5E8DL

Crystal structure of human epiregulin in complex with the fab fragment of murine monoclonal antibody 9e5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
210
Chain Sequence
b'DIQMTQSPSSLSASGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLHPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proepiregulin
publication title Epiregulin Recognition Mechanisms by Anti-epiregulin Antibody 9E5: STRUCTURAL, FUNCTIONAL, AND MOLECULAR DYNAMICS SIMULATION ANALYSES
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 210
sequence length 212
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8dL01
2B1AH 4PJ7F 5D1ZA 4EDXA 2BVPB 1CTOA 3GJFA 4XWGL 1YEJH 4KHXH 5SWSE 1J8HB 1F3RB 5GZNC 2Y7QA 4B5EA 4WTZG 1BVKB 5C9JA 2EKSB 3BUTA 3E6FA 3MJ9L 4ODTH 5SWQA 4OLWH 1IGYB 4PUBH 2CDEA 2O5XH 5CMAB 3QEGH 4QHNA 1K4CA 4JFFB 4K94H 1MUJB 1I75A 4LFHG 1QQDA 1YDPB 4MD0A 4Q0XL 5T1LA 4P2QE 3EOYG 4WU5B 5BVJA 1QBAA 3VXPA 5CFHA 4HV8B 1CDHA 2FHCA 4UT7L 1JNNL 2OTUA 4I48B 4PREA 4YR6A 3VA6A 2EDYA 1KBGL 4ELMF 4JFPA 3MRRB 2SEBA 3BVNA 2Z8SA 1EZVX 4KQ3L 2X70B 4P2RB 2B20A 4NQSA 1DDHB 1CXLA 4RMRA 1KTLA 1UXWB 4Q0XH 1FP5A 2NW2B 1P2CB 1F4XH 4E0RB 4WIQA 2YC1A 4UT7H 3GZKA 1EAJA 1JNNH 1EBAA 3VI4F 3D85D 1KBGH 1KG0B 3RJQB 3OXSB 5F7UA 3WIFB 4MD5B 1ZTXH 5BS0B 4KQ3H 3PP4L 4EN3C 1S9WA 2X4TA 1AY1H 3ZE2F 4U4BA 3TGXA 2LVEA 3HG1A 3T3ME 4O51B 4X5XB 5MENB 3O3DA 3DRQB 1BP3B 1EUTA 1HHIA 1OWWA 3BGMA 4ZOCA 5ACLA 4JO4L 3DURB 1C16A 1FJ1B 1WBXB 1U9KA 5ESVA 2AERT 2M2DA 5DRNA 1IGJB 2R4RH 2QQNL 1GZQB 1I7UA 5D2NA 1X6LA 4CN4A 1FQ9C 4X8XA 3DVIA 4XVUD 3O6ML 2V7NA 4FN0A 4Y5VA 1ED3B 4PJHA 3MRDA 1LO5A 4XNUL 1ZVSB 5CINH 5T1DH 4Z7QF 4LQFH 5DMKB 3ES6A 1YYLL 1ROWA 2PXYB 4XVSL 3NFSL 4QT5B 2QQNH 3V0WH 1QSFB 3FN3A 2VYRE 1A14L 2XZAL 5JW4R 3O6MH 5K9QG 3V52H 1DUZB 1CLYL 2VL5B 2JKXA 3BZ4A 3T1WA 4I4WA 5T1KD 1C7SA 1DBAH 4XNUH 5F3BA 4OUUB 2HKHL 3NOIA 2QQLL 4XVSH 4LPWA 1KN2L 1HDMA 3LOWA 1SMAA 3O2WL 3OKKB 3DGCR 1A14H 3L9RA 4KRMB 1CLYH 2E27L 4BSVA 2XPGA 4BFIA 5E6IC 3QEHA 5ETUB 4U1JB 2NY5L 2HKHH 5GGSY 2P5EE 3Q1SL 1SJEB 4FZ8H 2QQLH 1KN2H 4Y5XB 5TF1L 5F72S 3O2WH 3VXUD 3FO9B 2FZ3A 4P2QA 5HDOA 3G5YB 2I07A 1G7QB 2E27H 5BJTB 3VMOA 4NDMB 2NY5H 3RDTB 4I13B 3IKCB 1OAUL 4MJ2A 4Z7WA 1MFCH 3NPZB 5GGVY 4WEBL 4I0PB 1A6AA 5GZOC 5TF1H 3G5VA 3NABH 3IDMB 1EFXA 1PBYA 4QTHB 1CDIA 4Y4HC 3HS0B 1RZ7L 2VXVL 3NFPA 2R0LL 1FL3A 3PWUA 4HBQA 4N9GB 4LMQE 2IH1A 4YXLL 5F7HA 4PGBA 4WEBH 4F2MB 1U8MA 4J3SA 4CBPA 4ZAKA 4Z95L 3NA4A 2JB5H 3PWJB 2XFXB 3CZFA 5J11C 2BVTA 4LMQI 1U8IB 3IETA 5DK2A 3AGVA 1KIPA 5J1AB 5SX4I 4Z7UB 3ARGA 2VXVH 5HDBF 1LP9F 5CEYA 2G75B 3VD9A 3MJ7B 1NQBA 2NCMA 2IH3A 5CZXD 5F89A 3V5HB 2GAZB 4YXLH 3OBAA 4LLWB 4UT6L 3T09A 3ZMRA 3QXAA 3NTCH 4NM4H 4Z95H 1SEQH 4Y19E 4RX4D 4BZYA 4MA1C 3RVUC 4TSAL 4V1DA 1Q9LB 2GY5A 3ARYA 3HPLA 5IWLC 5JIHA 1J86A 4NCDA 5EU6E 3ULUD 1QPPA 2DBLL 5IFJB 4UT6H 4OSUL 4AIOA 5DRZB 3SDDC 3ESUF 1FCCA 1GAFH 3D18B 4JRXE 3KNBA 4YFEA 5D71L 4UILL 1AXSA 4TSAH 4HIIA 4FXGB 2BNRD 3ZHKA 2JJTC 1Z2KA 4P57A 4JN1L 1YEFL 2HYMA 1DVFB 4P4RA 4YHZL 1O7VA 2IPTL 4N68A 3O2DA 25C8L 2WIIB 4PRHE 5D71H 1NEZB 1NGZA 3VGAB 3STZB 4CVXA 4TSCL 3TNNA 5D1QA 2VDQL 4N9OB 1ZLUH 3HI1A 5EUOE 4BH7B 2KL6A 1YEFH 5DQ9A 4XCYB 4CU8A 2IPTH 4FQQA 5DJ0A 2Q6WB 2YZ8A 4LF3A 5FKAB 4HWBL 25C8H 5TE4L 4C54A 3X14B 4GW1A 3LD8C 2VDQH 4XZUA 1ZS8B 1FAIL 1J1OH 4HC1L 1NC4B 5DMYA 1JL8A 4RAHA 3ZKQD 3HE6B 3OJ2C 1DN2A 1MELA 4OJFL 5KJRL 1AD9B 5B8CB 4GXUN 4QLRA 4F33B 2NY1C 4K3GA 5TE4H 1G6RL 1ES0A 2PCPA 4WTWA 3P9MB 4X4XB 1FAIH 4P2RD 3H42L 3S6CA 4HC1H 5IMKB 4JGJA 2AEIT 4R96B 5KJRH 3VD4A 1KC5L 1SY6A 1JMZA 2VQUA 5DD0H 1U6AH 3G6DL 1OPGH 1HYSC 2ZZUT 1G6RH 1T04A 2XV6B 1S78D 1RMFH 4NNYB 1FG9C 5BS0D 3C5JB 3H42H 4NO0D 1AGDB 4HIHB 1I9JL 3A67H 3ZE0E 4Q58C 3S96B 1YC8A 3DI2B 1R0AH 3VXQA 1U92B 1KC5H 1MI5D 3LKOB 3ARQA 4DVRL 1IEAA 5MEND 3G6DH 4Y19A 4POYA 4GBXB 4NFBA 4JFQB 5E24E 3LAFA 2R2BB 4OT1L 4JM2B 5I1AB 3PWLA 1UB5B 2APFA 2GCYB 3G08A 1U8QB 5EU6A 1QRND 5J06A 4N0UE 1A4JB 4NBZB 4OF6A 1A9BA 5GRVL 3MRLB 2JF1A 1XH3A 4RFOL 4DVRH 3MGTB 3L5WB 3EIFA 5FA3B 5ISZB 4JFZL 2DMKA 4OT1H 4HKJB 1J10A 2PXYD 2VQ1B 2DIBA 2WBJA 3ZKXC 3U82B 3MREA 1AHWC 3PGCB 3VRLF 5I1LA 3QZWG 2YWYA 5HGHB 3DXAE 3ZDYF 2C5DC 2VLLA 2RIKA 2EH8H 3QR2A 4JAMB 1QO3A 4RFOH 1MIEL 3BT2L 4P5KB 4PRHA 5F3HB 4JFZH 3TCLB 2IQAB 4HKZA 5T3ZE 2C4XA 4PBWD 2X4OA 2OK0L 4DUVA 2R2CA 5EUOA 2DQHL 2GSGA 3FB5B 4Z6AT 5HVWA 1Q9WA 4Y1AE 4QHKI 1BM3H 1E0OB 2I25N 4RGNC 1NCBH 5KS9E 2DKUA 1IM3A 4APQC 1WISA 4TVPD 4X98B 3I6LD 4RMSA 5FO9A 5DO2C 1GGBL 4EN3A 2DQHH 5IEKA 3CCHA 4KJQD 2X7LA 4PJEF 4UDUA 4RISL 1ZA3A 3WFDL 5JOFB 1T1WB 3U7WL 5I15L 3RDTD 1EJOH 4JFEE 2BSSA 4LVHB 4WHDA 1JWMB 1OP5K 3DETC 4I0PD 1S7XB 1WBYA 4UIMB 2ZCKL 1GGBH 3PXHA 4AQ1B 1KJ2H 1KENL 2AJ3B 3LV3A 4NFDA 3LRSA 4YHLH 1CYGA 1A8JH 3DPBA 5J13B 3WS3A 3WFDH 2E6JA 5JZ7D 5I15H 1B0GB 5JXAL 3EZ8A 3AB0C 4OFIA 4JY6A 4UDTB 2BSRA 1KPUB 4LU5H 5D96C 4XNMA 3IDNA 4JO3L 1XR8A 4NQVA 3TVMB 5JORA 2X4UB 3TYFB 1KENH 1HSBB 5I0DA 2X42A 5L8KB 4P4KB 2X4NA 4F3FB 1U8LB 1BVZA 4OFYD 2J7LA 2X1PA 4N0UA 2EICA 2PTTA 4TUJB 3RJDA 3D2UA 4QRTA 1QSVA 4JKKA 5FYKD 