5IW6B

Anti-cd20 monoclonal antibody fc fragment
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
205
structure length
198
Chain Sequence
SVFLFPPKPKDTLMISRTPEVTCVVVDDPEVKFNWYVDGVEVHNAKTKPREEQYNRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of anti-CD20 monoclonal antibody Fc fragment at 2.34 Angstroms resolution
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 30
structure length 198
sequence length 205
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw6B01
1Z9SA 4YWGL 4LQFL 5LBSH 1AQDA 4PJDF 4KK9D 1RZIA 2E9BA 4JZOA 1M05B 1CYGA 3P9LA 1YY8B 4JHWH 4X6DE 1OP3K 3K2MC 2W0KA 4QRRB 5L2JB 3WFBH 3KHQA 3BZFA 3WFHA 4JM4L 4EDWH 1IGMH 5F7DB 3T8XB 3O11A 4WRLA 3IRZA 1NAML 2EO9A 4I0CC 5D7IA 1OW0A 1MHCB 1G84A 4HKBB 4WNQB 3F7YA 3AROA 1G7MA 1CXFA 1RULH 2EXWD 1P6FA 5L8JB 4Y2DC 1F90L 2E3VA 1VENA 1JJUA 1KTLB 2HTLD 3SGEI 3MQIA 1J8KA 4IMKA 5J1SC 1SJEA 4P4RB 1U8KA 4P9HH 3A6BL 5C0DB 2JJSC 2VLRE 3GSWB 2FHCA 4CMMB 5I18L 2BNQD 4HFUL 3SKOB 1I8LC 4P2CG 5IBLC 5L2JA 3MFGB 1VADA 2FSEA 3FQNA 3CFIC 3I84A 4PLNC 2R29H 4H26A 4A2LA 1MJJA 2D7TL 4JDTL 3BGFB 4M93B 4R2GC 3PWVA 3OAZK 1GOFA 1JUFB 3S4SA 4TYUA 1CD1A 4PTUB 1NEZB 3MV11 4JQIL 3T65A 3HMXA 4OBSA 3EHBC 3QIWD 4OCSH 1K8DB 1JPST 3OKYA 1FL6B 2P8PA 3BP5B 4GW5A 1YNTB 1AJ7H 2BVPB 2XZAL 3RU8L 4OGZA 2O61A 3UROR 1FFQA 2M26A 4A6YL 1TVBA 5I1DB 1GGIH 1B3JA 5IB3A 4WUKH 2GSGB 5HHOD 4DEPB 1SEBA 1VEOA 1YMHB 1BWMA 5CEXB 2WINB 4PJBE 3CGTA 4IJ3B 4JY6A 1UM6H 5C6WH 1X3DA 3AMLA 5IHZB 2QLVB 2N1KA 1UEMA 3QWRA 1KIUA 3FT2A 4QTHB 1T03H 3HFML 43C9A 5KVMC 1MVUB 4PRAB 1NANH 4LPWA 4MJ5B 5I18H 1G7QA 3I2CL 2DJ4A 4RMVA 5C09D 1P53A 4ODVH 3ZDXF 3S88L 4BM7A 1TVDA 3ULUD 2X4TA 3RI5K 1ZLSH 4FFWD 4QKXB 4KRPD 1F90H 3MGTB 4LCUB 4PJEE 5C0RL 2K7QA 4LIQH 4K07A 1RULL 2E6QA 1RHFA 5F6IB 1N3NB 3GBNH 5GRZA 2CUHA 1BGXL 3C8HA 4NQSA 3U1SL 1S8DA 4OZ4A 2J8UF 3GMMA 4OJFL 5KOVC 2GK2A 3RGVC 4U2YA 5D7LA 3PDGA 1S7TA 1LP9A 3N06B 4JHWL 3Q6GH 4N0FB 5F7UA 4FTVB 4OM1L 4S1RH 5EDXA 4JEGB 2NW3B 5ISZB 4FFVD 1CDIA 1QO3B 5JDSA 2VLRD 2FJHB 3REVB 4G43A 5D2LB 1IC1A 4Q9RH 2Z31B 4BKLA 1FZMB 2VO5A 5ICZA 3MLTB 1WFOA 4G8EB 4KRPC 1F13A 3MJ8B 3BPOC 6CGTA 3VXRB 1SY6H 4FQHB 3A6CH 5GRJH 1I3GL 3HS0A 5I15H 1IKNA 5DJZB 5HDBF 4NO0A 1MQKH 4X4XB 5TE4H 3FB8B 3MCLL 1V7ML 4XMKH 3ULUL 5DJXB 6FABL 1HXYA 1CK0H 2IFFH 4M7KL 4LRIC 4PJ9D 5LG1A 3EOBA 4PRPA 1MI5D 4QOKB 1DBAH 3GO1H 4KHTH 2IALB 5GRXG 4F3FB 3K8LA 3TPKA 2H6PA 2Z31C 1YPZE 3QHZL 4RNRB 3D3VA 3Q5YA 2FX7H 4QHMB 2YD6A 4LSUL 4X4MA 5D1QD 4R90H 4U6HA 5K93A 5CCKL 3FB8A 2ZJSL 4R7DA 2DQGH 1GGBL 1BBJA 3SBWC 3PDDA 3DETD 5M95B 5C6PB 1E4XL 5FO8A 1RJLA 4WUUE 1B0GA 4G6JL 4UDTA 5B38B 4KTDH 3RTQB 5AZEL 4ORGA 5HHPA 1ZVSA 4U6YA 3WKNA 1VCAA 3MODH 5JHDB 1Z9LA 3QXAB 1YNKL 2GITA 3AM8C 3GSVB 3QEGL 3W9DA 3DIFA 1NMBL 1WT5A 2IAMD 4NNPL 3WBDA 3G08A 4W6YB 4YLQT 2WW8A 3DJ9A 5HYQA 4FFZH 3WO4B 4FQIL 2KQMA 5KAQG 5INCB 2NXYB 1ZEAL 2D03L 3X11A 4L4JA 3OJMB 2VB5A 4MJ6A 2EYTB 1RJYB 1GGYA 2G60H 3WSQH 4EOWH 3EDFA 3E6FA 3K2UL 4NZUH 3OF6D 4Z6AT 2OR9L 4NQCA 2YD5A 2YA2A 3O2DA 4GG8A 3H8NA 5TQ0L 4WEBL 3QIUA 2ZUUA 5C3LD 1B4JH 3CFKB 1T4KB 5LQBL 1O5DT 1KJ3L 5IV2B 1OGAD 4U1JB 1AR2A 5T1MA 1A9EA 4PJAF 5EU5B 3QAZB 4J4PC 5DGQA 3BYTA 4M03A 3GIVA 4OIIH 4ZAKD 4DAGH 4NNYB 4L9LB 4FOMA 2WWMD 4XNYH 5C2BL 5IHZA 4JO2H 4DTGL 1K2DA 4KJWC 3STLA 1FNGB 2YRLA 3QHFL 2XNAB 2PW2A 5MEOA 3SBWA 1EGJH 1RJYA 2GSIA 3MMEB 2QSTA 1KBGL 3PHQA 1NGYA 4MS8C 4IRSA 2P8LA 2Q3ZA 2M1KA 4HUXB 5KSVA 4LSPH 4KV5F 5D7LB 5J13C 1SBSH 5EU7C 3G08B 4GAGL 3WL9B 3P2TA 4NQUA 3TN0D 3BGMA 3AREC 4MJID 4C83A 3V7AE 1EEZA 2X4UA 3WO3B 2VQUA 2CLZB 1FFRA 4WO4C 1JWSA 4HT1H 5E7BA 1C16B 2IPTL 4NO0B 1WT5C 4DKEH 3MYZA 4DUXA 3H7LA 2BNRE 4X6CE 4Y0GA 2UZYB 3IFLH 2OMBA 4PYGA 4U6VH 5EZJB 3UX9B 4Z7WB 2NY5C 4HBCH 3LAFA 1JL8A 4Y7MA 3L1OH 2DICA 1R24A 4P2OD 1NBZB 5ENWA 3LKSB 4GT7A 4PJBA 4YDLB 3ARPA 4O2EA 5C71A 3UO1H 1JMZA 4NKIL 2OK0H 4PGEA 1JNLL 2J6EA 2G5RA 5I1GH 1YQVL 3MRQB 1H5BB 5IWLC 3VXPA 2FX9H 3FAWA 1AKJD 1MRDL 4K3JH 1BBDH 4X9BA 3MRNB 5DWUH 1E4WL 1INQA 3G5VB 2VITA 4KRLB 1DQQB 4PB9H 2ZSWA 4WJ5B 2PNDA 1A6UH 4DGIL 1EFXD 1Q94B 3GK8L 3SO3C 3N1MC 4X4YA 4M7ZB 1A6ZA 4MAUL 4NWTL 1BPVA 4KVNL 3MUY1 3QHFH 3NCYP 5EU7E 3L7FB 5IP4A 2WLZA 3B8SA 3DLQR 3L3DA 3QI9C 2OSLA 4OIIL 2P24B 1OP5H 1NGXA 5IEHA 2DJUA 2YXFA 5DS8A 1UWGH 3O3EB 4XVJH 1JYNA 5CJ5A 4KZDL 2GFBA 4JRYA 4GW1B 5I1EH 2ADFH 4PUBH 3RVXC 1FGNH 2QSCH 1MJ8H 4FZ8L 3WSQL 4KHXL 4UB0H 4Z76B 5SWQB 3VFSB 1CICD 3HI1A 5C07B 5DRXB 1TQBB 1G7JA 4XGZB 4GBXD 1S8DB 1ORQA 1OP5K 5IMKA 5HVGB 2OTWB 4MS8D 4FFZL 4GG6F 5H35A 3HA0A 5HGAB 5FV2A 5TPWH 1NMBH 4XH2B 4Y4HD 5TE7H 1IZKA 2VN7A 4LEOB 1I9IH 4FQPA 5DFTA 3QHTC 5GSVA 1N64L 3HE7B 2WP3O 5IB1A 1F3DH 4MJ5A 1CFQA 4U6XB 1ORSB 2VLJB 3M45A 4M61B 1D6VH 4XVSL 4YJZL 5JOPD 2P5ED 2HJLA 4PY7A 1JGUL 2YZ8A 3QEQA 2RHEA 5ETUA 4OCMC 3U6RB 3DROB 4MMXC 2QQNL 3QUXC 3D3VE 2NY6D 4L9LC 4BZ2H 2YD2A 5KSAA 3CXHK 4YDIL 1HH6A 1EAPB 3KJ6L 4HIIB 4JZNA 1RIHH 1RUQH 2PCPA 4X6DB 3AU1A 5E8EA 5C08D 4XNZC 3LN9A 3ILQC 5JIKA 5L9DH 3RZCD 5CZXC 3DMMB 4PJXB 5A3ID 3I85A 4X6DA 2I07A 2CDFA 4UV7L 4K9EH 5IMMB 3GO1L 4RWYH 2UWEA 1RUAL 