2IPTL

Pfa1 fab fragment
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IgG2a Fab fragment Heavy Chain
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
total genus 55
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iptL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iptL01
3HG1E 3I2CH 4ESKA 5HDOA 2YR3A 2X70B 4M7KH 3UBXB 3LKNA 4DN3L 3WUWB 4OIIL 4ONHA 6FABL 1LO0L 1AD9A 2VDLH 5AZEH 3VWKA 5INCA 2M8XA 1ZLSL 3U30B 4JR9H 3QDMD 3D25B 5J3HC 4ALAH 2X1XR 2G5RA 2NZ9C 2R2CA 4IRSB 5D8JH 3CH1B 3NCYP 1JNNL 3U1SL 3DPBA 3H9HB 2OTWB 2WWKT 4R26H 5ICXA 4TUOB 3CPLA 3D0VA 4N9OB 3CXDL 3C8KA 4L3AA 3PQYB 2CDFA 2X1OA 2H26A 4OZHA 1DBBL 1JNLL 1WITA 1WAAA 3V0AC 1CICB 3NH7H 1DBKH 5C0CE 4H8WC 5I15L 4N0UB 2XOTA 4I3RH 1UGNA 4PD4K 5JNYA 1GYAA 1MHCB 1K5NB 1OAUH 1S5IH 1BHGA 5E2VL 1YEFH 3FO9A 3GSRA 2EDOA 4JEGB 4ZAKA 1T6VN 4R4BB 5FV1L 3HE6B 1HOCB 3H9SD 1CU4L 3MV7A 2EXYC 3WJLA 5EORL 5D1QD 4M7LT 1KLUA 5DD5L 3O4OC 4H1LG 4HH9B 4X6CE 4K55A 2RCSH 4APQA 3EYOB 4GG6A 1T21B 1U8NA 2CKBA 5EIQA 2R4SH 3ALWA 2VISB 1BLNB 4KROB 2P46B 1HHHA 5EU6B 2IADA 5C08E 4KU1A 2A9NH 3S35X 4PJ5B 2I9LA 1FFRA 5JOFB 3P2TA 1RV6X 4J12A 1FL3A 1LP9B 4QRRD 4Q6IB 3ROOA 3IAQA 3VGDA 5ESVB 3Q6FB 1UCTA 3EOAA 2VN7A 4HS6A 3MLRH 1PYWA 4LCCB 1I7TA 2ARJB 4DEPB 1NC2B 4LPCA 4KAQH 5ID0A 2EKJA 4GQ9H 5TH2B 5HGAA 3ZTNL 5JPNB 1MUJB 1LK2A 4OB5L 3BSZL 1YYLH 3VXQB 4WUUA 4N0YH 4E42A 2NY1C 4FTVA 1UQSB 3VFPA 5DJDB 1NFIA 2G5BB 1QFPA 2E27H 4NUJA 4HJ0D 5T1KD 1JWMB 4ZOEA 4K2UL 5EZOH 4GBXC 4QOKA 1UJ3B 4OZFB 4S1QL 5ETUB 3NPZB 1F58L 1PGRB 1KG0A 1UYWH 5BO1L 1EHNA 4MJ6A 1Z3GL 5DTFB 1JNHB 5GQBA 3L3DB 1FLRL 4NCDA 2VZOA 1RJYA 2V7NA 1DN0B 4BQ6A 1JK8B 3GB7B 4HK3J 5HDBE 2YKLH 3IJYA 1E27A 4FQJL 4OAWB 5L2JB 3P9LA 3FB7A 3UTSA 3ARZA 2Y72A 4J1UB 3V6FB 2P8LB 2A74B 4F33B 3KPSB 4OF5A 5J9PB 3P0VH 5SX4I 3FQXB 4H20H 3NN8A 4LPTA 1DLHA 3BP4A 3Q3GA 5T1LD 3G08B 3ILPA 2DQGH 1FJ1A 2UWEF 1KIQB 5JXAL 2Y36L 3BX7C 4PB0L 3MUJA 1M05B 2DAVA 3DETC 4P9MH 3SJVE 4XTRD 3ZKND 1T5WA 2L4OA 4MQXC 2I5YL 2VLME 1VESA 3ZHDA 3IDYB 1C08B 2W0FA 1JWSB 4P2QE 1NQBA 5MEOA 3RTQC 2D4DA 2PYFB 1WC7B 4LSTL 5IHUL 1AHWC 1CGSL 2EO1A 1HHJA 4CVZA 3U9UB 4KTYA 2E6QA 2J7LA 5FO8B 1FO0H 3NBNA 2P5WB 2Y23A 3O2VL 2Q86B 4AT6B 5L0QC 3SBWA 3S3SA 1PFCA 1A7NH 3VI4E 4WDIA 3O6FD 3VFRB 3N1QC 2ZJSH 2BVPA 4LRNL 4WY7L 3O4LD 1ZGLB 2FCBA 3E8UH 1M1SA 3RY4A 1Q1JL 3N9GH 2XWJB 4HMDA 3MNVB 1EBPA 5CGMA 1QA9A 3RY6A 2P5EB 2RQ8A 3QEHB 4V2BA 4AH2B 2P24A 2B4CC 1ND0A 4GW5A 1RUQH 2CKNA 4FFZL 1F13A 5AUMB 4JY5L 4L4TB 5IG7B 1NGZB 3UBXI 5DD6B 1KCSH 3ULUL 1OAXH 3GSNB 5EO9B 1X9QA 1SEQH 4H26B 4B7IA 1EEYA 3KNBB 1R6VA 4PB9H 4M9PA 1JPSL 4OZGB 4MVBC 4XHJD 3C09B 3QUKA 4F9PC 2XPGA 1MRCH 4B7LA 1G6RL 1H8NA 4ZTOL 1ETZA 1XF2A 3RVXC 4YDJB 2HKFL 2V7HA 3ECBA 1B0RA 4YDKH 2ATKA 1JHLL 2DD8L 4NQXB 5D96C 1T83C 1HI6A 1I1AC 3TWCH 3TPUB 3V5HA 1BQHA 4DTGL 1O0VA 3GMNB 1LD9A 3V4VL 2BXZA 4N8VB 3QCTH 4ODWA 5KSAC 1U58A 4RA0C 3BKYH 4R3SA 4YHNB 1ORSA 1HXMA 3L5IA 1NAMA 3QRGH 5IHLB 4RBPK 4WWKA 1OTSD 5IMMB 5HGGS 4U05A 3MJ7A 2XN9B 3W0WA 4NYLA 3BW9B 3BGMB 1FG2A 2FLBT 3QUMH 4JRXB 4PV9A 2BVQB 4YHYC 1RUAH 4QRTA 4LCYB 1CXFA 5J0BA 2H6PA 4Z0BL 1ZTXL 4NSKA 4GH7B 5D7KD 3TNNB 1OSZB 4H25B 5DJYA 3VJ6B 2VAAA 3V52L 5J6HA 1IQWL 5EU7C 5D7IF 1JV5A 2LAAA 2XYCA 4PRBA 4FG6D 1INDH 1J1XL 3RNKB 3G6DL 3T0BA 3TT1H 2A9MH 1NDGA 4ZSOA 5MENE 4OTXL 5TFSH 3UTTE 3HMWL 5T1LA 2D0HA 1QBMH 2ZOLB 3NCJL 1I4FB 3EO9H 1AGCB 3FB6A 4Y2DD 4HEME 3TT3H 3MGTB 4UV4L 1HHGA 1KXTB 1J8KA 5EWIL 4M43H 1GC1L 4NWUL 4MCYA 1MSPA 3CJJA 4IJ3B 4F9LA 1WFTA 3HUJF 4I9WD 4NNXA 1F3RB 2X41A 4MA3A 4JY4B 4RMTA 2VXTL 5IBUG 4M3KB 1KYOK 1YN7A 2DM7A 4Y16C 3RBSA 1CBVL 5CEZL 1BGXH 4G6FB 1YNTB 4JFQA 3PWPD 3BHBB 2J6EL 3GMRB 1FHGA 1KJ2B 2DWDA 4KK6C 4OCXL 2F15A 2YSSA 3PHQA 1CFNB 4MGXA 1EHLL 2FBJL 1O5DT 4RMRA 5A2KH 3KG5A 3MODL 1DUYB 5E8EA 2ZUVA 3T3MF 5E70A 4KGLA 4WHDA 2CK2A 3PABB 3T77A 5F3BA 4KJPC 3OJDB 1KIUA 1PD6A 4X7EC 1WWCA 1KGCE 4AK1A 4M1DL 3MGOA 1A3LH 1NBZA 4EVNB 5C0EB 1PKQA 3EHBD 5JXED 2PXYC 2JCCB 3V0VA 4X7TA 2DKSA 2XKNA 5CJOH 1H3PL 3QIWA 2JIXB 3GK8L 4YXKH 3D2UD 1WZKA 2SEBB 4XP6H 1HINL 4HIIB 1OTUD 1PQZB 1TLKA 4OLVL 3O41A 1RZJL 4OSUH 3ZMRA 3HE7A 3UJTH 4QEGA 1G7HA 5D7IA 2ESVA 3ULVF 1QFWI 4ORZC 2ZCLH 4P2CG 1SBBA 1QHPA 3VFSB 1NBQA 2IBGA 4XCYB 3H9ZA 5LAXA 2GTWA 5GGVH 3OKMB 3SGKC 1RY7B 1Q9OA 4O2CB 1JZ7A 1B4JH 3CDGB 5J12B 1NDMA 2VL4A 1CXLA 4EN3C 3QIUD 4XXDB 1J0KA 4YHKL 5JHDD 1NC4D 3CH8A 3H6JA 4MQ7A 1N6UA 2BSRA 3KJ4B 4GW1A 3HUJA 5E95B 5D1ZB 4NNPL 4R0LC 5I8CB 4I0PB 2WW8A 4XVSL 3I84A 3MA9H 4I18A 5AEAA 5HI3C 4RFEA 3QXDB 5CUSL 2VLRD 4MA8L 4UT6H 5I18L 1SJVA 5DFTA 3GSVA 3TN0D 2WBJD 1KC5H 4PIRF 1CZ8L 2DI8A 3LKNB 5GHWL 1CN4A 1BD2A 3AREC 4MNHA 4GMSH 4ONHB 4FN0A 4KJWC 3VWKB 1MCWM 4JG1H 3EYQC 4QTHA 1NAKL 1J18A 2EZ0D 3AAZA 3DROB 2R1XB 5DR5L 3PG2A 4X5LA 5IHZB 3UMTA 2GEEA 3PDOA 3MRHA 1N6VA 5DMIH 4C56E 4WHTA 3ET9F 3W9EA 5ICXB 4JAMB 4RGOH 5FOBA 3CPLB 3WLWC 4KHXL 2IBZX 2NY6D 5F6HJ 3C8KB 3L5HA 4QTIL 2ITCA 3CFEA 4FOMA 1MREL 4CU8A 3RVTD 1G0XA 1ZMYA 2H26B 2Y4SA 1R0AL 1HXYA 2YK1L 4HAFA 3WN5C 1DSFL 1WIUA 4GAYB 1QKZH 