5IW6B

Anti-cd20 monoclonal antibody fc fragment
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
205
structure length
198
Chain Sequence
b'SVFLFPPKPKDTLMISRTPEVTCVVVDDPEVKFNWYVDGVEVHNAKTKPREEQYNRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structure of anti-CD20 monoclonal antibody Fc fragment at 2.34 Angstroms resolution
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 198
sequence length 205
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw6B01
4RWHA 4CU8A 1CFNB 4WDIB 4PRDA 1G7MB 2AK4A 1VKXA 3VFTB 3MBED 3V0VA 1MLBB 4NUGL 2GW5A 2UY7A 3NFPB 3QUKB 5I8OH 5C9KA 1T2JA 3GGWB 1QYGL 5EH1A 5MERB 4M6AA 4OLZL 3EJZC 2VYRE 4N0CD 1I8KA 1EDQA 5KG9A 4XP6H 3NN8A 1JWMB 3WE6B 1ZHKB 5F1KC 5DR5L 1P7QD 4PJGE 3RI5K 4G9FE 1T0MA 4LLQB 2OSLB 5J9PA 3AGVA 4Q9QH 5HHPB 4JPVL 5AZEL 2P24B 3DROA 1CDGA 2AV1B 4JQIL 4WNQB 5FA4B 3WYRA 5AD0B 1P6FA 2F54B 1XGRB 5GGVH 1V3JA 3ZTNH 2EC9T 4NQEA 5IFJB 2MFNA 4HC1L 4MMZC 5DLMH 1RUAH 4XP4H 5JO5B 4MNQA 2MQ0A 4OGAC 1S7WB 2QR0B 1FPTL 1Z5LA 1T4KA 1RK0B 3U4EA 3VH8A 1AY1L 4P2RD 4F33A 1J1XL 2VLMD 3PHOB 1JGDA 4P9ML 4KV5F 1EHNA 1JPFB 4I4WA 2D7TH 2FGZA 1AD0B 4BK4A 3LKPA 2ED9A 1YECH 2W60A 4X83A 3TVMB 4OGYL 5DRNA 1LHZA 4Q74A 3ARPA 5F8QC 4L9LC 5C6WH 1A22B 4J12A 1CE6B 5FUCC 4HJJH 4RNRA 2P48B 3D39E 5MEQA 5EA0L 3ZO0A 1KT2A 4WUUE 4E42B 3FB6A 5L2KE 1NLDH 3SDDA 4NRYA 3VXSE 4X8XA 2B7DT 1JV5A 4KUZH 1N0XL 1FFPB 2W91A 3MRBB 3X12B 4PJGA 4HHAA 2X4OA 1T83A 1CGVA 4G8GD 1FN4A 1MY7A 3IRZA 3O6LL 4EQ2A 5I8KL 4KROB 4AG4H 1HDMA 3B2VH 1EERB 4OCMC 4G5ZH 3U1SH 1OAXH 2NMSA 3W39A 1BD2D 2HLAB 4OGXH 2YC1A 4JVUA 5I8OL 5B22A 3AREB 1DFBH 4PY8J 3Q3GA 4PJ7F 4XP6L 2Y7QA 4EI5A 4N68A 1FHGA 4H5SA 4LLVB 3HPJA 4G80B 2LTQB 2J3SA 1FSKB 4IRSB 3G6DH 2DN7A 1IM9B 4PRBA 3C8KA 1EFXA 1NJ9A 3MREB 2BVEA 3KDMA 4Q9QL 1OTUD 4Y4HC 1DJSA 5ACZB 2WBJA 5D72H 5GGVL 1L0QA 3ZTNL 4HZLA 4OLYH 3G6AA 1BF8A 4XPAH 2QJDA 5DLML 3PHQB 1RUAL 1A6WH 4XP4L 5FYKU 3RRQA 2MHAA 2FWOA 4GFTB 5DMGD 3MCG1 2ZUTA 1D9KD 3PWLB 3TH2T 3D39A 3WD5H 1XGQA 2HVJB 3DHJA 4WUUA 5E8EB 4J1UB 5F7MC 5KTEH 5L2KA 5LJYH 3BW9A 3G6JB 1VFUA 2BVQB 2I60H 1R5IB 5L2JA 5DJ0A 1J5OH 4JZJC 1J10A 3RY6A 4A6YB 3CX5J 4ZS6C 2D7TL 2EDLA 1I8MB 5DJZB 3KWWB 1YECL 4EN3D 5IM7A 1MRFH 4Y8AA 4DUVA 1NGXA 3CNKA 4NJ9H 5KAQF 1UKTA 4IRJA 2K1MA 4HJJL 1B9ZA 3K3QA 4RIRB 5JXAH 1R5VB 3EFFB 3R1GH 1AIFA 5IMLA 2X41A 4HBQA 5IB3B 3K8KA 1NLDL 3LPFA 1N6UA 4IBLT 3KYOB 3NIGE 5E6YA 3FQXB 4KUZL 5T1LA 3WLBA 1SYVB 3MRNB 3ZZ1A 3QCTH 3DHMA 3C8HA 4J7RA 1BQHB 4QHNB 3R06B 1KULA 2DQGH 4H8WH 4N0RA 4WV1C 4AG4L 3B2VL 2NY1D 3TIDB 3RWFA 4Y5VC 4G5ZL 4P2RE 3U1SL 3U36A 3KGRA 1K4DB 5DJ8B 3O45B 1OAXL 1BX2B 5F6IC 3NH7H 2I9TA 4OGXL 1KN2H 4LQ1A 1IGYB 4U6HA 1DFBL 1SMAA 3TBTA 4PRPD 4D94A 5L8JB 5CHNB 3GSUA 4MS8D 1KTLA 5DRXA 1I7TB 4LOUC 5K9KA 3G9VA 4NC1C 4CVZB 5BS0E 1ZXQA 3G6DL 2UZIH 1RZKC 4GBXD 3NCEB 1CICA 4XI5C 4U6XB 3WL9B 5D72L 5EU7C 3ARZA 1D5BA 6CGTA 1JGEB 4OLYL 1CD0A 1IEAB 1MQ8A 4XPAL 5DFVD 1A6WL 4AQ1B 4GAGH 3FO2A 3ZE2E 1FFRA 3U6RB 2EDEA 1IJ9A 3WD5L 4KJQD 4ELME 5KTEL 5EZOH 1UM4H 2ESVD 4OV5B 3D85D 1ADQH 4IOIB 2I60L 5C8JA 1J5OL 1V3KA 5F7YC 1UZ6E 5FYKE 3GMRA 3VXOB 4Y4KA 1KCKA 1MRFL 2Z93A 3N9GH 3TH4T 2DKSA 4NJ9L 4S1QH 2NY4B 3BWAB 2EDNA 3FQTB 4FQLH 2XWJB 1G6RB 1QP1A 5JXAL 3WIFB 5GS1A 3R1GL 4BQBA 3ZSSA 4ZFZA 3ARBA 3QFDA 1EUTA 5EZJB 3V7MA 1BHGA 1KCSH 3SKNB 1EO7A 4JJHA 5BS0A 3QB7C 2PYFA 2IALB 2OBGA 2V7NA 4U1HB 2APBA 3QCTL 1WIUA 4K8RC 4APQA 4HKJA 4I13B 2DQGL 4H8WL 3RZCC 5B8CC 3P0YH 1G7HA 3KVQA 1X6LA 2H2PC 3TCLA 4RQQA 5JR1H 3C6LD 3NH7L 1JZ6A 4PJBE 3UBXI 1KN2L 3N0PB 1P2CA 3CSYB 4OFIA 1F4AA 5DK0B 5CBEB 2EYSA 3SY0A 3BP6A 2UZIL 3F5WB 5DQDH 3DVGB 1F6FB 1E4KC 3QQ4A 2DLIA 4N8VA 2UY6A 2P49B 3QFJA 4PRHB 4AIXA 4D2NA 1G9NH 4G9DA 4OKVA 5CAYB 4AENB 3IETA 3DX6B 4RGNC 1AGEA 4ZUWB 4Q6IB 4GAGL 5GGVY 3CU1A 5FDWB 3MR9A 2XTLA 4ODWA 4KKAD 1A6TB 3M1BB 5EZOL 1UM4L 1K8IB 1ZA3B 5C08B 1A7NH 3GJEA 5JHDB 5SWQB 2YK1H 3IJSB 4GS7C 3L3JB 1ADQL 4O9HH 3E6HB 5IHLB 3QNZA 1HHHB 5JXEA 1T5XB 3VWKA 4NWUH 3TO2B 2VLJB 3H6JA 4M3KB 4PJIB 1BFTA 4PRPE 4HS8H 3QQ9D 1ZS8A 4LKXA 4QRQB 4FQ2H 1NCDH 1U8NA 3N9GL 4P4KC 4S1QL 4FQLL 4DGVH 4KDTC 1G7JB 5GRJH 1E4JA 3TN0A 4WO4C 4AM0B 2YD3A 1BQHG 4R3SB 3FT4A 5ID0B 2PW2B 1KCSL 1H0DA 1T0PB 4HJ0C 4P5TB 2WLZA 1LDPH 1DQTA 4XXCC 2P5EB 3LN5A 3QULB 4TUKH 4L8CA 3QPQD 4LLDB 3KYAA 3PWJA 1K2DB 3P0YL 3T4AB 5D70H 5E8PB 2ESVE 1ES0A 1LWRA 3ZSTA 3HPLA 4OIBA 4PR5B 4JDZB 5JR1L 1HYSD 3DURA 1BBJA 1HE7A 4OFDA 1VB9A 1Z2KA 4TTDD 2NW3A 2EKJA 1MJUH 2C3WA 2I26N 4HWUA 1J0YA 3EO1A 4M02A 4RAVA 2L7JA 4GW4A 4NRZA 1T21B 3BYYA 3MLVH 1GGBH 2CDEB 2NY3B 5DQDL 5CBAA 2P47B 4XB7A 4JM2D 4P23A 5IG7A 4HEME 4HIEA 2FIRT 2EEAA 4JQXC 4NO0A 4HKXA 4MHHG 1TZGH 4MCYA 1G9NL 1QRND 2ICWI 3ILQC 4QTIH 4WHTB 1L7IH 3QDHA 3DJ9A 2VITA 5DFWH 4NNXB 5EZLA 1R3KA 1C5DB 5EUOF 3BXNA 1XR8B 3I9GH 3NIFE 4HWZB 4KKNA 3BO8B 1KPRA 1T0NA 1A7NL 2YK1L 1FNGB 3QIWC 1U95B 4O9HL 1CDUA 1IKNA 1X6NA 3BGFC 2FRGP 3LRHA 2HT3D 4NWUL 1PX4A 4PGDA 5GZOC 5IJKC 4HS8L 3LB6C 4N8VG 2L7UA 1A4KA 1AR1C 1JHLH 4FQ2L 4PJ9D 1NCDL 4IMLA 3ZDZE 1FO0H 4MXVF 4OLUH 3MRPB 2XOTA 2QL1A 1UJ3C 4DGVL 4L3EB 