2YBRB 3PDOA 3VRJA 3GMNA 4X5WB 4XTRC 3WFHB 3S35L 2WWKT 2FEDC 4MQTB 1CK0L 1NJ9A 5FYJU 3O8XB 2DMCA 3TFKC 1ZVHA 1AKJB 2H32B 1A3QA 1OARH 4ZD3H 1MQKL 4H5SA 5F7KC 5J57B 1OP9A 2UZXB 1HQRA 3NIGF 1WBYB 3C8DA 1XR8B 3SKOA 3QPQC 3I50H 3C5SA 4FNLH 4JG0L 4JFPA 3TO4B 3IFNL 5EU6E 2AABH 5J6GB 4APQD 2D7OA 4HEPG 4P2OB 3H42H 3FO1B 5MEND 5JLZA 3TZVD 2AP2A 3SDCD 5HBBA 5ESVB 5D71L 4JFDA 4POZC 5F1SA 2IAMC 4NOBA 4OM1H 1BWWA 1YEGL 4OKDA 2CDEA 3CDFA 5KJRH 4RA0C 5F7HA 1ZWIA 1J8HD 3OPZL 1ITCA 1QEWB 2JCCF 3TEUA 2DYPD 3LKOB 4GXUM 1BGXH 4PJIF 4X9FA 1KELL 4I9WD 4Q9CA 1R5WB 1ACYL 5I76B 4P9HC 5TDOB 3KPSB 4MD5B 1GC1C 4PRDA 5BS0A 4H0IA 2EDWA 1NCTA 5IQ7L 3S88H 3ROOA 3DO7A 1V3MA 2OX5A 1X7QB 1Q94A 1A14H 3NIDE 4XP5L 1T03L 2BXZA 5HYJA 1MFDL 2NX5A 3VFGL 4G8FB 4LLQA 3ALWA 2AEQH 5JDJA 4ZXBA 4M4RA 5GZOC 4CNIB 1FAIH 1UM6L 3OKMA 4KJQD 1I1FB 3DGGA 4JO4H 1CLOL 5AG9A 1Y6NR 2F53D 5IHLB 5AUMA 1X5IA 4UV4H 1GOHA 2OYPA 3MLYH 1KB9J 4LVOC 3WFEL 5E1AA 5ID1B 1RURL 4WENB 4U1LA 4NM8L 1H3PL 5TH2B 4MAYD 4WEMB 2R1YA 3RQ3A 2DBLL 3X3FL 1VKXA 1ZSDA 3OR6B 3QJFA 1XGUB 2UZIL 3R1GH 1JZ5A 1FZOB 1IL1B 3BHBA 1SYSB 3F7VB 4HXAL 4PY7B 1ZA3A 4JFXA 5GS3A 3CFCH 3WIIH 4ORZC 3H7BA 4V1DD 4ZTPL 1HHIB 3BMWA 3PIQB 4X7EC 3MLRH 3SJVA 4OFYD 4QNPE 3I6LD 1VHPA 2V2XB 1R5IA 5JORA 3JUYA 3LOWA 3QDGB 1MI5E 4Y4HA 5C8JA 2Z92B 1DVFC 4PJGF 4WFGE 4HH9B 3D0LA 1FN4B 4CU6A 3DI3B 4OZFB 1N2RB 1GC1L 3L95B 3S3JA 1IGJA 2FO4B 2P8LB 5GISH 4TSBL 4P9HL 2WK2A 4F37F 3IF1B 1CDGA 4OGXL 3SDAC 2XWTB 4NP4L 1HE7A 2R0KH 4JQVA 4KRNA 4HIEB 4QRSA 1AO7B 1L6ZA 4KDTC 2HLFC 2NXZB 4PRPD 4OTXH 1NUDA 4TUKH 3UTSB 2EE2A 3GSNH 3FB6B 1EDQA 1J8HE 2H8PB 2V7NB 4FXKB 4Y1AA 1FE8L 3DSNA 3GMRA 1HHGA 3HCVA 3C5JB 3FB5B 4LCCB 5KVDH 1KGCE 3DX6B 1KC5L 3OKOB 4ZDHB 2X4OB 3FQTA 4NN6B 3D3VD 4U1SB 4O00A 4X98B 1U6AL 4ODXB 5DHVH 1R3IL 4Y4FD 3KR3H 1OAXH 4ZUVB 4OD1H 1ZHLB 3HAEB 4IIQB 4NO2A 3TCXA 2AGJL 4Y19D 2VABB 1FNSH 1PEZA 2FX8H 5D7SL 3TWCH 5EZOL 2RJMA 3EZ8A 2W0FA 3GSNA 3CSGA 5KSBB 1CGSH 1OLLA 5FIEA 4X8XA 2DQUL 4URTB 2NTFA 2I60L 4MCYA 1SMOA 3B5HA 3W9DB 5GZOD 4UIMA 2VDLL 3RIFF 3NZ8B 5C07E 3GM0A 3EFDH 4BFIB 1GGCH 1B2WL 3NPSB 4R97C 2OXGA 4Y4HC 4KXZH 1PX4A 3DO3A 1LGVA 4RQQB 3I3EA 4TQEH 2Q3AA 5EO0B 1HHHA 3RI5F 4R4FL 4FQXC 4R8WH 2APWA 4FQCH 2X1QA 5IB4A 4FQ1H 2FJFB 3LSOB 4PV9A 2H2PC 4HWUA 4Y5VA 3TVMC 3TJHD 2MKLC 1M7XA 1IQWL 4JFOA 2WWMC 1K4DA 2WMPA 1N6VA 4KK6C 3O3AA 5DC9B 1JK8B 3RWJB 1RIVH 9CGTA 3C08L 3MRDB 3H3KA 3VXQB 5KTEL 3WJJC 1TJHL 3LS4H 3CCHB 4ZODA 4XHJD 3MRNA 2NY5H 2GTZB 1T6WA 3W81A 5I75B 5B8CC 4HLZH 2P7TA 2IPKB 2BERA 4OF7A 3HE7C 2KBGA 3IDNA 3VXQA 1DEEB 3P77A 1BAFL 3NAAH 4HJ0C 4ONGL 3VCLB 1FZJA 3SGDI 4PJ8C 2EEAA 2CKNA 3TCLB 4QT5B 1B6UA 3DSFL 4JN2A 1FG9C 5HHOB 4PLKD 2BNUA 1VA9A 2CIIB 1AGCB 1BVLA 4MD0A 5IV2A 4HPOH 1XCTA 3CU7A 5EIIA 1JNHB 1QFWL 3DURA 1U8MA 1FDLH 1AHWC 4P2OC 2PYFA 1OT1A 1RFDH 2BNUB 3GHEL 4E5XA 2ZUWA 2VDML 4E41A 3CK0L 5GRUL 1D9KB 1DR9A 3HB3D 1FV1A 1KIRA 1QRNA 3X12A 3V6ZA 2J2ZA 1IGYA 1G0YR 3EYSL 1TJIH 1TZGL 3A6OA 1JFQL 3GMQA 1NAMA 3ARDB 3C2AH 4IOIA 1DBMH 5FUZL 4Z7QF 4LLUB 4CBPA 4KMTH 4Z7UB 3CK0H 3ESUF 3WV0A 5J7CC 3WNKA 4JGMA 4KK8D 4LBEA 32C2A 3GHEH 4H20H 3IAGC 3NIGE 2OJEA 3TO2B 4ODSH 1HWHB 2C3VA 1QFWH 3VDBA 1WWWX 5EOTA 4JJHA 1Y0LA 5BMFL 1UB5A 1ZT4B 4JDZB 1MOEA 1KTKE 4QRRE 3C60A 3GMRB 5I0ZA 3H3BC 1NMCB 2R2EB 4PG9B 2J3SA 4MA3B 5J11B 4GKZA 2VYRE 2YMXH 5DR5L 2XA8H 4I1NB 2WIIA 3NFNA 4RFNC 3UDWA 1BFVL 3TVMB 1G9EA 3KG5A 4DN4H 2W65A 2Y9RT 3ZSSA 2NY5L 2ERJB 4B7LA 1DLFH 3G9AB 1BP3B 1BQHB 2NZ9C 3EJJX 4A6YB 3VWJD 1CU4H 1WICA 4FQXB 3DRQA 1I1FA 1U3JA 4RX4A 3HR6A 3EOBB 5J9PA 4KKNA 5CEYB 5CLWA 5BVJA 1MJUL 3MRDA 4G8GE 3Q6FB 3QG6A 1DP0A 3FFCB 3UBXB 4WW2C 2D7QA 3GJFB 2BX5A 3PWPD 2FJFA 3S4SB 3W39A 4R8WL 3BDYL 2A74B 1A6WL 5H8DA 3MV7A 5HHQB 4YFEA 4WGVB 2B2XH 1KG0A 2ZNXA 4OGYL 2CRZA 1BVKB 1FYTD 1Q9LA 4TUJA 1WIOA 2J8UA 4Z78B 5CGMA 1Z9OA 3ULVF 4JKPH 3EFDL 2YUXA 1VESA 1GZPA 1F11A 2F5BL 2VDLH 1QEWA 2GUOB 4UTBH 5GQBA 2QR0A 2NYYD 2R15A 4MQ7A 1I9RH 4ZPTA 3FO2B 1YEDA 2IMMA 3NH7H 1D5BB 5SX4I 4YGAB 1LQSR 3MYJB 5CEZL 5BW7C 1HZHH 1CLCA 5IMLB 1V5JA 3MUGB 3I6KB 1IGJB 4UUJA 5B39G 1TJGH 3UJIL 5A16A 3MA9L 3OKEB 3TNNA 1OAXL 1FIEA 3RWFA 3UMTA 2PXYC 3KR3L 4NQSB 3SKJH 3ARGA 3QDGA 4NO3A 5D1QB 3P9LB 5K9JL 1RZJL 3G9VA 4RAVB 1AO7E 5I19L 5D72H 4D0CB 1WC7B 3CDGA 1MAMH 4RFOH 1IM3A 1QLEL 1U8QA 4LLMB 4FQHA 4HUUA 1S7WB 4ODHH 5K9OB 1OGTA 2I5YH 1AKJA 4YDLC 3V7AG 1HILA 5E4IA 4LEXH 3U7YL 1FSKC 4PRAA 4XBEH 5JZ7D 3EOTH 1T83C 4S1SH 2MFNA 4K8RD 3UTSA 3EOAA 1MRCH 3N9GH 1NL0L 1YEFL 4JANA 3MOAH 3P4NB 3P0GB 2GQHA 4U33A 3P4MA 4XP4H 1GC1H 3S37X 4GKNB 4MB4A 4K7PL 3FB7A 1K5NB 3ZTJH 3BYYA 5KS9B 5HGHA 3RWEB 1CGWA 5E5UB 1IGFL 3VD7A 3JWOL 5IBLD 3ZDXE 3SDDC 1QSVA 1V7NL 1XGQB 4IRJA 2QQKL 1XF3B 1Z5LA 3SDXE 1MCHA 3MLRL 1T2QH 1DBJL 3VXMB 3NCYS 2GK0B 1JWMA 2Q7YA 2X9YA 2YKLL 1EEQA 3MNZA 5FECA 4U49A 3ROLA 4PLKC 1TETL 1WBYA 3WIIL 4XP6L 3WYRA 5IW1B 4HXAH 3IVKB 1NBVL 3R1GL 4PGBB 1CIUA 3O9WA 1JWMB 4YEEA 4PRHA 5I76A 1F6AB 1I75A 5T3ZL 4PV8A 5BZWB 5TF1H 4NM8H 4YDKH 2NW2A 4RGOL 4Y16C 3KVQA 2PN5A 5CZVL 2W92A 1JYXA 2GEEA 2Y36L 4QF1B 5FYKH 2WBJA 2JJVA 1EK3A 2YHGA 