4PGBA 1V7NH 2AEIT 1G9NL 4NM8L 4M48H 2ICEA 5JNYB 5DD0H 4PJ8D 2DWEA 4TULH 1OT1A 3GSRB 1MI5D 4ZAKB 4YHLH 3I50L 4GKOA 3F7RA 3MV7B 1KPVA 3ULUE 3X13B 1KLUB 3JWDL 3OKKB 3PGFH 1CL7I 4WO4A 4MHHG 2QR0A 4APQB 2ZUYA 5IB3A 4JFPA 1U8NB 2CKBB 1XIWA 5HYJA 1HHHB 2ARWA 2IADB 3LEVH 5T1DL 2VRAA 4KDTC 1EO7A 4NQDD 1KB5A 4OGAC 4OLUL 3ZDZF 4Y88A 3FFCA 4Y4FB 3U46A 3VXRD 4WI5A 3VMOA 5T5FL 1FL3B 5JXEA 1MCBA 3ROOB 5GGQL 1LK3H 3OKLB 3VH8G 1A6VL 1DVFC 4HS6B 2HTLC 5C08B 3V95A 1H3XA 1PYWB 1I7TB 2ZUWA 4M4PA 4ZUTA 5ID0B 3J8F7 1EJOH 4QHKJ 4YO0B 1DQQA 1UENA 3KPRE 2MCG1 1LK2B 3BD5A 5I73B 3NGBC 2F54D 5DRWA 1K2DA 4O4YL 3RGVC 1JYNA 4WUUB 1QZ1A 4E42B 2H9GA 1NFIB 2NY7H 4NUJB 3MLXH 3U82B 5HI5D 1BEYL 4G8GE 1R24A 4EQ3A 4QOKB 3RAJL 4RMQA 2JK5A 2VB5A 2VLLA 5T3ZE 1WZ1H 2Z31D 3IDXH 3VXMA 3WXWL 4J3VA 1E6JH 3UJIH 1KG0B 4IRJD 1QD0A 4PRAA 4MJ6B 3L3JA 4NO2A 1NFKA 5CZXC 3S98A 3LV3A 1JZ3A 4NO5A 5IFJA 4Z95L 1A02N 5F7EL 1U2HA 4Q7DA 2HP4A 3WNPA 3IJYB 5E99L 1E27B 3ULUC 1L9MA 1W0VA 3P9LB 2RGSA 3UTSB 4OD3H 4YX2L 3FN0H 1CTNA 2CQVA 32C2A 3V8CA 5GZOC 3K0WA 2VJXA 4YFDB 1ZEAL 1EFXA 3BP4B 3Q3GB 5HJ3B 3ILPB 4HXBH 1FJ1B 3NCEB 2DTSA 4TNVK 3PE9A 1OWRM 1IAIM 3ARFC 4YHML 5IOPA 5TF1H 1SVZA 5F72S 3O9WC 3EO1A 4LLWA 1RZ7L 1QLFA 3NCYS 5CEZE 4M7LL 1CL7L 3ULSA 3QUXB 1YY9D 1T5WB 3OTTA 1K6QH 2C4FU 2FYYA 3NOIA 1FGNH 5I6XB 1VB9A 1CTOA 1AGBB 1ZVSA 2Z0BA 3UBXG 1FYTA 1ZLUK 4LSUH 1T89C 3WUWG 3HI6L 3S37H 5DD1H 1AE6H 1MJJB 5J13B 3KPMB 2VMFA 1MVFA 1Q94A 4S2SB 1AQDA 2LU7A 4ELMA 4YZFE 4MAYD 1MJUL 3MLSH 3NFNA 4LKXA 4OCSH 3BN9C 2M1KA 3ARBD 4G8IB 2P48B 4M1GH 3MXVH 4XPTL 1JTPA 3QFJD 3HZKB 3SN6N 1KPUA 4K3JH 4AL8H 4FP8H 1QA9B 4JB9H 4BK4A 4HC1H 1MWAA 3ZE1F 1N0LA 5FHAH 2P24B 4GW5B 4PBVC 1CK0H 2K7QA 5DMKA 2FX8L 3D87B 3ZSTA 1S3KH 3CDCA 5F96H 2R56L 1L7IH 5SWSD 4OQTL 1GC1C 2JF1A 1SY6H 5DFVC 3TO4A 4UTBH 1MELA 2XPGB 4ODTH 3VXRA 1IEBA 3DX8B 3HZYA 3ZDYF 3EJJX 5ESAA 3O0RL 1XF2B 2UWEB 2WUCH 4BZ1H 1BREA 1X5HA 3ILQC 2V7HB 1WJ3A 2GAZA 3ECBB 1B0RB 5AD0B 1WWBX 4X6DF 2O5XL 2OR9L 4G8FA 5HY9A 1HI6B 3TBYB 3V5HB 1BQHB 4BSVB 4P9HH 3PIQA 3RVUD 1A7RH 3MO1B 3TJHD 3V7AG 2UUDK 2DI9A 2F54A 1U58B 4LGPB 3L1OH 5CD3A 4R3SB 5L2KA 3MROB 4I77H 3WIHA 1L0QA 1LEKB 1ORSB 1HXMB 3IU4H 2APBA 4WWKB 3QQ3B 4YUEH 1AR1D 2PW2A 1VACA 1FLTX 2NXYC 4KVCL 1AFVL 4LSRH 3W0WB 3WNKA 1E4KC 1Q72H 4LFHD 2ADJA 3LSOA 3B5HA 4AMKH 1FG2B 3HCVA 3QH3B 4PV9B 1NCUA 4QRTB 1O7VA 1J7VR 1MAKA 1TMCB 2H6PB 2QTEA 4MJID 2VDQL 3DSFL 1RZJC 4WV1A 3MNWA 5IR1B 1BPVA 4FFVC 3ZTJH 3SDDA 3WNLA 2E7CA 5DJYB 2VR9A 1X6NA 5FUOH 3PHOA 3GKWL 5EOCH 4OZFG 3K2UL 1QRKA 3LRHA 1F4WL 3NCBB 2IQ9L 4PRBB 5KAQF 3S37X 1NDGB 3B8YA 3KHOA 4ZSOB 5IQ7L 2BSED 1Z0MA 4H88L 4OCYH 4EUPB 3QZWA 3FB6B 4KKCC 5I1CH 1QVOA 2D7TH 4LCUA 2BNQD 3DI3B 3RGHA 1HHGB 5LGJB 3CC5A 4U1LA 5BQ7B 4HCRA 4MCYB 3M07A 4ZD3H 3AS3A 3UTTB 5IROC 4FZ8L 1HSAA 3VXNA 1YN7B 4RWHA 4EOWH 4DEPC 5KANG 5BXFA 4Q58C 4WFED 3MLWH 4XVUD 4JFQB 4X6DA 4D2NA 2H1PL 5KW9H 3ZT7A 3RZCD 1MCIA 1G7MB 4IRZL 5E8NB 3LRGA 4FMFA 3PUCA 3CU7A 2ZWLT 5I2IA 5F9WC 4LVOB 5HGHB 5E8EB 3G9VA 1BBDL 5FYKD 3CLFL 4UNVA 3X3FL 3T77B 5I17A 5F3BB 1NLDH 1VERA 5ADOL 4NQTA 2QSQA 3VXOB 3VGAB 1CYGA 4OLYH 5KZCD 4KK8D 3MGOB 3OG6B 1NBZB 4PG9A 1PKQB 4HQQL 3RA7H 4TQEL 3JVGC 4M8VA 3D39E 4X7TB 2HRPH 5GIRB 3SE3C 2XKNB 1QFUL 4HIXL 3WDIA 5I1IH 4JRYA 4HWEL 5C2UB 2QSTA 4TUJA 1BFVH 4G8EA 2R8SL 2YN5A 2UVEA 3G04A 3MBEC 2C3WA 1Y6NR 4OF0A 3P30H 4IIQA 4PRPE 4KMQA 3HE7B 1T0PB 1G7HB 5D7IB 1RUML 2HFEA 2ESVB 1G9NC 1FIGH 4F7PA 3D85A 4Z5RA 5SWSA 1TDQA 5LAXB 2QQNH 1U6AH 1INEL 5GRJH 4U31A 1A3RH 5EIVA 4RMUA 5I8OH 2X4QA 4YXHH 4N5EC 1NDMB 1KIPB 3JWDC 3SEPA 1MFEL 1YEGH 2X6MA 1H3WM 3TCLB 2CRYA 5FDWA 5DEFA 3VGGA 4MQ7B 3MXWL 2BSRB 4GW1B 2CLVA 1BWMA 5BV7H 1JGUL 1KOAA 5IF0A 3O2WH 1R3HA 1UWXH 5IW6A 5CD5D 2EYTA 3TJEH 1CGXA 5DRZB 4Y1AA 3UXFA 2GIYA 3MRRA 3LB6C 5HHVH 2WINB 3DTXA 5FYLL 2OMBA 3GSVB 4TVPD 2A6JB 5EFIA 3D18B 4DFHA 2FNBA 2YUVA 4Z77A 2X89D 4MNHB 2Q8AH 1HYSD 5CMAB 2NY2C 2R0KH 3MRQA 1S7TA 5B39A 4U7KA 3T0EE 1FL6A 3VFGH 2Y5EA 1ZWIA 3PDOB 4ERSH 4RIRA 4LLMA 2P49B 3C5ZD 5ALBL 3LZFH 4WHTB 4NBXB 3W9EB 5IIEA 1E0OB 5CP3H 3B9KC 4OCNC 3L9RA 5D6CB 5CZVL 2ITCB 3MJ9A 2VXVH 2V9RA 2C5DC 1WV7T 5INDA 3X17A 3C09C 4O2EA 4PGBB 5E6ZA 3VWJC 4C56B 2PO6A 4ZXBD 2ICEB 1WEJL 1B6DA 4UTAH 1D5ZA 3GHEH 3W11D 2EDQA 4MA7L 3IFPA 2RR3A 2ZSVA 3ESVF 2B1HH 4U1NB 3RVVD 1MRFL 2GJ6E 2AS5M 2YEZB 3AC0A 4LKCA 1MJ7H 1UVQB 5CILL 4WO4B 2P7TA 1MOEA 2QR0B 4U2YA 4G6ML 5D7SH 2VLJE 3RZCA 4D8PB 1ZLWK 5IB3B 4JFPB 1IFHH 5E9DE 5D7JA 2DDQL 1RURH 1XIWB 2AJXH 3WJJA 5FO7A 3UAJD 5HYJB 3HB3C 3GSNH 5E4EB 4NCC2 1N6QL 1KLGA 2YHGA 3QNZA 1FZMB 2Q3ZA 3OKDB 3ISWA 3D0LB 3MX0A 3U46B 3MJ8A 5DRNB 2NY0B 1LO2H 2A1WH 4MNGE 15C8H 2VL5A 3PL6A 1X5KA 4DN4L 4PGDB 1S7RA 4OLEA 5DF0A 1OVZA 1SMAA 3IDUA 3DSNA 4CMMA 5D9SB 1G0YR 4I4WA 1U8HA 3OXSA 4KFZC 4P5KA 1DQQB 1FAKT 4NOFA 5DRWB 1YQVH 4M4RA 4DKFL 1K2DB 3BPNC 5F7MC 1PX3A 4YDVA 4B0MM 3QNYB 2B5IB 1X7QA 2H9GB 2YPKA 1HK6A 1FNLA 2CIKA 4Y5VC 2DQHL 3BZEA 1UH3A 2JELH 5CJ5A 3VXMB 2OSLA 1JRHI 2DBLH 4MCZB 3R8QA 4NO2B 4IJ3C 4LHQB 1SYVB 3WS6C 4NO5B 3EYSH 4U49A 5EC1A 