2IPTL

Pfa1 fab fragment
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG2a Fab fragment Heavy Chain
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
molecule tags Immune system
total genus 55
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iptL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iptL01
1B4RA 1FFNA 4ZSOA 4QRRA 1XF5A 4JG1H 2CQVA 4Z7UE 3C09B 5IIEA 1KTLB 1WQVT 3TBWB 4Y4FC 5IB2B 3BP4A 4KI1A 4PGZA 4K8RD 5L9DL 1CIUA 2FECI 5A3ID 5IWLA 1UQSB 4NYLA 3IFOB 1CZ8L 4OD1L 1A0QL 3PWJB 4D0BA 1GYAA 4ZFOA 2YHGA 1AH1A 2QQKH 1JUFB 2WAHA 3CMGA 2DOCA 2FHCA 2E5EA 3LB6C 3QUYB 4M61A 4BQ9A 1X5XA 1ZLSL 2FX9H 4RQQB 4JHAH 4F57H 1YA5A 2A6DA 1ZHLA 5I18H 3CU1A 4C58B 4M8VA 1HHHA 3OKLB 1CFBA 4OKDA 1NAMB 1QO3A 5F8RC 3JVGA 4M1CD 5E4IA 2EYSB 3E2HB 4FTVE 2ZWLT 4MS8D 3TV3H 5FCUL 1CS6A 2LQRA 4WI8A 1PLGL 3BAEH 1P7KB 4J1UA 2NX5E 1FNSH 1IKFL 5CIPA 1CGWA 3MFGB 4MSWA 4DKFH 3SCMD 3SGJC 5C8JB 3PWUA 2PTVA 5BO1H 2HTKD 1UM4L 3VFPB 3D25A 3KVQA 5GS2H 4QOKE 4EKXA 2DTML 3HZMB 3HE6D 1XMWA 4ZS6C 3GSQB 4DN4H 4DZBB 3MJ9H 5MHSD 4I2XB 4NWUL 3D69B 4JDTH 1B90A 4P5KA 1CD1B 2ED8A 5GS2D 2FL5B 5CEYA 1KCSL 2VNCA 2BMKB 4FNLH 3U0WL 4HW6A 2ATPA 4P4KC 1SMOA 3AB0C 5HVGB 2EDWA 4LCWB 3VFWB 3IU4L 4E41E 1BREA 4KJQC 3GSRA 4W6WB 1IM9D 1UKQA 1Q1JL 3GB7B 1AIFA 1LK2B 4JHBA 4RRPG 2UYLB 3WNKA 1JRHI 3INUH 4P3DB 1NDMA 4XP9L 1I1AC 4O00A 5ESQB 2B4CL 4YHZL 3BMWA 1FYTD 4MYWB 4XNUH 5BS0B 4ZO9A 3FB8B 1SHMA 1N2RB 1YEDB 1QPXA 2ZG2A 3QUKB 4XP5H 2EZ0C 2EDJA 4RIRA 2YZ1A 3JV6B 2E7CA 5DK2A 3D6GA 3D18A 4WNQB 2J8OA 2B5IC 4HGWA 3VWJA 2DLFL 1WK0A 4XPFL 3SDCB 2YOCA 2XN9E 5EZOL 3GI8L 5KN5A 1PQZB 3O8XC 1SY6H 2G60H 5FECA 1LE5A 1Q9WA 2X4SA 2XTJE 5T5NG 1JPST 3VI4F 4QHUB 4L8CB 1RAMA 3A67L 4PGDB 4OLZH 4DTGH 4X8XA 2LTQB 2H2SD 4ZUWA 4PRPD 5FK9A 2H32B 5T33H 1I7TA 1LO3H 2NY5C 3WMSA 2W0PA 5SWZD 5I71B 3Q1SL 5IBUB 3CVHA 4TSCL 2W38A 1PY9A 3W11D 1IKNA 5B39A 5T3XH 2AEIT 3QJHB 5C0AD 2HFTA 5D71H 43C9A 5TGBB 2E7HA 2Y06H 1HI6A 4RBPH 1JFQH 2VR9A 5GSVA 1AQKL 1NGZB 1HYSD 4YWGL 4WWID 1DDHA 3N1GC 2VDQH 3L3DB 3NTCL 1CFQB 3NABH 2DIJA 3MLWH 1ORSA 4WI6A 4K7PY 3WLWD 1BZQK 1KPRA 3TH4T 5FYJD 1KB5L 1QSEB 4O51B 4FQ1L 2OK0H 3HLAB 4M43H 2OP4H 4U3CA 3QUMA 4NQDE 3U48A 4WW1B 4U6YA 4FABL 3T2NL 3N1PC 5CBEB 3H9SA 3NGBC 1F00I 2NNAB 2HJFB 3HZKA 1DBAL 3H6JA 2AEQH 5DD5L 4LNRB 4MNGE 1S7RB 1T7XA 1MRFL 1B2WH 2X4PA 1HILB 2RIKA 4F7PA 2ARJA 3VE0A 4DCQA 4O2EB 3WCYA 3U36A 1C5CL 2MKWA 4ZTPL 4JB9H 1J0IA 4NUGH 3IJYB 5HYIA 5CD3A 5JXED 3T0EA 1FC2D 2DYPB 2I60L 2OI9B 4AMKL 3AROA 3KJ4C 5HHOA 4JO3L 3DX8B 2ADFL 3OXSB 2ZJSL 3U9PH 1G7LA 2E6QA 2AP2A 2I9TB 4GAYB 4MNQD 4PP2A 3CNKA 1AXSB 1KELH 4S1DD 2J8HA 1K3ZA 1HWHB 3LQZB 4EXKA 3LS5H 4MJIA 1BZ9A 3RBSA 3C6LD 2FZ3B 5J3HD 2FO1A 1IQWL 3GFUA 5T1LB 4QRQA 5I19H 1K8DA 1X7QA 5I73C 2AQ1A 1A6AA 2OX5A 5EU6E 3Q0HA 2M2DA 4XAWL 1BFSA 3VXME 4MMZC 5IB4B 5SX4I 5EORL 5C0CD 2BVUA 2MFNA 4X6DA 3MRNA 4KRPD 1M71A 1OGAB 2R69L 3OMZA 4HC1L 3RL1B 4KJPC 5HI5D 4HWUA 3HCVA 3HI5H 4XXCA 3GSNL 4V1DB 3GSWA 1IEAB 4LCIL 1BLNB 1JK8B 1YN6B 2R56H 5IB1B 2Y6SD 2EC9T 1BBDL 