3IS1X 5IUSA 1TCRA 2ZUYA 2Z91B 1VDGA 1RUKH 5ALBL 1N6QL 4KKLD 2FB4H 2VZOA 2AEQL 3UZVB 3DRTA 2QKIA 1MFDH 1OP3H 4NPYB 4XP5H 1ES0A 1A14L 5JHLH 3OL2A 3FQXB 4G8FA 1JMXA 3QEUA 3DO7B 3DX9B 4ODWA 4JREB 3GHBH 3RGVA 5C0FA 2JJWA 4L8DB 4NYLA 2AI0H 1V3KA 1ACYH 4R7NB 2IBZX 3FOLB 3T0EC 4PG2A 5E6IB 5GS2H 5LVEA 4ZS7L 2EDEA 3LKOA 1JP5A 3OPZH 1NDGB 2D9QB 1LEKA 4HX1A 5GGQH 3SDDA 1R6VA 3LN4B 1PGRB 5GGRB 4WFGD 4RMRA 3QIWB 4OFIA 4F7MA 2DB8A 4NBYB 3W9EA 5DQJB 3EO1B 4NHUB 1DQQA 4PGJA 4EJ1C 3WHE1 2ICES 4APQB 1H8SA 4XNUL 4AK1A 2CJUH 2D9CA 5C0CA 3W2DH 4Z77A 5HYFA 1NCDH 3ARRA 4KJQC 3U7WL 4D9RE 3PL6D 4FNLL 5ESAB 4LKCB 1EJOL 5KSAB 2ZCKL 3WHE0 2VWEC 1JNJA 1UENA 1P4LA 5E8OA 5DHVA 5HYJD 2XWBB 3VH8A 3NFSH 4JFED 4MWFA 4BFGA 2J88L 1FO0A 5C0BB 5L2KA 1IC7L 3AGVA 4Y19E 3CX5J 3BEVB 4DVRL 2JCCB 1Q0XH 5I71C 5T3ZH 3K4DA 2CLZA 4RSVA 4PJIB 4ZFGH 2WZPD 5MENB 4KC3B 5IW6A 1AP2A 3T0EE 2A9NH 1EHAA 2VLJD 1U92B 3ARGD 5HGAA 2B7DT 4Y1AE 3WL9A 3ZTNH 3T0EA 2CK0H 3VXNB 2M8XA 4P57B 4ZS6D 5KSVB 3VW3H 1HDMB 1T2QL 4KDWA 2QQNH 4GRWE 4HIIA 3DVIA 3L3IB 3ARBD 4O2EB 3ORJA 1MUJB 3BZEA 2GAZB 4L3CA 1CG9B 4EEEA 1G6RA 1KN2L 4KKBC 5ETUB 4UINH 4XP4L 1PSKH 2QQQA 3OZ9L 1LEGA 3D25A 4W68A 5FA4A 3UPCA 2AS5M 4PTTA 2V7HB 1RK1A 4QHNA 1I9IL 4WI6A 3TT3H 5IHUH 3L6FA 4N0CD 1A4JB 5TE7L 1FLRL 4HH8A 1OGAB 1P9MC 2YUZA 4LEXL 4HZLB 1BFOA 5C0CE 1HNFA 4OFKA 4L8SC 3EFFA 5IJVA 3OXSA 3LQZB 4ODHL 1SEQL 2HFFB 1J5OL 5IFJA 4XNXH 3THML 3T4YA 4Q0XH 1G7JB 2AV1B 1QLEH 5D2NA 5I1JH 5L0QC 2MQ3A 2K7PA 3O3BB 5CIPA 5J06A 4D9QE 4W6WB 3R0NA 1LMKA 4PLJC 4LHUB 4U1GC 2QTEA 3JTTA 5I8EB 3HNVH 3DIFB 4HSQA 4MNGB 2YRPA 3SKUD 3OKDA 5IVNA 2Z35A 3Q3GA 4YHML 4PJGB 3AMKA 4JB9L 3N1QC 2DQDL 3BRDA 4X6BA 2LFGA 3GIVB 2OQJB 2G75A 3MNWA 2ERJC 3JWDL 5FDWA 1A7QL 2XY1A 1HKLH 3CDGB 4NWTH 4UTBL 2MKWA 5ICXA 5HHMB 2O93L 4YXHL 4IRZH 3CC5B 4I2XA 1VPOL 4YDJA 2DKUA 2VH5L 1E4WH 1PX3A 1A6VL 4OCNC 3NVQA 1PFCA 2FRGP 2RB8A 3H6JA 3KYNB 2VE6A 4L5FH 1AFVH 4NM4H 2GTZA 4K94C 2GJJA 2P7TB 3GSXA 4M7LH 1KF9B 4MJIB 3MRPB 3K46A 3O3UN 3WIHL 3GIZH 3BE1H 4JFDE 5KSBF 2EO1A 4KI1A 3VFTB 2E9JA 2PW1B 2V2TA 1U58A 5SWZB 3PV6B 4JFYA 4Y2DB 3GJFH 3VI3F 3WNOA 2O5ZL 3MOBL 3VGBA 1BFVH 3LD8B 1T89C 4CDHA 4PJEB 2YMXL 1U8JB 1CLYH 3KAAA 3NCBB 4I48B 3GMPA 3NMEA 1FFPA 3B5GA 4ETQA 5E5MB 1N5AA 5B4MD 4LMQE 3V2AR 1SBSL 4C83B 1FJ1A 2OJZL 3ULSB 4ETYA 5D7JC 5L6YH 43CAA 4GAJL 3HE6C 3LQMA 2XXMB 1VFAB 4O51B 5J12C 1KBGH 2VAJA 3MRMB 2UWEE 4I9WE 5ISZE 4MNQA 4OLEA 3VFOA 5C2BH 2VABA 5DA4A 3SE3A 3SE9H 2BSRB 1RZ8B 3QZWG 5F93C 4U1IA 3F5WB 1HQ4A 4KMTL 1K2DB 1BVZA 4TOYL 4JFFB 1AGBB 1LVEA 4F7TB 3FMGH 4GQPH 4U3HA 2QADD 1FVDA 1XGYL 3HZYA 1AGBA 3TBYA 3HUJB 2H8PA 1HSBB 12E8L 2NY2B 4ONOA 5BVPH 3KDMA 3OKNA 3B43A 4RFEA 4AL8H 4UDUB 4QOKD 3TO2A 1W0YT 2D03H 4BQ6A 3LEVL 4Q2ZA 5IGXL 2EC8A 3VFOB 3D3VB 4U7SA 3WN5B 1N26A 1QP1A 1YEIL 4NNPH 5DHYA 2X40A 1ONQB 1FBIL 5E9DA 4R26L 5C0EA 35C8L 3PGDA 1PZUB 4RMTA 4B50A 3QEGH 4DZ8B 4YBLB 1ZV5A 3GSVA 2XT1B 3BZ4A 1A2YB 5FYJD 5EB9A 5DFVC 5JA8B 5GS0C 3IU4L 1BAFH 1MLCA 2B4CC 5SWSA 1ZS8A 4KTDL 2WV3A 2RAMA 4G6JH 1FG2A 5D7JA 5FM5O 1HCFX 3TBTA 4ZAKC 4UAOB 4MNHB 3U83A 1V8HA 5H94A 1QSFA 1TJHH 3RWDA 2C1PB 4O58L 3MLZL 3KS0H 5EOCL 5SWZA 4Y16D 1IQWH 2OZ4L 1N5YH 5GIRA 3H9HB 5BV7B 3BRFA 5IOPA 1D5ZB 2ICWI 3R06A 3MRRA 2NZ9D 4MX7A 4R0LA 2BCKB 4FQ1L 3VGAB 2Y1VA 1I7ZB 3VXSD 4NSKA 3BPNC 3WFCH 3TNMA 5T3ZD 1NGWA 4HLJA 2GSGA 2VE6B 1REIA 4HS3A 3IFPB 1X5ZA 5IVXF 4TQEL 4NQEE 5HVHB 2IFFL 4LLQB 3LD8C 4GAFB 4J3TA 1B2WH 1FVEA 1JCKA 3C6LB 3MRGA 3ULUH 4HIHA 1ETZB 3FL7A 1CS6A 1D5MA 3O2DL 3BPLC 4OLWL 3WO4C 3ALXA 2P1YA 2Y4SA 1UYWL 3PWVB 2IAMA 2A6JA 4MA1C 5I30L 4HLZG 4I0PC 5D2NE 1ZHKB 1BOGB 3UTTE 1A47A 1ZANH 2AXFB 5I8CB 5HHVH 1KULA 4PBWD 4CU7A 2QQLL 5A2LH 3IDJB 5L7XL 5FO7B 5E56A 1INEH 1HSAB 1KPVA 1BD2E 2W9EH 4JKMA 1R3IH 4F9LA 1U6AH 3QIUD 3VFPB 3IJYA 1QO3A 4GRWF 3SGJA 5JDSB 1NLDH 3G5ZB 1MSPA 5C0CB 2A6IA 5L88L 3CH1B 4PD4J 4U6TA 1YN7A 3D0LB 2AERT 5HHXH 5FYJE 5C0RH 4YHZH 3RL1B 3GJFK 3BKCL 1Q0YH 4R0LC 3EGSB 2BY2A 3FQRB 2VDRH 4B5EA 3RY4A 2XOTA 4ODXA 4OT1H 3CLFH 4PRHB 1ZK9A 4BJLA 1C12A 4DW2H 5IW1A 3BPNB 3E0GA 1NDMA 4G6ML 1T1XA 3O6KL 3L5JA 3MV9E 1MUJA 4IMKC 5HDBE 5DSCB 4ZFOA 4CN1A 1FL3B 1S7SB 3FQXA 3PDOB 1YC7A 5CWSB 1FFOB 2LVCA 3UTZB 4X8JB 5B21A 5E1AB 4A6YH 4PJAE 4M8QA 5DD3L 2Y5TA 3C09B 2SEBB 1E4XI 1SHMA 2F58L 1OCWH 1P2CA 3P11H 5E4EB 2FL5B 4CNIA 2H26A 5F89A 3ZLQC 1CN4A 3U9PL 5DRWB 4M8QB 3G5YA 3QUZA 4LSSH 4AMKL 4XRCB 2CDGA 3L5HA 3IJSB 1NFIB 3AUVA 5HY9B 4UILH 1BLNA 3UTSD 4CJ0A 1QQDA 4H25B 3ULUC 1FAIL 5DEGB 3CMOL 1U8OA 3QUXD 4HQQH 3SE4C 5CEZE 4J3UA 3W0WB 4R2GD 5ANMB 4GQ9H 2XTJD 2X89A 3RX7A 4PJFA 1MHPL 3S97C 5C0ND 4FS0A 4F7EA 3RWIB 3CLEL 1RAMA 1CL7L 3N1PC 5DHVB 4NHCL 4KXZI 3V5HB 1I8MB 2EKSA 2EDLA 4WVRA 3DXAE 1JF1B 2D0FA 1BD2D 3HAEH 3IXAB 4XMLH 1U91A 3CX5K 5I2IB 4S1DD 3EJZD 3IDMA 1QSFD 2VISA 4XGZA 1NLBH 1WFTA 5C08E 2IQAA 3QIWA 1AIFB 4NZDA 3MJGX 5D6CA 4WI3A 3OXRA 5F88A 4TVPL 5J56B 5HI3C 4EI6A 1RUML 1VGKB 3O3DA 4E41E 1QQDB 4H25A 5BO1L 3HKFA 1MCNA 4BK5A 5J13B 4LNVA 4LSQL 3F58L 3PE9A 2F53B 4N8VA 5FUOL 2VQTA 4JG0H 1IGIL 3I50L 4CW1B 1PBYA 2EZ0D 1PY9A 2R2HB 4L8SB 