1M4KA 1Z0NA 2VXQH 3QULA 4RA3A 3TH2T 1AH1A 2FGWL 3RX8A 1CLYL 3QEGL 4I2XE 1W0VB 5DMYA 3QCUH 4WUKL 1JTOA 4LCIL 2GSGB 3S5LG 3G5XA 4NBYB 4DAGL 5EPMA 3RKDC 1YEDA 4FXLA 5IB2A 3GRWA 4KJQD 4P23C 3CSGA 4UDUA 1EFXB 4OV5A 3FONB 3QXAB 3ZKMD 4R8WH 1CIUA 1N8ZA 3ARQA 4LLWB 1QLFB 1NANH 1NAML 3ULSB 2AJUL 3GSQB 4KVNH 4DGVL 3CVIL 3OJVC 3BE1L 4WU7A 3K4ZA 1EA9C 4M6AA 4WRLA 3EIFA 1ZVSB 3C5ZA 2OX5A 1EUTA 4KK5C 1NUDA 1FYTB 4GMTL 1KTKE 2IC2A 4U6TA 1YEIL 2RAMA 4JKPH 2CDGA 4HIEB 3QI9C 1Q94B 1DEEB 1MFAH 1JYWA 3QIBA 5T3XE 5KN5A 5JW4Q 3RU8L 2J1KA 4WJ5B 3NFNB 5DA4A 3BMWA 4OT1L 4XCEA 4K9EH 1J1OH 3BIKB 1DBAL 1A7QH 1KENL 5TDOA 1KPUB 2EC8A 4N8PA 3T0VA 2Q1EA 3KJ4C 5CGYD 3GMLB 3FZUD 1OP3H 1MWAB 5D1ZC 1KJ3L 3MTRA 4I0PC 2FD6H 4PY8J 1ITCA 2ICWJ 1JRHL 1UM6H 4XMKL 2NTFA 1HNGA 3CSPA 2CRZA 4YNYA 3WUZA 3TBTA 3R4DA 1HYRC 1BAFH 3UZEA 5IM7A 3TO4B 1MHPL 1NKRA 3D6GA 2MPAH 1IEBB 1A9EB 2HFFA 2NY4B 3HZYB 4NN5C 5ESAB 3V5DA 4OCRL 4NKDB 3VWKC 2QLVB 2FJHA 4JHAL 5EG6C 1I7RA 4Z76A 2GAZB 3BP5A 3PHSA 2R15A 4GG8A 4NQED 1FRGL 1T66D 3BPLC 4LCWA 5I75C 2JJVA 4G8FB 5HY9B 4JFDA 1UZ6E 3KS0H 3EDFA 4H8WH 4D0DA 4YDIH 2W07A 5FYLE 4HWUA 3HRZA 2X40A 4V1DD 5JHLH 3RJDA 2BY0A 3EDDA 4LU5L 5L2KB 2BVTA 3VGHA 1EO8L 4M7JH 2DL2A 1YECH 4NC2B 7FABL 1MFBL 1OQXA 2EIZB 2PW2B 4P3DB 5BS0E 3Q1SH 4YHZH 3NIFF 1ZGLM 1NGQL 2ADJB 3LSOB 3S6CA 4X8JB 3HCVB 1NSNH 3DVNA 3NZHL 4M61A 1F90H 3IJSA 2OR7A 4MZ3A 5E8PB 3RIFF 4CNIA 5H2BB 3BP6B 4XXCA 1T80A 1UH2A 2YPLA 2YZ1A 4JO1H 1ZHLA 2BHUA 5I66B 1QO3A 1KTDA 4U0RB 2AQ3A 3QQ9D 5EO1A 1OAZL 4HJGB 2VERN 2G9HB 4JO2H 4P5MA 1C5BL 5D5ME 5DHVA 1CD1A 4KKLD 4KTEH 1DL7L 3SKJL 4KI5F 5I71C 2GQHA 3SCMB 2FHCA 1HEZA 2GTZB 1Q9KA 2P8PB 2NW2B 4J8RB 3QZWB 4K23H 5LKNA 1SYSB 3U0WL 5I19L 1QVOB 2DTMH 4UIMA 3ZYJA 4Y19A 5JQHC 4U1LB 3QDME 4EBQH 5CIPA 4A6YA 3LEXB 1HSAB 3VXNB 4YHIB 4PRNA 5I0ZA 3T4AB 1A5FH 4QT5A 4L5FL 2R4RL 3QAZC 1FVEA 4GRLD 1T3FA 2EE2A 5F1KC 4LEXL 5GGSA 2ICCA 3L3IA 1XZ0A 4TRPH 5DK2B 5I2IB 3RHWK 3QUYB 4E9LA 4X7SL 1ZHKA 1PZ5A 3I02A 1J5OL 3INUH 5K93A 2NX5D 4I3SL 1RQ5A 5T1MA 4OF3A 3FQRA 3BJLA 1RVFL 1HH9A 2VQTA 1T1ZA 4YIQA 3JUZA 4PJXE 4Z7QF 4I8DA 1MFCL 1MAML 4PG9B 1P4BL 5ID1A 3ZKSD 3LQZA 2F74A 5IT2L 4H0HB 5ALCH 3VRLF 4YBLB 3TP4A 5HVWA 4DGIL 3H9SE 5MP6H 4O02L 3VXUD 4JRYB 4J23A 1MHHA 3I6GA 1UA6H 4HWZA 4Z7VB 4G8EB 5F7KC 3G04B 5C07A 1F00I 5GZNC 1NKOA 1DQMH 2AAVA 2OQJA 2XQYG 4DVRH 1ZSDA 4L8DA 2F5AL 4KH2A 1D5BB 1T1XA 3D85B 3RL1A 5BJTB 3ARDD 4Z5RB 1REIA 3P9MA 5IK3A 2GITA 2H45A 1EZVX 4KUZH 3N85L 1JFQH 5CEYA 1OGAA 2GW5A 3MOBL 1DTUA 1WFOA 4QRRE 4Y5YB 5E56A 3TNMA 2QSVA 1P4IL 1RIHL 4P3CL 3JUYA 1KB5L 2QEJA 3VG0L 4OLXL 5DEFB 3H3BC 1MY5A 2HYMA 1FL5B 5A3ID 5I6XC 1XCTA 1RIVH 2CLVB 4X6EA 3NFSL 4J4PA 4X4MA 3C6LB 2X5PA 5GGRA 4V1DA 1A21A 1R3HB 5IW6B 5DJ0A 3HNVL 2EYTB 2PYEA 4YEFA 5FUCE 5CSGA 5EO0A 3SBWC 2VZ1A 4Y1AB 2H32H 3MRRB 2HWZH 4X99A 3BN3B 1TCMA 3VFWA 5EFIB 3BFOA 4HXAH 2B4CH 1BQHG 2IEPA 4Z77B 5BOPA 4PJCE 5BW7A 3L95A 3MRQB 1S7TB 5B39B 2YD1A 1PJ9A 2BSTB 1FL6B 1GZPA 1OARL 1HQ4A 1F11A 1DQDH 3RY6C 3KPPA 3Q0HA 4RIRB 5FCSH 3WD5L 5F6IB 2X05A 5JUEH 3OKNA 5IIEB 5C0RH 2VXUH 2YMXL 5C0ND 1EGJA 3U36A 1CLZL 2ID5A 5DJAB 1N59A 2DQDL 3IKCA 5INDB 1KPRB 3K8MA 3UTOA 4RFOH 1BECA 4YE4L 4Z78A 2PO6B 4HW6A 1JF5A 1XGPA 1CDIA 4PYHA 3GJEA 3TA3D 1UXWB 5JA8B 1ZV5A 4JQIH 1D5ZB 1RFDH 5GISH 3MLVL 2UZXB 2ZSVB 2AJSH 3QSKB 1MJ8L 2CIIA 4MNQB 1U3HB 4LKCB 5DFWH 2APXA 4NP4L 5HD8C 1V3LA 2X10A 5LGHL 2Q87A 5HPMA 5D7JB 3K74B 2GCYA 4UT9H 5FUCC 4EXKA 4RAUA 5KVGL 5FO7B 4HJ0C 1MLCA 3EJYD 4IDJH 4LDOB 3FT4B 2C26A 3FHAA 3QNZB 2XICA 5I8KH 1G7QA 1MQKH 1ZAGA 4JKMA 1QSFA 2EH8H 1WBZB 5BVJA 3O4LE 4WFHD 4M5YL 3LEYL 3PL6B 5LJYH 1UWGH 2AQ2A 2BNRD 1P84K 5DVOA 2Q8BH 1I3VA 2C7UB 2D0GA 4CMMB 5CSZA 5J3HD 1JPGB 4I4WB 2KZWA 1U8HB 3OXSB 1KCUH 4P5KB 3HI1A 1I1YA 1U0QA 5ILTL 4LBEA 1U9KA 4MNGB 4Z9KB 1AY1H 5DMGD 3IDGB 1W0YT 4HGKC 1X7QB 4NZRH 4NJAL 3NFPA 1MCPL 2AI0H 2CIKB 1TETL 4U6HA 5FM5O 3BZEB 5MEPA 4PJDF 4WCYH 4M8QA 2OSLB 4XCFH 1Q0YL 2DQFA 3ZKNC 2GJJA 3MRBB 4F9LC 3CFIC 4OIIH 6FABH 5EC1B 4KUCD 1CVSC 1ZLSH 3MFFA 5JDSA 5D2LE 3RPKA 4JKKA 5HVHB 3QHFL 5HI4D 4J7RA 4PJFF 3FFDA 4XPFL 4JFHD 3DHMA 1JNNH 4KZDL 1YEDB 2HFGH 2QHRL 12E8H 2D2OA 5IB2B 4GUPA 3U1SH 1D5XB 5HHOA 3ZL4L 2AEPL 4AENA 4LVOC 1EV2E 3W82A 3CXDH 1NGXB 1TTGA 2CXKA 4E0RA 2FZ3B 2I9TA 4I2XB 5TQ0H 1DBBH 2IFGA 1JNLH 4XB7A 4EUPH 3MREA 1DQLH 1N8ZB 3WIHL 2IF7A 4ZMAT 4IS6B 1L7TL 3OL2A 5L9DL 1WFNA 3FB8A 3CVHA 3HR5A 4UI2A 5D7KE 1RK0A 3QIWC 4HKBB 3L3OA 2OZ4L 4PY7A 5EZJA 5E8DL 4HPYL 4JFXB 1A1OA 1VFAB 2R2EA 5C0BD 1CU4H 1D7FA 5EORH 3RWEA 3HE7C 4LLDA 1YN6A 5DQDH 5DD5H 4K8RL 1T6WA 4XC1H 2CDGB 3VD7A 1QSEA 1KT2A 3DVFA 3QIBB 3VGBA 3IU3A 2NY1D 3S96A 4MD5B 1KCKA 4G9FD 4XCEB 3AROA 4ONFH 2Z9TA 5E5MA 3TA3A 4PJDA 4GBXD 4I9WE 4CL7A 5TDOB 5SWZA 3S97C 5IMLA 2Z8WC 3WIFA 3OZ9L 1WGOA 4E41A 1PG7W 3PWPE 3T8XA 4DUWA 5IFAL 1JZ6A 2ICWA 3FQNA 1PY9A 4U1SA 3QDJD 3SDXE 4I18C 5KS9E 2D7MA 3AXLA 3KVQA 1JL8A 2NTFB 4PJFA 4FZEL 2HLAA 1GIGL 1JWUA 1X4YA 4YNYB 3ZTNH 4M62L 1NPUA 1CDCA 2IFFL 3AM8C 5IM7B 1T2QL 4GOSA 1P6FA 3HC4L 1OAYL 3BQUA 2OTUA 1MCOL 