5JHLH 3E8UH 1XF1A 2BXYA 5GRJL 4KJPD 4PG2C 2F5BH 3EJYC 4NQCE 1P7HL 3O9WC 1YC7A 5F7WC 3PABA 3MGAA 4FTVB 4FQHA 4TUKL 2GAZA 1OP3K 4RCAA 3ULVC 6FABH 4KC3B 3VFUB 5IF0A 4R4BA 1EEUA 5D70L 1HILB 2R29H 4OZFA 1FDLH 1MCHA 2FL5A 2OS7A 5EPMB 2FYYA 4CAGA 4U2ZA 1WCQA 1YMMB 1BVZA 2FH6A 2E6JA 1DDHA 3ZE1F 4F7EA 2FBOJ 2NXZB 4UQ2B 5E2VH 3AAZB 2D3VA 1MJUL 3C5JA 4HMDA 4NKDA 3CVIH 4M93B 4MQSB 3TP4A 3MLVL 1GGBL 1YC8A 1QHPA 4GMSH 2VN4A 1TZGL 1ED3B 2GK2A 2HLFD 4QTIL 1L7IL 5AYQA 4JZNA 2BMKB 4LNVA 3VWJA 5J1AB 2X4UA 4X7FC 5EB9A 5AUMB 5GIRB 1F11A 1I9IH 3QZWB 3I9GL 3SCMC 4PRAA 2R4SH 5HSFA 5F1OB 4P5KA 4NQCA 2AEPH 1OB1A 3KPSA 1RZIB 2KQNA 3OR7B 5I16A 1T1ZA 1HXMA 4NDMB 4ORZC 4JFHD 3OKEA 4IS6B 3PXHA 3D3VB 4JDTH 4M7ZB 3LMJH 1A47A 4BQ9A 1MY5A 1FLTX 4YHNA 4IM8A 4CNIB 3GJFA 2KUTA 2FATH 1VSCA 1JHLL 1QFWI 4LEOB 4PJCE 5BJTB 3IFPB 5FO7B 1BWWA 5DUPH 1FO0L 4OLUL 4JHWH 5EO0B 2G60H 3IKCA 5DGQA 1WBXB 2MSPA 4DZ8A 4ZO8A 5JHLL 1UQSA 3E8UL 5EOTB 4ZXBC 3WUZA 2F5BL 3AS3A 4PY8I 2VSCA 4IHOB 1QRNE 1TIUA 1SJHB 4RFOH 1QFPA 3RDTB 4PJFE 3ALXA 3HRZB 4K23H 4ZS7H 1R6VA 2H8PB 5IEHB 2ICEA 3F7YB 5EBLB 2ZSWB 4E9LA 1A7OH 4JFOB 4RMUA 6FABL 3R0MA 1YEJH 3FN0H 4PD4J 2R29L 4UIKH 1INQB 4B50A 1CFQA 1FDLL 4Z7WB 4G43B 4MD4A 2R9HD 5KANG 4ZODA 1EO5A 2W92A 3LIZL 4XCYB 3P2TA 3GSRB 5E2VL 4GW5B 3G5VA 3Q0HA 3P11H 2PUQT 2EXWC 3DUHA 3CVIL 1MH5A 3E2HC 4I18C 5IMOB 1CXKA 4PGCB 4Y19B 5GGUA 4P46A 4GMSL 5IVZB 4QRRB 2ADGB 2XN9D 4WW1A 3C5SB 1PKQB 1FH5H 2A2QT 4OZFG 1CFBA 1F2QA 1TPXC 4NN6C 5GS0H 3TO4C 5TPWH 5H35B 3REWA 1I9IL 5ITBH 3FTGB 3SDAB 5HHNB 2R4SL 2ZSVA 1LO5B 4GXUN 4OCYH 3N1QC 2DQFB 3HZVB 2AEPL 1G0YR 2F74B 2C5DC 2VO5A 4HXBH 4I1NB 4JDTL 3C2SA 3LMJL 5E8DH 32C2A 5LCVH 5ELIA 1EEQA 2AXGA 4HIJA 2FATL 1VA9A 4X9GA 3IDMB 2J1KA 4GQPH 1YNTA 2P46B 4P2QD 2C3VB 5DUPL 1LD9B 1ZT4A 4JHWL 4L8BA 3VI3F 2G60L 3ZMRA 5IUSA 1XR9B 3MV7B 5E4EC 1Q94A 2NZ9D 4RFOL 2HKHH 1S5HB 1AQDB 5EU4B 3WKNA 3VI4F 3LPGA 4K23L 1IT9H 2BY1A 4ZS7L 1BLNA 1IAMA 1NFDB 3LKNA 5F7DB 4YK4C 3DXAB 4KI5C 4F7TA 4KRPD 1A7OL 4BH7B 5ANMB 3VG9C 4GRWE 1YEJL 2NY5H 3FN0L 1ZT1B 2VRAA 4UIKL 2HVKA 1XEDA 3BQUA 3T1FA 4PJXE 5A2KH 3DVFA 3MJ8A 3BPOC 3EYOA 3QDGD 5BV7B 1QR4A 3F12A 2GJ6E 3LOWA 1QSED 3LRGA 3P11L 5LBSH 4Y16C 1KG0B 4DUXA 5GS3A 5BW7A 2B1AH 3OHXA 3CCHB 5D7IF 5TF1L 1TITA 1A9EA 1S7SB 4D0CB 1QOKA 1XGPB 3MRGB 3WLWC 1NFKA 5HHMD 1T7YA 3I6LE 1FH5L 3QZWG 2ZPKH 1M7IB 2VDNH 2HG5B 3OGOE 3ROLA 2V2TA 2ATKA 1Q38A 5GS0L 5TPWL 1NGZA 1MAKA 5DVLA 4JN1H 5ITBL 4XXDB 2AKRB 2H3NA 4FQPA 5LQBH 3C09B 3WKMH 5KS9A 2IAMD 4U1NA 4Z0XA 5IP4A 4MJIB 1DVFB 3MLYH 3CFDB 4HXBL 3QIBD 4O4YH 3TT3H 5E8DL 3TEUA 1U8MA 5LCVL 1I85C 4URTB 4X98A 3RL2B 4KU1A 3TT1H 4QHLA 3LQZB 4NOFA 2DQUH 4AH2B 4P2OD 1UEYA 2R1XA 1E28A 1A3QA 3O6FB 1ZEAH 2BJMH 2HTLD 5TQ0H 4V1DB 4PJXA 1I1AA 1R3HB 3O3DB 1RZJH 4LEXH 3RWGB 1ZLVH 4O00A 5DO2D 1DUZA 4G7VH 4CVWA 2GJ6A 2XN9E 4IEFB 4LL9A 1B0RB 4HS6A 4F15B 4A6YH 5A16A 2HKHL 1CN4A 4CADB 2DIJA 4LCCA 2Z91B 1U3HA 3PP4H 3RWJB 1IT9L 1X5FA 3FOMA 3IXAA 2HJFB 3P9LB 5L7XH 3ULVF 1NDMA 1S7XB 1XCQA 1T20B 4ETYA 2NY5L 1TDQA 1IE5A 1KJVA 4JANA 3QNXA 5D2NC 4YC2C 1T5WA 1JMZA 1U42A 3ZT6A 2OTUB 1IMHC 3PGCB 4MX7A 4ODHH 1K8DB 3MRHB 5LBSL 1NAKH 3ZE0E 2FX8H 3K1DA 2PCPA 2B1AL 1S8DA 4PGJA 1FFQA 1ORQB 4LKCB 2YRPA 3RWHB 2Z31B 3S36H 5LKNA 2VL5A 1PFCA 4S10A 1B4RA 5E6ID 2CJUH 1QEWA 1QBML 2M1KA 1AO7E 1F13A 4OAWA 4FABH 2ZPKL 5E2JA 4OD1H 1IEBB 1PW3A 2VDNL 1HH6A 5FOBA 1B6UA 4BYHA 3ARQA 3RKDD 1PDKA 4JN1L 5KVDH 3SO3B 3THMH 1LK2A 4OI7A 3CLFH 5LQBL 4BJLA 3WKML 3NMEA 4M9OA 3TBVA 4PGEA 5H8DA 4OT1H 4GKSB 2GHWB 3MLYL 4LLYB 2FJGA 1NL0H 3HE6B 3I6KB 1J8HB 3TA3B 4O4YL 1M05A 3TT3L 4TOYH 4X4YB 1S7RA 4PJEB 3U7AA 2QSTA 2VC2H 2R4RH 3TT1L 1NUFA 4FQXB 2G5BA 3BPCA 3IXTB 4UT9H 5C1MB 2DQUL 4JY4B 3GSWA 4XCNB 1EX0A 3UTZB 1ZEAL 2BJML 4JFDB 5TQ0L 3WNKA 5GS0D 3WFEH 1CLYH 1M7XA 3EDDA 3BPLC 1RZJL 4LEXL 4KKBD 2HFFA 5JQ6H 4I0PC 1C08B 1HCFX 4G7VL 2IGFH 1W8OA 5D6DA 5HHME 4A6YL 2VQUA 5E00A 3RWDA 3V8OA 3PP4L 2E6QA 3EDFA 3O6MH 4RISH 2ZUQC 1XGUA 1YA5A 2ITCB 2Z92B 5L7XL 3P73A 4HK3N 2WWMC 4LU5H 5KOMC 1G6RH 3MUY1 1OTTC 4ODXB 3BDYH 1CL7I 3QEQE 3P4MB 2AXHA 3RTQA 1JGLH 3OKKB 2X7LA 5K9OA 4D3CH 4G8EA 2MCPH 4ODHL 1T3FB 3NCFB 5E8OB 2ADIB 1SQ2N 4U1IA 1NAKL 4E5XB 2FX8L 2OTWB 3EOTH 2BSTB 2A6DB 5GSRA 3TVMD 3MLWH 1OGTA 2QKIB 3S36L 3IGAB 4W68A 2W9LA 4X6DF 1EEYA 2CJUL 3DBXA 3DOSA 2CLVA 3GIVA 4P99A 2EH7H 4MWFA 2B8OT 3CUPB 1DANT 5A40E 4CVXB 5KSBE 4FABL 4C56A 4OD1L 4NJAH 3T77B 4HAGA 5ID1A 3HAEA 3OKNA 3WXWH 5D6CB 3VRIA 4QRPE 3BRDA 1MAJA 5KVDL 3THML 4MCZB 1MREH 3CLFL 4S1SH 3ARSA 3PWUA 4MAYA 3JV0A 1RZ8A 1Y6NR 4KROD 4OT1L 4KGJA 1NL0L 4FFWD 5HPOA 1P1ZA 3C87A 4HV8B 4TOYL 1A9BA 4RZCB 2VC2L 2R4RL 1H15B 4QY8B 2KH2B 3RVUD 1FJ1B 4CDHA 4UT9L 3VFMB 4NCC1 1CU4H 5HYSB 5DJCB 5D5MF 5FHBH 4KK6C 4N5EC 3WFEL 4PLKC 4CW1A 1CLYL 1PSKH 1DN0B 4JM4H 4IRSD 8FABA 1IM9D 5JQ6L 4HK0B 3VGGA 1EJ6A 3WHXB 3BEVB 2V9QA 3L1OH 4QOKB 2JK5A 3MXWH 4X8JA 5L9DH 5T1LD 1SJVA 1WQVT 3VXME 3O6ML 2GITA 4H20H 3BSZH 4PV9A 4RISL 3VMPA 4UIMB 3H8NA 4S11A 4Y2OA 4Z95H 5DMKB 1GC1C 1JNJA 4AMKH 4LU5L 1G6RL 2PO6B 4RMQA 4P2CG 4YGVB 5D96B 5TDNB 4DKDC 1LEGB 4UBDC 