3P0YH 4YC2C 4PRIB 1NCCH 3VFSB 5JPNB 4WV1B 5MEQA 1G7JA 1BX2A 1AFVH 4WWKA 1BFOA 4ONOA 3P30H 2BCKB 4BSVA 1F90H 1CLYL 1FZJB 4LP4A 1WAAF 2E27L 3GRWH 1DR9A 4Y5VC 5EN2A 4POYA 5I30H 4EBQL 3F7VA 3I02A 4EXPX 3C08L 2NY1B 4JDVA 1RIUL 2PO6A 1W72B 2Y1VA 4O02L 4OLYH 4L4VB 3S6CA 3WEXB 3BQUD 2X4RB 4O4YL 1YEJH 2P5WB 2FJGB 4PV9B 5DJAB 1WIOA 2CDFA 3QUYD 4CNIB 4WW2F 1NAMH 3MRIA 4HUWB 1MRCH 4JQIL 3LMJH 4PG2C 3WKNA 1JP5A 2IAMA 3HNSL 2PR4L 4KAQL 1ZT1B 2QR0B 5DF0A 3MRFB 2JJUA 1UWXK 1W0VB 3S3JA 1T1XB 1ZVSA 4DGYL 1BQHA 2ADIA 4L5FL 4ZPVA 2IMMA 4P9HH 3CU7A 2NCMA 1G9NH 4P57B 2FLRT 4HMEA 1YY9C 2G75A 5EOTA 4FXGA 4PYHA 3EOAB 4WIQA 3VJ6B 3M07A 15C8H 3FB7A 1DANT 5JLZA 3ARUA 3ROOB 1VADA 3QHFH 5HVWA 4TPRL 3ULVD 1UH2A 4BUHA 1OAKH 1NCWL 4OFYA 4IMLA 1AGDA 1IQDB 1KPVA 4FFVD 2IQ9L 2Z8WC 5EPMB 4D9QD 1CFSA 1JNJA 5KJRH 3QYCA 4WU7B 5C3LD 4RGMB 1D5IL 2Z92B 3RZCB 4L1HA 1UCBH 3IDYB 4GO6B 2WSKA 2R0KH 1DQDH 1RY7B 3QHTC 1F4XH 5F88A 1JGEB 4K3JL 2X40A 4N0UA 3CIQA 5KSAB 1LK3H 1S9WA 2OJZL 3KPPB 3H8NA 2DQHL 2WP3O 3MOAH 1I9IH 4XP4L 4C83A 1DCLA 1DLHA 4G8GE 3BKYH 1UB5A 1F4WH 4J3VA 4U1MA 3B3IA 3AVEA 3MV9E 2CIKA 1A7QL 1G9ML 1HNGA 3PWVB 3SCMA 4ZO8A 1AQDA 2ED9A 4HXAL 3IS1X 1TMCB 1DSFH 4GRLB 4AEEA 5B4MC 5BS0D 3S96A 3BUYA 1D5MA 1KG0B 3GKWL 3HC4L 2GEEA 1GAFH 3HE6A 5CEZH 3E3QE 5LAXB 4PUBH 2PYFB 3IFNL 1E6OL 1R5IA 5F72S 3OKDA 1JGLH 1P7QA 4G6JL 4HT1L 3SDXB 1JYXA 2FX8L 3SDCD 5KVFH 3MYJB 4HJJH 5CEZD 4HWEL 1HDMA 1TCRA 3OKNA 4YPGB 2CGRH 3MJ9A 3WDIA 1YC8A 1HOCB 1HSAA 3TYGL 3WO4B 3T1WA 1UA6L 1IM9A 3IXAA 3KYNB 4MJ5B 4QEGA 4OZIE 4PJ5E 5FM5O 2VLRE 4PJFE 1MHPL 1RZJH 5ITFB 4U1IA 3P73A 2A9NL 1BQLL 4HDIB 3TH2T 1MFEL 3HZVB 3K80A 5FKPA 4DKEH 4MDIA 4IEFB 3CVIL 2FO4B 3P4NB 1ZA3B 5AZ2L 1NUFA 4N8VB 3C6SA 5SX4H 2X70A 1TFHA 3LEYH 4KI5D 3AXLB 1MY5A 4Z0BL 3RHWF 1VERA 1A1OB 1S7UB 4N8VG 3BEVA 1D5ZA 2RR3A 4QYOB 1OD7A 5ETUB 1FO0A 5HYQA 2R29L 2VDRL 4QNPE 5L8JB 5DJYB 1AD0A 1YEKL 3FHQA 5KANG 4C56E 4FQQA 2R0LL 4Q6IB 3L5WA 2NY2C 3L7FA 1PG7W 2PUQT 3LRSA 1QSED 2WBJA 3MLVH 3QIWC 1LEKA 2WIIB 3TPUB 5KAQG 1H0DB 1KC5L 1N8ZA 3A6OA 5E2JA 5SWZA 5TQ2L 2GK0B 3WHE0 1KTDB 5BRZB 1EHXA 1X5KA 3FTGB 3KPLA 4XTRC 3VRIB 5T1DL 2OTWB 1J0HA 2F53E 3MRQB 4J6RH 4S2SA 3MX0A 1U8OA 1EHLL 2BK8A 4XVJH 5KW9L 4PGBB 4UDTB 5GGSY 4PTTB 4I18C 1RZGA 5C0DA 3MZGB 3KPOB 3KPRB 3NN8B 2R8SH 1S7XA 2Y9RT 3WKML 2LVEA 2DYPD 2J4WL 4GKSB 4GXVL 5D1ZA 1I8MB 2ZUXA 1OQOA 5JW4Q 3RY4A 1FYTE 5C08B 4HWZB 5D2NE 3KLHD 1TVBB 4CVWA 3ZKNC 1N4XH 1ITCA 1YQVH 1ZWIA 2P8PB 4GG6F 4HQQH 3MODH 5IB5A 3JWDC 1IM3B 1KN4H 3T65A 4JQXC 4XGZB 2HRPH 1JBJA 2IPKB 2QQQA 2DQFA 5T1LD 3D85B 3DV6B 5KANI 5ENWA 2C3VA 2F8XC 1I7RB 1MPAL 2B0SH 2BNUB 2AW2A 5T3ZH 3C8KB 3QNYA 5DRXB 3C2AL 1A4JA 1UENA 2BX5A 2NXYC 3EYVB 4Z7OF 5D7SL 5FGCE 1GH7A 3BGAA 2NZIA 1OGAD 3OSKA 3PWPB 5DGQA 2YMXH 4X6CA 2CLVA 4V1DD 5T3ZD 1V3MA 3FMGL 4XMKL 4GMTL 4UT6L 3IDMB 1CR9H 2A1WH 4H88L 3QZWG 4MNQA 3WNOA 5LGHH 1OGTA 4PRID 5CWSB 3KHQA 2IQAA 1FSKB 3U0PB 3UTPD 1XCTB 1W72H 3FT4A 1SJHB 1NCDH 1D6VL 2DBJA 4RNRA 1U41A 3C6LA 2AJSH 2DF3A 3MR9A 3MLUH 3GMNA 3OGCB 4MQ7A 5T3XE 1S5IL 