3NCCB 2J88L 3QG7L 4R4FH 1S9YA 3V5DB 2OL3B 2IH3B 4K2UH 3GDBA 3P4LA 4S1QH 2D4FA 3LN4A 4A2MA 4JQXC 1F58H 4GG8B 3SKOA 5J7CC 2NR6C 3DETD 1Z3GH 1I7ZA 4LCWB 5J1TC 1U8PA 4JFDB 4OUUA 2LU3A 4MQXD 4LOUD 4D0DB 2A6IA 1GGCH 4KTDH 5CSBA 3ZE0F 3HRZB 4U1HA 3HA0A 3RTQD 1TVDA 2CO7B 1I9IL 4HF5L 3T0WA 2X4SB 4F7EA 5LG1A 1NCNA 3RX5A 1J8HD 5FM5M 5ENWA 2IG2L 4HHAA 3ZYZA 4U3HA 5KVDH 4PRID 3V7MA 4Y2DC 1PLGH 3EOBB 4NO0D 1OB1A 4OGYL 4CNIB 4XX1E 5L88L 1F4HA 2J4WH 2Y36H 4PB0H 4XBEL 5JHDE 5C09A 2DKMA 2YPLB 2FATL 3QWOA 4RZCA 5JDJA 1RD6A 4GXUN 3MACH 2D03H 5GJSL 1KTDB 4GRMA 2NLJA 2D7PA 3AFLA 2I5YH 2EEDA 3IS1X 4P5MB 1S7QA 1ITBB 3WFDL 2AEWA 3EDEA 4U4BA 5DHVB 1CD1B 5IHUH 1XF1A 1VHPA 1RMFL 2VLRE 4OQ1A 1XIWC 2ZUSA 3O11A 5DLMH 1GGBL 5I1HH 5E4EC 1HEZB 3S8WA 1GOGA 4OCLC 1Z5LA 3O2VH 1YEHL 2XRAH 3ETBF 5E2UL 2ORBL 4FFWC 3OR6A 1D9KA 4HT1L 3NPSC 2PETA 1SVCP 4UIMB 2CR6A 5JXEC 4JGUA 1JGVH 3KXFA 1DN2A 4MVBD 5CIPB 5ACMA 3RFZC 1I75A 4A6YB 3DMMA 2ATPA 1A7BA 4TPRH 4E5XB 4WY7H 3MLUH 5IB1A 2AXJA 3QUZB 1BIHA 3R06A 2YD8A 4Y4KB 4QWWC 3H3KA 1FVEB 1OTUC 1T3FB 2CLRA 1FH5L 2R1YB 3L3IB 4F7TA 5AWNL 1X3DA 1XZ0B 1CT8A 4RGND 5JORB 1I1AD 4Z7OF 4FFZH 25C8L 3KDMA 3MCLL 1EEQA 4PRHD 4JY5H 4PR5A 1ZHKB 1PZ5B 3I02B 4KQ3L 4BM7A 4ELME 1SEBA 3WHE1 2LTQC 5T1MB 2JJSC 3ULUH 2C9AA 3VDAA 4H0GA 3TYFA 5HGBA 2X1QA 1HH9B 5JZ7D 4YIQB 1EDQA 3SDCD 5EUOE 35C8H 1OSPL 4N1HB 3QISA 1XGYH 2NYYD 3LQZB 1GZQA 2F74B 3UEZA 4LNRB 1MI5E 4KY1L 1G6RH 1MNUL 3JV6A 4ZTOH 1TZIB 4N9GA 4DVBA 2DL9A 1BJ1J 3IAPA 1S7UB 5DK0A 4L8SA 1TIUA 1MHHB 4HWZB 4QRPD 3F7QA 4H0IA 2DD8H 1HDMA 4HK3N 3IF1B 1MCRA 4ENED 5FM8A 1JYXA 4LEOA 1ZSDB 4L8DB 3O8XB 1T20B 4MLIA 4ORGA 4BFGA 1U8QB 3V4VH 1TQCB 4RISH 4TNWK 3P9MB 1YEEH 4MMXC 5IK3B 3TN0C 5FUZL 2GITB 1FO0A 2WBJC 3DRTA 3E6HA 4NQDE 1RZGA 3QNXB 2DLFH 1JZ5A 5CEYB 3VXRE 3W81A 5JIPA 3NA9L 3QO1A 4HUXA 3TNMB 4XMLL 3QEQD 4BELD 5FYKL 4MAUL 1JGEA 2EZ0C 3MRFA 5DA0B 2NY3B 1Q0XL 3LS5L 3MV9A 5DYOB 1ZHBB 3PP3H 1XCTB 1NCDL 2ZCKL 3VMNA 4N0RA 5KSVA 1U42A 4OM0L 1E4XI 5T3ZH 5GGRB 3ARPA 3FQWA 1NMAL 2EDTA 3ARYA 1AKJD 2F54E 3V52H 1TCRA 2AXFA 3RVTC 5C0AD 1VFMA 4OFYA 4NFCA 5CJXC 5EO0B 4P57A 1J1XH 3D1MC 3G6DH 4X99B 5IVNA 1PAMA 4KK6D 2IAND 2IAMA 1A6TB 2MSPA 4OTXH 3X3GH 4XBGA 5DT1H 5JQ6H 1WUNT 4ZTPH 5MI0B 3HC0B 4PJ8C 5E6ID 1D5IL 1FDLH 2EEAA 2ZPKL 1U93A 3NCJH 4V2CB 4KJPD 4TN9A 1BOGA 4XMPH 3FOLA 3MYJB 3SE9H 1BVKA 5JOPD 4FXGA 4UV4H 1GZPB 5T1KB 1HQ4B 4GSDL 1F11B 5EWIH 1GC1H 4NWUH 3QDGA 2PXYD 3T2PA 4UBDD 2EO9A 3OKNB 5EZLB 3TBSA 1F02I 1SMOA 1CBVH 2YS4A 4M02A 5CEZH 4Y89A 1S9VA 3EDJA 2J6EH 4Q9QL 2DYPA 4FRWA 3IDIA 4P46A 5FA3A 4OCXH 4IMKA 4D0CA 4Y8AA 4AM0B 1EHLH 4WI6A 3IKCB 5FGCE 1YEJL 3MODH 3VXSD 4Z78B 2NXZB 2W38A 1OQOA 4RGMB 2KL6A 1KN2L 2JJWA 3N1GC 4XB8A 4JM2F 3QUMA 2EDHA 4XVTH 4P4KA 5E2TL 5E5RB 3M1BA 3P4MB 3E2HB 1OTTD 5IEHA 4L1DA 3QZWG 5E7FA 2FR4A 5B38A 2ZG3A 2ERJC 4OLVH 4U6VL 1RZJH 4XH2A 5DUPL 5EOCJ 5KTEL 4JQVA 4P2RB 4GKZA 1K8IA 4X5XA 2BCKB 1MLCB 4X83A 5FK9B 2YD5A 1J11A 3MLYL 2VDOL 1HIML 4DCQA 2Z31C 4BH8A 1G7QB 4M6MH 5GGSY 1QSFB 4N68A 4Z0XA 1E4XL 1F3JA 2C3XA 2MCPL 3QFJE 4WV1C 2WLZA 3FRUA 4L4VD 4K8RC 4U0RC 4YHKH 3SDDC 4HLJA 3U4AA 3C60D 4KJWD 5I8EA 5CSZB 3EYQD 1QBAA 4CKVX 1IGML 2ED7A 1I1YB 4NNPH 5IJKA 4FQXA 3NCMA 4XVSH 3GIVA 5SWSE 1OGTA 4GXUM 2NY5L 3PP4L 2GY5A 4LRIC 3WLWD 3VI3F 3NFPB 2VDML 4MD0A 1P7QD 4U6HB 4MA8H 5MEPB 1TZGL 5D71H 3TZVA 5I18H 1HN1A 1WT5C 2F53D 3P77B 1CZ8H 4KPHH 4I0KA 5K9JL 2AJVL 3GIZL 1M6OB 2BMKB 5EBLB 5LGKA 3CXHK 4L4JA 5KAQG 4JM2A 1UCBH 3B5TA 3MFFB 5JDSB 1AXTL 2I60H 1P7KA 1NAKH 1N5AA 5DR5H 5H35B 5I1JL 1MFDL 4JFED 4GUPB 4RRPA 5HHOB 5CHNA 4FA8A 4KHXH 2XQYK 1I3GH 4JREB 4XP1L 3EUUA 1GOFA 4QTIH 2R29L 4NQCB 4Y4HA 4E0RB 4MAYC 3BH8A 2FO4A 2FO1A 2YK1H 1VEPA 4JFFD 2VDKH 1WTLA 4JDTH 4NWTH 4MJIE 2AK4A 4NM8H 1NGWB 4YBLC 3FB8B 3CVHB 4OGAD 4WEUD 1FN4A 4JFZH 3V79C 3U7YL 3M45A 3L3OB 4PY7B 2XV6B 5EZJB 1KYOJ 1UB6B 1H5BA 4M7ZC 4F58H 1QFWH 1VFBA 4A2LA 1A1OB 1MRDL 3WO3B 3I50H 5DO2D 3BUYA 4PREB 4IIQC 2VABA 1CDYA 5IW1A 4K7FA 2HTLD 1NFDF 4LLDB 1AQKH 4MB3A 3UTZA 5B39G 1Z9SA 4LSPH 1BFOB 1QSEB 3QFDB 1ZT7A 1KT2B 3UTPD 1KELL 2VDRL 3RGVD 2Z92B 1V3MA 2VDPL 4K71B 4JPKL 2MOVA 2BNQE 3MOAH 5T1DH 4RQQA 2BRRL 3Q6GL 4PJDB 2CMRL 5K9QI 5T5FH 3SGDI 4WI9A 5SWZB 4MJ5B 4PLKC 5IMLB 5GGQH 2D7OA 4WFEE 4E41B 1MCCA 1A6VH 2XZQL 1ES0A 2ICWB 2QKIB 3F6LA 3TJHC 4U1SB 2PW1A 1QPPA 3PWVA 4AY0A 1I7UA 3AXLB 3CUPA 2R0ZH 3DYOA 1KXQE 3GO1H 3ZHKA 2HLAB 1N7MH 1JWUB 3BYTA 4LASL 2NTSP 4PJGF 5FYKE 3A67H 4MB5A 1FNGB 4LLQA 4O4YH 4ONGL 3BQUB 4JZJC 2OTUB 2RB8A 3SDXB 1BEYH 1KLFA 4K3HA 3RPIA 5D7LA 5D2NB 1GJIA 1Z9MA 4C59B 2Y25A 3RAJH 2WIIB 1G9MH 5LVEA 3CCHA 2FBOJ 3ARFD 1DFBL 5JO5A 4OD1H 2O61B 2FH6A 1I7ZB 1A2YA 3C60A 4PJIE 4WWID 1U8PB 3STZA 4Z95H 1U3ZA 5F7EH 3PWJA 4XNQB 2DIAA 4PJHE 5E8OA 3P73B 5E99H 3T2QA 4POZD 4F7EB 4PJEE 1NFDA 4HG4J 4LGSB 4QF1B 5ISZA 3SKNA 3WS3A 1A0QH 1KFAL 1G6VK 2PO6C 3W39A 5J89A 1F4YL 1XAUA 3O6ML 5SX5K 3RWCB 1OB1B 4K3GA 1FGVL 4JPVL 1QOKA 1AGDA 4YHMH 2XXCB 1UKQA 5C09B 3QWOB 4M7LH 1CL7H 3S9DB 4GRMB 2NLJB 5HHPA 4XVUC 3MMEA 6CGTA 4O9HL 1BF8A 4AEHL 3P9WB 