1GSMA 5I18H 5ELIA 2H9GA 1XZ0A 4X6BB 4HJGB 2VZSA 1F8TL 2EYRA 2HKFL 5E6IA 2YD1A 3SE4A 2PTUA 4LSPL 1YYML 3O2VL 1FVCB 1ZA6A 5H35A 2ESVE 1OCWH 1X9QA 4NYLA 3DXAA 3DGGA 3KYMB 2NY2C 4GG6F 3X11A 4DFHA 4FFWC 2GJZB 2VZ3A 4D0CA 3GMPA 5EU3B 4M7LL 3P77B 1NDGA 1DUYA 1B4JL 1JGUL 2HKFH 4LLUA 4TNVF 4PJBB 4KVCL 3WNNA 5K9OA 1FAKT 3QIWB 1YYMH 3BW9B 3BP6A 3O2VH 4LSPH 1CK0L 4PP1C 1DVFD 4OIBA 1CN4A 4OGXL 2A2QT 3P4OA 5E4EC 1QLRB 4YDLC 1QEWB 2ADJB 4R4NC 4Y4HA 3CGTA 2D0GA 4M7LH 2DDQH 4J1UA 3MMEB 1B4JH 5MP6H 2NYYC 3L3GA 3SKNA 1EJ6A 5J0BA 4X9HA 4EXKA 1CK0H 3HZMA 4N1HB 3SY0A 3QDMB 4OGXH 5J56B 3QA3B 3VRJA 5DJZA 5CAYB 2DQIH 1Q0XL 1SQ2N 3FJTA 2HFFA 3HLAA 3QPXL 1T20A 4JFEA 1NC4D 3G5XB 5D7IE 2VDNL 4ISVA 3MUJA 2XTJC 1MHHB 3HE6D 1ZSDA 3GMQA 4HFWA 1QD0A 3VRIA 5L8LB 5F7DA 4X5WA 2APVA 3TC9A 5IHZB 4X6DE 4V2BA 5EBWB 1CL7I 1NSNL 4J4PA 4OF8A 3FTGB 3QPXH 2BVOA 2DYPA 3CFEA 3AMLA 5IWLA 2UY6A 2VDNH 2W60A 3WLWD 5D4QA 4U1SB 3ZTNH 3T8XA 4RCAA 3FOMA 4PRDB 4WFFD 1RJLB 4LCWB 3SDDA 1WBZB 1NJ9A 5DS8A 5DZNA 3QDHA 1U91B 2QQQA 5E2WH 4C57C 5E5MB 5F96H 5I1DA 4G7YL 3TPUB 1EFQA 4TTDD 4YXKL 2EDRA 2QJDA 2JJTA 1RUPL 3KPLB 4WW2F 5F1IA 5FFLA 1KB5A 3WJJC 1K5NA 2FSEB 4FOMA 1G7HB 3BGFB 2ED9A 2XKNA 3MODL 3BUYA 4GBXD 5GGUA 4Q97A 3MRMB 5HYQA 1I1CA 4JM2D 1LMKA 3PABA 3QQNA 5HPMA 5ALCH 1OHQA 3WO4B 3IAPA 3FFDB 3GIZL 4YXKH 3QUKA 3NCMA 1S7RA 5B22A 1MCOH 1RUPH 2ESVA 5E5UB 1GCFA 4YDVA 3D69A 4YO0A 4M7ZC 2EC8A 1GC1L 1MY5A 3B9VA 3MODH 1R3JA 3EO0A 4LFHD 3X12A 3S97C 3CPLB 5E8EA 4RGNE 1ACZA 1HQ4A 3FB7B 1ZV5A 3UTSE 2HVKA 4M9PA 2EDKA 1X7QB 2H32H 4Z7NF 1BHGA 1SHMA 1YEHH 3REVA 4NKOB 2JCCA 4N8VA 1GC1H 5HGAB 3T0AA 3TIDA 4LCCC 4F7TA 4WW1A 1RIUL 4WHTB 4YX2L 3NGBC 2X4SB 3REWA 5I1HL 3VD7A 5I6XB 1VACA 4XNYH 4U6XB 4CKVX 5JO5A 5C0IA 1CE6B 4HS3A 3VFRB 1VFBA 5I73C 4K07A 3QUXB 1EDQA 4R4BA 4X5LA 4YBHA 3MOAH 2C4FT 4L4VE 1H15A 4URTB 1RIUH 3VFSB 4ZUSA 2YXMA 2P46B 4YX2H 5LVEA 3P4NB 1ZHLA 5D7IA 5I1HH 1WEJL 3MROA 2VAAB 1AIFB 1GGCH 1PG7H 4NKDA 3WDHA 1TLKA 2J12B 1HHJB 4X6DA 2BY0A 4YBQC 4JHAH 2VISB 1U8HA 1WEJH 4MZ2A 3QCTH 3MFFB 2NXYD 4ZS7H 2BY2A 3DVNA 5BV7L 4FXKA 1LEKB 5C86A 2D7TH 4OLZL 1LO4H 4PJ5B 3QZWB 2ICWB 1ERNA 3MBEB 4RWHA 3L7FB 5T5NF 4G43A 1X5XA 2V17H 1CTNA 1R3HA 3O11B 1AHWA 3TVMD 1HN1A 1XMWA 5BV7H 2N7AA 2QQKL 4OLZH 3UTOA 2FJFB 3FQTB 4P4KD 4J12A 1YN6A 4LEOA 3O9WD 1CFSB 3B9DA 2DAVA 1YPZB 1G9NL 4LNRA 3Q48A 1X3DA 1EXUA 3M17B 7CGTA 4C59B 3OJMB 1U95B 2VH5L 4ZODA 1MNUL 1TVBA 2DQGL 4CVUA 1F3JA 5DFVD 1C08B 4GT7A 4I9WD 2DTML 3QDGA 1PQZB 2AXGA 5T1MB 1D5ZA 2C3XA 4GSDH 1E4JA 1JNJA 4HS8L 4HXBL 3IDXL 3Q3GB 1FN4B 1G9NH 1BFTA 3UTSA 3S88L 4APQA 2VH5H 2GQHA 3OKEA 3JV6B 2DQGH 4LSSL 5E94B 4M4RA 4FP8H 2DTMH 4KQ4L 1X5ZA 5IBLC 1S7WA 3WIIL 1NUDA 3LY6A 3LPFA 4HXBH 3IDXH 2DLTA 3AXLA 3QIWD 1YUHB 1FO0A 3BEVB 2R23A 3DMMB 1SJHB 2XTJE 3D9AL 1JGLL 5EB9A 3QO0B 1EHXA 4LSSH 3VW3L 5D7JB 5IHUL 4KQ4H 4RNRB 1KNOA 3WIIH 1MLBB 4MHHI 2BJML 4JPVL 4L4VA 1MREH 3VFNA 2OJEB 4HULB 3KWWA 3GGWA 3D9AH 3QDMD 3AU1A 1WZKA 5HYEA 3VW3H 1V7ML 4U0QB 3CDGA 4ALAL 3Q6GL 4U1HB 4LLAA 3R1GH 2BJMH 2VABA 4JPVH 1FYTA 1HQRA 5MI0C 1D5IL 4YHKL 5DVNA 2DQEH 4X4YA 1WCQA 1IE5A 2O61A 4IRSB 1XGTB 4BKLB 3VGFA 4M9OA 4K9EL 4PJFB 5K93A 4FFZL 4MWFA 2AQ2A 3I50H 5FGCE 2VERN 2CR6A 4S1DC 5K9JH 1FSKC 3RNQB 5DUBA 5IOPB 1BBJB 3CSGA 1D5IH 2WWKT 1G1YA 4G80B 4YHKH 3WEXA 1U8OB 3VI3E 2HTKD 1OD7A 5HI3C 4LCWD 2VITA 4AH2B 5H2BA 2VJXA 4K9EH 5ICYA 4FFZH 1HH6B 4K7FA 4BUGA 3BH8A 2NY3C 1RIVH 4OZIE 5EZJB 3GMOA 2VLKB 2N1KA 4CADB 1B0RB 4XCEB 5BZWB 5DK0A 1LO2L 4KMTL 2VAJA 2NW3A 1UM5L 3IDUA 3LDBC 3HAEH 1DP0A 2AEWA 3I75B 5HVHC 5A3IC 4KXZI 2CO6B 1A6WL 4QHMB 5DFWH 3SGDI 3SGKC 2QR0B 3HMXA 4BH8B 4UIKH 4F15C 1ZGLM 1A3LL 2NY7H 5F6HI 2GK0B 3JSSA 5JHLL 1AQDB 2A6DA 3U46A 5TE7H 3RIAF 4G5ZL 3OKYA 5I76A 4F8TA 5GSRA 1QFWI 4MJ5B 1A6WH 4X6EA 4LLDA 1P9MC 3UROR 1YMME 1A3LH 4OZHF 5CBAB 1JFQL 3AMKA 3OJDA 4ONFL 4GKOA 4UBDC 4UQ3A 2XY2A 3UTTE 2D0HA 4HIEB 2FD6L 4JO1L 3VXSE 5DEFA 3WFBL 2DQUL 3MLTA 1FZMB 4GRLA 3RVTD 4RAVA 4M43H 4QRQB 4HHAB 2B5IB 1JFQH 1R5VB 4ONFH 4K55A 2ZUTA 3FONB 4XBPA 3QUXD 4WV1A 2Y72A 2G9HB 5JPMB 3SDAB 5GXBB 2FD6H 4JO1H 3WFBH 1S5HB 2DQUH 5AG9A 1KLGB 2VIRA 3HC3H 2Z31A 3OGCA 4AEIL 5FECB 1I1RA 4M00A 2H2SC 5KSAC 4QRPB 5DTFA 5LXGL 1P4LB 1ZANH 1T1YB 2CK2A 3DUSA 4L5FL 2H3NB 2ICEA 2YD5A 4LPTA 3OG6B 3QIBC 4YHIA 1AGBA 3KGRA 5TQ2L 5C08B 5IW6B 4AEIH 1U8KB 3WCYA 3WS6C 3VXTA 4MDJA 1UEMA 3IJSB 2J8UF 3SQBA 5SX5H 1BGXH 5DRXA 2HWZL 1QFWM 5ACZA 1C5DB 4PJ5D 5TDOB 2W9LA 2WLZA 4JHZA 3MBED 1YY9C 3BPLB 1CXIA 3W9DA 4OZIA 5TQ2H 3MV8E 4ONHA 1PKQE 2KBGA 3UMTA 1UB6A 4BSWB 3GSQA 3SGJC 2DWDB 5KANI 4JZNA 4NQXB 3AROA 2GITB 4BQBA 4Z7VA 4LCCA 3DVFA 3GB7A 3KLHD 2RFXA 2P1YA 3H9YA 1RV6X 4OQTA 5D1XC 1YEDA 1EHLH 1P7QA 4XTRC 2WBKA 3DTXA 3ILQC 3SO5A 1RULH 4B7IA 2FEDD 5ANME 1AFVL 1XGYL 4HWZA 3WFHA 4PJXF 4J8RA 4LLYA 3TT3L 2AJUL 4NOFA 3QSKB 4JFYA 2UV3A 1KB5L 2H2PD 4M6AA 4ODUB 3N50A 3QXTA 2P5WE 4WFED 4CMMA 4U1MB 3RU8L 1SYSB 1YMMA 4OB5H 2WLYA 2WWMC 3MJ8B 4G8FA 4BM7A 5J8OA 1LK3L 2PW1B 1AFVH 5KZCB 4MLIA 3UTTA 2F53B 3PNWB 5HGDA 3QNZB 4G6MH 3R8QA 5GRUL 4F9PA 3SN6N 1A7BA 2R39A 3HRZB 1YN7A 5C0AA 1J0JA 