4QRPA 5DD0L 4HUWA 3QFJB 1Z2KA 4OQTH 3RZCB 4QWWC 3BN9C 1S7RA 4Y4KA 1YY9D 3RGVD 1KCVL 2Z91A 5E5RB 4Y5XB 2X1OA 1QUNA 1QFUL 3HPLB 3BAEH 3ULVC 2WAHA 1I8IA 4G42A 4ONHB 1CDYA 3DWTA 4RWYL 4WW2B 1OLZA 3GKWH 2BDNL 2BOCA 3D39D 4QF1A 5BCAA 3MJ7B 1RK0A 3WJJA 5DJCB 1WFUA 5E08L 2AJUL 1NGZA 5DD5H 1NBZA 1T1YA 2Q6WB 1NDMB 4IOFD 1IEAB 2YPVH 4Z7WA 5EZJA 4GG6A 4NQXA 2HLFD 3DTXA 3QDJE 4KQ3L 2KKQA 3KJ6H 1F8TH 3H3PL 1YMMA 2Q8BH 2FATL 4GLRI 5DEFA 5I1CH 5DVMA 2Z8RA 2CO7B 2ZPKH 1NPUA 2VKWA 3MLVH 3BX7C 5AZ2L 4L4TD 3RL1A 3QUYB 3F12A 3QIBB 1X44A 5DZNA 5LGKA 2X2YA 3VXOB 2H26B 5F89B 3TJEH 1P69B 4KK5D 5C1MB 1S9YA 1TCMA 2IH3A 4KUCF 1N64H 4FN0A 1DEDA 5C0EB 1N59B 1UEYA 1DUYB 1Q38A 3NN8B 2XYCA 4MMZC 4EN3D 3IGAB 4OLVL 5F71A 3QCUH 3EYUL 1CLZH 4KQ4H 5DJDA 5CBEA 5C0JA 4XVUD 4FXGB 4PR5B 5T3XL 3D1MC 4PJ5D 3VFWB 2AK4A 2NMSA 3CJJA 4HC1H 1AGEA 2NY4C 2NY1B 3QZWA 3TBWB 4JKLA 3TZVA 4H1LB 2EC9U 3VXTB 2YPLB 2F8VA 5ACMA 1NGXB 3CU1A 4JRXB 5BXFB 3UPRA 3GSRA 4UB0L 3VXME 3L3GA 3HUJA 3K0WA 1LO3H 1ORSA 1J05B 5EU5A 4OKVB 3IETB 3RFZC 3LRSA 4RIRB 4N9OB 5DMGD 1T5WB 5AG8A 3L7EB 1UWGL 4G9DB 2F19L 1MFBH 5TF0A 3Q1SL 1OQOA 2X4QA 5IM7A 3HI5L 4HD9A 2OP4L 5J6HA 4D0DB 3CFBB 2R1WB 1EO8L 1A7NH 3RTQC 3FCTB 4PD4K 1Q9KA 1JGLL 5D8JH 2VLRA 1AD0A 1MELA 5M7QA 2JTDA 1MPAH 4HS3B 4AT6B 2MOVA 3DVNA 1BEYH 4MAUH 3V0AC 4BZ1L 2NY0C 1I85C 3VWKD 4MA1B 1ADQL 3S37H 5E5MA 5HJ3B 1A6UL 2X70A 3KWWB 3CAFA 3CVHA 4PP1C 4DGIH 1YMME 5IOPB 1I3RA 4KFZC 2EIDA 3CSBA 4HUNB 4UT6H 5CJBA 4LASL 4M1DL 3ZDZE 3ULVH 2ESVE 4LKXB 2MHAB 4OUOA 2HWZH 4G8GA 2N7AA 3HC4L 3C6LD 1LD9B 1YQVH 3RUGE 5EG6C 3T2PA 1JNLH 5I1GL 4LPTA 1YEEL 4U1NB 4IEFB 3INUH 4WU7B 3FO9A 1F3DJ 2I9TB 3EJYC 2PTUA 2FLBT 5IFHL 3RWCA 1J12A 2P5WD 2UYLA 2GT9A 4PJHF 1JGVL 1FZJB 5BV7L 3HZKA 4M00A 5BV7H 4U6VL 4LLWA 5FGSA 1MF2H 3CPLB 2F54B 3DX7A 1KXTB 2PO6D 3TT1H 3OAYH 3QO1A 2ATKB 2J4WH 4TPRL 3MACH 2B0SL 5DHYB 4OFYA 2R69L 5KBNC 3SDYH 4O5LL 1EHLH 2PW2B 2IPUK 2XPGB 1YA5A 2VTFA 2XKUA 1KJVA 3DYPA 3PWPB 4DUVA 5T3XE 5FYJH 5T1LA 4ELMF 4JO1H 3TM6A 3QPXH 3BO8B 3KPRB 3UDWC 3DUSA 4Y5VB 4HFWB 3DXAA 4HXBH 4MVBC 4Y4KD 5FO9B 2HJKB 1F02I 3OJ2C 1AD9A 1OD7A 1BFSA 2LU7A 1ZT4A 1JTTA 4UTAH 1S7XA 4XPAL 3DARA 1XCQB 5DJ0B 5FGRA 1LK2A 4WV1A 4L8CA 1I7UB 5D7JD 1TITA 5I1HL 3F5WA 4LVHC 4PRIE 1W72B 1G0DA 4LIQE 4YNYB 3REVA 1FSKB 1R3HB 4O02L 1MFBL 2F19H 1QLFA 4ONFH 1KJ3H 1EBAA 3NPZB 3WE6A 3EYQC 1B4JL 4KJPC 2Z93A 4WEBH 4JZJC 3S96A 3OSKA 1GIGH 2NCMA 4ZNEE 4JFEE 2Q7NA 4NC2B 4WCYH 3O0RL 5FK9A 4FQJL 1YNLH 2YUWA 1ITBB 4WW1A 5EBLA 2XKSA 3CD4A 2I9LA 1OWRM 4FQIH 2PXYD 5EOQH 4QXUH 2FBJL 3LIZH 1S7VA 4M6ML 2APVA 5D1ZD 2F8OA 3QNXB 1MLBB 2UY6A 3IDIB 2C1OB 5CILH 5HDQH 1NGPH 2YOCA 4HS6B 3V95A 1FCCA 3ZDYE 1QYGL 2DL2A 3SQBA 3K7UA 1KENL 43C9B 1Y6KR 2BVTA 4M6NH 1U8IB 5CJOL 5DJYA 5GRVL 5CEXA 4AG4L 25C8H 1X5JA 1SJHB 1W8OA 4WHYG 3S9DB 3M07A 3QUMH 4CAGA 3UXFA 4LRNL 2ICWJ 1VFBB 4J6RH 3VFVB 4JRXE 2JKXA 3MRHB 3IDNB 1P4BL 3CCHA 4W4OC 5KSAD 3EAKA 2R23A 4ZO6A 5IIEA 1ZHBB 5T5NG 4NNXA 1QBML 4Y4FB 1YDPA 4ZQKA 5E03A 5DVNA 1KB5L 5E94B 1DFBL 3FT4A 1ACZA 4FABH 2AJUH 5DD5L 4CU8A 1MAJA 2X4SA 1J1OL 1IGTB 3H9YA 4M6OL 5FYLE 5BQ7B 1KFAL 2ESVA 3FO9B 2EDQA 4HKZB 2VDKH 1OSZA 1FORL 4HUVB 1DQDH 5GZNC 5GS1B 1QFUH 4LOUD 2DI7A 1QFWI 2EH7H 2G2RB 1TNMA 5E95B 1EUTA 3MRCA 1LO0H 4K7FA 5I15L 5GRJL 5IG7A 3ZHLA 3PWNA 3WEXA 1PY4A 1X6NA 1LE9A 4PG2C 3MRJA 2CQVA 4GRLA 1IGIH 4YPJA 2IJ0C 4YXKL 2AJSH 5JXAH 4PJBF 2JELL 1G7MB 1T21B 4GO6B 4KJWD 4ZO8A 3V0WL 1U3HB 2VOTA 4RGMB 2DLTA 4TNVK 5D7IB 1MCRA 3UZEA 4PRPB 4XCEB 3ET9F 5I6XB 2JIXA 3PL6C 1RIUH 3UYOD 5KANI 4NZTL 2MJWA 3B2UD 1ZE3C 3L3JA 1KPRB 1J1PL 4YDVB 3EIFA 3T1FB 4EZMA 2UV3A 2X4OA 4PJEF 4U3XA 1NLBL 2PO6A 3ARDC 5E2VL 3KYKH 4HPYL 4RCAA 2CMRH 3RDTA 2BNRD 4JRXA 5BXFA 4OF0A 4XZUA 3FRUA 1P4IH 2DTML 1FNEA 1FFNA 1IAKB 5AYUH 5D9SB 4CUCA 3VFWA 1WJ3A 4NKMA 4ODVL 4NHCH 2A9ML 3E2HB 4UQ2B 4O2FB 4LHUA 1AO7A 3WDJA 3R0MA 1JE6A 2AQ3A 1AXIB 1S9YB 2BOBB 1AC6A 2NX5D 3LKNA 5DD1H 4M43L 5IVXA 4NKQB 2NLJA 2ZCHH 5EA0L 4ZNEA 1EO5A 1KXVC 5JLZB 1J0IA 2VXSL 4F7CB 4I3RH 5ABDE 4M7LT 5DFVD 2HT3D 1NEZA 3SO3B 5C0AE 4GKOA 5GGSY 4MNQE 4LSSL 4AMKH 4G8IA 5ANMA 4N8CL 1JPSL 3E8UH 5EUKB 5E99L 3U9PH 1Q8MA 5DEGA 2HN7B 4YX2L 4NO5A 4ENEC 1T2XA 3PIQA 4S0SD 5B8CB 2F58H 3Q2CA 4LDEB 1LE5A 5DI8A 4JQIH 1OPGL 3QUXB 1NUNB 5DK2B 3F6IA 2DLFH 2GJZB 3VGDA 3O6ML 5JW4Q 4JY6B 3VMOA 4OLZL 4OSUH 1T0NA 1NEUA 1UJ3C 2D7TH 4LHQB 3JWNC 4KK6D 3KXFE 1CD8A 4JR9L 3H0TA 2R56H 4J12A 1UADC 4X6FA 4YXLL 2R29L 4DGVL 5AUMB 4AJ0A 3BP7B 3EZJB 3FFDB 1YPZF 2FR4B 1MCCA 3O6KH 1WZLA 4LQ1A 1WFNA 2DDQH 3H0TB 4DW2L 1SQ2N 4WO4D 5F96H 4L8SA 2YXMA 2NY4D 3KPTA 3P30H 3LQAL 3S3PA 1S7RB 2A9MH 3HG1D 4F15C 1NFDA 5F7NC 1ULVA 3BZFB 2VWEE 4P2RB 1JHKL 5JW3L 5HHXL 1RMFL 2IMNA 1NMAH 1U3HD 4XI5C 3IXTB 3OHXA 4XCFL 2E7LA 4QHLA 4NC0B 1UJ3B 4DFHA 5CP3H 5DLMH 3PABB 3O6LH 2JIXB 1CTOA 3BH8A 3ARXA 3GSWA 2W9EL 3SE8H 3MR9A 1RIUL 3SGKA 1B88A 3QFJD 1PQZB 1H3UA 5JQHC 1CFNB 5DYOB 4WWKD 5D9SA 2AJSL 3GRWH 3CVIH 4J1UB 1HHKB 2B1AH 3D48R 1UG9A 4XZUB 4C54A 5E6YA 4JDVB 4TUOB 1FC1A 5CGTA 4ZXBD 1H3XA 5HXMA 3IDYC 3B9KC 2OI9B 4CVXB 2FYYB 5D2NC 1RZIB 4JZOB 2A74A 