5H37H 1S7QB 3L7FA 1FP5A 1MCEA 3RZCC 1JF1B 1TNMA 4ZFGL 1EVTC 2OXHA 1CE6A 5C6TH 5JHDB 3MCG1 3QG6A 5D7JC 5JR1L 5L8KB 3KPOB 3HI6H 3L5WA 2DQTH 4Z7WE 4P2YA 2YRLA 4TVPE 3DXAA 3R0MA 1Z5LB 3V4PL 4PJGA 3OR6B 2EIDA 1D9KB 4KK8C 4LL9A 2WV3A 4LSQL 1IJ9A 2D0FA 3ARXA 2DJ4A 4R2GB 2XZCL 1MJUH 3B9DA 4HUNB 5DFVD 3FQUA 3O3EA 5B8CB 3PL6C 1IC5L 3MUGB 3HS0B 4PJ9B 1MCHA 3OAUH 4ZQKA 3R06B 1W0WB 3ILQD 2X4OA 4WENB 5TE4L 4LARH 5HDLA 4IRSD 1DBML 1QNZH 2CLRB 3MV8A 1U95A 4F7TB 3FT3B 3QBTB 1CT8B 5D70L 3WFEH 1EX0A 4PJBE 3KDMB 4XGZA 5MHSD 3G5VA 2FX8H 3KWWA 4ISVB 3PQYD 1SEBB 3MPCA 1UACL 2R56H 4YEEA 2FSEA 1KXVC 5HGBB 3EOTL 3TYFB 4OQTH 4JE4B 4EI5B 1FORL 2AKRA 4HPOH 4ETYA 1X5LA 5C71A 1GZQB 1R5WA 4R7NA 3JV6B 4QGTA 4N9GB 3B43A 4DVBB 1MVUA 1CR9L 2O5YH 4MA1B 3A6BL 4L8SB 1HHIA 5DRXB 1HDMB 5DGQA 4FFVD 2ZUQC 5HPOA 1CFQB 5GS0D 3WFCL 1MI5B 5I0DA 3I6KA 4ORGB 3RUGE 4F7MA 2UZIL 2W91A 1FO0B 3DRTB 3E6HB 1RZGB 1JGLL 4KROD 1OW0A 1HYSC 4IDLA 4KVCH 3DBXA 4PJ5D 1JGEB 3MRFB 4ODUB 4PTTA 3VFUB 4KKCD 2IBBA 3LKPA 1U8LA 1AIFA 3MV9B 2AJYL 1A1NA 4PJ7F 3VD4A 4LVHC 3C5ZC 4P2OA 4AQOA 3O2DA 5KSVB 1VENA 5F93C 1H3VA 1MEXL 4HC1A 3FQWB 1NCCL 4CN6A 1NC2D 1EO5A 3GKWH 3LDBB 1NBVL 2AXFB 5FF6B 1CD8A 2IQ9H 4NHCH 4P57B 3QIBC 3WFBL 1YJDL 1S7XB 3FKUS 1UB5A 4R7DA 4XBGB 5B4MC 4ZXBC 3T65A 1SY6A 4UDTB 2EH7H 3CFDA 4K7PY 1U93B 1TPXC 4KQ4L 5IVXF 3W11C 1BOGB 1QPXA 1OM3L 3S4SA 2B1AL 4NZTL 2E6PA 4Y0GA 3RVVC 1LEIB 1UWEH 1GVIA 5FHBH 4FZ8H 2NY5C 3TBSB 3T1FA 4MSWA 4IRJB 2IALA 1S9VB 3ZYIA 3KS0J 4ZO6A 2DYPB 4ZFZA 3KYMA 4P46B 3HAEB 1J05B 3KPSD 2ARJQ 3HI5L 2XZAL 1O7SA 2W1NA 3HNSH 3CLFH 4KI1A 4XPAH 5CEXA 3GNML 1BM3L 5DQ9A 1LP9F 2X70A 4EEEA 4XBPB 3QUMB 2VQ1A 5CCKL 4P4KB 5BRZA 3M1BB 4HQQH 3DOSA 4ZS7H 4TQEH 3S35L 5IEHB 5A40E 2Y6SC 1LO5A 1QFUH 4HIXH 5T3XH 4OD2A 3W2DH 4UOJA 3CH1A 4PJ7A 3F12B 4HWEH 2FR4B 5FGBC 3OV6A 2R8SH 4G7VH 4U6XA 4TUOA 4GKZB 4X5XB 4KV5F 1IRAY 5FYKU 3QHTC 2P5WD 4BH8B 3ARGA 1CICA 2WUBH 1OP9A 4Z0XB 1GH7A 1INEH 1X5GA 3FCTA 3LB6D 3UTQB 4Q9RL 2OL3H 4XXCC 5ABDE 3QRFM 5I76A 2VLKE 2IGFH 4ZODA 3BOVA 1MHCA 1K5NA 3FRUB 3I2CL 4G80A 4MDIA 2UZYB 4Z8FH 5IVXA 5J11B 2N7AA 4X9FA 5I8EB 5IQ9B 1XF4A 4P5TA 3VG9B 4BFEA 4R4BA 1MHEA 3ARBB 3HE6A 1HOCA 4AEEA 3MXWH 1YMMA 1A4JB 3L7EA 4XT1C 4WU5A 4JR9L 3CZJA 4ALAL 4FFYH 4KJQC 1UM5L 5D8JL 3JWOH 3GHBL 1A6UL 2UYLA 4L4TD 3B9KD 5KSBF 4JGMA 5JW4N 4MD0B 1T21A 3AY4A 3TZVB 1BLNA 3SE8L 4R26L 1TTFA 3AB0C 5EU6A 5FYLH 2G60L 5TDNA 1ZANL 3LVEA 3T0AA 1GPOL 4QLRA 3BPCB 5JOFA 4NQEE 4OLZL 4XNZB 2ED9A 1LP9A 1QLEL 3CDFA 3NH7L 4Q6IA 4JM2B 1UZ8A 3MLTB 1N5AB 5ESVA 5K33A 3EYFB 1RJCA 2VNCA 5HXMA 4RWYH 4V1DE 1OAUL 1W72L 1S5IL 2ARJA 3T2NH 3GJFH 1RU9L 1MLBA 3FT2A 1U92A 4M9OA 1TJIL 5JPNA 1MUJA 1L9NA 5HHNB 5CZVH 4Y4HB 3FO2B 4JO3H 3BH8B 5DVNA 3VXQA 4K7PL 2FO4B 1BIIA 5DJDA 4WW2F 1L0XA 3HB3D 2RCSL 2XN9D 1MCLA 1YPZE 4POYA 5GRZA 1UJ3A 4TSCH 1UM4L 2AK4B 5FA4A 2HKHH 4JRXD 4X80H 1QR1B 3LN9A 4BZYA 1FN4B 1R5IA 1H15B 4X98A 3FZUC 1Y6MR 4PFEA 5DTFA 3L3DA 3SE4A 2A9NL 4H5SA 4GAJH 5KVEH 4S1DD 1DN0A 8FABA 4LPXA 5A43C 3LQMA 1JPST 2W0KA 1BQSA 5GS3A 4RCAA 1MRFH 4OAWA 4XCCH 3WYRA 4HS8L 1QSVA 5CILH 3UTZB 1OCWH 3PWNA 4J1UA 4PLOB 1JF6A 2P8LA 1OP5K 3MLRL 5AG8A 3KPSA 3FN3A 4KI5C 1ZT7B 1WCBB 3CX5J 3N1MC 3UCRA 2YD9A 4KAQL 2DDQH 2OBGA 4OZGF 1ZT4A 4GQ9L 1IGCH 3IRZA 4L3EA 4MX7A 1FNSL 4QRUB 5KSBA 1N6QH 2YA1A 1YYLL 5A16B 1KIQA 4M6NL 2DM4A 1EH9A 4URTB 1M05A 1T66C 2E27L 5IWLC 1MPAL 1VFUA 5EZOL 3KJ6H 3GSOA 3B83A 1R3JB 2PYFA 2W59A 5I9QB 2PW1B 2DICA 3PWVB 3C5SA 4G6FD 4D0BB 3OG4B 1X5JA 5CP3A 1ZXQA 3U9UA 4LVEA 1J1PH 3MUZ1 1D5MA 2YKLL 5FO8A 4LLQB 2NX5E 2YWZA 2Q86A 2XTJB 4YFLF 4AT6A 2QQLL 4P23D 3BKJL 2GYSA 4NN7C 5D7LB 5BW7C 2DQHH 2ADIB 3P0VL 4NNYA 1MIEH 4WW2A 5F7LB 4O2FA 3VFRA 5EOTB 1S7VB 1MCJA 2LVCA 3VXUE 4N0CC 3QQ9C 1A2YB 2NPLX 5DJ8B 1ZGLA 3STZB 1AGEA 1RK1A 4MXWL 3MGAA 4KKLC 2P5EA 2FGWH 2VO5A 1BJ8A 1CLYH 4WUKH 1C5DA 4LCIH 1KEMH 3MRIB 4KK5D 4DAGH 3KR3H 1IQDA 5IG7A 4PJIB 5ISZB 3D3VB 4XRCB 3SKNB 3GSNA 4EZMA 2P45B 5EO9A 3QI9D 4D94A 4H26A 3CIQA 5EU5B 1I8MB 3KNBA 1A14L 4OZGA 3WIIH 1AGDB 1HKLH 2BVYA 3V6OA 4HWBH 2IBZY 1NAMH 1GGIH 5BCAA 1CXHA 2AJUH 2OTPA 2XA8L 3ELAT 5HHPB 1A7NL 1ACYL 3MMEB 1LILA 3BE1H 4NQXA 3T09A 2ZJSL 1FNEB 4Q0XL 5L7XH 1CE6B 1UJTA 3TPUA 5DZLA 3QG6B 5D1ZD 4ODHL 4WI2A 1FG9C 4XZUB 4I0PD 4N8VA 1AO7A 4LK4A 4P0DA 4ZNEE 1YEIH 2BX5A 2FHFA 3DXAB 4PJGB 1S7WA 4FABL 2XN9A 1PEWA 2FIRT 5C9KA 5E00A 3FQUB 3BGMA 4HFUH 4OT1H 1KCSL 2BVQA 1OAXL 3SQOH 4Z7WB 1DBAH 2E7BA 2XG5A 5AZ2L 4R9HA 2W92A 3VWKD 1I8IA 1TNNA 3QHZL 4LPYA 3MV8B 1YJDC 1J9CT 1JUFA 1U95B 3VJ6A 1QRNA 43CAA 1E28B 4G6KH 3W9DB 4BSWB 4M1CC 3BRDA 3ARDC 2EDDA 2YA0A 4XGZB 1A7OL 3G5VB 1JRHH 4X4ZA 5EC2A 3TWCL 1VA9A 5HHMD 4DKDC 2FSEB 4W4OA 3QCTL 2AKRB 3BDBA 3U0PB 1IAII 5E0QA 1MHPH 3EYUH 2QHLA 1I4FA 1R5WB 2ZG1A 2O93L 1KBGL 3IB4A 4PBXA 3L6FA 4R7NB 5HYSA 3GBNH 4CJ1A 4OCRH 5A3IC 3LY6A 1MVUB 5DJ6A 1HHIB 4TSAH 2ADGA 1IARB 2OM5A 4ZAKD 2ZKHL 3VFMA 1RUAL 3DI2B 3MV7D 3UZVB 3BHBA 5HYIA 3I6KB 2WWMD 4EDWL 4F7MB 4LU5H 4GXVL 1CFNA 4APQD 2AQ1A 5FKPA 1BJMA 1YNKL 4GRWE 2WP3T 1JMZA 1LO3L 2CLZA 4U0QB 7FABH 