3BDYL 1QO3A 5KSBA 3MROB 3VD3A 2I07A 3ARGB 1JGLL 4ORGA 4S1DC 1IC5H 1X5JA 3B9KC 4NZTH 1J7VR 5CP3H 3QG7H 5FYLH 4D3CL 4QRPA 3TGXA 4Y5YC 4Z78A 1KIQA 4PJ7B 4ZAKC 2VR5A 3EYVB 4LSVH 2KZ1B 3EOTL 3HS0A 3NACH 5I0ZA 4X7CC 4QXGH 5CCKH 4OZGF 1CTOA 1TTFA 3MLWL 2X4QB 2APVA 2YSSB 5DJYA 1BFOB 1FVEB 1A6VH 3TNNA 1UXSA 1HWGB 2EH7L 5IFHH 5HXMA 1MVUB 5HYQA 3STZB 2F54E 3UDWA 4PFEA 4NJAL 5F6HI 1KPVA 4NSKB 3QIUB 3WXWL 3U9UB 1ZHNB 3GSXA 2IQAB 3RIFF 5GHWH 4IDJH 4WU5B 3QHFH 5GRUH 5TH2A 3S36X 1MREL 4NNYB 4S1SL 1A1NA 3FO0H 5JPNB 3A0OA 1EBAA 4PV8A 5B3NA 3VXMA 4MA1B 4XH2B 4XZUA 4WTZA 3ZKXB 4PG9A 1LP9B 4R26H 3AM8C 3KXFD 3SE4A 1CU4L 3HUJB 3C60B 3D25A 4M43H 3FFDA 1SYSB 5E9DB 5FHBL 5KZCB 5AWNH 3PHSA 1PSKL 3FO1B 4XNMB 4JM4L 2V9TA 4N8CH 4TUJA 3J8F7 2EEBA 1HSBB 4HGWB 5F72S 3DTXB 4NHUA 3TWCH 5E56A 3P3YA 4JFEA 1AKJB 3L1OL 5BZDA 3MXWL 4BSJA 5L9DL 5CSZB 2XFXB 2FLBT 4H20L 3BSZL 2ZOLB 1OW0C 4Z95L 3HB3D 5FKAB 4PJHE 3NABH 5F9DC 1I8LC 4AMKL 1C16B 5A1AA 4U7MA 2F54A 3L7FB 5F44A 3QDJA 2WAHA 4N0YH 1IC5L 5ABDE 4NZTL 3QG7L 5FYLL 5LGJA 3R4DA 1KTRL 3RPKA 2XA8H 4OF5A 5GGTH 3QDME 3MUGA 1B0GB 4B7IA 4LSVL 1NGPH 1RZGA 3NACL 4J4PA 3I75B 2V2WB 3MLRH 4QXGL 4WFFE 3V5HB 5ILTH 4GKZA 2WV3A 3CFEB 3MJ7B 2NY4D 1GGIH 1A6VL 1JP5A 4ETQB 5L0QB 3UMTA 2H6PA 5GJTH 5IFHL 1AD0A 2ZUUA 2Q86B 5C9JA 5I6XB 4AY0A 3BN9D 1BIIA 2MMXA 1RHFA 2FJFB 3HE7C 5GHWL 2F53E 4IDJL 3QHFL 4AEIH 5GRUL 2H2SC 3S96B 3GFUA 1XH3B 3FO0L 3FOLB 3LN4A 3QI9B 1K3ZA 3S5LA 4LSSH 4XMLH 5HHQB 2DWEB 3HC0A 2HT2C 3MZGB 4NQVA 5JXED 1E4XI 3G6JE 2YD2A 1QVOB 1AP2B 4M00A 5BVJB 4K94H 4PJHA 4R26L 2IH1A 1WSST 1F8TH 2XTJC 3QUYC 5GSVA 3CPLB 3SGKC 4R2GD 1OSZB 5E4IA 4M43L 2UUDH 5AWNL 3IJHA 3C9NB 2DAVA 3QWOA 4N8CL 2D03H 2GK0B 2GFBA 3NCJH 3VRJB 4F37F 2HLAA 4LLMB 3MV8A 3TWCL 5AEAA 4D9RE 3QDMA 2NNAB 1SY6H 1HKLH 3N85H 5HY9B 3VFVB 4RDQF 1UVQB 3ARDB 1LEKB 1EAPB 3PL6B 2X4NA 1SJEA 4F7MB 5K59F 2OL3B 1C7TA 4WTZG 1QQDA 3MREA 3NABL 2VDPH 4JDVB 4ESKA 1R3LB 2ORBH 3DX9B 2OZ4H 5ACZA 3E1F1 2YZ1A 3VXUB 3TIEB 4J6RH 1ZHLA 4X7TB 3T0EE 4CN1A 4GG6E 2QQQA 5JHDD 5CEZE 4N0YL 2C4FU 3EHBD 1LQSR 2FHCA 2XA8L 2F53A 2VLJD 4X9HA 3UROR 5GGTL 3BOVA 5TE7H 2CGRH 3VGAB 5HYEA 4HW6A 1NGPL 1QG3A 1JL8A 3MLRL 5ILTL 3DMMA 3QO0A 4NT6A 4P23D 1YJDH 4XGZA 5LG1A 3T08A 1GGIL 3IDNA 4NO0D 5DEGB 4NCDA 1CWVA 1AGBB 4QXWA 4NO3B 4OF7A 1S9XA 5GJTL 2C7UA 1FZOB 1KXQE 4K71C 1YEDB 5EBMB 4HUUB 3ESVF 5BRZA 3FN9A 4YFDB 1MF2H 5EN2B 1MCOH 3RJDA 4EQ3A 2P5ED 4AEIL 4OKDA 3U82B 1RJCA 1BZQK 1AD9A 2AVGA 5DMYA 1JNNH 1ITCA 1U58B 2VAAB 4LSSL 4XMLL 3S3SA 3LAFA 2PXYB 2AQ1A 4Q6YA 3BKMH 4G42B 1KB5A 3KYOA 3BZEA 4WWKC 1S7TB 2MNUA 2GQHA 2F8OA 2NXYC 3Q6FA 5KAQG 4I2XB 4K94L 1G7IB 5SWSA 1F8TL 2Q7YB 2VLKA 4XBGB 3JTTA 3BDXA 4OLWH 2SEBB 3G5YB 3KNBA 2VMFA 1H9VA 1A0QH 1WFOA 3KPNA 5C0CA 2YN5A 4Y5XC 3T0EA 2D03L 1HI6B 3ZTJG 5D1ZB 3W82A 3QJHB 2E27H 5IW1B 1DLHB 4GG6A 3NCJL 3O45A 2NY3D 5E0QA 3VGDA 4HKZB 2B5IB 5DJDB 1PG7W 2J8UB 5D1QC 2A6IA 1RQ5A 1WCBB 5HHXH 4DEPC 1SY6L 4ZOBA 1HKLL 3N85L 3S5LG 1R24A 1T1XB 3OAZK 1VACA 3O4OC 3T65A 4CVZA 5DXWA 2HFEA 4YDLC 5IKCB 3UEZA 2VDPL 1YPZF 5GISH 2ORBL 2OZ4L 1A1OA 2ARJQ 1S9WB 4J6RL 1RU9H 1T66C 4YDVB 1A5FH 3K8MA 4GOSA 5DA4A 3ULUH 5DD3H 4C4KO 5FFLA 5HHOB 1JHKH 1XF4B 3MRKA 2FJHB 5TE7L 2CGRL 3EO0B 5FIEA 5JW5A 1FIGH 1CK0H 4W4OC 1V05A 4BKLA 5CIPB 2XPGB 2CPCA 4L9LA 1YJDL 4DVBB 4QRUA 5KN5A 2XYCA 3H9ZA 3S7GA 4U0RC 3MA7B 4OD2B 3RGVB 1OT1A 2NY0B 4I9WE 4PRHE 4JG1H 4UQ3B 5BV7H 1V7MH 4IMKC 3VXOA 3X13B 3VWJD 1NGYA 5ETUA 5D2LE 1MF2L 1IGJB 4HUVA 1MCOL 5CS7A 4FTVD 1NFIB 2BVYA 2XWJA 3EOBA 3KS0J 3FQUA 2E7BA 4GRLB 4FXLA 3KPSD 4DOHB 1JNNL 3VFSB 5C08E 3FFCB 1OLZA 4XNXH 4D9QD 4JZJB 3BKML 2OJEA 3SKNA 4ZQKB 5DK3A 1XIWB 1YMMD 4Z5RA 5DEFA 3GK8H 2O61B 1I9JH 4UILH 4BSVB 4OLWL 2FH8A 1A0QL 2HJLA 3PG2A 1I4FA 5HGHB 2XICA 2E27L 2DWDB 4HWBA 4KK5D 3QRFM 4R4FH 3PWNA 5EU5B 3S35H 5E5MB 5HHXL 1U8IB 3BZFB 5EFIA 1RK1B 2D7QA 2ICCA 1NBZA 3FHAA 3OB8A 1XCTA 5FYLE 1Q1JH 3EJJX 5K9JH 3GI9H 1LO4H 2NW2B 2P5EE 3SE3C 4WV1B 4F57H 4HCRA 5EUOA 3EGSB 1W72B 2YMXH 5GISL 4LSPH 4NC1E 3JTSB 4XNUH 1RU9L 3UBXA 4U3XA 1A5FL 1E27B 3T4YA 3ZT7A 3ULUL 1MFCH 5DD3L 3AMLA 3SKMB 5D2LA 4GAYB 3D3VD 3U4AA 3UPRB 4M4PA 3SDDC 5EU7E 5JIHA 3RVWC 1D5MB 1JHKL 5EU3A 3OXRA 3F7RA 2F19H 4G8IA 1FIGL 1QA9A 2P45B 4H25B 1CK0L 1GXEA 4X6CF 3M1BA 1IAKA 4CJ0A 2EDKA 5IQ9B 3KHQA 2H26B 1FNHA 3LCYA 3GB7B 4X6EB 3CDGB 4HH8A 1P6AB 5D93B 2LABA 1MCNA 1RUPH 5BV7L 4JG1L 4O2FB 5I71C 3SE9H 4MQXC 2CLZB 5C0JB 3QO1A 5F70A 4IJ3B 1IQDB 4MA3B 1IQWH 5GGSB 4MDJB 1IAOB 1CXHA 1FG2A 1P7KA 5I73C 2IH3B 5C92A 1MCDA 1JRHH 5E2WH 5CEYA 4Y5VA 4XNXL 4R3SA 4RX4A 3D2UA 4ZPTB 2PW2A 2ZKHH 4YBQC 3WN5B 4P5TA 2AEQH 3VD9A 3GK8L 5ISZA 1ACYH 1I9JL 3WEXA 4UILL 1WK0A 2Q3ZA 4HWNA 3DGGB 4WJ5A 3EFDH 5I2IB 3WO4B 4M7LH 3D0LA 1JZ3A 4NO5A 3KPQB 3KPRE 3RHWF 2AERT 4L3EE 4TPRH 1RHHB 3SDXE 4ZG1A 1QSFB 4R4FL 5IB5A 2MKWA 2E7LC 5SX5H 3S35L 1KLUB 1NC4B 3H9HA 2EICA 4QRRD 1UKSA 3KPOA 5DTFB 3RNQB 3SOBH 2GTWB 4QF1A 4I3SH 5GRVL 4WIQA 5B3JE 1Q1JL 1IZKA 4NO2A 5ITFB 5K9JL 1ZVSA 3GI9L 1LO4L 3A6CH 1OGAA 2VR9A 4U1JA 3RZCB 4F57L 3OWEA 1JCKA 1TCMA 2W1NA 3RVXC 5DSCA 2YMXL 3UTTB 4XCCH 