1J0JA 4YHPB 1VACA 3G6JE 1DBKH 1IGCL 3Q48A 3RVXD 4I18A 1OF2B 3BFOA 4QWWD 4XRCA 3QA3B 3VRIA 3V4PL 1ZT1A 3WS6C 1P1ZB 3P3YA 3WFCL 1FH5L 3CVHL 4Y16B 2BNRB 5J9PB 2WQ8A 3U9UA 1WAAF 3I3BA 1T3FA 4FABL 2X1WL 2G5BB 3TC9A 3ZE2E 2HFEA 1BOYA 2DQIL 3MLXH 5IKCB 2BOBA 5H37G 3MLZH 1VFBA 3P0YL 1YMMD 1W0WA 3WJLC 5CWSA 4ZOBA 3CZFB 1G9NC 4Y19A 3BP4B 1RU9H 2A6DB 4Y5VC 3TVMA 4L4TA 3AXLA 4JREC 3ZDYF 5DK2A 2X4RA 1CXIA 3C60B 1BM3L 5C0AA 2AJ3A 3IU4H 1U8LB 1NCBL 2D4FA 1IGTA 3HC3H 5H94B 2BY1A 3M8OH 2KH2B 2IGFL 2ZCLL 3E6HB 4JPIA 3LPFA 4FA8A 3HE7A 4R26H 5ICYA 4BH8B 4QYOB 2I9LB 4K3DL 1E28A 3MBEB 4B41A 1JF5A 3M17B 1W72L 3C5ZD 3MBXH 5EOQL 4JO3H 3HNSH 1HIML 4HC1A 1HH9B 1CL7I 1PAMA 4BSVB 2FWOB 4YR6A 3KYOA 2A6KB 3MUGA 3QJHA 3GMQB 5BVPL 4WCYL 4HUXA 1GIGL 5C07A 3MMEA 1P84J 1CI5A 1FLTX 3QWOB 4JFZH 2H45A 5ECJE 2BJMH 4Z95L 3FMGL 4L4VB 4OZIF 1KIRB 4M1CD 1NFDE 4HUKB 4MDJA 1ZHKA 4TUJB 4Z78A 4E5XB 3X14B 2E7MA 1DCLA 1U8JA 1OGAE 1A9EB 3BD4A 1QBLL 3HMXL 5DJ8A 4HFWA 4BUGA 1MFCL 4N0CC 4HK0B 4M48L 5FFLA 5DUPL 1DVFB 1UWEH 5MENE 5F9DC 5HPMB 1IAIL 4UU9B 1IE5A 4HG4K 3HLAA 4LPUA 4F8TA 5L6YL 4WI5A 3ARTA 2D4DA 1TPXC 4JO1L 2X09A 3RIAF 3U48A 1MIEH 4NKDA 1WQVT 3TYFA 5IBTL 3FRPG 1INDL 5F3HA 4O5LH 1BQHA 1EHLL 3BPOB 4TULH 1VFAA 4M5ZL 2OMNA 3D85A 3I75A 3TIDB 1QRKA 4GMTL 1G9ML 3VXPB 4WUUD 5K33A 4K7FB 1MF2L 1CDCA 1HXYB 1UM4L 4KJYA 1PYWA 5D7LD 3VWKB 3C6LC 2GHWB 3D87B 4C56A 1JGVH 1CDUA 1MFEL 2ED7A 3WIHH 4LLDA 1QKZL 5CSGA 2EZ0C 4HUVA 3IDXH 1MCBA 2CRYA 3GSUB 2JF1A 2R8SH 4L3AA 4GRWH 4ZFFB 3U4AA 2G75B 3UTTB 4ZOAA 3R8QA 3PF2A 5L8LB 3D85B 1CGTA 3TA3D 3ULVL 1CFTB 3ARDD 2F53E 5F1IB 2XRAH 4YZFE 3ARFA 1VPOH 2FH8A 2MQCA 2P5WB 1AD0B 2C3XA 4IRZL 1AI1H 4Q74A 3A67H 1H0DB 4TNWF 4DQOH 3F7RA 5TDNB 3O2WH 4J7RA 1M6OB 4WEUD 2V5MA 1Q72L 3NZHL 2WIIB 5F7EH 5E8DH 1GZQB 3WHXB 4AY0A 3SGJC 2X9XA 5J6HB 1KLGA 5KVFL 1U8IA 2QHLA 3HI5H 3JSSA 4FQQB 3HMWH 2Z8WC 4U1HB 4KUZL 3TPUA 1ZGLA 1MCQA 3E6HA 4JPIB 2IAND 4RBPH 4RISL 5TE6L 2F8XC 2X4TB 1Q1JH 4K9EC 3QNXA 4MXVE 4OIAA 4XWGH 1LNUA 5JO5B 2AJ3B 5HHOA 3LEYH 4QTHA 3CDYA 3UYRL 3KLAB 3MV9B 2FECI 4Z7VA 4XNXL 1WZ1H 2FZ3B 2Z9TA 3THMH 2ZUVA 4K3EL 4X99A 2CLVA 5EBGA 4D9LH 1GZQA 4QRUA 1E6JH 2XWTA 3DVNB 4FXGA 4G7YH 4MGXA 2FWOA 4YR6B 1KJ2L 3JXAA 2AXGA 4FFVC 3EYUH 1TLKA 1T04A 4RBPK 1FJ1B 2O61B 1GOGA 2V17H 3WD5L 4YHOL 4ACPA 4OZIA 1OAQH 4RGNB 2V2XA 4ZFOL 5IW6B 3M17A 3RWHA 3KLHC 5KN5B 1ZXQA 1JZ4A 2QSQA 4BUHA 4DOHB 4YBLC 2LAAA 2JB6B 2L7UA 4P2QD 2GJ6A 5A1AA 1UXSA 1B90A 3HNTL 4K3HA 4B7IA 2X4NB 2Q8BL 5CD5C 4RGMC 1FNAA 4KU1A 1F8TL 3H3PH 1PYWB 2CK0L 1IC5L 5I66B 2F74A 3RVVC 1SBBA 3RX8A 1NGZB 1T20B 3D69B 5B22A 4IRJC 1I1YA 4C4KT 4IOSD 2VN4A 4F7PB 3L3IA 4HGWA 1CQKA 2E27L 1EXUB 1TZIA 3V8CA 4I77H 1F58H 1CFNA 2Q8AL 1R5VB 3ZSTA 1KV3A 3PJSB 2CXKA 3TH4T 1KCSL 5GHWH 5FDYA 2NY1C 1YQ2A 3RWJA 4NN7C 3MV8A 1ZHNA 2VJXA 1T22A 1S9VB 3ROOB 1P1ZA 4PJ5B 2JK5B 4RGNC 5GJTL 4LSVH 1MY5A 2AKRA 5DD0H 3RHWK 5D96C 4G9FB 3KPRE 1YMMB 4PJ9A 3BXNB 2PYED 4AQ1B 1LDPL 1BQHG 2D31A 4P5KA 4GFTB 3W2DL 1I7TB 4K55A 3KPMA 2NXZD 3GZKA 4XCNA 1IEHA 3QUZC 4M1GH 4QRRD 5F3BA 2AEPH 1R3LA 1I8LA 3GMOA 4BFIA 4WFFE 1ZLUH 4C58B 4IHOB 1R0AH 2RIKA 3A0OA 1SJEB 3O2VH 4KTEL 1KTDA 4QRPE 1QSEE 3O8XC 1R3KB 5GGQL 4PJ8D 1IT9H 3GSOB 4RDQG 2DQCH 4ZS7H 4RMUA 3FFDA 3T1WA 3F7YB 3VXOA 2O26U 1G9MC 2FJGB 3GNMH 4NBXB 4ZXBC 1AE6L 1XGTA 1I1RA 2PETA 3NACH 1UH3A 5DZLA 3W0WA 5FHBL 3GMLA 4AM0A 3IETA 2CUMA 2P5WE 2R1XB 3CLEH 4YQXL 1FCGA 2BVOB 2B39A 4X80L 4LSVL 4LVNC 1NJ9B 3QG7L 1IBGH 1G7QB 2DI8A 4F2MB 4HQQL 4CJ1A 1RUKL 1AY1H 4K8RH 3O8XD 5GHWL 2HFGH 1M7DA 1JGDA 4TRPL 3U4BH 3DX8A 3S36L 4YDKL 2VISB 1L4IA 5TF1L 3JTSA 4PJ9C 4JFHE 4NQCD 4N90E 1U95B 3QUYD 5L2KE 2W1NA 4NQEB 4DCQB 3AU1B 3TLRA 4N1HB 1T0NB 1NBVH 3IRPX 5EZIL 4XP6H 3HZMA 3FQUA 2NX5B 1UQSA 1EAPA 5J4MA 5FCUL 1M71A 2B1HH 2YKLH 3JV4B 5EFIA 2E7CA 3UJTL 2EH8H 3BVNB 2VR4A 4Y4KC 5KSBE 5GGUA 2CXGA 2QQKH 1TIUA 1J10A 4ZOCA 2HJLB 2R1XA 3GI8L 5JNYA 1J8HB 1IM3B 3IKCA 4L8BB 1W8NA 4NOFA 2ZOKA 1D5XB 1MWAH 1JN6A 3WXWH 3PWLB 2BVQB 3WD5H 4X6CB 4F33A 1NL0H 1TPXB 5JHDE 2ZKHL 3F8UB 3L5XH 3RA7L 3QO0A 4MQSB 4MDIB 4YHZL 4XBEL 3NCMA 4G7YL 5FKAA 3T0DA 4P2QA 1UKQA 4K8RC 5ADOH 3EDJA 2UWEF 4PRPE 3QDGE 1BJMA 1S78C 1I1AA 3PWPE 5ERWA 4L1HA 1J11A 5E8NA 4H88H 4PPTA 5ILTL 5C0BD 5CJQH 4NFCA 1YPZB 3SKJL 2ZUTA 5AD0B 3GMOB 4ZTOL 4DK6A 2P24A 2ARJB 4FQLL 4P4KB 3DV4A 5MI0C 3B5TA 3C8KB 1NANI 1VGEH 1QA9B 1MFAH 2BVUA 2ICEA 1WTLA 4OBRA 3ARBA 3RGVB 3UTSE 4XP1L 3ARGB 1Q9OA 3NH7L 3SGDH 1I9RL 2DQHL 1UACH 1A6ZB 3SPVA 1A7PL 4FZEH 1JHTA 1NQBA 2VLKB 2R2BA 3I6KA 1PLGL 1CE6B 5EH1A 5FKAB 1TTGA 2C3GA 1F00I 1YEHH 1QR1A 4R9HA 3U4EA 1F42A 1MWAA 1ND0B 1HYRC 2CKBB 3T77B 5C7XL 2YC1B 4LL9A 3HG1B 1I8MA 1XIWB 4E0RB 4JFDD 3F7PC 3BGAA 3JUZA 2R8SL 4F9PC 1MCOL 1N5YL 2DD8H 1SYVB 4CVUA 1QKZH 4HS6A 1MFEH 4OLUH 4WU5B 3KPPA 4N9GB 4O58H 2DKMA 4NGHL 5I16B 4H0GA 3S5LB 4XBGB 1UM4H 1CU4L 2CSPA 4GBXA 3GMLB 2Z0BA 4QTIH 5E94A 1DLFL 2ICWA 3JBG7 3MREA 3TBTB 3RPIA 2JJTA 4JKWA 4JE4B 1TVHA 4EI5A 1ZHBA 5K9QG 2H9GA 1N0XL 1G7PB 4TULL 4ZQKB 3QIUC 3RWHB 1DE4A 5IBTH 4OZHE 5I8KL 1B6DA 1AHWA 1KB5B 5HTSA 2A6IB 4KVCH 5FXCH 4JQXC 