2X4UA 3QEUA 1INDL 2Z35B 4XNMB 4WFHE 1NGQH 3RUGB 3NZHH 2BNRE 4PTTB 5TFSL 2PR4L 3OB0H 5F7DB 4FHBD 1U8LB 1QBML 4NIKB 1A1NB 2V2WB 4P2OB 1IILE 2CPCA 1ACZA 3EO9L 2EDNA 4BUHA 3TT3L 2JIXA 3FOMA 2LVEA 3N06B 4O00A 5HSFA 3CD4A 1PQZA 2FJGB 4DGYL 3EAKA 1N5YL 1DL7H 3C2AL 2AJZB 3HZMA 3SKJH 2V5YA 2FGZA 5TQ2L 1W8NA 2AV7A 4WUUD 4K71C 3THMH 4OZIE 1UB5B 4FTVD 4R7DB 3FO0L 3T65B 3TA3C 4XAWL 4Z6AT 4K3EH 4QOKD 3RJQB 3KLAA 1IGFH 5I19H 3U0WH 3S4SB 1RSFA 3CDGA 3K80A 3U6RA 4XXDA 1X5XA 1HHKA 1LDPH 2QQQA 5DC9B 1RZIB 5F71A 3QQNA 4JFHE 4KMTL 4MSWB 3T1FB 3PXJA 3VA2C 4R97B 2R4RH 1IAIL 4OUOA 4K94L 4HUVA 5CJOL 2A38A 3UTSD 1JJUA 2NCMA 5JLZB 3EJYC 1GL4B 2HJKB 1L6XA 4XP4L 5GZND 1BVZA 4YXKL 2FHBA 3QXDA 4R96A 4GJTB 3OAYK 4X7SH 5D93C 2AJ3A 2DJUA 3T3PE 4X6CF 2XTLA 4OSUL 4ZO9A 5CEXB 3UJTL 5DQ9B 3DO7B 3ZE2E 1EAJA 1RVFH 2VQ1B 1G1CA 5BRZB 1J12A 1P4BH 4ZS6C 3QUXD 5GGVL 4LF3A 1J0JA 1LO5B 2RHEA 3Q2CA 4OD2B 4XP9H 5EOQH 2DM2A 4DGIH 5C0BE 3DROA 2R1XA 4HWNA 4O02H 1Q38A 5IHZA 2F58L 4PJ7B 2FIKA 4XAKD 1E4JA 2KUTA 5DMGC 1NMCB 1XR8B 2DIBA 2CH8A 1C16A 3PV7A 4X9HA 2IQAA 1N4XH 4U6XB 4D3CH 4JAMA 4N1CA 1TTUA 1PSKH 3NIDE 3TBVB 1I85A 3F7YA 3ARGB 4DK6A 1JN6B 4X7CC 4G9FE 3PGDA 1T7VA 3FCTB 4GAYA 4AJ0A 3MQIA 3OGOE 1IZKA 2VH5H 5I76B 4BYHA 3MOBH 4UT6L 4G80B 4MDIB 3RWIB 4NBZB 1FQ9C 5IVXB 2P1YA 1P4IH 1RIHH 4P3CH 1KC5L 3SDYH 1XF4B 5HI4C 4P5TB 3VG0H 1MHEB 5IBTL 3QDJE 4OGZA 1YMMB 1SQ2N 3L7EB 5C0CA 5KG9A 2Y7QA 4WU5B 3X13A 5C0FA 2VLKB 3OKKA 2C1OA 1CCZA 1IBGH 2UYLB 2XKSA 4CADA 1WICA 1P4LA 3HNVH 3BPOB 5HDBF 2IPKB 1LWRA 4HIJB 4AIZA 4KRLB 5DMIL 5CJQL 2XT1B 4C83A 4R2GC 1F2QA 1XCQA 1KIRB 2J5LB 5TDNB 3GMMA 1DZBA 4X6CA 4Y4FA 3DMMC 1H3GA 4CN1A 2EE3A 3SKMB 1MAJA 1UZ8B 3T2OA 1QKZL 1YYMH 4BH7B 1F6FB 4HIHA 3OKLA 4MJ4A 1HILA 1OARH 1OY3B 5C08A 3VD9A 5DD0L 3SO5A 4ZUWA 3WD5H 4TULL 1MLBB 1HZHH 3FT2B 3H42H 1QACA 3BD4A 4YO0A 1U92B 3U79A 1J8HE 5HD8D 4YHLL 2CJUL 1WBXA 4PRIE 3WMSA 1CIDA 5DC4B 4MHHI 3E3QE 1CLZH 1BIIB 3PGFL 1N64L 3FTGB 4PGEB 5AYQA 3I75B 4WWKD 4TVSa 2DQDH 3I3DA 1KB9J 2J8UE 3SGEI 3W0WD 4YE4H 4HKXA 5FA4B 3SOBL 1R5IB 1H9VA 2GK2A 4X98B 4L8SC 4J3XA 1W8OA 4H5SB 5EA0H 4KDVA 3MLVH 8FABB 3VI4F 4DOHB 2NW3A 1T03L 1MJ8H 1DANT 3HPLB 1I3RA 5BV7B 2CRIA 4WTWA 3ES6B 3PWNB 5IB5A 5ESQA 1WK0A 4BQ9A 1VADA 4JPWL 1RZFL 4JN2B 2YC1A 1RUKL 5KVGH 1ZT4B 2H32A 4L3EB 4MX7B 5IESL 1EJOL 5HJ3A 5KSBB 1WIPA 5ICYB 2FL5B 5EIIA 4G5ZH 3DX9A 4HUMB 3QUXA 2NY7L 3FMGL 3MLXL 4C4KO 3HC3H 2KZ1B 3LEYH 5CKAA 4LOUC 5HHXH 3GSOB 1WZ1L 3IDXL 3OB8A 1GAFH 3UJIL 3C5SB 4RGNE 1AGBA 2LABA 4PRHE 5BZDA 3SJVA 5ILTH 4XI5C 1D5MB 2IAMC 1MJJA 3E3QC 3KPMA 1T0MA 4P2QA 4GRLB 2YRZA 4OD3L 4NJAH 4S2SA 4Y5XB 2B20A 3RKPA 5TGBA 1MCPH 3FN0L 2AV1A 1TETH 2AEQH 5B38G 4NNYB 4WW2B 4O2FB 1Q0YH 4G8IA 5KSAA 5I1GL 2VSDA 2R0LL 4U1IB 1MH5B 1JTTA 4HKZB 4QRPE 1AGEB 1PBYA 1NBYA 3HZKA 2XWBA 5TF1L 2GFBA 1RK1B 3QIWD 3B9AA 3I3EA 4XPBH 5GS2D 2YD7A 4UAOB 3VXPB 1M7DB 4GLRH 3QHFH 1C5DB 5EU7E 4XPFH 2DRUA 5FKAB 1FGNL 3HE7D 1IQDB 3OKYA 3ZL4H 2ESVD 4U1GC 4XNUH 3TFKC 2B0SH 5L6YH 4LSUL 1OD9A 1X5ZA 2XI9A 3QEQE 3TVMA 4PYGA 3S37L 4P4KC 4Z7NE 2VXSH 1X5AA 3DX8A 2UWEA 2YRPA 1L7TH 4K3DH 4QHNA 1A22B 5AD0A 1IT9H 1F8TH 3BAEL 5M95B 2B2XL 2OZ4H 4M1GL 3MXVL 3AMLA 4HPYH 2AK1L 4RGNC 1U2CA 3LMJH 3TBYA 4BSVA 2N56A 5C0AE 1TQBB 3O2DL 4JQVC 3MO1A 1AO7B 4FP8L 3HAEH 4HDIA 2IANE 5F7WC 3MROA 3LD8B 1QBLL 5JZ7C 1LEKA 1P1ZB 2MWCA 4WI4A 3RIFK 3SDCC 3QQ3A 1S7WB 2EEBA 4Y16A 3JSSA 3P11H 2NYYC 1S3KL 5E00B 2FECI 5F96L 4PJAE 5JOPE 3QH3A 4RRPG 1L7IL 1BD2D 3MRGA 1SY6L 1B2WH 5IVOA 1I8IB 3VG9C 5IR1A 3WFZA 2D7QA 1S5HB 2PTVA 3V4UL 4ENEC 2NR6D 3OZ9H 1BZ9A 1JUFB 5CZKA 2WUCL 1QRNB 43CAB 5IFAH 4CVWA 5IJKC 4FQXC 3OXRB 1DBJL 3G5ZB 5I1EH 3UYRL 4FZEH 1VEOA 2L7UA 5EC2B 1GIGH 3VXSE 1FZKA 3IAGC 3TZVC 2HT2C 5IHBA 2COQA 4ZPVA 3RRQA 2IFFH 3ULVD 3WSQL 4NUGH 3I9GH 1T2QH 3KGRA 4EUPA 1IKNA 3L1OL 4PGJA 1OAYH 1MCOH 5DURB 5GSRB 4I0CC 2J88H 3D5OF 3L6FB 3QG7H 4NRXA 5HYSB 4X6BB 4CW1A 2EDRA 5DJ6B 4K94C 5LGJA 5BQ7A 5GS1A 2ADGB 4TSBL 1Q72L 3UTTA 5MENA 1U8KA 4AMKL 3X11A 3VFMB 2V6HA 3D48R 3SGKA 3WLBA 1VEMA 1FNAA 2IMMA 4WO4D 3LRSA 1I9IH 4HF5H 5GGTL 1FNFA 4MZ2A 3OMZA 4EN3A 1A6ZA 1G7MA 4P99A 5E8NA 2H3NB 5FKPB 2O26U 2ADFH 5FUOL 4OZ4B 1IC4L 1XIWD 5HGHA 3Q48A 5HYJD 2CLZB 2VITB 2IG2H 2JJTA 5DUBA 5E6IC 2X4UB 3QEUB 2F19L 2QADB 5TDPB 3VXOA 5ITFA 3M8OH 4B53A 4FFWD 2A0LD 4X0KA 3FFCD 3C6SB 4G6JH 4L4VE 4OGYH 5L88H 4MD4A 5K9OB 2DQEL 4UBDC 4XBEH 2NY0D 1H5BC 2DLTA 2FATH 4PUBL 5GIRA 3LKQB 4M6OH 5GJSH 3FOMB 2D7TL 3U7AA 3MNZA 1SM3H 3HTLX 3EJZD 4ZD3L 2BNRB 4QWWD 2EDJA 2FECL 3AREA 3QQ4B 2O5ZL 5KANI 1LNUB 3HZMB 2V5SA 4LLUB 2OXGA 3GMPB 2AV7B 5GS0L 1T0NB 5BOZG 2XKUA 1WFUA 3LQAL 3F58H 3KHQA 2F53E 3MSPA 4CGTA 1FVDA 3B8SA 5E2UH 2ORBH 3WKML 3KLAB 4HT1H 4JDZB 3VXMD 3U6RB 1OTTC 1KIPA 2PF6A 1HHKB 1IMHC 3L3KA 3TCLA 3G9AB 4UQ3A 1VGEL 4UNUA 1GXEA 2ILLA 3U7WH 4JFEE 2HRPL 4HUVB 3BZFA 1AP2A 4C58B 4FMKA 5AWNH 3O45B 1XGQA 2VZUA 1KN4H 4R96B 5J6GA 5T33L 3G6JE 3MCLH 4IBLT 4BSJA 3ULUF 5DRZA 4NKIL 3RQ3A 1T5XA 4WVRA 2AJ3B 3BGFB 4JFFE 3P30L 1EUUA 1EFXD 4L8BA 2WINA 1A7PL 5D1XA 2A6JA 3D18A 1Q8MA 