1CFTA 3BQUD 1U8KB 4LSPL 2I24N 1UXWA 5D7JD 4XNUL 4XHJC 3C5ZC 4WHTA 3OMZA 5KSAC 1U0QA 2GY5A 5HI5C 2ZZUT 2HKFH 1MFCL 2B1HH 2OI9C 1U8QA 4YHZH 5CJ5A 4W81A 3DO7A 3GSNB 1BJ1J 5CD3A 2YA0A 2F19L 1ETZA 3L3HB 2VIRA 3GSOA 3EYFB 2MOVA 4TVPH 3G5ZA 1U95A 2ICWA 3BAEH 4PBWD 1EA9C 2X70A 2CUHA 4K7PX 4X9IA 3MV7D 1RUPL 3SE9L 4RGNB 5DDHA 4F2MA 3MRRA 4GKNB 2CK2A 2AGJH 4M8VA 3MMEB 3ULUD 3UBXG 2WLYA 1TQBB 1OD7A 3MRPA 1IQWL 3KPRA 1KF9B 3DXAD 3SN6N 1A2YB 1CLOH 1S3KH 3P9MB 3SDXA 3NPSB 4KJYB 5B8CA 3MBEC 4NZRH 1JRHL 4J8RB 5E2WL 5IHZB 3DRTB 3CFJA 1F4YH 2ZKHL 1E6JH 5J11B 3IAQA 2CKBA 5JLZA 2AEQL 5INDB 3JZ7A 1ACYL 4TSCH 3RUGB 1FE8H 1I3UA 2WWKO 4R7DA 4Z7QF 3AFLA 3IDYB 5KVFH 3EFDL 4M7LL 4PY7B 3S6CA 5T1KB 3SPVB 3W11D 4CVUA 3QYCA 4PJDF 5C0AB 1ZLWK 3OKDB 5ICYA 2YEZA 3PWVB 4TPRL 4ZUUA 2P7TA 1E4KA 2ZOKB 2HN7B 4ODUB 4MJ6B 5C6PB 4DKEH 3GMMA 4GT7A 4NYLA 4PJ5B 15C8H 3ROOA 4A2LA 1CD1B 4OQTH 2FHFA 3EOAB 3SOBL 1YDPA 4I3SL 5JOFB 4ZSOE 3MRDA 2FHBA 2IBZY 3A6CL 4L3CB 2E8YA 5BOPA 3VGFA 1YN7B 4NWTH 1X5LA 1WBZA 4XCCL 4NC2B 3VFNB 4MD0B 4UOW1 3S35X 1RJLB 2R1YA 2JCCB 4MJID 1X4ZA 4Z7WE 3LKOB 1OF2B 1DVFD 3BH9A 1JWSB 4MD5B 2HKFL 2B1HL 2VXSH 5T5FH 4HULB 5F3BA 4HT1H 1UH4A 4YHZL 4WVRA 1HKFA 4X80H 2JIXA 4M61B 4M6NH 3VXPA 5DRZB 3PWPE 5DQ9A 4QCIB 2YZ8A 4JVPA 4P4KA 4V1DD 2DLHA 4LIQE 1NGWA 4TVPL 4PLNC 4Y19E 2BVPA 2V5MA 3BAEL 4KDTA 2VB5A 2YD6A 3BP7B 1I3RB 4BELD 1FZJA 1T7ZA 4WO4A 4QRRE 1HH9A 1NBVH 4CNIA 2DIBA 5C0EB 2YXMA 2AGJL 2EZ0D 1I1CA 2XKUA 2VLRB 1WBYA 5F88A 1GVIA 1VCAA 5FAAA 3UYRH 4XXCA 3EDKA 3KPPA 2R2HB 4ELKB 1TVBB 1CLOL 2BSSB 1S3KL 1Q9LA 2OZ4A 3V2AR 1RFDH 2WP3O 4NZRL 2CO6B 2H32B 1OPGH 3FJTA 5I1DB 3RDTA 1F4YL 3WFHB 4BZ2H 4I3RH 1E6JL 1F42A 4JKMA 4P49A 4U6YA 3QJFA 2H8PA 4ZSOA 4UDUB 1N4XH 4FFYH 4TSCL 3ZKQD 3JV6A 1FE8L 3T2NH 1RMFH 4JFOA 4UI2A 5KVFL 1RZFH 4NZUH 3KLAA 4UNVA 2UWEE 4JJ5B 2OLDA 3MV9A 5IGXH 1KJ2B 2JTDA 5J0BA 5T3ZE 1MHEA 2Z31D 2FBJH 4WTXA 5D7IA 1FIEA 2BSED 4DKEL 2ERJC 2Y25A 4Y4FB 3LKQB 1K5NB 5ICZA 5JIPA 1VGKA 5E95B 5F3HB 15C8L 5CZKA 1OOAA 4OQTL 3QUMB 4RGMC 3PWPA 4K9EC 3G5XA 5J1SC 5DMGC 3MRFA 3L5WA 5TDPA 4OCXH 3JWNC 1MWAB 4LVNB 2CDFB 5LAXB 4Y19A 3K4ZA 3MQIA 4NWTL 1IRAY 1S9VA 3SGEI 2JB6B 2AXFB 4WGVB 5IBLD 4PJ8B 5J3HD 3ARFB 3L3DB 3CK0H 4XWOC 2UVEA 3KJ4C 3PDDA 2XI9A 5K9QI 2BDNH 5J12B 1U3YA 3HE6D 2P8LB 2VXSL 1J8HD 5T5FL 2D9QB 1UH3A 2W59A 4HT1L 4DTGH 2VLLA 1KB9J 4QRTB 1A14H 4X80L 2PTTA 4FQXD 3FTGA 4M6NL 1WTGT 1J18A 4MNGB 4PJGF 2NX5B 5T5NF 2RJMA 4JFDD 1CS6A 5JZ7C 4RMVA 4LASH 1UJ3A 3QCVH 1U8LB 3AY4C 5HDLA 4PG2A 4G7YH 1NBVL 2WINB 4NKMB 5INCB 4Y2DD 3T1WA 3O9WA 2G9HA 4LSTH 3SKOB 3K4AA 2UWEA 4FQIH 3UYRL 2C4XA 3VJ6B 1JTPA 1ZVHA 4FMFA 4MAYD 1RFDL 3T0BA 1JPST 1I75A 1P7QB 2BVOB 1KTDB 1BQSA 5C0GA 1OPGL 4TVPD 1K9TA 4BZ2L 4I3RL 3RWCA 3IDJA 4KZEH 1U2CA 1A6AB 1N4XL 3FQNB 4FFYL 2RFXB 4MS8C 1XZ0A 3M8OH 3T2NL 4FFVD 1RMFL 3OKOA 1VERA 5E94B 2FECI 4G8FB 1RZFL 4NZUL 1PQZA 3GMLA 3J7HA 5ICXB 4TVSa 2HFGH 3DSFH 2A6KA 5IGXL 3H7BB 1U3ZA 3QQ3B 2AJXH 2IC2A 2FBJL 3N1FC 4K3DH 3IF1A 3PGDB 4YEEA 1N0LA 5DFVC 5IV2B 5EDXA 4LSDA 5I17A 3MLTB 1ZHBB 4JKPH 3P0GB 2IPTH 1L0YA 4X5LA 5BVPH 2XQBH 5IB1A 5E1HB 4OCXL 1PKOA 2I25N 2NPLX 3KPLA 4UOW0 4F80A 3SCMA 1S7SA 3JWOC 1N5YH 3ESUF 3KHOA 3NFSH 1ZMYA 3T3ME 3CK0L 4R97C 3D87B 2BDNL 3HZMB 4G6MH 4LPTA 2DOCA 1KCRH 4YBHA 3SGDH 3PF2A 1QFOA 5KSUB 3E6FA 4DTGL 4GAJH 2X4RA 1A14L 4L8DB 4GUPA 4QLRA 2DL2A 2P5WE 2NY6C 1FV1A 5B39A 4G8GB 4EDXA 2YBRB 3OJMB 2ATPA 4LASL 4X6DB 3QCVL 3TYFB 5LWYL 4JPIB 1CT8A 2YKLL 3QHZH 5F1IB 4K2UH 4ZXBA 1WVZA 4LRIC 5T3XE 1VFMA 4I48B 4G7YL 4XNZC 3L3IA 3IU4H 4K07A 4NQTA 4O2EA 1VFBB 4OFYA 1F3JA 5ADOH 1VDGA 1ZGLA 3B5TA 3TO4B 4QOKD 4LSTL 2P44B 5IT2H 1FNLA 3OKMB 2A83B 1UJTA 1D5ZB 3S37X 4FQIL 4HKBA 1GJIA 5FO8B 3MNVA 4JRYE 5FECA 5DD6A 1FRGH 4LQFH 5CZXD 5J4MA 4ZUVA 1W0VA 2B4CH 2PO6D 1H3XA 3RL1A 4X4XB 2MPAH 1YEEH 3C6LC 3QUZC 5MEPA 1QFUH 4LCYB 1J8HE 4MNHA 1ZWIB 4KZEL 4PJEE 3AB0B 3OG6B 3ILPB 1G0DA 3QCUH 3M8OL 2ENYA 1M6OB 3GMNA 3NCBB 2EXYD 4CJ1A 4P3WA 1ZLWH 4I18A 1D9KB 3FT2B 4WU7B 2HFGL 2YD5A 3DSFL 5DVMA 3MRMA 4XAKE 2EDHA 4M03A 4KI5E 1MI5B 2AJXL 1WLHA 1GZPA 1MRDH 4K3DL 2OTUA 3V7AE 4JFED 1G7LA 1NDGA 2ARWA 3NIGF 3F6IA 4P57B 1JF1B 4MA8H 4JKPL 2DTSA 1N8ZB 2IPTL 2EDWA 2P5WA 4LLWA 4W6WB 5BVPL 1HWHB 2XQBL 3QIUD 2P1YA 4EN3B 4LKCA 4NQDE 3VG9B 5HTSA 3FO9B 4BSWA 2IF7A 2D7OA 3O11A 2EEDA 1N5YL 3NFSL 1AHWB 3AXLA 1O0VA 3WDHA 2CIKB 2DM7A 4NC0B 4TVPE 4FZEH 1IGFH 2OXGA 1VFAB 4Z6AT 2X09A 12E8H 4G6ML 2ZNWA 1KCRL 3IFOB 2D31B 1S7VB 5JIIA 1YNLH 1L6XA 4JRYA 4GAJL 2CMRH 2GT9A 3H3PH 3HTLX 5D5MA 3H9YA 5MENB 5E9DD 3DX7B 1CD9B 2PYEB 3IKKA 3QHZL 4H88H 4K2UL 2NY1B 1PGRB 2AS5M 3VXNA 4HEPG 5J13C 3IU4L 4DJMA 4KXZH 5ADOL 1AKJD 5IT2L 4J3VA 3ZE2F 3MLZH 1NPUA 1JK8B 1ZA6A 3ZHLA 1G0XA 5CIPH 2H9GB 2OR8A 3PDOB 4ELMF 3VE0B 1FRGL 3LSOB 4LQFL 1C08A 3LEVH 1GIGH 2B4CL 2MPAL 1FNFA 1YEEL 4YHKH 4WEBH 4DUWA 5HHVH 1ZV5A 1QFUL 3LPWA 1KTKE 3UC0H 5BOZG 1UZ6F 4HMEA 5DJ6A 5GRWA 4TTDC 3FCTA 4NQDA 3VXTB 3QCUL 1BIHA 3V4UH 2A73B 2R15A 2BK8A 4Y16A 4PTUA 3W9DB 2VISA 5ADPH 4JM2C 3P4MA 4OZGA 4NPYA 4OIIH 3OV6A 4H8WC 1CGTA 1HSAA 1CQYA 4P9HH 1MRDL 1PZ5B 3MV8D 