4I5BA 1FNGA 3R06B 3QQNA 4M5YH 1JTPA 2HLAB 5BMFH 2OI9C 3DUUB 2ADIA 2WSKA 4Z7VB 1FNLA 1JGDB 1UCBL 3K3QA 2F74B 4HHAB 4WHTB 3VGHA 1P5UA 3AB0B 3MA7B 4JZJB 4BA8A 1RZFH 4CVZB 4BK4A 1O0VA 1C12B 3FQWB 2V2WA 4CADB 3BXNA 1DBML 4GH7B 1U8QB 1F4XH 5MHSE 4OF6A 2HH0L 3BD5A 3MRFA 4JFZL 4C56D 2HH0H 2FD6H 4HIXH 4HKJA 4JG1H 1TDQA 1XAUA 2X1PA 1XH3A 1I4FB 3FOMB 4TOYH 2YD4A 3KJ4B 4JM2A 1HK6A 4YHKH 5GRUH 4I4WA 5CHNB 3F65A 2EEBA 5DT1H 3BP6B 3ULUF 4LFHG 4IOIB 1RFDL 5DO2D 2XZQH 1HIMH 4QXTB 5J8OA 2C7UA 3SOBH 5DRZB 5IVOA 4K3DH 3CSYA 3B6SA 1MCLA 3KS0J 4CGTA 4CMHC 1S7UB 2IANE 4HAGA 5F3BB 4MXQD 1HSBA 3ZYJA 4WV1B 1F11B 1R24B 1K3IA 4RGNE 4DEPC 4D8PB 3HZYB 1DQMH 1S7XB 2YEZB 3GM8A 4UOW0 4MB3A 4H0HB 5EU6D 3UAJC 1UVQB 1FL5B 5D7JB 1KLGB 5FHAL 3S34H 4WUUA 1C1EH 3PV7A 1L0QA 4RNRA 5BOPA 2DLEA 1C08B 4NGHH 3GGWA 4OD2A 3MLXL 4I8DA 5BVJB 1CFBA 3GSXB 5SWZD 3MC0A 4Y4FA 3ILPB 5A43C 3W5MA 4GXUN 3CFDB 5C0BE 2KPNA 1F3RB 1RZKC 5HI4C 2NY1D 3BD3A 5E24E 5F1IA 1T0MB 4L5FL 15C8L 1H3TA 3BUYB 4R4FH 1A6TA 2ZG3A 4GRLC 1MCIA 3CZJA 3JV0A 3TA3A 1IQDA 1E6OH 4NNYA 1MREL 2VH5H 5D5MB 1TXKA 2C1PA 2GY5A 3ZKXC 1N7ML 1EHNA 1XGRA 1JZ6A 5EU4B 2Q86A 5CFHA 3IFOB 1A6AB 3ZL4L 1QBAA 1FHGA 4G8GB 3KXFA 2B1AL 4PJDE 4L9DA 5KVEL 4WHTA 3QDMA 2A77L 4PJHA 2CKBL 4Y89A 4X6DF 1W0VA 1YECL 4MJIA 3B83A 2X70B 3BGMB 3Q5TA 5DEZA 4XBPA 2VLRB 4I5BB 1UB6B 5F3HB 1CVSC 2Y07L 1CGVA 2QHRH 3ARZA 3MCG1 5KANG 5MERB 3ULSA 5B3NA 4HK3N 4BSVA 1N5AB 4L4VE 1J5OH 4XPBL 4OCXL 1D9KA 1JV5A 4WFED 3B9KD 3WXVH 4PJHB 4Q9BA 4P5MB 5C0NC 2V7HA 3SJVB 1A6PA 4IOFC 4BH8A 1KEML 4NZRL 5TFSL 1A4JA 1YUHB 3ARFD 5IQ9A 2XI9A 1OAZL 4FFWC 4I2XE 1A4KA 5JOFA 3BO8A 4RFNB 2VKXA 1XGRB 1IEBA 2ZKHH 1G6RB 4JFXB 2OL3B 2YWYA 1S7QA 3TBVB 3F6LA 3LV3B 2F54D 2A1WL 5IT2L 2FGWL 3JV5A 3ALPA 1WIUA 2DBJA 5E2WL 4K23L 5EC2B 2DDQL 5F7FA 1OSPH 3KPSD 4CVWA 3U46A 1A7OL 4D9QD 4HIEA 2ATKA 1U8PA 3S35X 4P3CH 3LEXB 5DF0A 1NGQL 2BNQB 2EH8L 2QADB 3QQ4A 4M1CC 3VW3L 1N2RA 2ARJQ 3O6MH 5D96B 3T0EB 2DLFL 4EBQH 1AXSA 1CF8L 1WTGT 4Y16A 4DKFH 3ZTNL 1LK3L 1CFTA 4P48A 5ISZD 3D9AH 1MCJA 5DJ2A 5DJXA 2BY0A 3L6FB 3BIBX 4BQ8A 5GJSL 5E99H 5JXEC 2DBLH 3X3FH 4H26B 2X10A 5TDPA 4PV9B 1RQ5A 1T7ZA 4EDXA 3S36H 3C8KA 5CEZD 1IC7H 4M9OA 1RUPL 2BC4B 3X17A 4TRPH 3U4BL 3UEZA 1RK0B 4ELKB 2HFGL 4PRNB 5DA0B 1ZA6A 2P44B 2IPUG 4LP5A 2DQJL 1K6QH 2VXSH 4JO4L 3VFTA 1U8NA 5EO0A 2DQFA 3ZDZF 1VADB 1GHFH 3BKYH 3VFGH 1EZVY 4FQ2H 4MD4A 3DXAD 3OKDB 4YK4C 3DPBA 4NKOA 2CDEB 3RUGF 4YQXH 2VIRB 3U7WH 1OT2A 4HJ0D 1V3LA 2ITDA 1NH6A 3IDMB 2MNUA 2CD0A 3D5OF 4YAQB 4OD2B 3DGGB 3ZE0E 4WI2A 3SE4A 5F8QC 2VLMD 4BFEA 1Q9OB 2PTTB 3JV6A 1MCDA 4R97B 3MXVH 2AV7B 4XVUC 1QBBA 4OGAC 5E2VH 5C09B 4G9DA 1IT9L 4QCIB 4NRZB 2RGSA 3DV4B 5GGRA 2RFXB 1LO4H 2ZUQC 5K9QI 5E6IA 1QA9A 5CP3A 1A3RL 2HT3C 1I3UA 4PJGE 5CUSH 1XF4B 1JHLL 4GOSA 4GAYA 4DZBB 1QLRB 2LV4A 4MHHG 3TZVB 2V5SA 4NN5B 4ODWB 1CR9H 3DOSA 3VXTA 1KIPA 4JLRB 3RWGB 1Z0MA 4TN9A 3QULA 4G80B 2WINA 3QIWC 3H42L 1AGFA 1TQCC 4EUPA 1JRHI 2CDFB 1JPGA 4O2CB 5FYKE 5DJDB 3ZTJG 4I18C 1ZLVH 5IB5A 4Y88A 5IMOA 3BP7A 3AB0C 2FO4A 1LO0L 1N6QH 5ACZA 4Y4HB 5C8JB 4Z8FL 4ZD3L 2NY0D 3VWKC 4KGJA 1KCSH 1QG3A 5FYKL 2BVQA 5CZVH 2APBA 1OQXA 2V9TA 4MXWL 4N0UA 1F58L 5T5FH 1XR8A 4GSDH 4Z7UE 2HYMA 1QRND 3IKCB 4L8BA 4K94H 4CDGC 4M6OH 4K9EL 4OZGE 1GJIA 3L3KA 3E2HC 4P3WA 5E7FA 1FC2D 1IL1A 3MXWL 3IVKA 4G6AD 4MNGE 5L9DL 2PF6A 1UQSB 1IEAA 4OCWH 3VFUB 1TETH 5F1OB 4YBQC 1KXQE 5HDLA 5M94B 2X7LA 4HMEA 5FYLH 4JAMB 4ONHA 4W70A 2VZSA 3U0WH 3HNTH 3PQYB 4KKAC 2HKHL 3B9KA 4LFHD 4X7CC 2NNAB 2FL5A 2UUDH 5LAXB 5E6IC 2DMBA 4P57A 4E42B 1CFVH 4MJ2A 5JPMB 3ESVF 4ZUTB 1KCKA 1F97A 3WFDH 3PUCA 4TSCL 2FEDD 2FIKA 4N1CA 1AP2B 4XPGL 4U1KB 4OV5B 3C6SB 4QLRA 1MRCL 3N9GL 1D6EB 1DDHB 5F9OL 3KPSA 4HV8A 1KJ2A 2ARJA 3STZB 4D9LL 5ITBL 1K4CA 2FBJH 3K8KA 4K3EH 2I5YL 1YPZA 5AD0A 3ZT6A 4P9ML 2FDBP 1JGEA 4JQVC 1XGTB 2QBWA 3SCMC 4KHXH 2CKBA 3QEUB 1FGNL 1RZJH 2QSCL 3MLSH 3T77A 5T3ZE 4WW2F 1N8ZA 1ZWIB 1Q1JL 3B9VA 1DN2A 3TZVC 3VFNA 1EUUA 3GJEA 4LF3B 4AEIL 1TJGL 5HYJE 1JF6A 2W0PA 4PJFF 4O02H 3OJVC 4P59L 7FABL 4DGYL 4K71C 4YAQA 4O9HH 1JF1A 3ABZA 3HHRB 5EUOB 2R0WH 5DQJA 3NA9H 4N0YH 4MJ4A 5I74B 3DUHA 5D7KE 1EFXB 5GIRB 2LU3A 2HKFL 5FV1L 2BFVH 1NCWH 1HINH 3A67L 4MLSA 4F7EB 1X6LA 5B8CA 2BVEA 5HI5D 5IFAL 3VD4A 1FYTB 4Z0XB 1C5BL 1J88A 4XC3H 4GKSB 5JR1L 3QCTL 1BBDL 1G6VK 2P46B 1MRDH 1A6WH 2JJUA 4N0UB 3C6LA 5FKPA 3SDYL 4XXDB 2R69H 1MCPL 4JFFE 4UI2A 2J4WL 4TPRH 3TT1L 3RVTC 4R2GB 1U93B 2VLME 1AH1A 3RZWA 2VQ1A 1H9VA 3D2UD 4NWUH 3HRZB 5IIEB 1I7ZA 1OTTD 4JZNB 4GKNA 4FQXA 4MQ7B 1CGYA 4FHBD 4AIOA 3MRIB 4DKEL 2NY3C 4NJ9L 4TSAH 1G9MH 3MRCB 1BJ8A 4O4YH 3RNQB 3MPCA 4RZCB 2XA8L 3DROA 4LPVA 1IAMA 4JRWA 2NY0B 4G5ZL 4QXWA 4GMSL 1MIEL 2W9DH 1T1XB 1A9BB 1T1ZB 4TVPD 3L3KB 5E2JA 2B4CH 1A64A 1XR9B 2W60A 3EGSA 3F62A 4OF5A 4D0CA 4P23C 4NFBA 3D0VB 4M8VA 3RVVD 3DNKA 5CP7B 5IVZB 1EGJL 1DBBL 5SWZE 5KG9B 5D8JL 3WMSA 1U3HA 1WV7T 4KRMB 2EIZA 1JVKA 5FUZH 5DXWA 5KS9F 2XXCB 2ATPB 1JFQH 3WE6B 2YS4A 4RFEB 3N50A 3W5NA 3TBYB 4C4KO 2DQFB 5SX5H 3PQYE 1XCQA 1A1OA 2G60L 3NFPB 4F58L 4JM2D 4L8CB 2XTJE 3T0WA 1NAKL 4PJ9B 5E9DE 3HNSL 1FDLL 1T1WA 