1FIGL 2ZNXA 3O4OB 4DKAA 4XPGH 3H3PL 4NC1C 1OSPH 3GMQB 2QQNL 1U6AL 3C60C 4UIKH 5CMAA 3KLSA 5GRJL 4LF3B 3IJHA 4JVPA 5D6DC 1A9BB 1MNUH 1J0YA 2P8MA 4DW2L 3HG1B 1INQA 4YXHL 5CKGA 4IEFB 2FIKB 1IKFL 3GI8H 1C16B 1XF3B 3S3JA 1FYTD 2IQAB 1NLBL 3IFNL 3OQ3B 1P6AB 5D6CA 1S9XA 4OBSA 3UTPE 5GRUH 3F7YB 5C0BB 2ZCHH 3PGDB 3O2WL 1XF5A 4Z7UE 3HRPA 1PX4A 4J6RH 4C56A 2Q7NA 3IVKA 2FX7H 3NA9H 3TJEL 1AI1L 4GAGL 4HUKB 4ELKA 4XMLH 5B3JE 5FYKH 1WZLA 4MAUH 1TXKA 3H2WA 4NKMA 1U8JA 1Q0XH 3LS5H 3PDDA 4G9FB 4YAQA 2Q8AL 4U1NA 1PG7H 4OIAA 5C0CB 1NCDH 1WIOA 2ZCKH 3VFTA 5J56B 5KG9B 4QXTA 2YEZA 2Y7QB 4OM0H 5C0FB 1UVQA 4HH8A 2C1OB 3VFGL 1NMAH 4D8PA 4W6XB 4CADB 1P4LB 4ERSL 5EBMB 2HG5B 4AIZB 1BQUA 4F3FB 2YD6A 4C83B 2Y06H 1XCQB 1G7IB 1NGYA 3MLPA 2YOCA 1CQKA 1Y18B 3GMMB 1FZMA 3TO4D 5MEQB 3OKDA 1J86A 3D0LA 2VXVL 4X6CB 1D5IH 2W0LA 2ZPKH 5M7QA 4X9IA 5DRNA 2CGRH 1X4ZA 1G6RA 2E7HA 3BWAA 4ZOBA 4HIHB 5DO2C 1HILB 4PGDA 4XC3L 2XNAA 1KCRH 4GSDH 2YBRB 5F8QC 4ZUWB 5D9SA 2DB8A 3O9WA 1SJHA 5HHQB 2K1MA 2HN7A 1CGVA 4QGYA 1WBXB 5L2KD 4CMHC 5EU3B 1MJ7L 4NN6C 3QNYA 1NANI 1BBJA 4X8XA 2BVOA 5H8DA 1HWHB 4NM4L 1IFHL 1AHWB 2E7LC 4HKXB 1MIMH 1RURL 4XHQA 2F8VA 3KPRA 4MCZA 3GSNL 3SKUD 4TVPH 1SYVA 2ZG2A 4YZFF 1V7ML 1C5CH 1VSCA 2NW3B 4JKLA 3B2VH 5DQJB 4G8GA 4K8RD 3SDDD 3SDAA 1I3RB 4W81A 3EKCA 2VR4A 3CMOL 2A1WL 3MRPA 15C8L 4OJFL 1UKSA 2BXYA 3S4SG 2GSGA 43C9A 5IB5B 5ANME 1XT5A 3DUSA 4F8TA 2XZZA 5ESQB 1VADB 4KWUA 4U6VH 2YC1B 4FS0A 5DUPH 5IJVA 4DJMA 5AAWA 2H32B 4L3CB 3FONA 3QXAA 2D9QB 3SGJA 2Q7YA 5EIIB 1YQVL 1SBSL 3DX9B 1BJ1H 5CBAA 4DUVA 3UJJH 3GSQA 4BKLA 1RZKH 4QHMB 1I9JL 3MRKA 2CSPA 2OI9C 1PG7X 3EDKA 1P69B 1OHQA 2E9WA 3BO8B 4POZC 2W9EH 3AUVA 5MHSE 1Y0LA 2G2RA 3EYSL 1IGMH 4MXVE 5BZDB 3SJVB 1OPGH 1XGUB 2J6EA 2VXQL 3PQYE 2BFVL 1T0MB 4P2QB 3QCUL 4HIEA 4NKQB 5MERA 2NY5H 3S34L 3PP4H 3ZTJG 5D96B 1DEEA 3HPJB 5TGBB 2AV1B 2VDMH 2FEDD 2P44B 4N0UE 4WJ5A 1TZGH 2FX9H 1T2JA 2J12B 2YPVL 5KSAB 3R1GL 3BIKA 3S88L 3TC9A 1IGIH 2AJVH 3GIZH 1NBYB 3BD3A 2XWBB 3ESUF 4O5LL 2GFBB 2PNDA 1H0DA 4W70A 1J0ZA 3KPLB 3GMLA 1AXTH 1LQSR 4JRYD 1T1WA 2QSCL 3N1PC 3CSYB 4JHWH 3LPWA 5F9JB 2H8PA 4YHYB 3O3DA 2N4IA 1MFDH 3A6OA 1RZ8A 1WLHA 3QPXH 4DQOL 4XCNA 3D85D 4YC2B 1KJ2L 2FEEI 4PJ5E 3TVMB 4WTZA 4DKEL 4JKPL 1A9EA 3V7AE 4NKDA 4HLZH 3U30C 3BKCH 4QHNB 4OCMC 2EC9T 4IRSC 3QCVH 3U7YH 3QEQB 3NAAL 3ARRA 4K9EL 1KJVB 4PLKD 5KSUB 1MRDH 3DRQB 4MXQC 3C6LD 2GJZA 1B0WA 2YA2A 4HDIB 5ICZA 4JO4H 4UT7L 3VFVB 1JPTL 4CUCA 1QUNA 5IROA 1CICC 1AC6A 4Y1AD 2DS4A 1AKJB 4Y16B 2Y5TB 2EIZA 1NUFA 5GJTL 5IEKA 4P3DA 5LXGH 2VDRH 3B5GA 4WIQA 5B22A 2YWYA 2DLIA 4X8JA 4TYUA 3LKSA 3IRPX 3MRGB 5E8PA 5DZNA 1CDHA 5H2BA 1KACB 2CMRH 3BP6A 3D9AH 4UUJA 4CBPA 1T04A 4P5TC 5I66A 2L0DA 2DMCA 3HE6C 3MZGB 4Z7VF 1YC7A 2AERT 4JFOA 1BZ9B 3AMKA 5GS0C 1WVZA 5I1DA 4HJGA 2XZQH 2G9HA 4PJAB 4JKWA 2H2PC 4NRZB 3RIAF 3DO3A 3LQAC 3VU2A 5GRXG 2HH0L 3KPSE 4NHUA 3U4BL 2EIEA 3AY4C 4ZUSB 3MRDA 1FZKB 3NACL 4KROC 4YDIL 1CGUA 3SCMA 4ZPVB 4GS7B 3V2AR 4YHPA 3X12B 2GTZA 5CWSA 4ONGH 3QR2A 4NO3A 2P8PA 2NW2A 4J8RA 2DQCL 3MBEA 1SYSA 2PO6D 4NRXB 1YECL 4CW1B 4Q6IC 3DGCR 3VDBA 3BT2H 5CBEA 5GS1B 3VGEA 3VXSB 4WEBH 1DFBH 3BZ4A 3Q1SL 3LEXA 4QRQA 4YHZL 5MENB 1U8KB 3X11B 1NSNL 4YHIA 3QDHA 4LCCC 5C0JA 3OF6A 3T4AA 3WLBB 4MNQD 1U3HD 2FEEL 1KEGL 4JO1L 3LRSB 4NQUA 1BZQK 1MF2L 4RBPH 4EN3B 3QO0B 1A6ZB 1PW3A 2MQ0A 5DUML 2BNUB 2Y1VA 4MJ2A 3G6AA 1J0IA 5K59E 5DK2A 2P5WE 5D7JD 2DIJA 2X4PA 4JO2L 3QUYA 5DUBB 1S8DB 1J87A 5FEBA 1UJ3C 1ZS8A 4KTEL 5ITFB 1F4YH 4R0LB 3P4OA 4X0KB 4FXKA 3O6MH 2H2SD 1BZ7B 4JPVH 3SE4C 4MD4B 2XQBL 2A77L 4K23L 3VMPA 3PL6D 4MDJA 2DTML 3MNZB 5IFHL 4Z7VA 2F8OA 4AEHH 5BZWB 1CE1L 3FQTB 4HBQA 5JIKA 3AREB 3WEXB 4F37F 2GKIA 2DQUL 4C55A 5AYUL 4N90D 4L4TE 5TPWL 1U91A 3ZDXE 3D39A 5LCVH 1CS6A 1A5FL 5JIIA 3PWLB 1D5BA 5BJTA 5E5UB 3EFDH 5KOVC 3SGDH 4LPWA 4PGCB 3V4PH 4F8QA 1FVDB 4ODBD 1E6OH 3J7HA 4PRPA 2CKBL 3W5NA 4Y5YA 5DJZB 4JM4L 3INUL 3E6FA 3IDYC 3IT8D 3L3KB 4UQ3B 3BKML 1FL5A 3WN5B 3QXUA 2HT3C 1IGTA 5TE4H 3VWJA 1N0XL 3WHE0 3BVNB 4DK3A 3BZFB 4N8CL 1OAKL 2BJML 2W65B 3DWTA 2QL1A 3C6LA 1AP2B 4NZUL 1XGQB 3HN3A 3IXAA 5D70H 5J6GB 1RIUL 3Q5OA 4LHUA 5C9JB 5C2BH 1T5XB 2EXWD 2MJWA 4L8BB 2XN9E 5D1XB 1UACH 4NGHL 3HFML 3EOTH 1C1EL 4JRXE 2CUIA 1FORH 5EH1A 4N8VG 4FQCL 5DMJB 3CZFA 3IJHB 4KUZL 3K1DA 1JFQL 3BMVA 2P8MB 2BSTA 5DJ2A 1TENA 1INQB 4JFFB 1CR9H 3BJ91 5A2IH 1R3IL 4HJJL 4UAOC 4U1KA 1HH6B 1AD0A 2OJEB 1CXEA 3SY0A 1G7LA 3WFCH 3T0EA 1S9XB 1RIVL 4HZAA 1DVFB 5DJAA 3GSXA 4KKBC 3STLA 1XF5B 3ARWA 3RWFB 1ONQB 1KPRA 3QIBD 4QNPE 4ACPA 1JGLH 3WDHA 4P59H 3IVKB 3QWRA 5B4MD 4EIGB 4ELKB 2HWZL 3NGBB 4U7SA 1UXWA 4NKMB 5F1IA 1U8JB 3RGVB 3JXAA 1EIBA 4HXAL 4G9DA 5A2FA 4YAQB 3AGVA 4Z7UB 4Z18A 4MNQA 1U3HA 4Y5VA 3VFTB 4QXTB 1TQBC 5EU4B 1WQVT 5HYSG 1JIBA 1WBYB 1DQDL 5F7NC 1NBVH 4LHJB 3OR7A 2HRLA 5FV2A 1C12B 4UQ2B 3WFBH 5J1AA 3FT4A 2GJ6A 1NGYB 5CLTA 2VXUL 2QQKL 4OQTA 5F9OH 3R8BB 4YDLB 1KTRL 4WEMB 2Q3AA 1CF8L 2VLJA 1WBZA 5E1HB 3TF7C 1UC6A 4PLNC 4KQ4H 2JCCE 3DUHA 4S1DC 5E9DA 1G6RB 3BWAB 4RFOL 3I6LD 2B1AH 5FYJD 4NZTH 3WXVH 2XNAB 3QJHA 1FFPA 