5D1XB 5FKPA 3OB0H 3DV4A 2OX5A 3P4LA 4S0TD 1T3FA 3F7VB 3L3KB 4MA8L 3I6GA 5D2NE 2AJZA 1C7SA 4G3YH 2BNUA 4XNQA 4UV7H 1AGDB 4XRCB 3ABZA 5ESQA 3CX5K 1GOGA 4ZDHB 3NCCB 4CRPA 4B7LA 4KPHH 5CGYD 3UTSB 3WFBH 2V5YA 4JZOB 1H3UA 3BVNB 2EDTA 4U6VH 5SWZB 1XF2A 4FZEL 1IGFL 1CI5A 5HGAB 2HT3C 4PJBF 12E8L 1Q8MA 2WSKA 5IVNA 3Q5OA 3CC5B 1F6AB 1MVFA 1YNLL 1C8PA 3BH8B 1I85A 4FN0A 4PJ9C 1CBVH 2CMRL 1FL6B 3H3PL 2VKXA 4R96A 3IB4A 3V6ZA 3O2DA 1W72H 3TJHC 3DUUA 1BZ7A 2OTPA 4XPFH 2QBWA 4H88L 1L0XA 3VRLE 3WHE1 5CGTA 4GLRH 2WZPD 4RBPH 4EIGB 3VGHA 2OYPA 5FGCB 1NBYB 5DHVA 4PP2B 5BRZD 3GKWH 1BZ9A 1KLGB 3LRSA 3ARDD 3ARWA 3MLZL 1CIDA 5ERWB 3Q5TA 1A4JB 5BW7C 4IIQC 4BH8A 3LEVL 1GIGL 2X2YA 5DFTA 4HUXA 3DX8B 4D0BA 4YHKL 1F3RB 3FN3A 3VXUD 5HHVL 5DRWB 5D2NA 3UC0L 1GZQA 1TXKA 2IANE 3BIBX 1U91A 3V0WH 1LP9E 3EJZD 3V4UL 2PW1B 3OX8A 2FEDD 3GSQA 3HUJE 3UPCA 5ADPL 1KJMA 4O51B 5F9WC 3FRPA 3FAXA 4JLRB 3ARGA 1N59A 4P9HL 1MJJA 2HLFC 1A7QH 3STLA 3ZKMD 4O5LH 1PAMA 2X89A 4G3YL 1CXLA 1WWAX 4UV7L 5IVXE 2YPLE 2R23A 5JUEH 1FBIH 3BD3A 5C0FB 4F8TA 1ZSDB 4HS3A 4KPHL 3WFBL 2GCYB 1MJ7H 1I1AC 3LV3B 4U6VL 1CG9B 4NN7B 3NZHH 4LDLB 3UTQA 1G9NC 1EZVY 3O2WH 4QT5B 5DYOB 2V17H 4XPHH 5DS8B 3IJYB 3DLQR 4JO1H 5GJSH 1W72L 2XQYG 5EBWA 4PB0H 3MZTA 2B0SH 4YAQA 1W0WB 4OFKA 4XPFL 5D1ZD 2IANA 1MUJA 3GMOA 4ZFFB 4I0PA 3KPMB 4R7NB 4PUBH 4EJ1C 3MCKA 3GBMH 3SE8H 2DYPA 4ONHB 1WFNA 3QH3A 2P8PB 3GSNH 5IBTH 3GKWL 3B6SB 1NMCC 5H2BA 1D6VH 2BCKA 4EUPB 3NIFF 4OD3H 3PQYB 5I8EA 4X0KA 4JFYA 4UOJA 5EC2A 3OJDA 1Q9OA 1TZHB 4NRXA 3BWUC 4LMQI 4QRSB 2OXHA 4HG4J 2R39A 4EI6A 5C0DA 2BOCA 3LEYL 5IVXA 4OUOA 3V0WL 2YPLA 2BFVH 3M07A 4XHQA 1H5BB 1WFTA 4HIHA 4P4RB 4NM8H 5LVEA 1I7ZB 3EW3B 3W9EA 3ZDZF 2H1PH 2BHYA 2PKDA 4YLQT 5T1MB 3N1PC 4P59H 3SDCB 1MPAH 1EXUB 3GRWH 4X6BB 1BOYA 1CTNA 1CDYA 1SVZA 4Y4HD 4JN2B 1UM5H 2EYTA 1A7QL 1EBPA 1D7FA 2R2EA 1MIMH 3RGVD 2NY0D 3LEXA 4O5LL 4M7JH 3LD8C 2Z9TA 2OQJB 3S3PA 4P5MA 1BJ8A 5JUEL 3JXAA 3B2UD 1FBIL 5E1AB 2FO1A 4MB3A 3ZHKA 3VCLB 3V52H 3FB5B 4AT6B 1MJ7L 4X5WA 3OXSB 1QLFB 1DEDA 3T0VA 3H9SB 3FKUS 4PREB 1P5VA 4XMKH 3NZHL 5M94B 4N1CA 3HKFA 2XWTA 4K8RL 3O2WL 1XIWD 2V17L 1D5XB 3DNKA 4XPHL 4U1MB 4JO1L 1X44A 3I85A 1QZ1A 3O3EB 1U8OA 5GJSL 2N4IA 4U1GC 4PB0L 3QI9A 4MB5A 2B0SL 4N90D 3WHE0 2DQDH 1Z3GL 3DRQA 2AJ3B 2R2BB 4U0QB 4F7PB 2NZ9C 4M6MH 5DJXB 4PUBL 3L3OA 3K46A 1JPGA 4LCUA 2BSRB 1XMWA 3GBML 3SE8L 3RTQC 4P3DB 1LO2H 4MXWH 5LGKA 3GSNL 4I5BB 5IBTL 1DQQB 3CFBB 1ACZA 1AC0A 1D6VL 2A6JA 2R0ZH 1UM6H 3D0VB 4OD3L 1HK6A 4WW2B 4RFNC 5I66A 1NBQA 1S9YA 1YPZA 4U1LB 1HQ4B 1OP5K 3TF7C 4X6FA 1I9RH 2WQRA 3D2UD 1RI8A 4LSUH 2YRLA 3ET9F 2XQYK 1UVQA 3B9KA 3VW3H 5CINH 2BFVL 5J89A 3ZDXE 4PJCF 5HYJE 2OL3A 5HGBB 4Y5YA 5KVEH 3CFIC 4ZAKA 4NM8L 4LOUD 3RIFK 4JDVA 2H1PL 4ISVA 1YEGL 4PRIA 1CGSH 4P48A 4P59L 4JM2F 1F5WA 1MPAL 4RDQG 4YHOH 2H32H 43CAB 4YHYC 3GRWL 5F21B 1RIVH 1CZ8H 4XI5D 3GMPB 1UM5L 2Y36H 2E7CA 2J8UE 4PJFF 2FR4A 1MIML 2BC4B 1WZMA 2X4PA 2UYLB 4M7JL 1VPOH 3OKLB 3X3FH 2EYRB 5FOJA 1EHLH 1OGAD 4X5XB 1SEBB 2EIZB 1FLRH 4ZUTB 3G04A 1RJYB 5JPMB 3DIFA 1KJ2H 1R5WA 2IAMC 2EC8A 1WC7A 3V52L 3BESR 4MJ5B 4JG0L 2NY2C 1M71B 4N0FB 4NO3A 4ZUSA 2LAAA 2WANA 2XKNA 3VD7A 4XMKL 3QUMH 4Z7VB 1CFVH 1FFOA 2QSQA 1NAMA 5DK2A 5JMOC 3MYJA 2OP4H 1IFHH 4P2OC 1C12B 4QO1A 5HHOE 3ULVH 2IADB 1MWAH 3KYNA 3AM8A 2HTLC 4D8PB 3SJVA 3PE9A 4W4NA 4X6CB 3FHQA 3MNWB 3VFOA 4V2CB 1IM3B 2VAAA 1A6ZA 2DQDL 5DO2C 4TN9A 5C3LD 4UDTB 4M6ML 5HJ3A 4JRWA 1QSFD 5HYJA 4HMCA 3RZWA 1LO2L 3VFGH 1ND0A 4MXWL 2J4WH 2XZQH 3TZVB 3HE7B 3PDGA 5KSVA 4LPWA 2R0ZL 4K8RD 4Q97A 1UM6L 1OW0A 2VZVA 1DLHA 5EO1A 5AAMA 1I8LA 3RZCD 1QPXA 1WZLA 4NOBA 3BEWA 5C09E 1Y18B 1WCBA 1I9RL 4DKFH 4LSUL 3FFCE 2ZWLT 1VADB 1V8HA 5JNYB 3VW3L 3L3GB 1KLFA 1ROWA 4TNWF 5CINL 2HTKD 3ES6A 4AEHH 5EOCH 5KVEL 2W65A 3HN3A 3D18A 4D0DB 4QHKJ 1CGSL 1D6EB 5E03A 1T22A 2NR6D 1V3MA 4YHOL 5KW9H 5B4MD 5E6IC 1RIVL 3BMVA 1CZ8L 2Y36L 1UB6A 2AV7A 4LNRA 3T0WA 5EBGA 3ULSB 1XF4A 2FJHA 4RGND 4ZOAA 1T1WB 3OTTA 4GJTB 1VPOL 4ODSH 5EIVA 3X3FL 1EEZA 4H26A 4GRMB 1EHLL 3P4OB 1FLRL 3UPAA 4GRWF 1KJ2L 1R3IH 4P2QB 3HG1B 2XNAB 4PJXF 4GW1B 4Z7UE 3JUYA 3RFZC 5IK3B 4KKLD 4G6KH 4UQ3A 4WFGD 4F37K 5HPMB 5IJVA 3HZYA 5IWLC 4LCWB 2Z4QA 3QUML 3O8XB 1CFVL 3O4LE 3FB8B 3L9RB 2OP4L 1IFHL 1ONQB 2DJSA 3ULVL 1MWAL 2NLJA 4XCEA 3QUYA 1FORH 2C9AA 3SGKA 5GS0C 4M5ZH 5F9JB 3RWIB 3IU3A 2X4TB 5C09A 4HUWB 4HJGA 4E41B 4KRPB 1A6UH 4KKBC 2Q76B 5C0AD 4U2YA 5ENWA 3BE1H 3EO9H 2GSGA 4PD4K 1WV7T 1QRKA 4DCQA 2V5SA 3K2MC 4HJ0D 4PJ5D 2C4FT 3B9DA 4H1LA 2VUYA 3VFGL 5IR1A 2J4WL 1X5AA 2QV2A 2XZQL 4NGHH 4TTGA 2VE6B 1QSEB 3MXVH 3HCVB 1S7UB 4UTAH 1FNEB 3TPKA 3I50H 3ISWA 4HDIA 4YPGB 5B38A 2DM4A 3HC3H 1DEEB 3BZDA 1HHJB 4Z0BH 4QHUB 5D7LA 3REVA 4DKFL 3ETBF 4U3HA 2IMMA 4CUCA 2Y07H 3CH1A 4R0LB 4MVBD 4U7KA 4Y89A 1LO0H 2GSIA 4GKOA 1QLRB 2D0FA 4AEHL 4I3GA 5EOCL 1I1YB 5IB4A 3RKPA 1P9MC 3MRCA 3TVMC 3H0TB 4Z7UA 4NUJB 3U48A 2PTVA 4I77H 5D7SH 4F3FB 3KLDA 3U0TB 5KW9L 3WMSA 2NY5C 4LDEB 5D1QB 1ZANH 2ID5A 4N9GB 3O4LA 5DJ2B 1QSFE 1YUHA 3UPRA 3QIBB 1DBJH 2ZCLH 5DQJA 3U0WH 3TBYB 4JAMB 2ZP0T 3QUXB 3C6SB 5JOPE 4ZFOB 4RAUA 1KXTB 1NC2A 