4UILL 4LGRB 4KK9D 2B7DT 3OJMB 3M1BA 2R4RL 1KYOJ 4NT6A 4PJXE 1NDGA 2EDYA 5KG9A 2C1PB 5GS0L 3AS1A 2NY1D 3V5KB 4TVPL 2A0LD 4TSAH 1KGCD 4L4TE 5EU5A 3RWCB 4E42A 4L4VD 1KIPA 2FX7L 1A7NL 5C0CA 3IYLW 5E2TL 1SBBA 2J5LC 4LSSL 2P5WD 2DQUH 3KYMB 5C0JA 1ZGLB 5F6IB 4OCYL 4NO0B 1A6UL 2DTSA 2A6IB 1C08A 4PIRF 3FL7A 2X42A 4XCYA 5AZEL 5GIRB 1TCMA 1U92A 1GL4B 1FLRH 1KCVL 2QQLL 1C8PA 1WBXA 4BZ2H 5HHQB 3EYFB 3HC3L 3HUJA 5DZNA 1IGJA 4IRSB 5F70A 3RGVA 4IRJC 3RP1A 2X6MA 5E8DH 4XCNB 1KTLA 4X4ME 4PJCE 3TBWA 2V5TA 4XCFH 3L6FB 5HHME 1MCBA 1OOAA 3TT3L 4X0KB 5FM5M 1UQSA 3VA2C 3IFOA 4CBPA 4KK5D 2XZQH 2VXTH 5C0BA 1G7HA 5GRYA 2W60B 3QG7L 1KLGB 1UVQB 3PWJA 2E8YA 1YEEL 2LVCA 3ZE0F 3MRGB 1JUFA 3O81A 1TJGL 1CQKA 3RDTB 3U79A 5CGYC 3QUYA 4BYHA 1EK3A 4IRZL 2GY7B 3SGDH 1FE8H 2QLVB 4ETQB 3RZCD 3SO3B 1LE9A 1N0LA 3VD7A 4WEUD 3OKLA 1IGFH 2IG2L 4M7ZB 4Y5XA 3UTZB 3WNLA 5KSAD 3RVUD 1N7ML 1G9EA 5I1AB 2EYSA 5FYLH 2I5YH 4MAUH 1YPZE 3MGTB 5C7XH 5CINL 1MWAB 4YE4L 4JFEA 1IC5L 4XPBL 2EDTA 4I0PA 5FHAH 1P7KA 4C55A 2NXZB 4ZAKC 4NM8L 4O2FB 3RWEA 4P49A 4EDWL 5C8JA 5CZXD 2UZIH 1MAML 2BRRL 3BT2H 5HI4C 1UT9A 5HYSG 1AGBB 4GRLD 5FYLD 4N1HB 3VFPA 4CMHB 2B1HL 3TFKC 3HZMA 5TQ0L 3BPNB 2VDNH 3BH8B 4Q0XH 5I9QC 3TJHD 1CK0L 3MXWH 4I2XA 3VW3L 1DP0A 1I8IA 3D69A 4B50A 3TZVB 3NA4A 4NZTH 1SBSH 2EC8A 3CFBB 3WN5C 3N1FC 3RPIB 2BMKA 4LSPL 5DLML 3MLTB 3WLBB 4LCWA 3VFWA 1NGQL 2ED7A 1JF1B 3DRQA 5EO1B 4HCRH 2A77H 4NCDA 3V0AC 3GB7A 5JW3H 1LK2A 1MFCH 2UYLA 4QXTB 2H2PD 5I1IH 1MNUL 1UYWH 1DBBL 2AI0H 5D8JL 4YNYB 1VGKB 1RU9H 5ESQA 3RAJL 2KBGA 4NKQB 4HJ0D 3GMLA 3REVB 5BS0A 4OGXL 2ZUVA 4Q9CA 3V0VB 3FB8A 1QACA 1N2RA 1YEDA 3MRJB 3MV8E 3QUKA 1YMMB 1CD0A 1IE5A 4KKNA 4WNQA 4ZUVB 5C1MB 3PF2A 5DJCB 4DGIL 1ERNA 2Y7QB 3SDCA 1HK6A 5HJ3B 3WIHA 1PQZA 2HP4A 4FP8L 3OX8B 3QIUA 2VC2H 2VQUA 1GJIA 5D70L 4QHUA 4PGDA 1PAMA 5E00B 2L0DA 4NHCL 1OCWH 4PLJD 1G0YR 4K94C 4HUVB 2J6EH 4F7EB 2H32A 4PJAB 5FYJU 1I8LA 3BJLA 1INEL 3VG9B 4D9QE 3PUCA 4J3TA 4WU5B 1DLFL 3W0WB 5BRZD 1RIVL 3MUZ1 2O5YH 4LFHG 5ALBH 3S35L 5EFIB 4XPAL 3RUGE 4BFEA 1G1CA 4X9GA 4WY7L 2VXUH 3AY4A 1OARL 1NGZA 2GCYB 4DOHE 1QSZA 1FRGH 3OL2A 4QHLB 4FQCH 1FGVH 3JTTB 4XNMA 1J9CT 1KJ2B 1R5VB 1CFQA 4KC3B 4KKLC 4EUPB 4R6UA 2VUYA 2JF1A 1U2HA 4Z7VA 1FFRA 5C08D 4X6DF 4YEFA 4XWOC 3ZKXC 3P4LA 5CAYB 3C2SA 3MLZH 3K1KC 4O51A 3OBAA 4NO3B 3HLAA 7FABH 1GHFH 3EDFA 1T7WA 5CBEA 2VAAA 1MCRA 4MDJB 2NNAA 2HJFA 3D85D 3GMRB 4WGWB 4JO4H 4TULH 1CLZL 4JG0L 4LPCA 5CEZE 5D93C 4LNRA 1S7RA 1KCUH 3GHEL 2Q87A 1B6UA 3SE3C 3CLFL 1T83C 1HILA 4GSDL 2YXFA 3JWNC 4O2EA 3LQAC 4EIZC 1KCRH 4BQCA 3Q6FB 5CMAB 3PWPD 3T2PA 2JLLA 3QNZB 2EKJA 1J10A 4LLVA 4OZGB 1TENA 3OXSA 1KENL 3QI9B 2I9TA 2BHUA 4NN6C 4OCXH 3LEXB 4L8BB 4I4WB 2FGWH 1W0YT 4KI5E 3LQZA 4GAGL 4MCZB 4JY6B 1A7RH 2FZ3A 4OI8A 3HAEH 4MD5B 1YN7B 4YGVA 5TF0A 4TSBH 5F7NC 4QHNB 5JMOC 5IB4A 4N0FB 5CD5D 1QSEE 2XA8H 2CDGB 3ILPB 3LD8B 4FQ2L 3RL1A 3O3UN 1UC6A 5DURB 4LEXH 4JY5L 2PW2B 4V1DA 1IEAA 1YEFL 4NO0D 2WZPD 4PGCA 3UJIL 1BLNA 3BP7A 4RDQF 4FFYL 1JK8A 1YN6A 2YPKA 1CDBA 4YHOH 5I1GH 3THML 4HIXL 4RWHA 