTA 5J1AB 4OZGB 1CDGA 4WY7L 3D85D 4A2LA 3DGGA 3SGDI 4HLJA 4QRPD 1KGCE 2YWZA 3MMEB 1A1OA 4I8DA 1S7UB 1G0XA 2NCMA 3HZMB 3QWRD 4HFUL 3H0TA 1JNJA 4LSUL 2GYSA 5CZVL 3UYOD 1JFQH 1A2YB 5EBGA 1MJ7H 1ZEAL 4F7CB 4NRZA 4G6ML 5FYKH 1FO0H 4FQCH 3LQAL 1RZ7H 4PJGA 1I3RB 1UJ3A 3INUH 2XOTA 1WWWX 4ZPTB 2EDKA 5C7XL 3BD3A 2NZ9C 4FP8H 1U42A 4R26L 4ELKB 4XCNB 4Z7UF 4H1LB 3TCLA 1NGWB 4MDIA 1JNHB 1ORQA 3EYSL 3SY0B 3BKYL 5DMIL 2HKFH 3EDKA 1YEGL 3VXMB 3ARDB 1HWGB 2O61B 4R6UA 4DGVH 3BYYA 1EFXB 3C8KB 4FQHB 4HWUA 1EX0A 3QWOA 1EXUA 1RZJH 4OUUA 5C0RH 5B3JE 3NTCL 5DVLA 2FL5B 2X4RA 3PE9A 3WFHB 3EYQC 5IB1A 2PTTB 1MHHA 2F8VA 4C56B 2D0HA 4MCYA 4M1CD 4UIKL 5CJQL 1L0YA 3VXNA 2H8PB 4HZLB 5IJVB 1R5IB 1U91A 1UXSA 3U9PH 1KCRH 4G6FB 1CWVA 3DYMA 2QLVB 5DDHA 2D03H 5DRXA 4YHOH 1OOAA 4G3YH 1FZJA 4NC2B 4JRXA 4X6CF 4B5EA 4K55A 5GRXG 4MJIA 2VZOA 1A0QH 4P2RE 3IJYB 5JPNB 4O2FB 4AT6A