3TT1L 4PJAE 1YMHB 3DMMD 3VXRE 5D8JL 5DJCA 4XP5L 2EXYD 4S1RL 3CNKA 4GKSB 1JNHB 1DQML 3ARFC 3C5SB 2Q3AA 5D7JD 1S7SB 2WV3A 4MCZB 1RZKC 3WBDA 4ACPA 2YPLB 5GRUH 2WINB 3SCMB 3KPMB 3DX6A 3TT1H 4XVTL 5C0DB 3PDGA 5EC1A 1UXSB 3DUUB 5C0CB 5D8JH 43CAB 5L7XL 4XP5H 3RUGF 3QEUB 3OZ9L 5FYJE 1DQMH 4ODHL 3EJZD 4DEPB 4KK9C 2B39A 4JZOB 3ZT7A 2RCSL 4P9HC 1WAAF 2NY6B 1E4XI 5CJXC 4RZCB 3VG0H 4TNWF 5JNYB 2EZ0C 4XVTH 5D5MF 1N3NB 3QEQB 3WL9B 5L7XH 4IRSD 1PVHA 3LCYA 3QHFH 4ODHH 3RWDA 3MGOA 2AAVA 4JDZA 4YHOL 5DQDL 2OSLB 3RP1A 1OSZB 4HXAH 4L3AA 2L7JA 4JY5L 3C09C 4PJDE 2X9YA 3QQ4B 1C12B 4OQ1A 1S9VB 1PKQA 5GGRY 1H9VA 4YGVA 5DHVB 3SDXA 3CVHA 1U3HB 4JHWL 4XVUC 1A9EB 4HKBB 2G5RA 4JN2A 4YHOH 1LK2A 2BNQA 4B53A 4POZD 3ROOB 4JY5H 4JPWL 1S3KL 2HG5B 1A7NH 1EBPA 3ILPB 5ANMA 2UZIH 3U4BL 1HZHL 3NIDE 4ENED 2VE6A 5CEZE 3I02B 3WUWA 3QJFA 4HH9A 4JHWH 3IDJB 5GSVB 2VZUA 2HN7A 2P5WA 4LPCA 2R1XB 4D9QD 3NIFE 5L2KA 3BXNA 1KIQA 4KJYB 5JLZB 1Q0YL 4QXGL 3B4NA 4LVNC 3AREB 1UFUA 4G8GB 3I6KA 4U1GB 3E1F1 3U4BH 1CICD 1HZHH 2XNAA 4MNQE 4YHMH 1GL4B 4NKMA 4XX1E 4Y0GA 3N9GL 4JFXB 2FIKA 5FGRA 2J6EL 3EFFA 1AXTL 1L7IL 1V3LA 3RTQB 1LE9A 4ZOBA 4HZLA 1T1ZA 1Q0YH 3UYOD 2X1WL 5IV2B 4QXGH 4PJAA 4ZFZA 5CP7B 1NGYA 3QDAA 3OKDB 4IDJL 3V6OC 3WSQL 2R1YB 4NN5B 4OLEA 1GH7A 5C6WH 5ACMA 3N9GH 1UT9A 4WENB 2J6EH 1AXTH 5EZOL 5IM7A 4LHQB 1WFNA 4EZMA 3WHXB 2AABH 5I1GL 4ZO6A 3VCLB 1BX2A 1TENA 4JJ5B 3SDAD 1G0YR 3WSQH 3KPNB 5DC9B 3S37X 2FHFA 1P69B 1JPFA 3QFJB 1GGIL 1XGQB 3SJVE 5ICZB 4L8SB 3TNMA 2VDLL 3CXDH 5F9JA 3DO7A 5DJ6A 3AS2A 5C0JA 3ZKMC 1T2QL 3T04D 5I1GH 3MCKB 1T7WA 4PY7A 5IQ9B 3RIFF 5ID1B 4KFZC 4ODBD 2NNAB 1WSST 5IB3B 3CDFA 5C0FA 15C8L 3DECA 5FCUH 2BK8A 4LIQL 4P23C 1T66C 3SGKA 5EOCJ 2VDLH 5C08D 3EZJB 4JLRB 3LS4L 1CFBA 4PJDA 2H26A 5I19H 2O93L 4XCCL 3F5WB 2KDGA 4GRMA 1MRDL 1PG7W 5D1ZB 4O5LL 3GJFB 1QFUL 2HP4A 1WVZA 5HHMD 4Y16B 4I3SH 1EHAA 2BSED 2A0LD 2Y7QB 15C8H 3VXME 4M7JL 2B4CL 4LIQH 3T3PF 2IFFL 4DTGL 5C9JB 3SKOA 5SWQB 3M45A 4XPAL 1P9MA 2CDEB 1FRGL 3LS4H 4QHNB 3AC0A 1CR9H 4XCCH 4HLZH 4O5LH 1QFUH 1X44A 3FCTB 1CGSL 4MD0B 1JF1B 1J05A 3KPPA 5T1LB 5I1JL 1PKOA 2VKXA 4FQCL 3VGBA 2B4CH 4PREB 4YR6B 2IFFH 4DTGH 4JFPB 4U1LB 1F42A 3BVNB 4XPAH 3O3AA 5EBMB 4MAYB 4OV5B 4LBEA 4KRPB 2F8XC 1KTLB 2OR9L 1CGSH 4MNQA 4ORZC 3L3KA 4X6FA 4HFUL 4FQCH 2YC1B 3N1PC 3UPRA 1C1EL 3LB6D 3BKJH 4KKCC 5TH2B 3R4DA 3HMXL 2JK5A 5KZCD 3KAAA 2F53D 3RKDD 5KSAA 5DVKA 2GSIA 2OR9H 1RFDL 1IC1A 3D48R 3HG1B 4LSVH 3BDBA 1G9MC 3BZEA 2EC9U 1XIWC 1KCSL 2GW5A 1C1EH 3QIBA 1HHIB 3N85H 3OL2A 1JPSL 3BGMB 4K71C 2Q86B 5ESVB 5DRNB 3WS6A 1I7UB 2AXJA 1NGXA 5CSGA 2YPLD 4LSQL 4UOJA 2V7NB 3SCMD 1G0XA 4Y5VB 1CGXA 2IGFH 3WFEL 4PJHB 4PD4J 3MRDB 1JPSH 4I2XA 4K3JL 3TJEL 5C0CD 3ES6B 1ZLWH 1A3QA 3BISA 3P73B 1L7TL 1NCUA 1MHCA 4QF1B 3VFTA 1S9XA 1F2XK 4LSQH 3SGJA 2NY6D 1W8OA 2Z0BA 3RWHA 4XGZA 4I4WB 2VKWA 4GAFB 5F3BB 4GXVL 1CQYA 1OGTA 3CLEL 3HE7C 3QEQD 4X9GA 3TJEH 4K8RC 2CIKA 5DT1L 4GG8A 2V5YA 5DSCB 1HDMB 4HDIA 1L7TH 4MXVF 1JV5A 3VXMA 3L9RB 3INUL 3WFZA 4BSVB 4BFIB 3QEHB 3IFNL 3BRDA 1H5BA 3CLEH 4GXVH 4K2UH 3VFGL 3OV6A 1UM4L 1S5IL 3TEUA 4PJIE 3EW3B 3JBG7 5IQ7H 3ZLQC 4MZ3A 1IC4L 5LKNA 4OCYL 3OR7A 3CSBA 2I07B 3INUH 4F7CA 2E3VA 3RVWC 3SGEH 1A7OL 1OTUD 5C3LD 1WFOA 3LKSA 3VFGH 4Z7WB 5HJ3A 4X9IA 5F1SA 1IMHC 1A6AB 1T89A 4Z77A 2HRLA 5EOTA 1QLEL 3V6OE 4JPKH 3GI9L 5E56A 3VXUE 1CLZL 1IC4H 4OCYH 2OR8A 2V2XA 3OHXA 4YK4B 3NFPB 4IBLT 4PD4K 1FL3B 3PWUB 5BCAA 1CDBA 3ARED 4J3XA 3FT2A 1R24B 4G8GD 2IH1B 4Y2DC 2OS7A 4ZFFA 4PGBB 1I8MA 2C9AA 1U8MB 2X4QA 4ZAKB 1Y0LB 2BOCA 1QLEH 3EDKA 1OP3K 3GI9H 4WFHD 2YN5A 3CZFB 3IETB 1CLZH 1KIPB 2W92A 4WI8A 1LNUA 3RTQD 3BE1L 3ARGB 4KTEH 4H25A 2FRGP 3AAZB 5CEYB 5CJXA 2IH3B 5CZVH 5F89B 4U2YA 2FYYB 4M8QA 5E2UL 4MQXD 5HHPA 3RHWK 1DE4B 1I7TA 3QXAB 2Y9RT 3VFOA 4YHNB 1VFOA 4X6CE 3FMGL 5INCB 4V1DB 3HC4L 1QBLL 3CX2A 1A7PL 1DSFH 3BE1H 3HPLB 5EUKA 5CLWA 3L3IA 3GSNA 1YJDL 3MLUL 3V5DA 1TZHA 1QFPA 2I5YH 3S3SA 1JUFA 3HR6A 1MJJA 3G9VA 1NFDF 3QFJD 2X05A 2CDFA 3IDIA 3FQRA 3KNBB 2YBRB 1OAXL 4WI2A 1AXSB 4GJTB 2WMPA 3IFLL 4HIIB 1QBLH 4LP5A 1A7PH 1UA6H 3X3FL 1YJDH 3MLUH 3TN0C 1WWAX 3ULUE 4P57B 5GRJH 5GGTL 3IDGA 1I9RL 4PJ9D 2ENYA 1R3KA 4F80A 3GMNA 2PYFB 2ZSVB 1OAXH 1TMCB 4N0YH 2NY4C 1NGZB 3X13A 5ENWB 4KRNA 4CVXB 3X3FH 2HLFC 3AFLA 5T1KA 3TNNB 5D1QB 4EJ1C 2BNRE 2XZQL 3IU4H 1WIPA 3HI1B 3HZKB 5GGTH 4Y16D 4R7DB 35C8H 5DQ9B 1TXKA 1BZ7A 1RZIB 3KHOA 4F7MA 4PJIA 1JRHL 1LEGA 5DJ0B 4IMLA 4LF3B 3SE8L 4CVZA 3VXNA 3TBWA 3EYUL 3BO8A 3PHQA 4GW1B 4IRJC 4NQTA 4XZUB 4X7SL 1PYWA 2ORBH 2VLRE 2XZQH 5K9KA 3NA9L 5T1LD 3V6OA 3T77B 3B9EA 5GRWA 3VXUA 3SE8H 3IXTA 4OIAA 3A6CL 4MAYD 1ORQA 4KRPD 1DVFC 1NCAH 2XN9A 3BSZL 1J1XL 3T4YA 1A4KA 4LSDA 3O6LL 4RAUA 1T04B 4M3JA 3OTTA 5EC2A 3LN9A 5HHNA 4P2RE 3MLVL 3NPSB 3S98A 3MTRA 1RJCA 2QSCH 4WO4C 3VDCA 3WKNA 3HG1D 1XFPA 3VXQB 2Q7NA 2NY0D 1KIRA 4Y19B 4HEPG 1I85C 1DQJB 3MLRL 3G08B 5BS0E 2ILLA 3MLVH 4PTUA 1KEGL 5F7EL 2PR4L 1A9BB 1XH3B 3P0VL 1MI5E 3T0VA 5MENE 3MLRH 4MXQC 4NC2B 2FECI 3RL1A 4B0MM 3Q6FA 4PRPB 5JMRA 3MREB 2LABA 1QRNE 4PV9A 5F7EH 2PR4H 2EDBA 2VLLB 1XCTA 1QO3B 3P0VH 3TIEA 1NANI 1P4IL 4PRHB 