3HMXL 3VFSA 3EHBD 3AREB 4WV1A 3EJYD 2H6PB 4ZNEA 1TETH 1RMFH 5C92A 1IC7H 3CFKB 3CXHK 5EOCH 2N4IA 5DRWB 1KUMA 4IRSD 2APBA 1CDIA 1FZJA 3G5YB 2MPAH 5DHVH 3U30C 1W72A 4J4PC 4L4VA 1YEIL 3ZTNH 4O2CB 2Z8VC 5TFSL 4OZHE 4ODXB 3OKKB 3P4OB 5GJSL 2P5WA 1SEQH 2FJGA 2LU3A 3PL6C 4PV9A 5DJAA 2N7AA 3QDAA 3IVKA 3LRHA 5KSVB 2DQEH 2O26U 5L0QC 4CNIA 4X7CC 1QBBA 4JO2L 5IEHA 4TQEH 1ZLWK 4DKDC 1MWAH 2R2CA 4PD4K 3T8XB 1XF3A 3X14A 1ZT1A 3DLQR 4G80B 1QLEL 2QR0A 3MRFA 3VXRB 1P6AB 1PX4A 3B8SA 1OGAE 1W0VA 1AO7B 1T1XA 1FVDB 3CSYB 4UBDC 5F97E 3U9UB 1WIUA 3B5GA 2EDLA 5T3ZE 2NXZD 2HFGH 4P57A 4IOFD 5ADPL 5K9QG 1Z0NA 1RZ8A 3V52H 3EOAA 1U8JA 1BP3B 3VJ6A 4OCWH 4PRIE 3ROOA 5D1QC 2GITB 4NZUL 1T2QH 4XMLH 1MF2L 4BQ8A 4ODUB 5GGTA 5EPMA 5LJYH 4Y19E 2D7MA 1KF9B 2HLAB 4JFHE 3ZE2F 1QD0A 1NUNB 4WU7A 2NY5L 2Z92A 4N0YL 4X7TB 3TZVD 5D7IA 2AABL 4U1JB 4ZD3L 3SDYH 1CL7I 5EZLB 4XZUB 3SKUD 3F65A 1JGEA 3VMOA 4X9HA 1EJ6A 3T3ME 5INDB 1YEGL 4ELKA 2K7QA 4PJ7A 1VGEH 2R4SH 4FQLL 4MHHG 1EPFA 3MBEA 5JIIA 4WCYL 4CMMB 3QSKB 1HZHH 2FLBT 2HH0L 1RZKL 4NBXB 1A3RH 3PWVA 1L7IL 1Y6MR 4Z7WB 1GIGH 2R9HC 3M8OL 4GRLA 1YYLH 2VDLH 4TUOB 2BP3A 1VB9A 2J7LA 5LAXA 1YMMD 2F74B 2PYFA 5L7XL 4D94A 3SDXA 4W81A 3JV5A 3MYJA 5CJBA 5KBNC 2E7LC 5J1AB 4WDIB 5K9QI 4PJ9B 2MNUA 3QXAB 2AXFB 4OQTL 4YPGA 3C60C 1CZ8H 5HGHB 1HOCA 5HDQL 4NZJA 4OD1H 5A16B 4FFWC 3KYNA 4XVUD 5DMGC 2YD2A 2FBOJ 3WHE1 5ABDE 1QSFE 3BZ4B 2XI9A 4YBLC 5FA3B 4HDIA 3HZVA 3W0WD 2BNRE 2J8UE 3OGOE 3W82A 2FO4A 4HCRA 5IROC 4EUPH 1Y18B 2W65B 4N8VA 4N5EC 4P23C 1CICC 4RA0C 1IARB 4X7EC 1A1OA 3HI1B 4EDXB 1S7UA 1X4ZA 5FYKD 1TJIL 1X5YA 4AEFA 5K9KB 5FCUH 4QYOA 1IAIH 2Z91A 4LASL 1PLGH 4DUXA 3I50L 5ETUA 1IKFH 2EEDA 5I1DB 5DJYA 5DR5L 1MCOL 1NMAL 5FYLE 5C9JB 4Q6IA 3VG0L 4OBSA 1PKQB 2WIIA 3TPUA 3MCLL 4X6CF 3NZHL 1S7SA 1H0DA 3EYUL 3GK8H 3CFDA 2GK0A 1KTDA 5BRZA 3FTGA 4IIQC 3VRIA 4I77H 2OTWA 4NWUH 3QHZL 1KEML 3MRQA 3V2AR 2D3VA 1F11B 4OLVL 2AEPH 4HMDA 3VXSB 4KDTC 1KCSH 4LCYB 4YAQB 3U0WH 3O2WL 4Z76B 1FZKB 4HWNA 2D9QB 1NLBL 4PGBA 4HG4J 2K3TA 4PTTA 2YK1L 5AG8A 4DK3A 2X5PA 4MQXD 3IU4H 3KPOA 2OMNA 3KPRA 3QPXL 4L8DB 3NN8A 4MAYB 2Z31C 4GKSA 2HKHL 2QL1A 1LO2H 1I8MA 1WC7B 2W07A 4XP9H 2B4CH 3H3PH 4HWZA 5CILL 3QI9D 3EDKA 5DO2D 4EN3C 5JUEH 2P8PA 3MXVL 4N9OB 1T0MB 4K3EL 4LU5L 5LXGL 5DQDH 1J86A 1IM3A 2OR8A 4X99A 4Y2DB 1KFAH 3QDHA 3IS0X 4XGZA 5C09E 4BUGA 2JCCB 5KS9B 2IPKA 1UKSA 5F21B 3D85A 3DV6A 4XPFH 1D9KB 5EZOH 1H5BC 2YZ8A 1I7RA 3MGOB 3WJLC 4Q97A 2BNUA 4ERSL 1EJOH 3C8KA 3TN0D 4M3JA 5DRXA 3BO8B 1R24B 3K46A 3A67H 1Q9KB 4NKMB 3H7LA 3G08B 3EYVA 3VGBA 1AY1L 3HB3C 2Z4QB 1GZPB 3ZDYE 1U36A 3PWPA 1HKLL 5DURD 4NJ9L 3ZYOA 3V7AG 3FQWB 5J6HB 4FZEL 3Q1SH 1LO4L 3QEHB 4TSCH 4CADB 1J8HB 3IDMA 2DD8H 1RFDH 4HSQA 2JJTA 5CWSA 4MXQD 3ARED 3U0PA 4RGNE 2OSLA 1XCTA 3ZE1F 1SJHA 4R2GB 1AQKH 4Y16B 4YWGH 3HE7C 3OGCA 1DQJB 4PJ8C 3NTCH 5ADOH 1HYRC 3C5ZB 2C1PA 2DN7A 5D2LB 3V6OA 5F6HI 1CXIA 2NY6C 1CL7L 3RWCA 1OTSC 3LKNB 5C08E 2OJEB 4YBHA 5EZJB 4OLUL 1EDQA 1KB5H 4ZUUB 1GSMA 5B3JF 3KYMA 2NTSP 1JI1A 1NGYB 4FQ1H 1TNNA 2EYRB 3CLEL 4OGYH 4ELMB 4LVEA 