3CFCH 3MFFB 5C3TA 4H25A 4ODSL 4MSWA 2VLRD 2EDOA 4B41A 4JGJA 1KCLA 1BVKA 1X5XA 3HI1A 4YDJB 1MEXH 1R3IL 2EE2A 1WWCA 1MCRA 4KROC 3UTTE 4C83A 2W0KA 4G6KL 2CR3A 4IOFD 4O2FA 3QIWD 3HMXH 2BVUA 3W0WE 1MQKH 1X5YA 3GSVB 4CN4A 4WWKA 4YXLH 3RVUC 2QQNH 2WIIA 1T03H 1R3JB 3AREC 1TVHB 3LB6D 5BQ7A 3CMGA 3ZE0F 5C71A 4L4VE 2J5LB 3HLAB 1FORL 2GUOB 4M5ZL 2P8MA 2LTQC 3BJ91 1OP9A 4J3WA 5D9SA 2VTFA 5C07A 1FSKC 4IRSC 2CDGA 4Y5XA 1A6UL 4JFFA 1TZIB 2FSEA 3TFKC 4PRDB 2AK4B 4U0RB 1VKXB 4F7CA 3QHTC 2AJVL 3BE1L 5JW4N 5F7EH 5IB2A 3V0VB 1WJ3A 3EO9L 3WS3B 3BGMA 4FHBD 3VDCA 4O2CA 2W0LA 1BFSA 1N2RA 1EGJH 2RQ8A 4NGHL 1A7BA 1IC4H 1T89C 5KG9B 1I8KB 4UTAL 3NN8B 1MNUH 3ARTA 4PYHA 3ULVD 3I50L 2QADB 3B83A 2KQMA 2ICWJ 5DZOA 1RHHA 1G7QA 3K81A 3HC3L 4XBPA 5C0BE 1T0MB 3HNVH 2NYYD 3F6LA 3V95A 1HIMH 5J9PB 4Z0BL 1RZJC 4PJ8D 4RGOH 3ARFD 2Y07L 3DROB 1OCWH 1KGCD 5IROA 4NQXA 4PJAE 3CSBA 1LO0L 3LN9A 4NQEB 4FA8A 4OUUA 5ITFA 3RUGE 4CU6A 3MJ9H 1FL5A 2A77H 2BNRD 4U1SB 4W4OA 4XX1E 4Z7OE 1Q9WA 4I77L 4TRPH 5D7SL 3WJJC 2NX5D 1Z5LB 5DJAA 4U1KB 1T4KB 5DF0A 3W0WA 3U4EB 1ZANL 1CIUA 2YWZA 3N06B 4F33B 1JGDB 5B38G 1DBJL 4L4VA 2ZCLL 4IMKA 4LHUA 3U0WL 2EIDA 4I4WB 3QWRD 3EBAA 3CFCL 3U46A 3LKPB 2W60B 3MACH 1NCTA 5DUMH 1J1OH 3DVNA 2J2ZA 4BFEA 1DUYA 4LAJH 5DRNB 1MEXL 4N0UA 1VEMA 2BNQE 3OL2A 1OAQH 2X6MA 2ZUYA 4U4BA 4RNRB 3T0EC 5MEQB 5EU6A 5HGDA 3VFRA 1KT2B 2JCCE 3HMXL 1MQKL 3FB6B 3QRGH 4M6OH 1NEZA 4YXLL 2QQNL 3SDDB 4L4TA 3MRLA 4NRYB 1T03L 3PIQA 4MQ7A 2X5PA 1JV5B 4K3HA 4M8QA 2BZDA 3R0NA 4PJGB 3CGTA 4HHAB 3P9MA 1H8OA 5C0BA 2X4OB 4LBEA 1FN4B 3RIAF 5TQ2H 1TFHA 1HDMB 3B4NA 4ZXBD 4PJAA 3IDGA 5F7EL 5KSBF 3LKSA 2LFGA 1TTUA 2PNDA 3D69A 3W39B 4UAOB 4OFYD 1S78D 4OLEA 2YC1B 4UTBH 1DE4A 3TV3H 1EGJL 5I1LA 1IC4L 5FM5O 4PY7A 3Q3GB 3CU7A 2Y7QB 4EI5B 1MNUL 5CFHA 4H5SB 3FB7B 3SE3A 3HPJB 5I1AA 3RX7A 4PRBB 3C8KB 1NJ9B 5IHBA 3HNVL 3KDMB 1HIML 4L29B 2HJKA 4RGOL 3VA6A 1XGTA 4AZ8A 2WBJB 4QTHA 1OCWL 5JOFA 2J88H 4HZLB 5A3IC 3TPUA 2EXWD 4ALAH 2MHAB 3MJ9L 2BNQA 2FWOB 2A77L 1UWEH 1RJZA 3D39B 4TRPL 1I7UA 1XGQB 4G9FA 4WUUB 2VDRH 4NQUA 2NY4C 3KG5A 2M8XA 2VH5H 4X4ME 5L2KB 4MD5A 1BQUA 3BW9B 4NN5B 1T7WA 5L2JB 5IEKA 5DJ0B 2XZZA 1HHGA 2FO4A 3BN9C 4WEUD 4QCIA 3TO4D 2MWCA 4JRXE 3MACL 5DUML 1J1OL 5IM7B 3QA3A 1NGXB 4OLVH 1OAQL 2VQ1A 3RHWK 5HYFA 4IRJB 5F89A 4FOMA 2Q8AH 1AIFB 1DTUA 2CRYA 3LS4H 4HLZG 3CVHA 3QRGL 4M6OL 3SQBA 2C26A 3L6FA 3SDYH 5GXBB 1TJGH 25C8H 3MGTA 5T1LB 1J0HA 2JE8A 3WLBB 3RVTD 4Y1AE 3VXRD 4MNGE 2J6EA 3EYSH 4PPTA 3H3KA 3IAPA 2FZ3A 5F71A 5TQ2L 4Z9KB 3RWFB 3U36B 3WIHH 1MI5D 2E7LA 3L5HA 3JWDH 4WWID 2I9TB 3VXSA 4UTBL 3TV3L 4U6HB 2NY7H 1JN6B 4Q6IC 3F7QA 5DRXB 5K9KB 5BXFA 1KACB 2VN7A 1CD8A 1Z9LA 3CZFA 1HHKA 3O81A 2A38A 5DUBA 3TNMA 4OFPA 3H7LA 3CZJA 1CICB 1F3DH 3C5ZA 5JW4M 5KSAA 2DMBA 1D5BB 3AVEA 2J88L 4JRXA 1AGFA 4LVHB 3PP3K 4WI6A 5LAXA 4EUPH 1WZKA 4ALAL 1J0JA 4KHTH 3VH8G 1EH9A 4WI4A 3FO2B 1UWEL 5L88H 4B5EA 4X99A 5BO1H 2VDRL 5MEND 3D48R 3HC4H 2APFA 2VH5L 2ED8A 4YNYA 1U36A 2PYED 5C86A 3BKJH 2AQ2A 4YX2H 2VLME 5C8JB 1PG7X 4Y1AA 4P5TC 2CH8A 5AAWA 3GMRB 1DLFH 4PJHF 1KXVC 4Y88A 1TNNA 3KXFB 4QXTA 4Y4KB 4ZD3H 2Z93B 3BUYA 4OLVL 4MHHI 2PETA 4Z8FH 4OGZA 3MBEA 1PY9A 2Q8AL 3X11A 5GS1B 3LS4L 2APWA 4ZFZB 4JPKH 1T6VN 3ARBB 1DBBH 1M7DA 3QFDB 5F1NA 5T5NG 3SDYL 1Y6MR 4YXKH 1TJGL 1Z0NA 25C8L 4YO0A 3W81A 5BS0B 2PYFB 2V7NB 2IFGA 4KK8C 4APQB 3AMKA 1P7QA 4HKJB 3EYSL 2NY3C 4M1GH 4G8GE 2Q6WA 4WEMB 1G7HB 1A1MA 4L1DA 5GZND 5HDBE 4FFZH 1JMXA 2O93L 3WIHL 3TCLB 3JWDL 4RQQB 5D1XD 2RFXA 4WFED 4CDGC 4QHKI 1BD2E 3MJGX 4MYWB 4NKOA 1JWUA 2NY7L 1P2CB 3S34H 3R8QA 4FG6D 2EYSB 1AFVH 3SY0B 3INUH 3BP6B 1A3RH 2R1WA 2FEEL 4P2RA 1J11A 3QQ4B 3UTSD 4N8VB 4BQ6A 4WHYH 4FXGA 4MDIA 3QFJB 5CLWA 5SWZD 1KSRA 2D4DA 2EDRA 4YDKH 3FMGH 4G9DB 4OKVB 3D1MC 3IETB 1P84J 1AGCA 5I76A 1AGEB 5CGMA 2APXA 3C08H 4KHTL 4JCLA 3RWEA 5L88L 3MR9B 4YZFE 5BO1L 1A8JH 3OQ3B 3HC4L 2ERJB 3SQOH 1MI5E 3GJEB 3TCXA 2XT1B 3BKJL 3N1GC 2AQ3A 4YX2L 4IDLA 3QNZB 3VWKB 2JJSC 4UUJA 1JNHA 5DHXB 2Y6SC 1MOEA 1NMAH 1ZS8B 3CLEH 1DLFL 3OG4B 4G8GA 4ZD3L 1MAMH 4R2GB 1CDJA 1INEH 1U8NB 1Q9KA 4JFXA 4PGBB 4ELMA 1CGXA 4Z8FL 2XKSA 4I48A 4GG6F 5CKAA 3U7YH 4C4KT 5J8OA 5DI8A 3TN0B 1BD2A 2I5YH 4MLSA 3M45A 3NGBB 1HQRA 4JPKL 1DBBL 3Q2CA 3FT4B 2NXZC 4YXKL 1H0DB 2R0WH 3VXQA 2DI7A 4TQEH 3LN5B 4L8CB 4M93C 3RVVD 4DN4H 3PWJB 2RCSH 4M1GL 4X4XA 4KK5C 5CEXA 4FFZL 1J87A 3HPLB 3HNSH 1YN6A 5H94A 1BBJB 5FK9A 5K9QG 3UZQA 5KOVC 2NW3B 3S34L 4K94C 3FT2A 3EO1B 4MZ3A 1AFVL 3MRJA 3INUL 4RAVB 4GW4B 2EH8H 4NRZB 3TBSA 1A3RL 3L7EA 1OTTD 1EAJA 1KPUA 1GHFH 4P23B 5IG7B 4MMXC 4HIEB 3OR6A 4LGRB 4NO0B 1HCVA 4HKXB 4HFWB 1YYMH 4LLAA 4M7ZC 4YUEH 4MCYB 4YDKL 4CL7A 3FMGL 4PJBA 1XFPA 5FB8A 4KKCC 1WIPA 5IW6B 3LQMA 1MCSA 2EIBA 2HFTA 2VITB 2DMKA 5ECJE 4Q0XH 3FO9A 1HEZB 4HC1A 3A6OA 3C08L 5F96H 5EZLB 4NM4H 1R3KB 5C70A 3BXNB 3MO1A 4B0MM 4QKXB 1KNOA 1MHCA 1KPRB 1T0NB 1GYAA 3AY4A 3SQOL 4ODBD 1JHTA 3RDTC 3IT8D 4UU9A 3ARUA 4NHCH 5IHUH 3LKRA 1NMAL 1P5UA 1FVDA 3CLEL 5I1GH 1A4KB 1GGCH 1MAML 1XAUA 4IMLB 3UTPD 1INEL 2VABA 2WUCH 4QHMA 5C0IA 3MLUH 2DM3A 4DK6A 3PQYD 4R97B 5ESAA 4EIZC 3UTSE 5FA3A 4ONOA 