1RZJL 4HUUA 5JQHC 2BNRA 4L29A 4XMKH 2YD9A 1J9CT 2GSGB 3PHSA 1Q9WB 4NQEB 1U8PA 1QUNA 2P44B 4Z78B 1OD9A 1RZJH 1Q94A 1B6DA 1D5BA 1IM3B 1MEXH 2ITCA 4MD4A 3VWKC 1HSAA 5C2UB 1QVOA 4U3CA 2VLRA 1MCQA 2LU7A 5CILL 5IT2L 5FO9B 2Q7YB 5IEKB 3CCHB 5F93C 3CFIC 2X7LB 4UDUB 2QKIA 4TULH 1PEZA 3IF1A 1ZA3B 1N5AB 3MJGX 2EKSA 1A1NB 1XIWA 4LDOB 3L3OA 1TPXC 1J8KA 5L2JA 1WBYB 4TVPE 1MUJA 1UYWL 2KZ1B 3I6LE 5IK3A 1BMGA 1TJHL 4OM0L 4WRLA 2VC2L 4WHYH 3LRSB 3PWPD 1JIBA 4I48A 5E70A 3RAJH 3WS3B 3CDCA 2DJSA 1B3JA 2BX5A 4JY6B 1XGRA 2BSRB 4P2RA 4XNMB 1DDHA 3IDNB 1UXWA 5F1KC 1EAPA 4NQVB 5JORB 5E8NA 5CKGA 4E0RA 2VO5A 2VC2H 5BMFL 4U0RC 3LRGA 2X4NB 4S11A 3OXSA 5L9DL 3EGSA 1EO7A 5BS0A 3VFMA 2PTTB 4JEGB 2BSTB 3D2UB 4QRTB 4NO0A 5D7LD 5FOBA 2H9GB 1XZ0B 3MRNB 4O51A 4V1DD 1MI5A 2X4RA 4Z7UE 3QNYA 5HBBA 2EYRB 3DRQA 5D9SA 1JWSA 2ZCHL 5E6IB 3DURA 3A0OA 5L9DH 1WBXA 4NN7C 1ZA6B 5H35B 4NM8H 1QRNA 2NXYC 5I71C 3DXAB 3DGGB 4G6KL 5FYKE 5GRZA 3X11B 4TVSa 1NEUA 4D0CB 2UVFA 4BQCA 3W5MA 1QA9B 1DUYB 4PYHA 1BOYA 4LLUB 3GSXB 2ZCHH 4J3OC 5K9OB 4GAJL 4JQXC 3BP6B 3KPRD 1YEEH 1F6LL 2GEEA 2CUIA 4G6KH 5F7NC 4L9LC 4Y4HB 3OKNA 4D3CL 3O9WC 5D1QD 4J1UB 1T7YA 4NQUA 4AM0A 2YMXH 3L3GB 2EE9A 4GAJH 5EORL 3VG9C 4Y2DA 3SY0B 4XWOD 4X0KB 2I9LB 2XACC 4G6AC 3VRJB 5DJZB 5J11B 2HFFB 4K3EL 3HLAB 4N90D 1INQA 4XNZC 1ZLVH 1T20B 1LEIA 3ETBF 4ISVB 5EORH 1TTGA 1ZSDB 3GMQB 5IW1A 4Y5XA 4ODXA 1MJ8L 5F7DB 2GJ6D 4XPHH 4ZPTA 5E9DD 1QHPA 4MA1B 3IFOA 1RK1A 2DYPB 3IKCA 2W60B 1B0WA 3QH3B 4PB0H 5DF0A 3KLSA 3IDMA 2EEDA 1MJ8H 4D9RD 3SDDB 1JWUA 4HMDA 1NJ9B 5DS8B 5HDQL 3HS0A 5KTEH 2R29H 1NKOA 3K0WA 3N06B 4XT1C 4RA0C 4NO2A 5I1DB 5F7KC 1PD6A 4N9GA 4KDWA 4CDGC 4KKAD 3TN0A 4HUKB 5F1IB 1KB5B 3ZE2E 1K5NB 1YQVL 1VEPA 4P3CH 4PJCF 4WFFE 3PWJA 2XFXA 2XKNB 1DANU 3BUYB 5HDQH 1U8IA 1NCCL 5HYQB 2Y5TA 4Z7UA 5AYUH 1HKLL 1VGEL 3PABB 5CWSA 5HPMB 4U1KB 1JN6B 1NFKA 4P9HL 3QUKB 2A77L 5HD8D 4LLWA 1S7RB 5LG1A 1F00I 4YDVB 3D69B 4YO0B 1HXYA 1YQVH 5GZND 1SVCP 1NCCH 1AH1A 1OQOA 3X12B 2I60H 1U58A 5E8EB 1VGEH 1FNFA 1HQ4B 1OT2A 5JOPD 4ZUWB 4XMPH 2HVKB 4PRPD 3TBSA 5GJTL 4MVBC 2BP3A 2A77H 2HTKC 2P43B 2FIRT 3P0GB 3REVB 1IAKB 2JCCB 4ZUUA 1MJ7L 2R0WL 2FBJL 1JHKL 3ZYJA 5F6IC 5SX4H 4F7TB 1K8IA 4WW1B 3MA9L 2NY1B 4QNPE 4FXGA 2J1KA 3REWB 5GJTH 1VACB 2DTSA 4TYUA 5JO5B 5C0IB 4HS3B 3SPVB 1JMXA 3KS0J 4PJ7A 1N8ZA 1HWHB 2LU4A 4NQED 1DVFA 1Q38A 5F8QC 1MJ7H 2R0WH 4J3WA 1U2HA 1PG7X 4R4BB 4PBXA 3K8MA 2FWOA 1BBDL 1MJUH 3EDEA 3MA9H 1ZHLB 2F8VA 4KI5F 1AO7A 5D7IB 4NIKB 4GUPA 1MCPH 2W91A 3MROB 2H6PA 3PGFL 4NKDB 2DQCL 1WICA 4WO4A 4HBCL 3H3PH 5MHSE 4I77L 3T0XA 2A6IA 1I85A 1MH5A 4LSUL 1GHFL 5MEOB 1WV7T 1F58L 1U8HB 4F37F 3SQOL 5JHDD 2IEPA 4Z0XA 5IVXF 3HE6A 4MA3B 4FXKB 2JE8A 3U9PL 4KZEL 3N1GC 4HBCH 4YFDB 4G3YL 4DK3A 3RVTC 3O4LD 5DQJA 1H3XA 1PGRB 4LSUH 5I6XC 1GHFH 4X4XA 4J6RL 5IEHA 4G43B 3IB4A 3I2CL 2IADA 3SQOH 1R3HB 4JB9H 3ZKXB 4TNVK 1UWGH 1AHWB 4MXWL 5FIEA 1P1ZA 2V9QA 2CKBH 3IVKA 3U9PH 4XVJL 3CFJB 1RHFA 1KGCD 1I4FA 2WBWB 5IVOA 4HJJH 4G3YH 3W11D 3HZVB 1FORH 4RMUA 3MRJB 1YN6B 4L8BA 4LEOB 1Y18A 4LNRB 1IEBA 1FNEA 4JM4L 4KHTL 1DBMH 3B9KD 1RIHH 3D2UD 1AGDA 1WT5C 1TVBB 5CSBA 4M61A 4XVJH 3QDGB 3WIHA 3T2NL 2AXGB 5K9QI 1D5ZB 1IBGH 1RAMA 4GBXA 3ZYZA 2DQDL 3B5GA 4HIXL 2MPAL 5E6ID 4RGNB 5I1AA 5LBSL 3UTSB 4JM4H 2DJ4A 1CXKA 4KHTH 4WTZA 3VWKA 4APQB 5I66A 5JW5A 3KYAA 1EH9A 3D5OF 2DI7A 3STBA 4ETQA 2EEAA 4I9WE 1S7WB 3L5WA 3OSKA 5FA3A 2MPAH 1UH4A 1TVDA 5AUMB 5LBSH 3AXLB 4HKJA 3L3HB 2VQ1A 2R23B 4XP9L 3ZL4L 2OI9C 2YA1A 5GZOD 2P48B 1MAML 3MLZL 4Y4HD 1UACH 1A21A 1KNOB 4P5KA 4X4ME 1IKNC 1KIUA 3CK0H 3QIUD 3KLHC 3MV7A 5A2JH 2WP3O 2IQAA 3V8OA 3VFNB 3WUWG 1LHZA 3MLWL 4EKXA 4XP9H 3ZL4H 2ATPA 2VR5A 3AB0B 3KWWB 3AU1B 3NACH 3U9UA 5JDSA 1MAMH 3D3VD 1DTUA 1ADQL 3CDGB 3MLZH 3DV6A 3VWJC 3JUYA 3FHQA 2VABB 1FYTB 1HQRB 1X5IA 1HNFA 2FJGA 4X98A 4X4YB 4UU9A 3VDAA 2O61B 3CH8A 4NKIH 3QDME 4ZPVA 3RI5F 1DQTA 2XQBL 3PDOB 1ADQH 4MWFB 5FYJU 4JREC 4TPRL 3RVUD 5JOFA 2DYPD 4FQJH 2E8ZA 5CIPH 1ACYL 4KUCF 3WXWL 2BY3A 5DUBB 1G9ML 6CGTA 2EXYC 3TV3H 3WEXB 1CDGA 4M7LT 2VITB 3SDDD 5H2BB 2AK4D 2XQBH 1I7RA 5D93C 2NY2B 4K7FB 3BH8B 2YZ1A 4HGWA 4Z8FL 3GMOB 5C8JB 1BIIA 1MOEA 4LRNL 5DK0B 4UDTA 2NW3B 1KPUA 4JQXA 1EEZA 3EJZC 2X4UA 4PJ8C 1OWRM 4ZFOL 1MF2L 5DJXB 3BD5A 4K94C 2EDJA 1IT9H 4L9LA 1W8NA 1I1AD 5E4EB 4WU7A 4YDLB 4OF7A 4Z8FH 3O9WA 2YWZA 4F3FA 1U8LA 3W5NA 4XPFL 2A6DB 4LRNH 1V5JA 3U46B 4PGEB 2E8YA 5I76B 4KJWC 5GSRB 1TQCC 4YZFF 2HAZA 4DKFL 4X6BA 1MF2H 3GMRA 4K8RL 1LE5A 4X6EB 1W0YT 1KT2A 4WHYG 3S8WA 4TSBL 4NHUA 5GS0L 3VGEA 1FVCA 4OD2B 4XPFH 4WW2C 3OJDB 4UQ3B 5BO1L 3T2QA 5KVGL 5B39A 2XTJB 5FV2A 2W38A 5DEFB 4DKFH 4EVNA 2NY1D 2FO4A 4OAWA 4TSBH 4PLJC 3C87A 1S7VA 1GGUA 1XAUA 3QIWA 5GS0H 4N8PA 4YIQB 2X40A 5BO1H 1VDGA 2VLMD 1XF5A 4XBPB 4ENEC 4RSVA 5IP4A 4NWTH 5DD6A 5BXFB 4P2YA 1HH9A 3NIGF 1D9KC 1T22A 2VIRB 2ADJA 2P8PB 5E1HB 1UCBH 4OLXL 3WXVH 3GUTA 1K8DA 3OGCB 1YNTB 3ARDD 5FUOL 5DTFB 1CICC 4Z0BH 1JHLH 4RDQG 3DUSB 2ICEB 1E27B 2ZPKH 2E7HA 2FGZA 4U1NB 4ZFGH 2I27N 3S5LG 4YHIB 5E4IA 1AGBB 4OLXH 1XGPB 5J12C 3LHPH 4X99A 5H8DA 4F9LC 1IJ9A 1ND0B 5DRXB 3N1MC 5ACZB 1MWAL 4M7ZB 4D2NA 