2W9DL 4OD2B 4JGUA 4NO0A 3IJHB 4OGAC 4FABH 4OLXL 3T2NH 1IZKA 5J11C 3PP3H 2A6IA 5FV2A 4ODWB 5GIRA 1DQTA 3ULVF 4KDWA 2CIIB 1DBAH 3UZVB 3K3QA 5HHQA 3MOQA 1MCJA 2FB4H 2EKSB 2AJ3A 5DD5H 2VJXA 5D1XC 4Z6AT 4JFDB 1MRFH 4NKIL 1E4XL 2ICEB 4IRSA 1IZJA 2Z9TA 1AO7D 5DJ6B 4XCNA 3ARWA 4XRCB 1C5CH 3L6FA 3SBWC 1BGXL 2WWKO 4U2ZA 1E27B 1IMHC 4QRPA 5ID1B 1OT2A 5K9JH 4X0KA 2I60H 4XBEL 4AMKH 4JO3H 5MEOB 4HH8A 3X3FL 3SE8L 3O2DL 2ADFH 2W60A 2ZJSH 3FKUS 3DETC 4FXKB 1KLGA 1UVQA 4MA3B 4XI5D 3MRGA 1PSKH 4OUUA 3RDTA 5JW4N 3QCTL 4TTDD 4PJHB 1BFVL 4U1HB 4UU9A 1RJLB 2JJSC 1NQBA 5D7KD 4YXKL 3PQYE 3STZB 4WW2C 5F8QC 1ZVHA 4XAWH 3RI5K 1T89A 3UTZA 4N9GA 5T5NF 5I1AA 3MGTA 4YEEA 1MWAA 1IGTB 4HC1H 2R69H 4CGTA 5HYSA 1BQSA 4XHJC 1Z9MA 1WT5A 4LCIH 4M6ML 1QSVA 3LDBC 5I17A 1AHWB 4P5TA 1QEWA 1AGBA 3MUGB 4Z77A 2YD6A 3OAUL 1A9BA 3BH8A 3EO1B 1M05B 3BKMH 4NRXA 1CLYH 4KMLB 4ZFGL 2B2XL 2EDDA 2E27H 4EBQH 3CFBA 2CR3A 4PJ9D 3RPIA 3GMQB 4LSVL 3C08H 4KHTL 3MLTA 3WLBA 4O02H 1RK0B 1I9EA 5E1HB 1A5FH 1UM5L 4LSRL 4KGJA 25C8L 1P7HL 5F93C 1MCPH 1QBML 4QXTA 4YK4B 3A6CL 4Z7VF 4YNYA 1VGKA 4XNXL 3UTTB 5I75C 4JQIH 5L6YL 5HYJB 1VACB 2MCG1 3Q6GL 1E6JH 3REVA 5M94B 2X89D 4HKJB 3V0VA 3VXTB 2CLZB 3HNSH 2PR4H 2WM0A 3ARDA 4JFQA 3WIFB 1YMMA 4NJAL 3BUTA 4KAQH 4QRTB 5I15H 4NC0B 3MOBL 2YSSB 1P5UA 3DVFA 1O7SA 5FAAA 3V79C 3JWDL 5DJCA 3UBXB 2CRYA 1J1XL 4YDKL 2Y7QA 4DGYH 4NUJB 1MFDL 3BJ91 3OX8A 3VI3E 3UYRH 1ADQA 2Z8RA 3VRJB 1G6RB 5SV3A 1CGXA 5D5ME 5E00A 3TEUA 3VGAB 4F2MB 4TPRH 1NCWH 4F7EA 3O9WA 5JXAL 5FGSA 4WU5A 1DBJH 3W0WA 5EOCJ 1RULL 5I74C 1FVCA 2OL3B 3GMOB 3AS0A 5B8CC 4YIQB 2XXMB 3WS6A 4KZEL 3VXSD 4KKAC 4OLEA 3QRGL 5DSCB 1VA9A 4K3JH 1PEWA 1Z9OA 3FOMB 1MH5B 2F8OA 3U7YH 4QHLA 2WLYA 3JTTA 4XP4H 1K8IB 1KJ2A 1R5VA 5F9OL 1NFKA 3UYOD 3HFML 5F7LB 4LLDA 1G9MH 4LPVA 5GJTH 4P2OB 4M5ZL 2PXYB 4HXAH 1S78C 5F96L 5HSFA 4PJGB 2ZOKB 3WHXB 4NO3A 4OI9A 5JPMB 3GKWH 3HC4H 5D6DA 1J5OH 4Y2DD 3VGEA 4KTEL 1NPUA 2YUWA 5EIIB 4F9LC 1DUYB 4MDJA 3IFNH 1E6OH 2V2TB 3GMRA 5F3BB 4G6JH 2EIBA 2FX8H 1D9KD 2JELL 3QA3B 4Q9BA 3FCTB 4HWEH 5EBLB 3RU8L 4PJBB 3G6JE 3TYGH 3UYPA 4PP1C 1UA6H 4PJAE 1ZA6B 2VZ1A 3Q6FA 2L4OA 3MRCA 5CMAA 1RUPL 1ODAA 1T21A 1NMCB 1MHPH 4HIJB 2A9NH 1Z0MA 1BQLH 4OZGA 1CE1L 1J8HD 5F9JB 3QI9A 5MENB 3IAGC 3CVIH 4L8BA 3ME0A 5AZ2H 2X1PA 2X1WL 4R2GD 4QXWA 4MCZA 4JY6A 1P4IH 1RK1B 2C1OB 3KG5A 4FQPA 4MD5A 1YN7A 3R0NA 1NCBL 3C5ZD 1FG2B 4NQCB 4QHNA 2R29H 2VDRH 1JE6A 1YEKH 4N0FA 2FBJL 1UZ8A 2R0LH 2CDGA 1T22B 1BPVA 1QBAA 4LAQH 4P2QD 4Z78A 5FM8A 2PW2A 4P46B 3QAZB 4FXLA 2FEDD 4AENB 3C8DA 1CVRA 3O4LE 1XGYL 3RVWC 2BNQB 4UB0L 5T1DH 3DGCR 5IWLC 2HMIC 3VH8B 4POZD 3AREA 3EYQC 4L1DA 2BHYA 2H6PA 4JFDD 2AERT 3GSOB 3CFKA 5DD3L 2HT2D 3D0LA 5DRWA 2JIXB 3S4SG 3TA3A 1MQ8A 3G5YA 3IFLL 1EFXD 1XF4B 1EZVX 5D7IF 3MV11 1FBIL 5GHWL 1HN1A 4ORZC 2VZSA 1LHZA 4HUMB 2J4WH 3ZTJG 4GXVH 4PBXA 4PJ7F 5HDBF 4LAJH 3ESVF 2Z93B 5DT1L 5JW4M 4ODXA 3OKKA 1FG9C 3P4OA 1MI5B 3BEWB 1RZFL 3JVGC 1OLZA 1Y6KR 4DW2L 1RJZB 2VZOA 5KVGL 1F02I 1U3HA 1KCKA 4XC3L 4I13B 3ZE2E 3T8XA 1NKOA 1MPAH 4QTHB 4G80A 4I5BA 2CK0L 