3GEWB 4HC1L 3U30C 3P0VL 5T3XH 1A02N 2OL3H 2EYSB 3M8OL 5D6DC 1FVEB 2PTTA 3JV6B 3HUJE 1WWBX 1IVLA 3BISA 3L9RB 1F45A 3NAAL 1UT9A 5AZEH 1NGWB 5DK3A 2DM3A 1QACA 5FUCC 3IFPA 1IMHC 3NIFF 3QQ3B 4OZHB 3PWUA 1U8NB 3MLVL 1QPXA 3SDDD 4X83A 5GS0D 5I1CL 1GGBH 1C08A 4AYFA 2YUVA 4LCWE 2CR3A 2X4PA 4PJ5E 1BJ1J 2DQIH 5TDPB 4N1EA 3U82B 5I66A 2YPVL 2H3NA 4Y2DA 5FDWB 5I1IL 3PHOA 5CBAA 3P4OB 1T7YA 3QT2A 3AAZB 4FQCL 2HJFA 1LEIA 4KH2A 1ZS8B 2V2TB 3PP3H 4JJ5B 1I3RB 1JV5B 2PXYA 3QCVH 3QQ9D 3ZYZA 4G43B 1IGCH 2X4UB 1AR1C 3N1FC 1DBKL 4OD3L 3VWJB 5J1TC 2YD1A 3PJSA 3U79A 4OZIB 2AW2A 3RNKB 5D2LF 1T04B 3SY0B 3SGEH 5I17B 2HTKD 1WLHA 1F2XK 5TE4L 2EXYD 4U05A 4AEHH 5F7YC 3D39E 3I3DA 4OZ4B 4Y8DC 2I60H 5B39B 5F6HI 5GS2D 2DQUH 5DFWH 5KSBA 2HAZA 5EC2A 3KLAA 3L7EA 4IS6A 4NQVB 5EZOH 1B0WA 4DOHE 1FNSL 1EPFA 3TESA 4HEME 5F7LB 2V2WB 4CADA 1P84K 3HZVB 1RK1B 4QHNB 2A73A 2CIIA 3QWQB 3D25B 3T0ED 1FVCA 3ARUA 4WI4A 5HVFB 3BQUC 3MCKA 5KVDL 3QZWB 1S7UA 2LE9A 3TBWA 3TIEB 1RZ8A 1F4WH 3WNPA 5HJ3A 3HC0A 3SDAD 1ZLWK 2WUBL 1NMAL 1R3JB 3DECA 4TUKL 5JPNA 3ARGC 4LIQL 4YO0B 4IDJH 2YZ1A 4MB5A 4NP4H 4I0PB 5A3IC 2PR4L 3OAUH 4JFQB 2DAVA 5GISL 5ACLA 1CL7H 5JIHA 5JQ6L 4RMQA 1M7IA 3BP5A 1IJ9A 3P40A 2ARWA 2Y06L 1ZHLA 2EIEA 4GQ9L 4KI5C 3T2NH 3LS5H 4PTTB 3GI9H 5JO5A 5FM5M 3IU3A 5MP6L 5C6TL 4OKVA 4JVPA 1G7IB 5FO8B 3V6OE 1EMTH 4YXLH 2Q86B 2R56L 3IYLW 4LLVA 3WDIA 3S5LA 1H15A 5EPMA 2A83B 1GGIL 3G6JF 4KROD 4P49A 4WHCA 3CFCL 3PXJA 2CH8A 1EJ6A 2H1PH 4R7DB 1TTUA 3QH3B 3CZFA 5DURB 1MWAB 1ND0A 2UZIH 3K81A 4JKKA 1JPSH 3E8UL 4NN6C 1H0DA 5DD3H 3H9SD 3WUZA 1UWXH 4Z77B 3VXNA 3UTPD 1ZT7B 1IKNC 4HDIB 2R1WA 2YK1L 4PJAB 3O9WC 1TMCB 2ESVD 3BMVA 4NQDD 5DC4B 5E9DD 1UVQA 5CD5D 3PABA 3EO9H 1TNNA 3L3HA 4IJ3C 4RRPG 1Y6MR 2ZOLA 4HFUH 2Y06H 1NDGA 3SDDB 4LVOB 4LCWA 2VDRL 5TGBA 3VH8B 5IQ7H 5DGRA 1Q0YL 4HZAA 4X6BB 5J3HC 5AYUL 2Z31A 2JJSA 2DTMH 4X7TB 4L4VA 3EDKA 1KLUA 2WUBH 2FHFA 2R1YB 2CMRL 2E7BA 3KYKL 4HPYH 2FECL 3DUUA 1NAMH 1F4WL 1AIFA 4PRIA 2NW3A 3QIBD 1I1AB 2IFGA 3OR7A 1B4RA 4JRYD 3IF1A 1QSFE 1J1PH 2YN5A 3EO1A 4NHUA 3ULVD 1BX2B 4XNQA 3V6OA 1CICA 4G9FE 1GPOH 3MR9B 1MHCA 2EKSB 2EYRA 1S5HB 1TFHA 2EDJA 4CW1A 4HCRH 5ADPL 3D0VA 3MGTA 1R5IB 3V0WH 3FQWA 2JELH 4X6CA 4LHUD 1LO5B 3LB6D 3MGOB 4H5SB 1VGKA 3LZFH 1A9BA 4TVSa 1MVUA 1BQSA 1N6UA 1G6RH 5E2TH 4X9HA 3C5JA 3O2DH 5HY9A 4AEHL 4DVBB 2E9WA 3ZHKA 2Q6WA 4U1KA 1OARL 3OXRB 1AO7D 5F88B 5AYQA 1D7FA 1X4ZA 5AWNH 3BW9B 2FO1A 4F8QA 3HPJB 4RZCA 3IB4A 1XF3A 4PJDB 5EFIB 3JWDC 5C0JB 5A2FA 2P47B 3DV6A 1FORH 3QCVL 3DMMA 2OTUA 4MXVF 4HWEH 3SKMB 3DRTB 5INDA 4GBXC 3BT2L 1U92A 5HHOE 3QNZB 4RA3A 3U9UB 4MJIE 1K8DA 1KB5H 2BP3A 3SHSA 1XIWD 3BWAA 1RUQL 4ZPVB 1BZ9B 2GW5A 2HVJB 3RZCA 4NQDE 3QR2A 4I0KA 5F1NA 5BZWA 3TH3T 5I16A 2VZUA 1HHJA 2HN7A 2UUDK 3VRIB 1T1ZA 1LE5B 5HI5C 4JQXA 4QOKE 4J6RL 4PGDB 4I18B 4FTVD 2QADC 5CD3A 2XTJC 2DLGA 4S1QL 4DK3A 5C09E 2CPCA 1AXTL 3S5LG 4BFBD 1D6VL 4XVSH 2X4RB 4EI6B 1EFXA 3OKKA 1L7TL 5C09A 4JFEA 1QYGH 1QR1B 5HHME 5E8NB 2NLJB 3GBLA 1OAUH 2OTWA 1K3ZA 5D70L 2PYEA 4R4BA 4ODTH 5IKCA 3RHWF 4YZFF 5TPWL 3T3PE 1YEIH 4DKAA 4LU5L 4P2QB 3LIZL 4NKMB 2C9AA 2OTUB 3ZKMC 1NAKH 3LEVH 4LGRB 4JFHD 4NQCE 3LRHA 2HFTA 3VMNA 3PWNB 4Z7QE 3U6RA 1YNLL 2W0LA 4ZSOA 2JJTC 2EDDA 1N8ZB 5F97E 5DS8B 1FNEB 1FPTL 3OKKB 2EDXA 1I9JL 1NC4A 4KZDH 1Z6JT 4X0KB 3LPWA 4TVPE 5FOJA 1D5XA 5IWLA 5DRNA 5GS1A 2VLJA 3VXSA 1G7HA 4R7NA 4F57L 1F6FB 1UXWB 1Q9WA 2DQTL 5GSVB 2ZOLB 5MEPB 5L0QB 3Q5OA 4QGTA 5H2BB 4QCIA 3H9SE 3FZUD 4U31A 2Z8SA 2WBKA 4PGCA 4HIHB 1WEJL 2EYRB 2XZZA 3MRKB 1C7SA 4KVNH 1UGNA 1ZTXL 3CXDL 3HZMB 1T21A 4KV5E 4UIKH 4LNRB 1CXEA 4HXBL 3QXTA 4UAOC 2PYEB 1TZIB 2BNQA 1NC2A 3MFFA 4D3CL 4NSKB 3ZKXB 1UC6A 5SX4H 4XPTL 4K3JL 2HTLC 4NUJA 4Q6IB 4XP9L 3DV6B 3BIAX 2G2RA 1H5BA 2VDOH 4PJ7E 5K59F 4MA3A 5CINL 3NGBC 4NIKB 1JN6B 4X6CF 4R3SA 3WCYA 5I73B 4J8RA 4PJ7A 4A2MA 3BKML 4KTYA 1UH2A 3VA2C 5JOPE 4U1MB 1QSFB 1KSRA 3L1OL 5ESQB 5EO1A 3ROLB 4PJXE 1YUHA 1VB9A 3BE1L 4PB0H 2J1KA 4NWUL 2DI9A 1ZAGA 3MOQA 4OQ1A 3AS3A 4X5WA 2IPTH 3QUYC 4QEGA 1XGQA 2NY7H 3ZKNC 4ZPVA 5FB8B 4WW1B 5EBLB 1U8HA 4MZ2A 4WTXA 1WISA 4PP2B 4DJMA 3V52L 2SEBA 4XPHL 1A2YA 5IEKB 4IRSB 3BEWA 5IK3B 2Y5TB 1K5NA 4XC3L 4LASH 1MCWM 4M1DH 1CBVL 1JRHH 3QFJE 2P5EB 3GSQA 3PGDB 3T0VA 4LSPL 2MCPH 4UIKL 3ZKMD 4WDIB 5EORH 4NRXA 1NCWL 2BFVL 1BEYL 1A7QH 3LKPB 2WM0A 1EHXA 4N0YL 3KXFB 1JGLH 3KDMB 4LAQL 4PP1D 4O9HL 2OP4H 3HE6A 2DQTH 4HCRA 4P59H 2XQYG 4JB9H 4APQC 4GW4A 4U1HA 1RSFA 4G6KH 4G7VL 5IVXE 3OKEA 3TNNB 1I9JH 3HNVL 3RTQD 3MLSL 4NZUL 3BUYA 4ZAKA 3BZ4B 2YPKB 1F4YL 1R3KA 4R96B 5H35B 3S36X 4KROC 3U2SB 5I1JL 1E4KC 4GG6E 3G04A 3WUWA 2IPKA 3S96B 5E00A 1YEDB 4PIRF 1YY9C 5HYQB 4X6EB 3WN5A 5ITBH 1J0KA 5SWQA 1YJDH 4ODTL 5JHDA 1HSAA 2VAAB 3QCUL 5IHUL 4X5XA 4XI5D 1D5IH 1YNKH 4IM8A 1KCLA 2NXZC 3QDMB 2N56A 2Q76B 3GMPB 3OZ9H 4Q97A 2BSTB 5A40E 4P2QE 5EIIB 5D5MA 2H3NB 4JY5L 3WFDL 2ESVB 4HWZB 2OSLB 5HGGS 2A6JB 1CFVL 1CVRA 3QP3A 5FOBA 5AZ2H 4UT7L 4IS6B 4HK3J 3AY4A 2DQGL 4XCEA 2E6PA 2RQ8A 4R90L 4NNXB 2NR6C 2XPGA 4LSUH 5I1AB 4XX1G 3BRGC 2FX7L 3FT3A 5T3XD 1NC4D 1WBXB 1A1MA 3CPLA 3PG2A 4K7PX 4KZEL 3CFDA 1EERB 2R23B 