3U7YL 1YJDC 3Q6GH 5SWZE 2I5YL 2QHLA 1KCVH 5I75B 3ORJA 2X1QA 2APTA 4HXAH 4PRPA 4TYUA 2R0WL 43C9A 1CLZH 4CMMA 1OTSD 5FCUH 3PABB 4TQEL 2NY6B 4FQHB 2GAZB 4KK6D 4DN4L 3IFNH 2RCSL 5IF0B 4R4BB 3SDCD 4GBXA 1T1YA 1T80A 4OZFB 5JW4Q 2FX9H 2AABH 4N1HB 5F7NC 2FL5B 1CR9H 3G08A 1GOFA 2FYYB 3V6BR 5EC1A 3QXDA 3UCRA 3HNSL 1JYXA 4YHLH 5FGCE 1KIRA 4YFEA 1DDHB 4F7EB 5D2LF 2E9BA 2F58H 3C5JB 4KUCF 4NKDB 4AJ0A 4JKWA 5I74B 2EH8L 3SDAC 1KYOJ 2YPKA 3I84A 2NCMA 2ESVA 3ARRA 1YMHA 3QNYB 1GHFL 2R2CA 3D85A 4LF3A 4PS4H 1Q72H 2GJZA 2DDQH 1YYML 4YUEL 1F2XK 3H9SD 2HYMA 3SBWC 4ZAKD 1O5DT 4R9HA 4Q0XL 3VWJB 5MEOA 2FIKA 4ZDHA 5F96L 3WNLA 4NM4L 1F11B 2EE9A 3WNNA 4PRAB 5JTWA 1BGXH 3RX8A 4P5KB 3HR5A 4NQCB 1OB1B 2P4AB 3KPSB 1OAKH 1T1ZB 1U6AH 1MFDH 1UB5A 1HXMB 4LRIA 4M7KH 3MRQB 3OKEB 1V3LA 4NHCL 3VD4A 5IHUL 5E99H 2ZJSH 3GJFB 3T0XA 3LIZH 5I1GL 1R0AH 1GGCL 2DQEH 4JO4H 3FONA 2WUCL 3TJEH 1SMOA 1FZMA 3MLUL 4EKXA 5E8NA 3IKCB 1JJUA 4DZ8B 1UQSB 1MHHA 4JFQA 2V2XA 3Q6GL 3C6LA 3QUZA 5FUZH 5GS2H 1UENA 1KCVL 2VZ3A 3U30B 4P3CH 2CRMA 4W6XB 5BV7C 4HXAL 1WICA 3L95A 2F8VA 3WBDA 3OKYA 1CLZL 1ZK9A 3SJVD 5FCUL 3TBWA 1MRCH 3W11C 2ICEB 4J3TA 2BY3A 1FYTD 1KC5H 1CDHA 2EO9A 3IFNL 1QHOA 3WSQH 4YXHH 1CFQB 2FX9L 2AABL 4XPTH 1CR9L 4HX1A 3JV4A 1SVCP 4EOWH 3QXWA 5F7KC 5D8JH 3DI2B 4YHLL 4ENEC 2Y23A 5IOPA 2F58L 2YUZA 1U8HA 3G5VB 1EV2E 1MH5B 2D7PA 2Z8RA 1AI1H 4YHIA 3PQYE 3UAJD 5F6HJ 5GGUB 3KLHC 4XC1H 4P46B 1DQJA 1DVFC 4PS4L 1IL1A 5FGRA 1Q72L 1MSPA 2DDQL 5M7QA 2WWKT 4WW1B 5KVMC 5IIEA 3T2OA 4OF3A 1CFSA 4K7FA 5F7LB 3TC9A 1C1EH 3REWB 3O6FC 2G75A 3L5JA 3WUWA 1RAMA 4EVNB 2ZSVB 3LV3A 1BGXL 2CRIA 3SDXF 1GAFH 5IMMA 2IMNA 1UCBH 4LMQE 1OAKL 1TQCB 1U6AL 1MFDL 1DSFH 3IS1X 4M7KL 2W0FA 5J6GA 4F15C 2MTPA 2EZ0C 32C2B 4JFPA 5B3JF 5E99L 2ZJSL 2AXGB 4HIJB 5J56B 3TZVD 3MLXH 3HE7D 1R0AL 2DQEL 2VZUA 4JO4L 1YNTB 1QLEH 1ZT4B 3TJEL 1IKFH 1KIPA 4L8BB 3S4SA 3KPMA 4DN3H 4OV6F 4OZIE 4Z7NE 3RPIA 5MI0B 4LARH 2HT2D 5FUZL 3O3AB 1Q94B 3H9SE 1I7RA 3BP4A 5TF1H 4P3CL 4ZFOL 3VU2A 3HZKA 3CDYA 5FYJH 4H0IA 1JI1A 3OPZH 1U8JA 2XTJD 3V5KA 4PJCA 1BLNB 5J6HA 3LKNB 1JYWA 1MRCL 3FQWA 4F7TB 1KC5L 3MLSH 4R6UA 1T04A 3WSQL 2Z31C 4JM2A 4YXHL 1N7MH 2HVKB 1KCUH 3BQUB 4XPTL 5CLTA 3T1FB 5D7JB 4BQCA 3MJ8B 2XWBA 4AIOA 1QRNA 4EOWL 2MKLC 3BIAX 5D8JL 4PJFA 3EYOB 1Y6KR 4HH9A 3F12B 1LE9A 2F9BT 5L8LB 4J3OC 4NZJA 3P77A 1NGQH 3MYZA 3SO3C 2VQTA 4X6BA 4M9PA 2HRLA 1AI1L 5IBLC 3OHXB 5M95B 3HG1D 5D7LD 4XC1L 1N64H 1A9EB 5HGGS 2VL4A 3HE6C 4MXQD 2OMNA 3TA3C 2QLVB 1JZ2A 4LCWD 3O8XD 1BP3B 3P4NA 4FQXC 1X7QA 4PJ9A 3ROLB 4HIIB 2V2TB 2ATKB 1NGZB 1C1EL 3TM6A 3FB5A 4OZIA 2ZUSA 2H3NB 4E41D 5KS9B 4U1NB 1GAFL 1UCBL 3V6OC 3LHPH 1DSFL 4PRNA 1ITBB 1ADQA 1U8MB 2CQVA 4JFHE 4X98B 1FVCA 1MLCA 4QHLB 1K6QH 3MLXL 2R1XB 5TDOA 1E28B 4GRWB 3BPNB 2YWYA 3S97C 2EE3A 3FQRA 1QLEL 5EIIA 2AJ3A 1IKFL 4PJXB 1I1AB 4MZ2A 4XNYH 4DN3L 5E7FA 4IIQA 4Z7WF 2BSRA 3MJ6A 4LARL 3WUWG 1DUZB 2Y9RT 3QR2A 2GJ6B 4ERSH 4HS6B 5A16B 5C7XH 4OIAA 1UYWH 4Z7VE 1QBMH 5EWIH 2ITDA 3KYMA 3OPZL 4FFVC 5FYJL 3T8XA 4LCCB 1U3HB 4YDIH 3D0VA 3FOMB 3S3JA 1EMTH 3IXAB 5E6ZA 5C07D 1NDMB 4X6CE 3MLSL 3LQAC 1XCQB 3GM0A 3OGCB 1N7ML 5HVWA 1KCUL 1I1FA 1KJVB 2YRZA 4JANB 1XF3B 5EUKA 3QNXB 4KTDH 5D1QD 5I0DA 4NKIH 3ALPA 1KOAA 1T5WB 3QXUA 5GS2D 1WWBX 4MX7B 5ALCH 3QUXD 2AEIT 1JZ4A 3O41A 1C5CH 1NGQL 4LLUA 2PCPB 2NTSP 1S8DB 4OB5H 3U2SA 1HXYA 3MBXH 1U93A 1K4CA 2VL5B 1HNGA 1N64L 4WY7H 1T66D 1LNUA 4L1HA 3A67H 4OAWB 2UYLA 4JB9L 1T7XA 1WAAE 4NZDA 5D7KD 1HH6B 5FOBB 3RP1A 4OZHE 4NKQB 5JPMA 3AS2A 2UWEF 1OP3H 3H42H 1LK2B 3SKUD 2ARJA 4PGEB 3TBVB 1I8IA 4OI8A 2IBGA 2C3HA 2AK4D 3LHPL 5TGBA 2FJGB 1F4XH 4BFIA 2EDFA 3F65A 5DVKA 1S7RB 1EUUA 1JRHI 3IVKA 2G5BB 3BPCB 2VSDA 4M3JA 1K6QL 3T2QA 1DQDL 3GSWB 1AE6H 5CZXC 1TETH 2EDXA 4OCRH 2QADD 4P2QE 2PO6C 3PNWB 4XNYL 1MCQA 1G84A 4JCMA 5EU6D 2HFFB 1YY8A 3ARGC 3MV11 4BFGA 4ERSL 4XVTH 1HZHH 4KI1A 5C7XL 4L4TD 1XT5A 1UYWL 1LK3H 5EWIL 5E00B 3RWDB 4YDIL 5FO9A 4NQED 3UJIH 3NZ8A 1EMTL 3GJFK 1XGUB 5I18H 5JDSA 5C0RH 1G9EA 4MNQD 3P73B 3DWTA 3PV6A 2YOCA 4BM7A 4EBQH 3GMQA 2WQ8A 5DMJB 1LE5A 3V6FA 2Y06H 1MCBA 1L9MA 3RBSA 5JQHC 2XN9A 4KTDL 5JNYA 3RTQB 5FM5M 4NKIL 1S7QA 1WAAA 2X7LB 5ESVA 4YR6A 5K9OB 4OZHA 4PTTA 3V5DB 4G8EB 2O5XH 5JORA 3QDGE 3QIUC 5ALCL 5CP7A 1U8PA 3NFNA 4U1IB 1QSEE 1C5CL 5FYJD 5I1JH 3QXAA 5IBUG 4YJZL 2JLLA 5I8CA 1BVLA 3AU1A 5GSRB 2X4SA 4OB5L 1ZT7A 1WWWX 3MBXL 1OGTB 4E0RA 4WY7L 1EEYB 3DBXB 1T2QH 2CLVB 2DIAA 3GIVB 4F9PC 4MA1C 1AH1A 3A67L 2VXTH 3ZKXC 5DZLA 4C56B 3QG6A 4GRMA 1Z9MA 3SDDD 3RVWD 1N5AA 4Y2DB 4Z18A 5ID1B 3GUTA 3HAEB 3OKNB 3C60C 4P2QA 3VRIB 3ZDYE 3H42L 4G9FD 1H3PH 1P4LB 3KS0H 3PWUB 4MAYB 1MCIA 4TUOA 1PYWB 3BZ4A 4LHJB 1F4XL 2EKSB 5FYKH 2GEEA 1P1ZB 3L9RA 1AO7A 1IILE 2Z35A 3Q5YA 1WISA 3BIKA 5A2FA 5BZWA 4CMHB 1NSNH 1AE6L 1Z6JT 4EI5D 1TETL 2C3XA 4OCRL 4CW1B 1FNSH 3O3BA 1FO0A 4IRZH 5HVHB 3NA4A 1LO3H 8FABB 1EFXD 1UH2A 5EO9A 2X1PA 4K9EH 3QDGA 4XVTL 1HZHL 1FZKB 2LAGB 2WBJD 2IPKA 1LK3L 2JK5B 4X8JB 1AXSA 2LU4A 3UJIL 2GITB 1LILA 4PV9B 1G7PA 4UZGA 5I18L 5C0RL 4EBQL 1J05A 2HT4D 2VDLH 3D39D 2Y06L 3BYTA 4WUUD 4HPYH 1QO3B 5KSBB 4PYGA 5L0QC 1L6ZA 