4OI7A 5M7QA 3C2AH 3CK0L 3VXRA 5IJVB 4HKZB 2H1PL 3REWB 2VR4A 1AO7A 1FVDA 3EYOB 5D7SH 5C0NC 1CDGA 1TLKA 3P40A 4AEIL 3KJ6L 3WS3B 2VLKE 3EJZC 3P9LB 5JHDB 4XMKH 4LMQI 4GMTH 4UT6H 4K9EC 1H8OA 1OTTD 2DI9A 2V5YA 4H88H 2WUBL 4WFED 4KROC 1U95A 1QFUL 3BN9D 4PLNC 4ODUA 3W5MA 4K71C 5IB3B 3OAYH 5K59E 4R90H 5CHNA 1DQQB 3KLAA 4Y4KB 3RWIB 2WBKA 2P5EB 1D6VH 4K94L 4CDHA 4N8CL 3U83A 1ZHBB 1S5IH 4UILH 3L5XL 1U8LB 2R4RH 2EDXA 1E28B 4U3XA 5EZLA 2ADGB 4XZUA 1S5HB 2UZYB 4KKBC 5E5RB 4X83A 5INDA 2FX7H 3LS4L 2CH8A 4KJWC 2C7UB 4JLRA 5E2TH 5F71A 4LSSH 4LRNL 2NY7H 5H37H 3VWJC 4OCYH 1A6UH 3UTTD 3VCLB 4K3HA 2J2ZA 4LIQH 4X5WB 1G7MB 5AZEH 4Z7WA 5J57B 2A9ML 5HYJD 2YPLB 4X7DC 2GJ6E 1KCVH 4TUOA 2UVFA 3HC3H 2F74A 1G6RH 3KPQB 5KVDH 2QADC 3O6FA 2RCSH 2L7UA 4FG6C 3A6BL 4PJEB 5J1AA 1A1MB 4PJ9A 4NNPH 4AL8L 3TIDB 1P84J 3QXAA 1IKNC 2AXFA 3S36L 3WFHB 3TT3H 1XT5A 2AKRB 3IKCB 1IRAY 5HGHA 5F1KC 3BZDA 5A16A 3QG7H 2P44B 1UZ6E 3ORJA 4KK6D 3RNKB 1KEGL 1TJGH 3LQAL 3BZ4A 1U8PB 2EE6A 4NN7C 3SDAB 4PGEB 3CDCA 2DL2A 1H3TA 2VXQL 3P3YA 2X2YA 4APQA 5CZKA 1FNGB 3SE9L 5KTEL 3B2VH 4WHTB 3RVTD 1Y18A 3AB0B 1T1WB 2W65A 3QEQB 4LCUB 5GGRY 2A83B 4R4ND 5D7LB 2RAMA 3JXAA 5HD8D 3OAZH 4MQSB 4PJIB 3RWFB 3HI1A 4EDXA 3TP4A 2H26A 5K9KA 1D5BB 1IC5H 4XPBH 1WICA 4M1DL 1I1AB 5I1DA 1T0NA 1FDLL 3F8UB 3WIIL 5T5FH 4P2OD 2PXYD 4XX1E 4EDWH 1HNFA 1MAMH 2BRRH 1PKQA 1T4KB 4G9FE 1X5LA 4X8JB 5T1MB 2B1HH 5CJ8A 2F5BL 1AR1C 5TQ0H 1HINH 1NUDA 3KR3L 2F54B 1TJHL 3U4BL 5IHBA 1GZQA 5FO8B 1XEDA 3TCXA 1CK0H 3VW3H 2QSVA 1F4AA 3ALPA 4F37F 1F11A 3VXSA 4F7CB 2ZKHL 4LCYA 4YAQA 4Z76A 4JRXA 2CXGA 2BRQA 5L2KB 1NGQH 4XC1L 4HULB 3ARBA 3WNPA 4L8DA 4O9HL 3BPOC 4MAYA 2OZ4L 1FJ1B 3CX5K 3CPLB 1MNUH 3V6FB 1DBBH 5D8JH 5HPOA 1I75A 1WC7A 3RAJH 2Q8AL 4OF5A 3TPKA 3L1OL 5MEND 4LVOB 4WENB 4EOWL 1T0MA 4F7MB 4OGXH 2HTLD 5EOQH 4U6VL 3IAPA 4K7FB 4KXZI 4RAHA 5KS9A 2JCCA 5BQ7B 4K3DL 3H9ZA 4XXCC 1V3JA 2YWYA 3TBTB 4DGIH 5FM4A 1D9KA 4GBXB 4A2LA 3ZHKA 3MGOA 4NQCD 3BO8A 1R24A 4NKMA 1Q9KA 3G08A 4KQ3L 2ADJB 2VYRE 4NHCH 3TYFB 2ITDB 5EH1A 3VDAA 4CW1B 1GZPA 4WWKC 4YQXH 1MREH 4HIHB 1FQ9C 1NEUA 1INEH 2VH5L 3DVGB 5DC4B 4WFHE 4P46D 4M4PA 3FQWA 5B3JE 1DLFH 2EECA 1X44A 3QEHA 3RL2A 4WI5A 4CADA 1ITBB 5IMKB 4K3GA 2PYEB 2PO6C 3S35H 1PZ5B 2FH6A 4N8PA 5E2WL 3NAAH 4R0LB 4Y16A 2HG5B 2JIXD 4GLRH 1DQJA 1JYNA 3SPVB 1F2XK 3T0XA 2Q6WB 1N59B 1SVZA 3C5ZA 5F7WC 5D2LA 5DQ9B 4Z8FL 5IF0B 1MHHA 3NOIA 3LKNA 4Q9QH 2OJEA 5EZJA 5IQ7L 2IAMC 4WUKL 3B83A 1J18A 4ZUUA 1MI5D 1JIBA 2UWEB 1NGYA 1QHOA 4ELMA 1DBML 3BKCL 5TDNB 3IJHA 3KPSA 1INQB 3MV7B 4PJDB 3FFDA 3G04B 4ODWA 3KXFE 4GW4B 1BVKB 1JHTB 5A3IC 1X5FA 1CLZH 4JG0H 4IDLA 3CDGB 2EKSA 5I6XC 1UWGH 4JFDA 1WFUA 3CLFH 2ICEA 4X5XB 3V0WL 4QXGL 3DOSA 1FNFA 5DJ6A 5IKCB 4X98A 4PPTA 2X4UB 4XRCA 3BD4A 4X6FB 1IAOB 2FEEL 4BJLA 5GS1B 1WZ1L 5ID1A 4R9HA 3R06B 3EW3B 3MRMB 1VHPA 4XNYH 1EBPA 4HXBL 2O5ZL 1QQDB 4YC2B 5JHDD 5MEOA 4J3OC 4UT7L 1DN0B 4FXKA 1KENH 1CFNB 3LN4B 4ZOBA 4MA3A 4LLAA 3WNMA 5DK0B 3MFFA 5SWSE 1RUML 1UGNA 5F6HJ 4GAGH 2P5ED 5TPWH 1NH6A 1XAUA 3FN3A 4U1HA 4PJHA 1K3IA 1Z9LA 