3CJJA 1NLBL 3Q5TA 2R15A 3K4ZA 3W9DB 2GI7A 2F8OA 5BZDA 4GRWH 5KSBF 1OAQL 1UB6B 2X1XR 4PRDA 3SKUD 1IVLA 2EIBA 3ARXA 1MWAH 5GGRA 1E4WH 4PJ5E 4K23H 1CL7L 1NLBH 4Z7VB 4L4TA 1NMAL 1OSPL 4LCCB 3GB7B 2RFXB 1BFSA 5E5MA 1YEDB 1P7QB 3DTXB 3NGBB 3MXWL 1OAQH 2V2TB 2ICWI 4HWZB 3WFHB 4CMHC 3FKUS 4HF5L 4LLYB 3QDGD 2NY5C 2X4PA 2VRAA 3CX5J 5I73B 4JFYB 3V4PL 1CL7H 2W65A 4OGYL 3DO3A 4CMMB 1YPZE 1OP9A 3UTSD 1MCIA 2OTWB 1X5FA 4JGUA 1ZLUK 4OCWL 4TRPL 2E5EA 4G8FB 1G7PA 5I8OL 2NMSA 3UTTB 5DO2D 1WUNT 2VR9A 4HF5H 4L8DA 4QHLB 5HGDB 1EEQA 3JWNC 2F19H 1A3RL 4H1LA 3V4PH 1YN7B 5C0AB 3T4AA 3K46A 4EDWH 4WFEE 5A2KH 4ZS6D 1G7MB 1MCEA 5DK3A 2APWA 3P40A 1Y6KR 1OT1A 4OCWH 4TRPH 3QG7H 4JO2L 1DZBA 1F4WL 3LN4A 5JUEL 3HC0A 5HGAA 3UYPA 3DBXA 3KLAA 5GRXG 4JRYD 1UH3A 3DX6B 3NCCB 5EO0A 4DUWA 4WHTA 4POUB 1D6EA 4PRNB 1OY3B 4JO2H 4X7DC 2UY7A 3VFRA 1UJTA 5JUEH 4L8CA 1BF2A 4FFVC 3CU7A 4PJEA 3T3MF 1FYTD 1M6OA 4YJZL 1EHNA 3TBYA 1X4YA 4R90H 3P4NA 3RKDC 3C5ZC 4R97C 5TFSL 1WT5A 3CH1A 1H3VA 3OGOE 3QDJB 3RIAK 3RQ3A 3TWCH 3CX5K 4QOKD 3MGOB 4BK5A 5JMOC 2H1PL 4JDZB 2IBZY 4WI4A 2XG4A 1A5FL 2VISA 1Z3GL 3NN8A 4LPXA 3K4DA 3VGDA 4BZ2L 4XP1L 1KCRH 4DKAA 2Z8RA 3GM0A 4YGVB 3SDXB 3CVHB 5TFSH 4JVUA 1DQLH 1LEKA 1U3ZA 2NY2D 2DM2A 4PJFE 5E2VH 1FO0H 2C1OB 1FL5A 4FFWD 3QZWA 2BCKA 2H1PH 1LK2B 2BNQB 1PZUB 5DD3H 1A5FH 2IC2A 2IJ0C 4FABL 5ANMB 4PP1D 3O11A 4BZ2H 4XP1H 5FXCH 1MVFA 5D6CA 5DJAA 5GRVK 2X9WA 4H88L 1EV2E 5KVMC 1M71A 4M5YH 3WUWB 3QJFB 4HH9B 1OAKL 4R4ND 1IZJA 1BWMA 1Q72L 2HN7B 2EIZA 5L2KB 3BXNB 1KIQB 1YPZA 2NYYD 5IKCA 5CGYC 1U95A 3RZCD 1MFAL 1K85A 5F9OH 2XNAB 4H88H 4NKMB 1TVHB 4LHUG 4GG6A 2NZ9C 2PNDA 1PQZA 1OAKH 2FIKB 3QRFM 3EFFB 4UV4L 2Q8AH 3VWJA 3MRKA 1LE9B 2OL3A 4HZLB 1T1ZB 3WIHL 3Q3GA 4D9QE 2G5BA 4P99A 4DZ8B 1XGUA 4PJAB 2GJJA 5H37G 5MI0B 1MFAH 3JV6A 5CP3A 1JYVA 5E94A 1D5XA 3BKML 1NAMA 5IM7B 4HGKC 2VOTA 3U79A 2VR4A 3K4AA 5IGXL 1FSKB 2W0KA 3TFKD 1BX2B 2C4FU 3ARZA 4V2CB 1IAMA 2DQFA 3ET9F 1UZ8B 1FZJA 1FVDA 1F5WA 4RNRA 4E41A 3TNMB 3LEYH 5F9JB 2AKRA 3AM8C 3DO7B 1TTUA 2NY3B 1UKQA 5DJ6B 5C0JB 5IMLA 2OMNA 5IGXH 3VFUA 2HTLC 1T7VA 3PUCA 3K2UL 3LDBB 1PY4A 3CLFL 3L1OL 5C0FB 4XRCA 4NQDD 5HVHB 3K8KA 4PJ8A 1U42A 4KH2A 2R0ZH 4F15B 5A2FA 4PJDB 2H26B 1S7UA 4GRMB 3UZEA 4M5ZL 4Y4FD 3MJ9A 1MCDA 3SKMA 4BKLA 3RFZC 3L1OH 5I1KL 1BWWA 3SKOB 4N5UA 1ONQA 4GLRI 1Z9MA 5DUML 5C08E 1FZKA 4NZUH 3RPIA 3ZSSA 1U8OA 4WW2A 4LLMB 5HYJD 2CJUH 5HHME 3U36A 1J05B 3KPPB 2ZUQC 3CVIH 1EERB 3OR6B 5GISL 1HH6A 4PYGA 4MYWB 3LS5L 5DUMH 1P7QD 2JB6A 2H8PB 3O3AB 4HD9A 4LBEB 4Q6IC 4PJ9C 5EUOF 4MNQB 5GISH 1ODAA 5LGKA 1SBBA 4KROC 2QR0A 4PFEA 2B2XL 4Q9CA 1D9KA 4UNVA 1VFMA 1HILA 1KPRA 2DQJH 4IOIB 2JK5B 3S34L 4TNWK 3VD3A 3S5LB 3F65A 2Y36L 3QO1A 4ODWA 5KSAB 2GSIB 1CICA 3NFNA 4MJ5A 3HI6L 1WCBA 3BZEB 5C0AD 2IFGA 2BOBA 2F9BT 1H8SA 3QIBB 4UINL 4YPJA 4RFNC 4HWUA 1R5IB 4YBQD 3S34H 2RAMA 1RU9L 5JIKA 4LASH 2WW8A 2F53E 1NGXB 4F9LA 4UNUA 4HSQA 1JZ3A 1QFWL 5DJ2A 1INEH 4KXZH 3HI6H 3SGDH 5AD0A 4Y89A 2UWEB 4UINH 5BVPL 4H8WL 4I2XB 3PXJA 1TITA 3WDJA 4HHAA 1R5VA 5AAMA 1RU9H 1RURL 3EFDL 5I0ZA 1A22B 3ZE0F 4D8PA 4OQTH 1S9XB 2VL4A 1QFWH 2YPLE 3OF6D 1KLGA 1FIEA 3VA2C 3RWHB 1QP1A 2OP4H 4XGZB 2FL5A 2YA2A 4LVEA 5DI8B 2E6PA 1HXMA 4H8WH 5BVPH 1OGTB 5C0CE 5FECA 3MUY1 5D1XB 5DD1H 2CIKB 2D0FA 4LKXA 4YXHL 4GG8B 1RURH 4HDIB 2UZYB 3QDJD 5IBUG 3BD3A 1KOAA 3VGGA 1JV5B 1ZT4A 4ZXBC 2NY0C 4QKXB 3VXMB 5B21A 5C08A 5FOJA 3Q2CA 3V8CA 1U8KA 3QEQE 2Q87A 1YY8A 4C55A 3FZUC 4YXHH 1B88A 4DOHB 2LU3A 4WNQA 2DD8L 5IBLD 4OI7A 2BNQD 5MERB 1HHKA 3LKSB 1F45A 2FHBA 5HJ3B 3T2PA 4J23A 4BSWA 5EOTB 2K7QA 3ARBC 3ARFB 3UJIH 3ULSA 4FQLH 2V2XB 3OHXB 5CKAA 4FZEL 5L2KD 4XC1L 1VKXA 1GJIA 2FLRT 5KS9F 3FT2B 5I16A 2JJWA 4ZFFB 4JFOA 3QISA 1I8MB 2X4QB 5IB4A 1IGMH 4Q9QH 2AJSL 2ATKA 2ZOKA 1HIML 4ODUA 2VDRL 1LNUB 3G04B 4FZEH 3NZ8B 4YE4H 4D9LH 5E6YA 4U1MA 1SYSA 4XCNA 3MR9B 4KZDH 3MJ8A 4M8QB 4LGRB 4G8GE 5HHPB 4JHBA 5FHBL 4JQIH 2APXA 2M8XA 1NGPL 1V8HA 2WQ8A 1TJGL 3C5ZA 4NUGH 4XNXL 4WFHE 5EWIL 2IQ9L 1HIMH 2VDRH 3L3IB 3GSNB 1YMHA 3D6GA 1TZHB 3KXFA 5KAQG 3C09B 1NGQL 4PG9A 5FHBH 1OF2A 1INDH 1JUFB 1MIML 5HI3D 2D03L 1IEHA 1MJJB 4DAGL 3AVEA 1S7SA 1DBBL 1TJGH 3DSFL 4MCZA 4NBYB 2CDFB 4XAWL 3IDIB 3FQRB 5J6GB 2IQ9H 3HMWL 2D7NA 3WKML 2NY3D 3UBXG 1TZGL 3FT4A 4R8WH 1FNHA 2K7PA 1VERA 1NGQH 3IDGB 1ITBB 5EG6C 3UPCA 1J0IA 1T6VN 2D03H 5F7LB 2YD6A 1RY7B 1R3KB 4LCUA 4YHYC 4XAWH 5A3ID 3QFJE 2XRAH 3HMWH 3WKMH 3X13B 5FYKU 2JTDA 1GC1C 4LHUB 4M6ML 1MCSA 4WWID 4ZDHB 3ZDZE 3V79C 1NDMB 3VH8G 1RHHA 4LVNB 1G84A 5FUCC 3NH7L 1MPAL 4D0BA 1IAII 4IMLB 4CVZB 1W72L 3VXNB 1E4XL 4HC1A 3TBWB 5I8KH 3BO8B 2OSLA 3PHQB 4H20L 1PYWB 4M6MH 5K9KB 5JQ6H 3VJ6A 1IZKA 4UBDD 1ULVA 5DHVA 1Z0NA 5CEZD 5LCVL 1G6RA 2APTA 3B6SB 1QHOA 3F6LA 2BVEA 3VXUB 3G6AB 1E4XH 5HPOA 4NC1E 5FYJH 4ESKA 3IXTB 1SJVA 4H20H 3ROOA 1ORQB 2Y23A 1NCWL 5I9QC 5J4MA 3ILPA 4M93C 1LVEA 2XN9B 5LCVH 3MLPA 2GIYA 1ZK9A 2DL9A 5CBEA 1A4KB 5GSVA 1S7QA 1T1XA 5C0ND 2R1XA 3GBNL 3OAUH 4R6UA 3GEWB 5EC2B 5JLZA 4OZHA 3AM8A 2X41A 4ODSL 1JI1A 5HHNB 1OVZA 3C8KB 4DQOL 2H2SD 5KSAD 1J7VR 2ZNXA 4MJIB 1W2KT 4XWOC 3B2UC 4BQ6A 4HPOL 2A9NH 3QQ9D 4JFXA 