2ITCB 4QOKA 5I1AA 3RBGA 2XFXB 3S7GA 2LU4A 4PGEB 3EDEA 4K94L 2CLVB 2WANA 3U0TB 1Q0XL 1DBAL 3EBAA 4DVRH 2R2EA 4GSDL 4BELD 2UYLB 1NCAL 2QL1A 2C4XA 2C5DC 2BC4A 1GRWA 4FXLA 5F1KC 3BESR 5JW4R 2DTSA 1KCVH 1V7MH 4XMPH 3P9MB 3W11C 2Q76A 2A73B 3X14A 4PS4L 1NC2D 3QDAA 2DWDA 2X41A 3A6CL 5E2UH 3RX5A 3HCVB 4D8PA 5KN5A 1SY6L 2DKSA 4PJCE 1MRFL 4KK9C 5BRZA 3P9WB 3RY6C 3OJDB 4HWBA 3F58H 4PRBA 4NQVA 1ZGLM 2BXYA 1DQTA 1RZ7L 2AAVA 4U7KA 3PWJA 5E0QA 3WNLA 3BN9D 4XNUH 4L29B 4LLUA 5CMAA 1EA9C 1GPOL 3MRBA 1U8PB 3C87A 3ETBF 1A3RH 3ARFB 5D5ME 3TIEA 1LO2H 1LO4L 4ZAKB 4Y2OA 4OJFH 1YC8A 2L7JA 1II4E 3HC0B 1F2QA 3U1SH 1OGAA 5HPMA 4J3OC 2OBGA 5E4EC 5D1ZC 4Z9KB 3HAEA 5F9WB 3UTTA 1U3YA 3QPQD 3L3GB 5IQ9B 3T4AB 1KIQB 4W6XB 4XMLL 1VEMA 4WU5A 3UPRB 3CFKA 4LLDB 3UYPA 5HYIA 1ZLUK 2DMKA 2APTA 1MH5B 3TCLA 1T0MA 1N4XL 2GYSA 2HT4C 3MLUH 4U1LB 2A6DA 3P77B 2EDRA 2DQJH 4NBZB 5JMOC 4UILL 2Y36H 2HMIC 1HCVA 4WUKL 5H37H 3MUZ1 4S10A 3L5IA 3RP1A 3L9RA 1CD0A 2P42B 2P49B 3T65B 5D1QC 3VWJA 1WCBA 5GJSH 2VR9A 1NUGA 4OQTA 4I2XB 4EN3C 3EYVA 5CBAB 3V7MA 4GKSA 2NXYD 4HK0A 3AAZA 5FOBB 1RZGB 4GG6B 4EBQL 2R9HD 1KB9K 4WU7A 3JVGA 1MCSA 1V05A 5CZKA 4ZUWB 5KOMC 1LD9A 1NGQH 5DQDL 3FT2B 4MYWB 3EYOB 1J7VR 2ED9A 1EEUA 1FZMA 3VWKA 2G9HA 5C6TH 5CSBA 1A7OH 5ID1A 1IGFH 3GI9L 3FN3A 5JHDD 1JZ7A 3LS5L 4TTGA 1PKOA 3T2NL 2XFXA 2RCSH 5CS7A 2A1WH 5IT2H 1KEGL 1PG7W 4M93C 4PJ7F 1T7WA 3CLFL 3MOAL 4OT1L 5EC1A 2MCG1 4LNRA 1YEFH 4UIMB 3BP6A 1UCTA 3OAUL 4OZHF 1NC2B 3EOTL 4S1SL 3CFBA 1J0YA 3SCMA 4IDJL 4HMCA 3VE0B 4MDIA 4JN1H 2EDOA 1KEMH 3U7YH 1E27A 1NEZG 2V9RA 4WI9A 2ID5A 1N3NA 4HKBA 3WXVL 4LSTL 3SDCB 4XPBH 3VA6A 4YGVB 3B3IB 4HKJB 4QY8B 1IGML 1GH7A 4CN6A 4QRRA 5D72L 1J8HA 5I19H 3O4LB 3MV8E 2V7NA 5HD8D 1ROWA 1T6VN 5L7XH 2J12B 2Y07H 1NFDB 3WLBA 1IKFL 4MSWA 1YECH 5J11C 3PGFL 4RMWA 2EIZB 3G5YB 3QUZB 2XQBL 1KTLA 5MEQA 1HZHL 4ZUTA 5I30H 5CEZH 5LCVH 2HLAA 4U2ZA 1UYWH 2K1MA 3NA4A 3VFRB 5GGTH 4JFDB 2MMXA 4OZIE 4X6FB 3WS6A 3KPNB 5ESVA 4NJAH 1BIIB 3P4LA 2F5BH 1WIPA 3UTZA 5FCSH 2ICWB 1MNUH 3MREB 5FB8A 4OD3H 4JFEB 1TVHB 5DQ9B 2R0ZH 1EEYB 1I7RB 4Q7DA 5IJKC 3MO1A 3ARYA 5C0AB 1VACB 1WF5A 4PRID 2AK4E 4J4PD 3T09A 4RX4D 3SEPA 1CE1H 1T1YB 3VI3E 5DMJB 3NTCH 3BPCA 2OZ4H 4KDTA 4LCYB 4NQXB 4QHUB 1BZ9A 1SYVA 3BP4A 1XIWA 3FONB 3N85L 5F1NB 4L4TB 2HVKA 4ZSOE 3PNWA 5TJWK 2DLIA 3LPGA 4X9GA 1C1EL 3K4AA 2R4RL 5TH2A 3BEWB 5IK3A 2X42A 2DWEB 3LKNB 4F9PA 1DTUA 5EWIH 1HH6B 2A0LC 4P23A 3JWOC 4JCLA 2QJDA 3DX8B 4QRPD 3SPVB 4WO4B 1RHHA 3D18A 3VGEA 3W9EB 2VLKA 4GW1A 1XF2A 1FNHA 1DUZA 4QHUA 1ZMYA 5SV4A 1I8KB 1FYTA 2XN9D 4QRQB 2VXVL 1XF1A 35C8H 3TBSB 3P0VH 1EAJA 5IEHB 2ZUSA 5I1KL 1K4CB 1FYTE 3VRLE 4J8RB 2GCYB 4TTDC 1KYOJ 3BQUD 4ODSL 4RAVA 3TYGH 4Z5RB 5IGXH 3KPLB 1QRNE 3FQRA 3SDCA 3BH9B 3TO4C 4N8PA 1QR4A 2FH6A 2JK5A 2VL4A 2JLLA 1E27B 4NT6A 1ETZA 3BIKB 4PJCB 4MA7L 2FEEI 1HNGA 5E6ID 1TJIL 1BX2A 1TZGH 4ZUSA 3I9GH 5E6ZA 4POZD 3G5ZA 5E70A 3BWUC 4LCCC 1AGDA 3RL2B 1KACB 1RZFL 2BRQA 2VDMH 5IG7B 2Y6SD 3OBAA 4EI5D 4F33B 4GRLB 1J0ZA 5E8PA 4KKCD 1DL7L 1KG0B 2I25N 2NXYC 4GAJH 3OTTA 4M5YL 1U3HC 4ZNCD 3VJ6B 5GGUB 3W0WE 1FQ9C 4PJ5A 4QY8A 2FLRT 3WIHA 3TFKD 3FFCE 5I8KH 1OHQA 4GMSH 1I85A 4GRWB 4G5ZH 1HHJB 1CLYL 5D93B 4ZYKB 1N0XH 2BSSA 1AXSB 1L7IL 1OOAA 2NY6B 1JYWA 4E42A 3MOBH 4NJ9H 4TSAL 4EVNA 1YEJH 4V2BA 4PFEA 3B9KB 3MRHA 4YIQA 5ALCL 1BF8A 1RIVL 1GXEA 3MRJB 3GIZL 4HKXA 3NCEB 4KI5F 3U0PA 2VNCA 5HGBA 4LCYA 3RKDD 3WS3A 4CL7A 5D7LE 1QOKA 1JNNH 3H9HA 2X05A 4OGAD 4WI8A 4YFDB 1IFHL 2X44D 4XVTH 1AFVL 4NM4L 3C9NA 4H8WL 1SJXA 5JR1H 5EUKA 1A6VH 1PKQE 4OB5H 5C0IA 1CFQB 3LCYA 4U6XA 3MV7E 3JV4A 1GSMA 3FT4B 3EDDA 4M62H 2OM5A 4J3VA 2FJGA 3ULVE 5EUOF 1A7PH 1KPUA 2FIRT 1MLCB 4UQ3A 2HKFH 5I71B 2DQHH 2YD3A 5FK9B 2YD8A 4UUJB 3WKML 2R0WL 5EO9B 2XQBH 5DRXA 2ADGB 5IB5B 3BGFC 3TWCL 4JY4B 1MFAL 1ORQB 2F9BT 2DQDH 5F6HJ 4XXCA 4UQ2A 2AGJH 4YHMH 4QO1A 4Z76A 4MD4B 4OD1L 5DK0A 1OW0C 1IGYB 2XICA 3WLWC 2VXUL 3QFDA 1KPVB 1M4KA 5GGVH 4XB7A 1GZPB 4F2MA 4H88L 2WBJC 1KC5H 3O81A 1JYVA 4P9MH 3IFOA 2DS4A 1XF4A 4V2CB 4Q0XL 1FZKB 4F7TA 3B3IA 1SEQH 2XY2A 3LKQA 2OLDA 3B4NA 4P23D 3S8WA 3L3HB 4OLXH 2C3VB 3QIUB 3CFJA 4PREA 1D5MB 2X4SB 3MNVA 2WP3T 1NKRA 2R0KL 3MRGB 4U1IB 4W81A 1XMWA 5MERA 4NC1E 4WHDA 4MA8H 2APXA 3ZYOA 1PSKL 2XV6B 4O51A 1KEGH 4UINL 2Y7QA 4HS8L 3EO0B 5BRZD 3MRMA 5I17A 1CDJA 4ERSL 1LE9B 1KN2H 2GIYA 2NR6D 4FRWA 3V9FA 3KYAA 3RVTD 3V6ZB 4KI5D 4Z7NE 1EBPA 2B5IB 2R0LH 1OB1B 5FO7A 2G9HB 1OTTC 1CXLA 4PRNA 5DQDH 5EU6A 2D7NA 4XCNB 4WWID 2GT9B 4LSRL 5F7MC 5FCUH 3S98A 2OL3A 1BOGA 2EDTA 4ZOEA 3TGXA 3BOVA 2GJ6B 4Z7UF 4HW6A 3O45A 1FRGL 1YN6A 3DXAB 3GSUA 2A9NL 5J3HD 1YYML 2XACC 4TNVF 2JB5L 1CZ8L 3V0VB 4WWKA 2VLJE 4YC2C 3TV3L 3Q6FA 3QG6B 2Z4QB 4RMSA 3H9SB 5DRZA 1JPTL 3QQ3A 2R39A 4S2SA 3G5XB 4ZFZA 4K8RL 3QQ4B 4JFQA 2ILLA 5I0DA 4LP4A 4Z8FH 1MEXL 4A6YA 1N4XH 1IBGL 3MRBB 3EO0A 4X7DC 2A0LD 4X80H 3L3OB 1MCKA 4K2UH 1EJOH 4LLYB 3ZKSD 4L29A 3D69A 1R3HA 5J0BA 1JZ3A 5FHBH 2HT2C 1MCFA 1NCDL 2C1OA 1WUNT 3N0PB 1AE6H 1T5WA 2CJUL 3DBXA 1OTSD 3GNML 2DJSA 4N5ED 1UJTA 1X5AA 3OB0K 3FFCD 1CR9L 3FQTB 1EVTC 1CXKA 2EE6A 1KELH 1S7VB 1G7IA 1Z9MA 2EDBA 5T33H