4RX4D 4ZOAA 1RJLA 1A3LL 2MQCA 5MEPB 1B9ZA 4LRIA 4HS3B 3SCMC 1AD9B 3STZA 2V7NB 3D3VB 2HTKC 1P6FA 1QTYT 1K4CB 4TRPL 4RMTA 4P2QE 1IGTA 2AJYL 3FFCD 4FQ2H 5E8PB 3LB6D 5KSUB 4UI2A 1JHKL 4HD9A 2DMBA 2O93L 4PBVC 4YJZL 1YEFH 1I3RB 4QF1A 3UJIH 4XVSH 5FO9B 4FFYH 4Z7QE 3LN9A 4KJYA 2YPLD 1AGCB 4JPKL 4HIXH 4HFUL 32C2B 3VDBA 3P9WB 3MUGA 2EDKA 3BGMA 3EFFB 2VWEC 3VFGL 1NBVL 2I9LB 2R1XB 4KVNL 3BIAX 3EO1A 1M05A 2DKMA 4JREC 4J3XA 4JFFB 1CGSL 1CQYA 1FAIH 1T66C 3GMQA 3VGGA 1GGCH 2IGFL 2P8MA 1CFVH 1AGFB 3GIVB 1YEIH 4GXUN 2EDRA 4J23A 4NZDA 4UQ3B 1WV7T 4RFNC 3RI5F 5GJSH 4LP5A 1R3LB 3DSFL 5EUOF 4JAMB 2V2WA 2BOCB 1IGYA 3KPTA 1JTOA 3UTTA 4JO2H 1JVKA 3T3PE 5HYJA 1VACA 1TVDA 3QXTA 1OAYL 1IL1A 1OAUL 1N64L 1YQ2A 4K55A 4HKJA 5E70A 3IDNB 1NCTA 3QEQD 3N06B 3VXTA 2CLZA 5D7LD 3DROB 3WIFA 3AGVA 4XCCL 4QRTA 2WBJC 1GPOL 2H2SC 2YSSA 5IFAL 1QLEH 4Z7UB 5TF1H 1A2YB 4NUJA 5B21A 1PYWB 5GRJL 1I1AD 1IGIL 3DUHA 5ADPH 2YD7A 1G6RA 2FIKB 4P3WA 1MJUL 4Y5YC 3FN9A 2CR6A 5BZWB 4NZUH 4F2MA 1HYSC 1MF2H 2EE2A 2F19L 2MOVA 3GHBH 4XAKD 4Y8DC 1UJ3A 3DSNA 4KV5F 5IR1B 2OL3A 2GY5A 3O8XD 5CSZB 2NY5H 4N0YH 4YIQA 3QWRA 4UTBH 5D1ZC 3WNNA 1K85A 3MZTA 3WLWC 1BMGA 5DSCA 5IM7B 1MH5A 1YEGH 4LHUB 2AV7B 4FTVB 5FOBB 4LEOB 4FQLH 1K8IA 4Q74A 2DJ4A 1WITA 2CKBL 4KMQA 5EBWB 1H3XA 2NX5B 1QFWI 4WCYH 2VRAA 4TVPE 4ESKA 2HH0H 1VENA 3PXJA 5AG9A 4M1GL 4P2OA 5DTFB 1QOKA 1L6ZA 1L7IH 3KAAA 4QOKB 3M8OH 3WHXA 3GBNL 2VKWA 4I48A 3OJ2C 5JPMA 5IHLB 3B8YA 4Z7NF 2QV2A 3DNKA 5I16B 1U91B 5EIIA 3KNBB 1DUYA 5L7XH 1R3IL 3J7HA 4GBXD 3QA3A 3MUJA 4N1EA 2R1YB 3FCTA 3AS3A 4OQTH 1JWMB 2Q1EA 5EBLA 4E41B 2P49B 5HDQH 2E7MA 5MERB 4G8IB 5HPMB 1ZA6A 5E6IB 3C6LC 1QBLL 4HIJA 4P4RB 1SJEB 2YRZA 4WHYG 4UT9L 6FABL 3OXRA 3UXFA 1Q72H 5EIVA 4HGKC 1MAJA 3R8BB 1I1CA 1P2CB 5HGBB 5TDPB 5F9JA 2PYED 5MENA 4G7VL 2Q7YB 3B2UC 1A8JH 3QG6B 3NA9H 4OZFB 5BV7C 1RK1A 2C1OA 5DVNA 1NFDE 5HI5C 5JA9A 5AUMB 2XN9B 4KUCD 3SGEI 1TJIH 3ABZA 4XXDB 1A22B 2DI7A 2XTJB 1FG2A 4LASH 4NQCA 3I50H 2Y6SC 1T04B 2VR5A 4JKPL 1NC4B 3G5VB 1L0QA 3H0TB 1MCOH 3VA6A 2CK2A 4PJGE 1T22A 2F58L 3VG0H 3W2DL 1QPPA 1JHLL 4OTXL 4AQOA 3MCLH 3S3SA 4XB8A 3NZHH 1WWWX 3RGVC 3C09C 1KT2B 4P46A 3EYUH 1I85A 2YXMA 3MV7D 4AENA 5DQJB 3MREB 2BZDA 2OS7A 1DJSA 3QFDB 5TE4L 3ZKMD 2ILLA 2BNQA 4BK5A 4X4XB 1A4KB 1WZLA 2X44D 1KEMH 4KQ4L 3SKOB 3VH8A 4N1CA 1YY8B 3UC0H 5SX5H 4KZDH 3OZ9L 4OLVH 2JTDA 5B3NA 3O11B 3O2WH 3ALWA 3MCG1 3GSOA 4PJBE 4WUUA 2NXYB 1NLBH 2JIXA 4NKOB 4MNHB 2ICES 5K33A 5C07E 2LV4A 3PDDA 1XF4A 4KJPD 4R4FL 4X6BB 5DDHB 5I1KL 1OSZB 3GBMH 3EOTL 3QUYC 4R8WL 2FR4B 2DBLL 2DLEA 4QRUB 5CS7A 1J12A 4OJFL 1A9EB 1MJJB 2HKHH 3DTXA 4LKCB 1EXUB 2Z93A 4RWYH 5BOZG 2FJHB 5HTSA 5CILH 1MI5A 4Y5XC 3MXVH 3BEWA 2W9EL 4W6YB 4LU5H 4LLMA 5LXGH 4R26L 3E2HC 2BERA 4YHKL 1OAQL 1RJZA 1EZVY 3CC5A 4I0PC 1QLRB 1T20B 2CRZA 1INDL 5B38B 1HCVA 4MNGB 4HWBA 1YDPB 3V4VL 4ERSH 3D3VD 4QTHA 1BBJA 3JV0A 5DMJB 3ULVC 5B38G 1QRNB 1UXSB 5IJVA 2HT4D 5HHNA 4FFVC 4HKZA 3REWA 2G5BB 5DYOB 1QR1A 1ZS8B 3EYOA 5IK3B 2P42B 3WUWB 2J3SA 4WFGD 1I1FB 1MCCA 3F62A 3QUZB 1OT1A 4FZEH 3B9EA 1LO4H 