4P59H 4A2LA 1KIRB 1FFRA 3QIBD 2QL1A 3ECBA 2J5LC 1T2XA 3DROA 4GQPH 3GBNH 4X6DF 5BV7C 1F97A 2HH0L 4P23B 4OLYL 3IGAB 5HXMA 2W0FA 4G8EA 3UAJD 4JDTL 4PTUB 4DQOH 3OKDA 1MFNA 1UKTA 2XWJB 2R1YA 2BRQA 4Y2OA 1IAIM 2Z8VC 5DZOA 1MRCL 2XTLA 1YY9D 3LSOA 5CJQL 4OTXL 1KCLA 2HH0H 1GGYA 4OLYH 5CGMA 2FGWL 3RL1B 3Q6FB 1T7XA 1PSKL 2VSCA 4NO3A 5C1MB 3DX9A 4Y8AA 5DJDA 3ZYOA 4JJ5A 1CIUA 4KMLB 4HMEA 1G9NC 4HPYH 4DCQB 2EECA 4U7KA 1XCTB 1C5CL 3GKZA 2QSQA 3TIEB 1WAAE 1KB9J 4N0FA 4ODVL 3RX5A 1MRCH 3QI9D 2CSPA 2VN7A 5CJQH 4OTXH 2EE6A 4HUUB 5K33A 2N4IA 2IAMB 5D1XD 2BNRB 3OWEA 4L29B 1Q9KA 4NN6C 3O81A 3ILQD 4KKAC 3GRWL 2OMBA 4QRSB 5IQ9A 4KU1A 1YEJL 2ZUXA 4KHXL 2J8UA 2MQ0A 1U8PB 4PJ9A 3L5XL 4ODVH 4ODTL 1Q94B 4GMTL 1D5BB 2ITCB 3EO9L 4MD4B 4JLRA 4PUBL 1MHPH 1HSAB 2WWMD 3C6LD 4JRWA 3F7VA 2VLRB 3GRWH 2IMNA 3WMSA 1FG2A 4Y16A 1VEMA 5FUZL 1JPST 2BVQA 4PV8A 1YEIL 2DICA 2QKIB 3LMJL 3IF1B 3L5XH 2YKLL 1Q9OA 3MRCA 3LRHA 3QPQC 5C71A 4G8IB 3H7BB 4GMTH 1XIWB 1DLHA 3L3OB 3EO9H 2F58L 4BJLA 1DN0A 3BESR 5L2JB 1OARL 1KELH 4K71B 4S0TD 1WIUA 3ARFD 3FCTA 4PJXA 1JF1A 5IK3B 5FUZH 1F4XL 4IOSD 5HI4C 1YEIH 5F7WC 3LMJH 2YKLH 1QR1A 2RB8A 4U1LA 4Y4KC 4NRZB 1A6TB 3V4VH 4Z7WE 5C0GB 2F58H 5EBMA 1OARH 1J0KA 1XGRB 1ZTXL 4MAYA 4OV5A 1ZT1A 1JZ5A 1AY1L 5LGJA 4KI1A 5LAXA 1EAPB 4KK9D 1OLZA 2DN7A 5E8NB 5KBNC 2XWBA 3QCVL 2JELL 1O0VA 4OLUL 4MB3A 3PWPE 4P2OC 1KB9K 4A6YL 4J7RA 5C09D 5IBUB 5TH2A 1U3YA 2EZ0D 3BP4A 3EGSB 1HHGA 1WLHA 4K9EC 4P3WA 2AJVL 7FABH 3HE7B 3VFMB 1BFVL 1BQLH 2R4RL 4NO0B 2XQYK 1N59A 4QXWA 5FOBB 3DX7A 4MA8L 3QBTB 3QCVH 1MI5B 2JELH 2X4RB 4OLUH 5I75C 3QNYB 3BGAA 1N26A 4A6YH 4ZXBA 5D9SB 5CINL 1JWSB 5T1DL 2AP2A 1IC7L 4LQFL 4RIRA 2AJVH 1DANT 3PV7A 4TN9A 2Q86A 1QRNB 2AXFA 4XPTH 1BFVH 1AGFA 5SX5K 3V0WL 5D7LE 3J8F7 5J57B 3BP5B 3FQWB 4MA8H 3V52L 1WAAA 4V1DE 1J88A 1CDYA 3BWUC 3QCUH 1DBAL 5EOQL 2QSTA 4I3RL 5DWUH 1MHEB 1IC7H 4X4ZA 5D5MA 3HUJE 1ETZB 1QACA 1MCLA 1KCKA 1XF4A 1AC0A 3P73A 4UOW0 4QF1A 4N1CA 2ITDA 1F4HA 3M8OH 3ARBA 3W11C 4CN6A 1VADA 3OKNB 2AEQH 4ZTPL 2ADFL 3U2SB 4JPIA 4LHUD 4AM0B 5EOQH 2DIJA 4I3RH 2ADGA 3B9KC 4FZ8L 4Y2DB 3KPRE 3DIFA 3ARUA 4YEEA 4EQ3A 5DSCA 2QEJA 2X5PA 1UZ6E 4FQIH 4RA3A 3ALPA 4GRWB 1CGTA 1AD0A 4ZTPH 3BAEH 2ADFH 4Z7OF 3OX8A 1INQB 2BVYA 5GS2H 1LEIB 1EZVY 1MFCL 5F7FA 3SDCB 5IUSA 1MWAB 3QUML 5IW1B 3I3EA 3PDDA 4ODXB 3NABL 3F62A 4IM8A 3GJEB 4IJ3C 4ZPTB 4WWKD 4PJGF 1F6AA 5B39G 2ERJC 1T5WA 3IFOB 1XCQB 1RK1B 4N90E 1BREA 1BQHG 4F57H 3C2AL 3H8NA 1LO0L 3QUMH 2XN9D 2Y4SA 3UBXB 3H2WA 2JB5L 5IIEB 4JDVA 4B50A 1JWUB 2GJ6E 3MZTA 5E9DE 3QIUC 3LKQA 3H0TB 3PWPA 3MCG1 4HWNA 2F5AL 4CL7A 4NO2B 3QRGL 1MAKA 1R24A 1EGJL 3ZKMD 3JTTA 3C2AH 4I8DA 3TN0B 1Z9LA 1FLTX 4MJID 2ZUUA 1FE8H 1LO0H 3CFDB 1Y0LA 4L3EB 3NTCL 2R2EA 4NM4L 3TO4C 3LQMA 1EO5A 1SEQL 4O00A 5E1AA 4D9RE 3VH8B 2Y5TB 3M1BA 4HCRL 2H32A 4P23D 2GFBA 1T66D 2VDOH 2OXGA 2IBBA 3AAZA 2NY4B 2F5AH 1WQVT 2W59A 5CWSB 3PF2A 3QRGH 4AENA 4NRXA 1MLCA 3ARPA 2QSVA 2FYYA 1EGJH 5FGBC 5K59E 3EOBA 4NSKB 1DE4A 1YC7A 3VI3F 1HXYB 5D7LA 4YHNA 3RVXC 1GAFL 1B9ZA 1U58B 5INCA 2Q3ZA 4HCRH 2DI8A 4OZIF 3ALXA 3TBSB 4IRJB 4R0LC 3JVGC 3HUJA 1VFUA 4RRPG 2HFEA 1JF6A 4ZUUB 3LN5A 1FNAA 3F7QA 3WO3B 2BRRL 2J8OA 2YBRA 1K8IB 5B38A 2IAMD 1M4KA 5JOPE 2XXMB 4PRPE 4JKWA 5IMOA 4NRYA 5JW3H 3KPRA 4PJ7B 1N8ZB 1NBVH 5DVLA 3GMLA 2BRRH 4X7TB 1BLNA 3U1SH 2PYFA 4M8VA 2ZSVA 2FWOB 2J4WL 2VDML 1I1AC 1OLLA 5ENWA 3JWDH 4KKCD 1M1SA 4P46D 4EUPH 1OOAA 1J1OL 1AO7B 2VLRD 3OB0H 3DYOA 1FBIH 3HZKA 2Y06L 4GUPB 2H6PB 1T2JA 4CJ0A 4R7DA 2PTVA 4NQEE 4WO4B 4AZ8A 1DJSA 1RZIA 1XIWD 2A6IB 2J4WH 2VDMH 3T0EC 2R69L 1MH5B 1NBYB 1ZXQA 4ELMB 1SJXA 1ZHNA 2Y06H 4H1LG 8CGTA 3NBNA 4Z0XB 1JP5A 2P8MA 3ZTJG 3BKYL 3T77A 2DL2A 5DD0L 1U6AL 2GJ6A 5E9DA 1OPGL 4XH2A 4XMLL 5DQJB 2YUXA 2R69H 1J1PL 1RMFL 2YOCA 5IEHB 2IADB 3MCLH 2JIXD 3A67L 5JHDE 1T5XA 1ZLSH 1P1ZB 3BKYH 3B8YA 1R0AL 4YQXL 3IVKB 4KVNH 2AJZB 2Q8BL 3DVGA 1I4FB 4L8BB 3O4LE 1T0MB 1Y18B 4K7PL 4XMLH 5E8OA 1FFQA 3J7HA 1J1PH 1NMBH 3MX0A 1IEBB 1FNEB 3HE7D 2HT2C 5F1NA 3ARDC 5IJKC 3WNMA 3RY4A 4JJHA 4K8RD 3R06A 1VA9A 5TDNB 4YQXH 4M61B 4DN4L 1BVLA 1P84K 2Q8BH 5BOZG 1KGCE 1DQJA 2QHRL 4K7PH 5GRYA 4YH6A 4N5EC 3VWKB 5I66B 5JW5B 1KULA 2EDQA 5FYLL 2IPUG 2EH8L 6FABH 2A74A 4DN4H 4ETQB 2W9DL 4ZSOA 4GKZA 4UOW1 2FEEL 3RVWD 1YNLH 2JJSC 2QHRH 5FO8A 2D31A 3BZFB 4UZGA 5L6YH 4PRPA 3VD5A 4E5XA 3T1FA 1TPXB 1AQKH 4PY8J 1H3PH 1WITA 3EYQC 4LDLB 5FYLH 2MKLC 2V9TA 1X5HA 1LWRA 2W9DH 4O9HL 1BM3L 4S10A 1NCBL 1OW0C 5D2LF 3MV7B 5B3NA 2EDHA 2FECL 5TQ0L 3O6FC 4Y4KA 4Y2DD 2L7UA 2ATPB 4HUXA 4M48H 3BKCL 4S2SB 3UTPD 1JK8A 3U9UB 2ARJA 5JDSB 4NQEA 5C2BH 4O9HH 3DV6B 4OZGF 4Z78A 1TNNA 4U0RB 2WIMA 5EA0H 4P2OA 1EJOL 1X5LA 5TQ0H 3SDCD 2FJGB 4ZYKA 4LGSB 4UU9B 3UO1L 5M95B 3BKCH 1CDUA 2Q7YA 3GSOB 4ZPVB 4TOYH 1KJ2L 3WE6A 3D3VE 3OXRA 2IANA 4YHLL 1AP2B 1NANH 1N5AA 3LQAL 1A1NA 4ZS6C 4XB8A 3HAEA 2CIIA 5BRZA 4LU5L 4NN7B 3OB8A 5JHDA 3UO1H 2NXYB 4NGHL 5I71B 1I7RB 4JFHD 4RMQA 1KFAH 4HGWB 3MLYL 1K9TA 3LQAH 4PRAA 1BIIB 3O4LA 4WUUA 3EBAA 4ZMAT 3FAWA 3BWAA 3KJ4C 3UYRL 1LP9B 1X5GA 4YC2C 1LD9A 3TN0D 2XYCA 3NCJL 4WI3A 4R9HA 2Q1EA 3GSVB 4L3ED 1KJ3L 1JGVH 1EEZB 