5L2KD 5DD5H 3MODH 4ORGB 5CWSA 5DD0H 1UZ8A 4WGWB 4X7SH 3VXSD 1LVEA 2R0LH 2O5XL 4Z78B 5I6XC 4NUJA 2BOBA 5I1JL 5IQ7H 4F3FA 3HS0B 1KB9K 4BFBD 4Z77A 2IG2H 3RVXD 5CGYC 2IAMA 1UKQA 2DQTH 5EIQA 3QI9C 5CSGA 5DJYB 3QEQA 2DB8A 4IRJD 3TNNB 1UXSB 1T2QL 5KSAD 4JAMA 4PJEF 3ECBA 2WUBH 3MFFA 3RGHA 2VXTL 4BZ1H 1KPVB 4P2OA 1CGWA 1QR1A 5FF6A 2F5AH 2OJZH 2FLRT 3GSXB 5B21A 5CD5C 1L4IA 5TH2B 1H3PL 2GTZA 4KI5F 3FT3A 1N3NA 1A1NB 4JY6A 2ZG3A 4YIQA 4Y8DC 8CGTA 2V7HA 4PV8B 5FYKL 5CMAA 3JV5A 3VXMB 2Y5TA 4OCSH 4XZUB 4TNWK 3ARDC 1TNMA 3PL6C 1YEIH 4BUHA 4ZTOH 1IGTA 1NSNL 1YY9D 3D25B 1JZ8A 1TZIA 3FFDB 2C1OB 1FNSL 4PLJD 4TUJB 4IRZL 3WS3A 1LO3L 4YFLI 3CFKA 3BP5A 4K9EL 1EHXA 1CICD 4NHUB 1N6VA 4GG8A 1G1CA 3IDIA 4JFEB 4L8SB 5BZDB 3BHBA 2FEDC 1FL3A 4JE4B 3LS5H 3VGAC 1IAIH 3JSSA 3JWOH 4NBYB 4HUMB 1NCCH 2O5YH 2VDLL 5D4QA 1X9QA 2LU7A 5E2TH 5E6IA 4HPYL 2A74A 2B4CC 2YD1A 5DD5L 3MODL 3QDJB 4XVJH 5DD0L 3O6KH 3ZKMC 4KQ3H 4X7SL 1HHIA 2R0LL 3IDUA 3DUSA 4DFIA 5LGJB 3KYKH 4AIZB 1W0YT 4YHPA 1FFNA 3MGOA 4U1SA 4ZPVA 1TCRA 5IQ7L 3MUGB 1BJ1H 1RZGB 4U1KA 4FMKA 2IG2L 2DF3A 4Y4KD 3U0PA 3QAZB 4OZFH 2BY2A 1J9CT 2DQTL 1CFNA 4GKZB 4WDIA 1G7MA 1JVKA 3VFTA 2PXYC 3HAEG 1MLBA 3V79C 5IWLA 2H6PB 3NFPA 1PVHA 2WUBL 1EIBA 3QUKA 3EZ8A 3S88H 5BCAA 4NBXB 4BZ1L 3ARBD 3GGWA 5C9JB 5MERA 4C58B 2F5AL 1BIIB 2OJZL 5BS0D 1JWMA 4FRWA 3WE6A 1ZHKA 3LZFH 4APQD 4JR9H 2A0LD 5D1ZC 4EXPX 4LLQA 2OSLA 3LN4B 3S5LB 2B5IC 2I9LB 5HHPA 2P24A 2AV1A 3HC0B 4WNQA 4NQVB 5FA4A 4YBLB 5AD0A 2VZOA 4OCSL 1XGRA 2QHRH 5IFJA 4LFHG 1MFBH 4PJHB 2IH1B 1EHAA 5GSVB 1YEIL 3BFOA 5JO5A 4ZTOL 2DBLH 1S7WA 5AZ2H 2QR0A 1JNLH 3IJHB 3QWOB 2GFBB 1RK0A 2Z8SA 1MELA 2XG5A 3MUJA 2X1XR 3PHOA 3MV8B 1OT2A 4O58H 3QDMB 3QFJD 4HIXH 1JPFA 3GJFH 5FYKD 3SHSA 2WW8A 1K3IA 3FB7A 4OZ4B 2X4NB 1SJEB 1KEGH 3LS5L 4LVOC 5I1IH 4HWEH 1IAIL 1P9MA 3CXDH 3TVMA 3JWOL 2DI8A 1QQDB 1NCCL 2O5YL 1EJOH 1WTLA 4L29A 3LVEA 4TNVF 3VRLF 2OK0H 2R56H 4QWWC 5E2TL 1CE6A 1ZHLB 5ACMA 4E42A 4XVJL 3RGVC 2NY0C 4L5FH 3O6KL 4KQ3L 3ZLQC 1IGCH 3B9EA 3KYKL 3VWKD 1WF5A 2F53B 1FFPA 3MRBA 3X14B 3B2UC 3X12A 5DD1H 1LGVA 4JO2H 3SGDI 4YFLF 5LXGH 1PZUB 3C8DA 4GRLC 4TSBH 3DMMB 3QO0B 4NT6B 5JA9A 4XGZB 1UADC 4XWOD 3IDNB 2A1WH 4P9HC 3AUVA 1S9XB 3TN0D 2C7UB 1XIWC 3S88L 2LU3A 4G6AD 1LP9F 3AREA 5C0ND 3DETD 5BRZB 4WI9A 3HUJF 4LLVA 4G80A 3LZFL 2AEWA 5DHYB 5JZ7D 4IRSA 4JR9L 1IM9A 1AD9B 4LPYA 4JEGB 4POZC 4M1CD 1KB5B 3EOYG 2E3VA 3BZEB 3S8WA 2QHRL 2YA2A 3Q6FB 1MFBL 5IVXF 5SWSB 3PHQA 2VLKB 3HA0A 5CUSH 1T89A 3JTTB 2DBLL 3KXFE 4PP1D 1QUNA 3KNBB 3PWLA 5CJQH 3KPNB 5C0CB 5AZ2L 1JNLL 2R8SH 2HVJA 3T0EB 4GG6B 2VZ1A 5E8EA 4J1UA 3LDBC 4ZYKB 3K7UA 1DP0A 3G6JA 2A6IB 2BVQA 4O58L 1R5IA 4HIXL 4A6YA 1JN6A 1R24B 4HD9A 1VACB 3T65B 4HZAA 2HFEB 1KEGL 1I8MA 5DJZA 3KWWA 5I1IL 4HWEL 1JFQH 3CXDL 3K0WA 1EJOL 3BD4A 5HDQH 3WJJA 2OK0L 2R56L 1A1OB 4RIRA 1R5VA 3EFFA 5D93C 1JUFB 4L5FL 5IB3A 5EOCJ 1IGCL 1PJ9A 4LPCA 4IJ3C 1W2KT 3FQXA 3ZYZA 2XZCH 1SYVA 3MRNA 3MRKB 5DD1L 3RJQB 4JO2L 5JW5B 1J1PH 5LXGL 1BQHA 4QHNA 3RIAK 1FP5A 3R06A 5CZVH 4BKLB 4KTYA 2YD4A 4TSBL 4L9LB 2IEPA 3TIDA 4QRUB 5KN5B 1BJMA 1K4DA 2A1WL 5DJ8A 1BX2A 3QFJE 3MLPA 3WN5C 1NCNA 3CXHK 1JPSH 3UP1A 1IGYA 3KXFA 4TSAH 5CHNA 5IMKB 4FP8H 1NGYB 5ETUB 3VD5A 5DEZA 1I7TA 3WO4C 4HUVB 2NY6D 4KXZI 2CUIA 3AROA 3EOBB 1MCWM 3FQUB 3PXJA 4U6XA 3WL9A 2OJEB 4DWHA 4Z5RB 1JGEA 5DEFB 1IEAA 3I3BA 5IROC 5I1CH 4K7PH 4RFEB 2VDQH 5CUSL 2YA1A 2OR7A 3LY6A 2Y1VA 4PB9H 3O2VH 4RA3A 5CJQL 2HJLB 3U6RA 2R8SL 1I4FB 2W07A 1EVTC 3QUZD 3RAJH 4Y4HB 3PWNB 4OV5A 2E8ZA 3ZKND 4IOIA 1WGOA 5EFIB 2HTKC 3MOAH 3B43A 4OCWH 1NBZB 5FGBA 1XCTB 4GRWH 2JJWA 5KBNC 4X7EC 1JFQL 1VFOA 2OCFD 2NR6C 5B4MC 5EUOB 1NCBH 1RUQH 2AJSH 5HDQL 5JA8B 3QEHB 3TLRA 3BWAA 3FQTA 1G6RA 4LVEA 2LQRA 2DLEA 4NQCD 3UBXB 3WIFA 4MAUH 5GRYA 3T4YB 2CLRB 2EDQA 1XF5B 4RAHA 5JHDE 5D2LB 5EZJA 4J23A 2DI9A 1JF6A 3QBTB 2IALA 2XZCL 5EU3B 2VLJE 2UV3A 1TQBC 3OXRB 4U1HA 4PJIE 5CJBA 2XIDA 4G8IB 1J1PL 4OBSA 1QA9B 3CH8A 1UT9A 2N1KA 5CZVL 1IAKB 3NPSC 4KKLC 2QQLH 3EYQD 3P9WB 5J11C 4KDWA 2EO1A 3ZDXF 1JPSL 3QO1B 1X5ZA 4TSAL 3NAAH 2COQA 3IDYC 3CSYA 3Q1SH 4FP8L 5SV4A 4GLRI 4HFUH 4PGBA 1MCPH 5DK0A 5CBEA 4XAWH 2X9XA 5HI3D 3NCYP 1FG2B 3F5WA 3DVGA 1P7KB 1CLCA 2BXZA 3ZKSD 2J8UF 1IC7H 5CEYB 4Y5VB 5TFSH 2DKUA 4PRHA 3D2UB 2J7LA 1U41A 5F6IB 2EDDA 1SEQH 2XACC 4XTRD 4AENA 3DX6A 5I1CL 5ISZB 4FXKB 1LEIB 4K7PL 3EUUA 4HG4K 3WEXB 4ZUWA 2VDQL 2Z8VC 5F7HA 4Q6IA 2BHUA 2Q8BH 1CF8H 4WJ5B 4PB9L 3O2VL 5FDWA 1C5BH 3ARYA 5DZNA 3D0LB 5EZIH 4NO5B 1A6TA 1H3VA 1K8IA 1ZA3A 5C08A 2CRZA 3RAJL 4JY5H 5SWQA 5JHDA 4P46D 5HYIA 2BRQA 4MVBC 3AS1A 5IB5B 3IJSA 1JTOA 3L3JA 3E6HA 3H9HB 1HHHA 1T5XA 3TO2A 2VLJA 3MOAL 4PJIA 2R69H 1BREA 3KPOB 4OCWL 5TE4H 4U7SA 1NANH 4QF1B 2NTFB 4QRQA 4CBPA 4NO2B 1DQLH 3KLSA 1ZVSB 1OGAB 3ZYIA 4U1JB 1YEFH 1NCBL 1RUQL 2AJSL 5DSCB 1CFTB 3V0AC 3QSKB 5GGQH 5CKGA 4HFWA 1UXWB 1G7JA 2E9JA 1BFVH 4MAUL 5IW6A 4AM0A 1HEZA 5ID0A 2Q7NA 1U8QB 3DECA 5CP3A 5I30H 3DO7B 5CD3B 2P5EA 3QULA 4R4NC 3GZKA 1ETZB 1RVFH 2VIRB 4QEGA 4LLDA 2AW2A 3GSOB 1J88A 1K2DA 3T4AA 4IOFC 5E8PA 2VZTA 3U9PH 1SM3H 3G5ZB 2QQLL 2ICWB 2LE9A 2X70B 4ZFGH 4PR5A 4JDZA