2BC4A 5IUSA 1NCAH 4TNWF 1JGDA 2C7UA 4LCWD 3V6ZA 2DI7A 4JFDD 4UV7H 3ARFB 3FN9A 1JPGA 1RFDL 2Y6SD 4ODVL 3O9WB 1SJHB 2AJSL 5B3NA 1H3UA 2AGJL 2HN7B 4MNGA 3BIAX 3RDTA 3MLZL 3IDGA 3ARTA 4W4OC 5ACLA 4M93B 1IM9A 1BBJB 5SV4A 4EI6A 2BVOB 3HI5H 4G43B 3BP7A 2P47B 4XVJL 3KPRB 4X5WB 3CFCL 4RMSA 3ZO0A 5E2JA 4IDJL 1IM3A 2ZZUT 4KRPB 3MRBA 4TUKH 2YPLD 4NQVB 5SV3A 5I8KL 2BOCB 3ALXA 3H0TA 5IKCA 2EH8L 4CDHA 4G8GB 3SDAB 3EYVB 3MRPB 2CXGA 3UC0H 3GZKA 1A64A 5C7XL 43C9B 5CS7A 3DUSB 4FNLL 3S36H 1D5XA 5IJVB 2HJLB 1PY4A 4RAVB 1NGXA 3LIZH 2QADC 2FZ3A 2Q7YB 4I2XA 2IPUG 4C54A 2ITDA 3B2UD 1OAQL 4K9EC 4S10A 3GFUA 5CBAB 1M71B 4NZRL 4QHLB 2VYRE 2MTPA 4Y19D 4IS6A 2AI0L 4BKLB 4HKBA 4WCYL 3QT2A 1NL0L 4IOFC 3MRKB 4XCFL 3NIGE 4WHYH 4PG2A 5HVGB 3WL9B 5KJRH 3QUZD 4JFXA 5DVLA 1VFAA 4Y4KD 1Y0LB 2G2RB 1OT2A 3LKOB 4X7FC 3CDYA 5HHME 1E4WL 4LSSL 1UZ6F 1UM5H 4OZHE 1FV1B 2OCFD 1WAAE 1A6UH 3GHBH 5MERB 1GSMA 3C87A 3OGCB 3L5XL 4G3YH 2HFGL 3RNQA 12E8L 4B41A 4X6FB 5F88A 3SE8H 3T4YA 2Z4QA 1QEWA 4MD5A 5J12C 1B0GB 2G60H 1ZANH 1GPOH 3WDJA 4Q9CA 1PKOA 5TQ0L 4OLZH 3O6KL 2N1KA 4GRWH 1DQLL 1QLEH 1H0DB 3MV7E 3MRNB 2NXYB 1T1WB 1IEHA 2BDNH 1HE7A 3OHXA 5C07D 2H8PB 5J06A 1W72H 3O3DB 1UXSB 1RU9H 1RZ8B 2HTKD 2BK8A 2B8OT 3O8XD 4GG6E 1YQ2A 3DUUB 2KKQA 4XCNB 2ZSWA 1TJIH 5FDYA 3BGFC 2KH2B 1RI8A 4JN1H 5D5MF 5DQDL 4KI5D 4K7PH 5DHYA 4XC1L 1OGAD 4S1RL 1NJ9A 2OL3A 2IH3A 3CFBA 4YQXL 2E6JA 5ITBH 2BSSB 1UM4H 5C8JB 2NY3D 1ZLUH 3H7LA 1YNLH 3I85A 4M5ZL 1JZ8A 4ONFL 4FQQB 4X7DC 5TE7L 3DV4B 3CK0H 4S1SL 5LWYH 4KZEH 4J4PD 2JTDA 2GJZB 2VOTA 4WFFD 5ICZB 4HS8H 1I85C 3S36X 3TH3T 2X4SA 5F9DC 4WUUE 2PYED 4FTVE 4LAQH 3HNTL 5IEKB 5CFHA 4QOKE 2EKSB 4L1HA 3H7BB 1FNSH 3CFJB 1ADQH 1AGFB 3EOBA 3LKSB 3F62A 4PRDA 5DC0A 1RHHA 3TPKA 4UUJB 4M6NH 4JG0L 1T04B 1QG3A 4ZAKC 5F9WB 1ROWA 3DX6B 3WJLC 1MPAH 5LQBL 3DIFA 4JFOB 1FVCA 4R4FL 4PJXF 4N0CD 5BS0A 3OWEA 5I1DB 2ZOKA 4JDVB 4XNYH 5C92A 4BQ8A 3UTSE 2WWMC 4HBCL 3TH4T 4OI7A 3GJFA 1CFVH 4FQLH 4APQC 4NHUB 5F70A 3DLQR 4R90H 4HK0A 3MRDB 3OPZL 3K8LA 4RX4A 1GGCL 3HHRB 4KTDL 3T1WA 4YHPB 1KSRA 5CWSB 5JPMA 2WBKA 4NO3B 1QBBA 4Y4FC 1OLLA 2QQLH 3MBEB 4L29A 4I3GA 2JKXA 2NXZD 3BKJH 5D5MA 5CGTA 3O6LH 2LE9A 5CBEB 5KVDL 1RUPL 3E1F1 3BZ4B 3AU1A 4QRQB 1MCNA 4KKNA 4E5XA 1PLGL 2IH1A 5C0DA 4XAKE 5I74B 5C0JB 3LPFA 2UUDH 3QUZA 2QBWA 3MBXL 2J4WL 4H1LH 3RWDA 4Y4KA 3CLEH 3VRIA 4MXWH 1FCCA 4AEIH 5BVPL 3LN5B 3TLRA 3MACL 2R1YA 3ZKXB 1K3ZA 2D03L 5I73C 3QDMA 5JORA 3TBWB 3G6AB 3IETA 3UO1H 4FQ1L 1DANU 2PKDA 2X4PB 4P2RD 2QJDA 1V3KA 1ZS8B 3GM0A 2DOCA 4K7PX 1XGTA 3P4OB 2OP4L 4FXKB 5DLML 3VCLB 1FC1A 1MQ8A 1QSFD 4UZGA 3ROLA 1A14H 5I1HL 2DQIL 1D6VL 1QYGL 2UY7A 2E8ZA 4CU6A 3ULVL 5IV2A 2OS7A 4LNRA 1GOHA 2XRAL 4ODXA 1TZIA 2RFXA 4MDJB 1S7UA 1NMBL 1S7SA 2DLEA 3DNKA 2VTFA 2XA8H 3EW3B 1ACYH 1JGVL 4PJCF 3V0WL 3IF1A 4PJXA 4TPRL 4Q0XH 3MLUL 3HMXH 5IGXL 1U91B 2NY2B 3O8XA 3D39B 1S78D 1T20A 2JB5L 4NZJA 4ODHH 2WMPA 1U8QA 4M1CD 3H9SA 4ZDHA 5D1QA 4KHTH 2HA1A 5TE6H 3QNXA 3MRLA 4KXZI 2R69L 4GKSA 1X5IA 4FABH 2MFNA 1EMTL 4PRPB 3QUXC 2UWEE 1GCFA 3B9KB 3BISA 3E6FB 4NRYB 1UT9A 1AJ7H 4JZNA 5E08L 3NABL 5AZ2H 4KKAD 4U33A 35C8L 4LAJH 5DYOA 1ZHBA 3NVQA 3QHZH 1IGTB 1XGYL 3NTCL 4LPVA 3VWJB 3GMOA 3C2SA 4QRRA 1FZJA 2FB4H 1FZOA 3C08L 1V05A 3IXAB 4DZBA 4KMLB 5J13C 1BQLH 5HHOD 1U36A 4LHUB 1A7OH 4QO1A 5EBGA 1FIEA 3OAZK 2CRMA 4NQCD 1A6TA 3W0WE 1DJSA 3VFNB 1RULL 3HC0A 4RISL 2LFGA 1YEEL 1FBIH 3BEWA 3CZFB 4HZLA 2VAJA 1KBGH 4HWBA 3HLAA 4PGZA 1WSST 2DLFL 3MYJA 4NPYA 5DJ2B 1EEUA 2NZIA 2R1WA 5T1KA 3LKRB 4TTDD 4U1KB 3KLDA 4Y2OA 2ZKHH 2RBLA 1AD0B 5EZLA 5F3HB 2X1PA 1YUHB 4PJCA 3SY0B 1G7LB 3LCYA 3T0EB 2W9DH 4ZSOE 1X4XA 4EDWH 5C0IA 4YC2C 5T3ZL 3GSXB 4GXVH 4AM0A 4F57L 3STLB 1QSED 3TVMC 4QRSA 2W9LA 1YNKH 2EDYA 1LO3H 4NQSB 3T0XA 5F1IB 3BPNB 2OJZL 3X3GL 2PR4H 4G9DB 4NKOA 5DT1L 3P4MA 5JQ6L 4ZTPL 5SWZD 4AYFA 1FDLL 5GGUA 2I24N 4Y5VB 4E41D 2MQCA 3SHSA 4XMPL 4EUPG 3SE9L 1EK3A 1IEAA 5E94A 3OR7B 5D2LF 2C1PA 4P2RA 4WWKC 5FK9A 4DGYH 2BCKA 1N5YH 4NFBA 3G5YA 3C2AH 5J1AB 2GJ6B 5F1NA 5TQ2H 1RHFA 4XWGL 1PZUB 4LMQI 3LS4H 3FO0H 3BQUD 4QXUH 2VLJB 4XAWH 1PKQE 1I8LA 1A6AA 5HGDA 5E9DB 1KF9B 5I16A 3EO0A 3QP3A 2E9BA 4UILL 4P23B 1UWXK 4BQCA 2ZUXA 3QJHB 1FFPB 2BC4B 4ZS6D 1JGDB 3WHXB 3V6ZB 3O6FA 3LPGA 4XVTL 2F5BL 4KMTH 2YXMA 3O4LA 2ENSA 1IAIH 5D7IE 4LSVH 2ESVE 4K94H 3VFOA 4BZ2H 3RDTB 3CNKA 2CUMA 4LLAA 1MWAL 4XP4H 4GS7C 1IM9B 3RY5A 4TOYL 2KDGA 4EI6B 1IKNC 2I26N 3BP7B 3HKFA 2DBJA 3JBG7 3TV3L 1CGYA 3RWGB 5FOJA 2P43B 1G0DA 4LQ1A 5HDQL 4FQ2L 3P77A 1IM3B 4G42A 4Q9BA 5GS1C 2GT9A 5C09D 4DN3H 1M6OA 1UKTA 2BMKA 5EBLA 1BF2A 1LO0H 3QI9B 4WI3A 2HJFA 4M6ML 1TVBB 1TZHA 3H0TB 3K8KA 5IKCB 4ZOCA 3GUTA 1DUZA 5DHXB 1A6WL 1JMXA 3HUJE 2LV4A 2V9QA 1ZLWH 1Q9LA 4EJ1C 4F7CB 2GSIA 4LLVB 4MYWB 5FCUL 3S5LB 2F58H 2PUQT 1NGPL 5H35A 3GSWA 4LIQL 5FECA 2BOBA 2HMID 2PTUA 5DSCB 2VE6A 3QYCA 2JJTC 4B50A 4D9LL 1VGKA 1IZJA 4NQCA 5D2LA 3SDXF 4ZOAA 5KS9F 2WQRA 3VGAC 3T3ME 3BWUC 2ITDB 1D9KD 1JI1A 5LBSL 3Q5YA 8CGTA 1BD2E 4R2GD 1AC0A 4D9RD 5I15H 3KXFD 4HG4K 4L8CB 4CVUA 1NGWA 5J8OA 1HCVA 2BVUA 2X09A 2UVFA 5D71L 3DURA