1I3VA 4NGHH 5I18L 2AK4E 3IDYB 2ZG3A 2X1QA 4M6NL 4TVPL 4L9LB 4F8QA 2NY4D 3KYOA 3MLYH 4NWUH 4WU7B 3S35L 5ESAB 2HLFD 3O9WB 3UYRH 5C0EA 5FA4A 3EDDA 3TYGH 3NCJH 5BQ7A 3B9KA 2BSTA 1OCWL 2B4CC 3VG9B 1KJ3H 5GJSL 2PO6D 1A6ZA 4W6WB 5KN5A 4GQ9H 1GOHA 3MRNA 3B5HA 3GMRB 4M6NH 4TVPH 4XHQA 1LE5B 1KT2B 3GHEH 2YK1H 2BXYA 4GAGL 4RGOL 3S35H 3I9GH 4IRJD 5SV4A 4IHOA 4NHUB 4NZRH 4XNZB 1MCNA 5B39B 4WY7H 5HHOD 3PL6B 5GJSH 3DUHA 1DBKL 4HUVA 5IESL 1BQHB 2DKMA 1Q1JL 4EVNB 2FO4B 4GAGH 4RGOH 1QA9A 2DDQL 1LQSR 4OAWB 5MP6L 1RD6A 1U2CA 3HFML 3GSXA 3NIFF 5HSFA 3FRPG 1S7VB 4AT6B 1XF5B 2NLJB 4DGVL 2JCCE 4OZFH 1DBKH 5DD6B 1QKZL 5E03A 5IESH 1LO3L 1HH9B 2DQIL 2E7CA 1Q1JH 1T22B 1OTTC 3EHBC 4MX7B 1R6VA 4W6XB 4LAJH 4U1IA 4LK4A 3GUTB 3HFMH 1AO7D 3QIUA 1K8DB 3ZYIA 3RZCC 2VLME 4WO4D 4CNIB 4DGVH 4X0KA 2I9LA 3LPGA 5FDWB 1FNLA 1QKZH 4GXUM 1BJ1J 1LO3H 3D3VA 4G6FD 2RQ8A 2FX7H 1Z5LA 2KQNA 4HS6A 4QYOA 3TZVC 5DMGD 1CD8A 2Q76A 5DURB 4GH7B 3FO2A 3KPQA 4X99B 4HW6A 3ZTNL 5FGBA 1XR9A 2DKSA 1FYHB 5GS1C 1Z6JT 3OPZH 5IF0A 3ZDXF 4JGMA 5E2WL 4MXQD 5F96L 2Q20A 3EAKA 4KI5C 5BZDB 3FQNA 1C5BL 1CWVA 3TFKC 3JVGA 3QH3A 4YBLC 3V0VA 2FX9L 5CLTA 4DKDC 2AK4A 4Y88A 5GGRB 5EFIA 5C07A 3HPJA 2Y6SD 4L4TB 5F6IB 1FNSL 4Q9RL 5ALCL 1C5BH 1YEKH 4OIIL 1MCOL 5I8CB 2FX9H 2X4PB 4XP6L 5IHBA 5LWYL 4JFDA 4JANA 2W65B 4PLNC 2DMBA 2UYLA 1MQKL 1FNSH 1I1AA 3U4EA 3MRFB 4Q9RH 3VWKD 4U1KA 1JN6A 1G7PB 4P49A 4OIIH 4QXTA 5IVNA 2X1OA 4PRIB 1YEHL 2LFGA 4KAQH 4Y4FC 1RJZA 5FB8B 5DMJB 4L8DB 1W0VA 3QDGE 5T5NG 2WANA 1SMOA 4XP6H 4U6HA 4H1LB 3D39B 5LWYH 4M02A 3AS3A 3RI5K 3T4AB 2CRYA 3BPCB 1MQKH 4KGLA 4ZUWA 3T0EA 1OAZH 3KYKH 1OM3L 4XNYL 3A6BL 5DHYA 2VUYA 4ZUTA 3LN4B 5D6DC 1PFCA 1IAKA 3HC0B 4OBRA 2R1WA 1CXHA 2HJFA 3L5IA 3DBXB 3C60C 5DHXB 3E3QC 3KLAB 3MOAL 4X80L 2OZ4L 3MV7D 1MAJA 5EO0B 4I3GA 4M62L 5J6HA 1D6EB 1OM3H 3A6BH 1UENA 5IB2B 1UWXK 5J3HD 3SPVA 1GGCL 1PG7L 5DJYA 4L8CB 3DWTA 3Q5OA 1DL7L 5MHSD 3EYVA 4PJEB 4X80H 2OZ4H 1BZ9A 1M6OB 4JRYE 3W0WB 3TBYB 3RRQA 4M62H 4JHAL 3UDWC 3TESA 4MQTB 3MRHB 3QCTL 4OCSH 5IB5A 3ARDA 4ZS7L 1W72B 3DJ9A 3CH1B 1NCNA 1DL7H 1YJDC 2D7TL 2HLAA 3I84A 3V4UL 1IM9D 2V2WA 5JIIA 1LO4L 4ZQKA 3RVVC 1FYTE 2EDEA 5MEOA 3O3EA 1DQDH 2V17L 3NN8B 4NNPH 1S9YA 1U41A 4G9DA 4H5SB 4MA3A 3B2VL 5I2IA 2YSSA 3BYTA 3V4UH 4QWWD 3P9LA 1FL5B 1MFDH 3MNVA 4QOKE 2BCKB 1BFOA 2JJSA 1UWEH 1JZ6A 4NKQB 5FF6A 4EUPG 3MOQA 3I3BA 5D6CB 5DJAB 2OI9B 1FFNA 4UUJB 5L8JB 4PJCE 3B2VH 1M71B 2CD0A 3CFJA 4M6OL 3HZVA 4GSDL 3MRJA 2EIZB 4GS7C 1OW0A 5IKCB 1R5WA 1AGEA 3O6FA 1FGVH 3HZYB 5DZLA 4L3CA 2AK1L 2J6EA 3G6JE 4GG6B 4G6AD 4FP8L 3FL7A 4M6OH 1E28A 4PJIF 3TJHD 1NFIA 1D5MA 1HYRC 1CZ8L 4I18C 3VWJB 2R8SH 3MRKB 5T3XL 2OL3B 3MUGA 2G5BB 1XGUB 4P0DA 3PL6D 3F7YB 4JKMA 1ZHKA 1KLUB 2AK1H 2VXUL 4DZBB 1D5XB 1NAMB 1CZ8H 3E0GA 4JREB 5T3XH 5AUMA 1MREL 5EO1B 1WTGT 3L3HA 4PLOB 3VMNA 2VXUH 2DQFB 1NCDH 1M7IA 3NCBB 1FZJB 1FVDB 1N2RA 3W9EA 4E41B 3R1GL 5D93B 3NZHL 4JRYA 2AKRB 2NR6D 4CRPA 2AQ1A 5IMLB 3GBML 3VFUB 3FAXA 3N0PB 2DQEL 5B4MD 4MJ4A 4XRCB 5DD5L 5IMMA 3LKNA 3U6RB 4PJ8B 3I50L 4X6CF 3PHOA 1QNZH 3NZHH 5DURD 5K9JL 5EU5B 3GBMH 1IQWL 3MC0A 1S7UB 2IG2L 1YNKH 5DVOA 3BIKA 4JZJC 5IVXE 1WFTA 1B2WL 2W1NA 3SKMB 1OAYH 3PDOA 1IGCL 4ZD3L 5DD5H 2C7UB 1TQCB 5ADOH 4NQDE 4M7KH 1RIVL 4QOKA 1ONQB 3UX9B 3DI3B 5AEAA 1FZKB 3SGEI 3EO1A 3RPIB 1IQWH 2IG2H 2OQJA 4MVBD 3RX7A 3ULUF 1NC2B 4WW2B 1RZJC 4IMKC 2HVJA 3U36B 2PUQT 3U0TB 1B2WH 2W0LA 2VN4A 4PJCA 4Y8DC 1IGCH 4ZD3H 4L4TD 2Y07L 4OGAD 3RWGA 4UIKL 2HJLA 5C8JA 5JW4N 2A6KA 2JB6B 3BOVA 2NY7L 3BZDA 2FCBA 5TE7L 4EI5C 5I30H 1KCUH 5HYJE 1ZEAL 2BNUA 2D4FA 3G6JA 2A9MH 1UGNA 2UUDH 5DJXA 5EIQA 3ULVL 4Z7VE 3E3QE 2Y07H 3B3IA 4EEEA 3QXDA 1D9KB 5FEBA 1HILB 3P3YA 1KPRB 1G9EA 4KK5D 4PRID 4PGEA 5D7SL 4ODWB 3QO1B 4NJ9H 3RZCA 3KPSB 4ZTOL 1CICB 2YXFA 3NFNB 3SO3C 1MCBA 1ZEAH 3BRFA 1JGDA 3D39D 4HGMA 1WCBB 4P48A 3BEWA 3ULVH 5CUSH 1JYXA 5ICXA 4YDKH 2BOBB 4M43L 1ZLVK 1ZWIA 1IKFL 4U6YB 2P8LA 3ESVF 3TZVA 3RWFB 4YAQA 3QHTC 4OD2A 3RWCA 5D7SH 5J12B 3UCRA 4ZTOH 4YHPB 1CLOL 5DJ2B 3GBLA 2EDTA 5KG9A 4FMKA 4QGTA 2BY1A 2DRUA 5GS1A 5C0AE 5AD0B 2YRPA 4ZNCD 1HWGB 3HC3L 3QQ3B 1IKFH 2ZOLA 5DMIH 2KPNA 3W2DL 5LQBL 2D7MA 4J3TA 1I8KA 4YIQA 4F7EA 1ZANL 3BN9C 3UZQA 4D8PB 1DCLA 4PGCA 1CLOH 1RZGA 5BXFA 1D6VL 1JYWA 2G60L 1GZPA 3W0WD 3CXHJ 2P8PA 5C0NC 2FL5B 3BIAX 1HXMB 1NAKL 4M1CD 3W2DH 1YNTA 5LQBH 4LKXB 1HHHA 1X5JA 1PDKA 1RUKL 4HWEH 5IVXA 1BGXL 1FC2D 4CMHB 5C7XH 3WJJA 1JE6A 2VLJB 3QQ9C 4NUJB 3X17A 1E27A 1D6VH 1ZT4B 2MCPL 2G60H 3D25A 3QYCA 4U1NA 3LH2L 1X4XA 4NQDA 2Y25A 1DQQA 5ILTL 3QUMB 3RZWA 4NHCL 1NAKH 1XGPA 3UAJC 3S9DB 2VZOA 4HLJA 1YY8B 2IMMA 3ZE1F 4S0SD 5EH1A 1RUKH 3JWOH 2W07A 2XIDA 4OF0A 5HHMB 3QDJE 1ND0A 4OZFG 4Y4FA 4WNQB 1JRHI 2MCPH 4BYHA 3LH2H 4MNGA 5ILTH 4MAUH 1HHKB 1EHLL 4NHCH 3C8DA 1RULL 4PGDB 1T7ZA 2AJXH 3SDXE 3UTQA 4ORGA 2AI0L 5HYJA 5D6DA 1OGAB 1MCJA 3ULSB 3MV9D 5JA9A 1MFBL 3C60A 5INDA 1KJVA 3QI9C 3F7PC 2BNQE 3JZ7A 4TUKH 1VKXB 2KKQA 5AAWA 5HVFB 4OB5L 5I16B 4JVWA 4JFOB 2V2TA 1GPOL 5IB4B 2AI0H 1IGIL 4G6ML 2ATKB 3CUPA 2ZOKB 3VWJD 5KSUB 1MFBH 4QHUA 3LQZB 2AVGA 3CXHK 5L2KE 2GUOA 2OTWA 4XCNB 3C6LC 1IL1A 3F58L 1TETH 3UDWA 1G7IA 3B43A 3QHZL 4KRLB 1GPOH 1ZVHA 4C4KO 1V05A 3C5ZB 1EUUA 1CVRA 4R97B 4EIZC 3AY4C 1IGIH 4QHLA 3E6HB 5A2LH 4QEGA 4DK6A 1H3UA 1G7MA 5C9KA 3K81A 3F58H 3KXFB 4PG9B 1OF2B 2BHYA 5C0BA 4MLSA 3QHZH 2YD8A 4L1DA 1C8PA 4L4JA 5L0QC 3SDYL 4NZDA 1BECA 4WGWB 4E41D 4HK3J 2ZWLT 3VG0L 5GGTA 1MVUA 3FT4B 4PRNA 4IRZH 2D4DA 1CE1L 2AV7B 2R4SH 3QHFL 5M7QA 3SDYH 4OGZA 2O5ZH 4LCUB 4PJ8D 4M1DH 3OF6A 1IGFL 1OL0A 2ZSWA 4Z7UF 4FRWA 4HXAL 1Y6MR 5FM5M 1LDSA 4P5TD 3DX8A 4IEFB 1N64L 1RHHB 4AQOA 1CE1H 1A47A 4KJWD 3U30C 5MEQB 2V5MA 2LAAA 3QDJA 3L3DA 3BD4A 4WJ5A 4D0BB 5JW4M 1IGFH 4I18A 4O02L 3RL2A 1A7NL 1NC2D 4HG4J 1N64H 3VJ6B 1I3GL 2UZIL 4WFGD 5I1IL 1G6RB 2W0PA 3WNKA 2C1OA 3KS0H 5IHLB 1JHTA 2D9QB 1F2QA 1VENA 2Z93A 3H9ZA 4O02H 4PLJD 1F3DH 5IFAL 1V7NH 1TZIA 1I3GH 3P11H 5B38G 5DXWA 4YHML 5I1IH 2FJHB 5GGQL 1IRAY 5CBEB 1S7QB 1D9KD 4MJ6A 1T1XB 2NX5D 4DW2H 4KK6D 3BDYL 3OKOA 3MV01 4OZHB 5IFAH 2WBJC 3BJ91 1D7FA 5FHAH 3KPSD 1A02N 2YUWA 2BC4A 4XWGH 1U8JB 1TVHA 5GGQH 3BPOC 2XY1A 1AKJB 3ECBB 3DROB 1I7ZA 1FZOB 1F6FB 1TCRA 3BDYH 1PJ9A 3I6GB 3MJ9H 4DZ8A 1CQKA 2AABL 2W0FB 4G8EB 1FC1A 2XXCB 2FATL 1CG9A 5A16B 2CRMA 4DVBA 4XBGA 2GTZB 4QRRE 4JZJA 2BDNL 3MRIA 4WWKC 5F44A 2VTFA 1K4DB 5CD3A 3F12A 3CXDL 3IJHA 3LSOB 3OKMA 3QULA 2DWEA 4NO3B 3DX9B 5DJDB 5F88A 2F74A 2FATH 4HG4K 4MS8C 1TQBC 4OCLC 1M7DA 4PPTA 4IMKA 5GS2D 1CD1A 1UZ8A 2BDNH 3C9NA 5TDPB 1I9EA 5FCUL 2LVCA 2ZUQB 2RR3A 4N0FB 2MQ3A 1J0HA 4RQQA 2NTFA 2UWEE 4C56E 4I2XE 3VXOB 1TDQA 1KXVC 1VGKA 5I19L 1Q9KB 5EN2A 4MB5A 1SYVA 3PP4H 2J8UB 4I3SL 4EI5A 2VLJD 4Q6IB 4PJ9B 4QY8B 1UJ3C 4G9FD 5E00A 4HX1A 4AIXA 4R7NA 4KROB 2CPCA 1CGVA 4JM2F 3F7VB 4JO4H 1CR9L 1KJ2B 5KSBA 2KQMA 2WQRA 1FG2B 2B8OT 2BVQB 2B7DT 4PV8B 1UCTA 3GM8A 1NGWA 1Q9OB 3MRCB 2YD7A 1DLHB 4ZO9A 3LEXA 2V5SA 4Q2ZA 4I5BA 4QNPF 1AXIB 1DN0B 4RFNB 1L0XA 3K8LA 1YYLH 2P42B 4GO6B 5DYOA 4DOHE 3NFSH 4LLMA 4PJXB 3RWIA 4AG4L 1CGWA 4C83A 1OGAD 5SWSA 1YECL 3OR6A 4IS6B 4GMSL 3P30L 4HUNB 1QR1B 2XZAH 4NPYA 3KPTA 2Z4QA 2IAMC 3BKJL 3CDYA 2H8PA 3SE4C 2V7HA 4LOUD 4YFLI 1ZT1B 1OQXA 5LGJB 4PP2A 5LAXB 4AG4H 2LTQC 1YECH 2EKJA 4LSVL 2XWBB 3O41A 4FFVD 2ZUWA 4GMSH 3P30H 1RZFL 1GOGA 4GLRH 2DI9A 3SE3C 3N85L 4P46C 3MRPA 4IOIA 3BP4B 1HHGB 2FLBT 2ZNWA 3Q1SH 3S5LA 5DEGA 3C5ZD 1N59B 1UC6A 2C26A 4QRRA 3DX7B 1JI2A 4I0CC 4W4OC 2IGFL 4ZXBB 2NY0B 2YRLA 1N5YL 4O2FA 1RZFH 4LQ1A 4HK3N 5C09E 4XPBL 3KXFD 3S7GA 1R5IA 4OZFB 3GDBA 4RIRB 2AXFB 4IIQC 1OAUH 1AGFB 3RUGB 3OAZH 3HAEG 3O8XC 2MSPA 1Z9OA 1JNLL 1N5YH 1RZ7H 2UWEA 4XPBH 4C56A 5D5MB 1K2DA 4W6YB 2R0LH 4WUKL 1XF4B 5BW7C 5MEPB 3T65A 4NCC2 2EYSA 3PP3K 2ITDB 2RGSA 2UVEA 3ARBB 1VADB 2ZJSL 1JNLH 4J4PC 4JPIB 3QI9A 5DI8A 1B6UA 3HNTL 4K2UL 1N6QL 2ADGB 2ICES 4LHJB 1QLFA 5CGYD 5D1XA 4WUKH 1CT8A 3DIFB 4FQPA 5DC0A 3IU3A 4OFPA 5IQ7L 2NZ9D 5GS0C 1BD2E 2ZJSH 1AD0B 4GW4A 1XF2A 3TH3T 3OX8B 4OKVA 3VGHA 3HNTH 4FG6C 1N6QH 3DNKA 4Q6YA 2DBLH 3C6LA 2P45B 3SE9L 4JPKL 4OSUH 4KTDL 1F6AB 3AY4A 1G7JB 1A1MA 1SBSL 4MGXA 5MERA 1T5WB 4UILH 4DGIL 4PJBF 2FH6A 3T0BA 1H3GA 1PLGL 3MBXL 1F13A 2P5EA 4LP4A 4OKDA 3T2OA 1J8HD 3SE9H 4JN1H 3KLDA 3ARFA 4JDVB 4YHZH 2XQYG 4KTDH 2CR3A 3O3BA 3LKQB 1SBSH 3PWPB 4KTEL 5EIVA 4AEFA 5CZVL 4TSCH 4DGIH 1ZMYA 5ESQA 3IRZA 3JTTB 4JFFD 1KTDA 1PLGH 2HTLD 3MBXH 4ZG1A 1CFVL 2XN9E 2R2EB 1T4KA 1AKJD 3OMZA 5E1AB 3K2MC 4YHYB 4Y7MA 3M1BB 3G04A 2H32B 5AWNL 2GFBB 1DSFL 3NZ8A 4HWBH 5FYLD 5C09A 4AENB 4NRXB 1MLCB 3MR9A 3SDCC 2I5YL 5CHNB 4WI7A 3EOBB 3ULVF 4MJIE 1CFVH 5SWZE 3G9AB 5D7LB 3QAZC 4OJFH 3BIBX 1QR4A 5DHVH 5AWNH 3DV4A 1UA6L 1J12A 2ENSA 3F6IA 4CW1A 3D1MC 5GRJL 3HUJB 4Q9BA 2HFEB 3FO0L 1E6OL 4S1SL 1JTOA 3LN5B 1P4BL 1HNGA 1QBBA 2V5RA 3RA7L 4CAGA 5J6GA 4N0YL 1OB1A 1E6JL 4PIRF 5B38B 2HMID 4B41A 3WFCL 1J18A 5E7BA 3IU4L 5IMOB 4NRYB 3KPRB 2ADIB 5I9QB 3FO0H 1E6OH 35C8L 4S1SH 1I9JH 3GMLB 3TO2A 4M93B 2R2HA 1BLNB 1P4BH 3RA7H 4WCYL 1BD2A 3EDJA 4KROD 2HJKA 1E6JH 4JRXA 1ITCA 3WFCH 2VXTL 1IQDA 4LHUA 2ORBL 2P24A 4FNLL 4ZDHA 1NDMA 4PLKC 1QFOA 2PO6C 3HB3C 3QWRD 4WEUD 1QSFD 2DIAA 1DEDA 4WCYH 3ARVA 3UC0L 2NXZC 2VXTH 1FDLL 2J5LB 3TH2T 4N0CC 5BV7B 4FQXC 4FNLH 1ZHNB 2CKBA 2QADC 2P8MB 1NCAL 4KY1L 1EEYA 5EZIL 3B6SA 5F9DC 1FV1B 1NUFA 2BXZA 1IAIL 1CDCA 1UADC 2GJ6B 3ZT6A 4WWKA 5E9DB 2HT3D 3UC0H 3G6AA 1MIEH 3BT2H 4MDIA 4XH2B 3VFPB 3OAYH 2ICCA 1FDLH 4PTTA 4UQ2B 3RNKA 5DRWA 5A40E 4O4YL 1MQ8A 2QSCL 1T5XB 4HUMB 4KY1H 2OK0H 4KPHL 5EZIH 3U0WL 4NO5A 1IARB 3DVGB 1IAIH 3RWJB 1I1YA 3FT3B 3WHE0 5E8OB 5J9PB 1JVKA 3C2SA 4K7PX 5F1NB 3JV0A 3C8KA 4B7LA 3T0DA 1PZ5A 4O4YH 3R06B 4NN6B 4MJIA 1CXFA 5SWZA 4KPHH 3U0WH 1BVLB 4TTGA 4LLQB 1JYNA 4ZXBD 1UJ3A 3V7AE 4XHJC 3GJFH 4RISH 5DMGC 1HI6A 4P23A 3IGAA 4GOSA 3U7WH 5DGQA 4HAFA 4QCIA 3E2HC 2PKDA 3LKRB 1VFAB 3FZUD 2XWJA 2ZCKH 5B3JE 2A74B 4ZSOB 4GKZB 2YUVA 4HKXA 3EJYC 3WJLC 5FO8B 5F6HJ 1I1FB 1PAMA 2D31B 4EBQL 4E5XB 4EI6A 4XMKL 3T1FB 5EDXA 5JXAH 9CGTA 1N7ML 3QUYB 4OI8A 2V5TA 4LKCB 2EO9A 3ARBD 4DCQA 4JO3H 3ZKSD 2Y6SC 1ZAGA 4G42A 4U31A 1Z9SA 1MEXL 1YPZF 2IAMA 5EBGA 4EBQH 4Y4KB 4BELD 1N7MH 3MLXL 1ADQA 4HUXB 4QRSA 3GIVB 1JK8B 5EULV 2WNGA 5DJ8A 4CU7A 1U36A 2ARJB 3GSUA 5JR1L 5CIPA 4TULL 2EIDA 5CJ8A 1KYOJ