3P9LA 5JHDA 5IQ9B 3VFNB 4OCRL 3RWDB 3LV3B 5IB3A 1MEXL 3HPJB 4IS6B 4NC1E 4ONHB 1Q9LB 4Y4KA 5J9PB 3RWIA 4OCMC 4WEBH 4C54A 4JRYE 1ZHBA 4RX4A 4JFFD 5GRWA 2ZCHL 1I9JL 1U8LA 4S11A 5EU6B 3T77A 3DMMA 2DICA 4GXUM 4R96A 4JFYB 1S5HA 1XFPA 4BSWB 3VXMB 1GOHA 2CD0A 1QLFB 1UM6L 3QQ4B 1ND0B 1BAFL 3G6DL 4OLUH 1S7QA 1R3KB 3FO9B 4JZJA 4XNQB 4A6YA 2KPNA 4N90E 3JBG7 4QGYA 3FONB 2CLRB 3CLEH 3NH7L 2W9DH 4EI6A 1BWMA 4OLXH 3SDCC 1QFWL 4H1LB 3VCLA 2DQJL 2YUVA 4HLZH 4JHZA 4N68A 4U1LA 1G7MA 1JYVA 4AIOA 2YPLA 1ZHNB 3QIUC 2N1KA 1H15B 4YFDB 5JZ7D 3QWOB 2LTQC 1E4XH 3GIZL 3U2SB 1I8LC 4NWTL 2W0KA 2GJJA 3CDFA 2DWEB 4PJEA 4TUJB 4Y1AE 5I71C 1A1MA 3MROB 1BGXH 3SE4A 2AVGA 2VDML 3WFHA 1YNKL 3MRBB 1MUJB 4ALAL 2AKRA 4XBEH 3NIGF 3IKCA 4ZQKB 5B4MD 1EGJA 5FKAA 4X7SL 3SE8H 3O2DH 4P99A 3K74B 4NIKB 3ROLB 2FRGP 2P5EE 5IJKA 3F7YB 3QCTH 3SDAA 4PGEA 1RZ7H 1DUZB 1CIDA 2NW2B 1BFVH 3SGEH 4DZ8B 2EEBA 4GRMB 3U6RB 2DLIA 4WHTA 1LMKA 3QEQA 1KJ3L 1T1WA 4LCUA 5DJXB 2A83A 5D7LA 5E8OB 2JCCF 4Q9RL 2IC2A 5E9DB 4LHUD 4PJIA 1MRDL 4DVRL 3FFCE 1PJ9A 4TNVK 3T09A 5F1NB 2NX5D 3I85A 3IJSB 5CCKL 4NBZB 3GSVA 1WEJL 3QO1B 4D0DB 3DUSB 4HS6B 4YHLL 4LCCA 5C6TL 1T4KA 4QOKD 5T1MA 4MD4B 3U7WL 35C8L 5IMMB 3BRGC 1PY4A 2O5XH 3OAUH 2F54A 1MHEB 5LGJB 5FO8A 3MRLB 4ZFGH 2K7PA 3M17A 2B2XH 3MLYH 3PE9A 4U49A 3S5LB 2OI9C 3MNWB 2ENYA 4JN2A 4H8WC 3GJFK 4F7CA 4LSVH 5HY9B 3CMOH 3BN3B 4KHTH 4LSQL 3PWLB 2YPVL 4JM2B 1JGUL 5E4EB 3LCYA 3S35X 4E41D 3LHPH 5L2KA 4DUVA 4BK4A 6CGTA 4G8GB 4LSRH 5E6ID 3W39B 4JHWH 4EEEA 4ZFOL 1QBMH 3V4UH 1LP9B 1NAKL 1FJ1A 4UIMA 3CPLA 2Y07H 3A6CH 3V6FA 4OZFH 3V5HA 3QBTB 4XPGL 5EZIL 3VFTB 2IBZY 2VKXA 1VFAB 3Q6GH 1PX3A 1RUKH 2XG5A 1J88A 2GQHA 4XP1L 4ELMF 4K7FA 3NMEA 3EZJB 5EO9B 3MNVB 1CDUA 3MOBH 3NIDE 5IT2L 3JWDH 5D9SB 2XN9D 3TBTA 4GBXA 4GKNB 4JDZB 3F5WA 5EBMA 1BQHG 1LO0L 2XTJD 1MFDH 2X4OB 3ZKXB 1NC4D 2OXGA 2X4TB 3ZKND 4WV1C 4GRWH 2ADJA 3TYFA 2ITDA 2KZWA 4RDQG 4CW1A 3WL9B 4OZIB 4PJ5B 2VLRB 4PJFB 5AAWA 2OQJB 5JNYA 5JXAH 4KK9C 4PFEA 4HHAB 2ZP0T 5CLTA 1RULH 4Y88A 1A6ZB 5IMKA 4J3WA 2PYEA 1QFPA 1PZ5A 3NIFE 3IGAB 4KZEH 3LKQB 2WIMA 3BWAB 1IJ9A 3BP5B 5CJXA 1UWEL 4K9EL 4R0LA 1C5BL 1EEZA 1QG3A 3O3EB 3QRGH 2NXYD 3OV6A 2HG5A 4OB5L 3QDJB 2KKQA 1CGTA 4PRNA 3SPVA 3OF6D 4NSKB 4XVTH 1CGYA 2Q6WA 3T2OA 1N59A 2AV1B 4O5LL 5F9OH 2Q3AA 4G8FB 3UJJL 2XKSA 4Z0XB 5DQ9A 5IF0A 4C56B 3ULUL 4NN6B 3RHWK 4M5ZH 3IDXH 5CSBA 5F96H 5C0FB 5DUBB 1AKJB 2UWEA 3UTQB 3CSBA 4ZTOL 3BESR 3VFUB 2W59A 1GOFA 2A6JB 5TDNA 3TF7C 2HVJA 3D39A 1INQA 3MV7A 1XH3B 4PJDA 1ZTXL 4HF5L 3G04A 2F53B 4GW4A 3BW9A 1KIRB 1JHTA 3ZT6A 4K23H 4NNXB 1EIBA 5I8OH 4NOFA 2JELH 2YEZA 3CDGA 4KK5C 5DD1L 2LU7A 4YXLL 3RU8H 1QRND 4X5XA 5E5MB 5IKCA 1OD9A 1KXQE 2FATL 2X4UA 3O3BA 4X6FA 1IAOA 1RSFA 4WI2A 5GS1A 2XQYG 1OP9A 3QDMB 3R06A 3MRMA 5IP4A 4RGMC 2X4NB 3QUZD 1QQDA 3IDYC 4HBCH 2F15A 3I6KA 1CE1H 5D2NB 3CVHL 1BF8A 3OHXB 3LN4A 5FUZL 4MX7A 3RVUC 5DK0A 1OQXA 3DWTA 1RUAL 3LAFA 3O6KH 4ZNCD 3WFCL 4JVWA 3MBEC 1WCQA 1CWVA 2JE8A 1FH5L 5EU6D 5GRUL 4LPTA 1AD9A 1NCBH 5CZXC 3VXMD 4GRLC 3FQXB 4H1LH 1K4CA 1AXTL 2P24B 4B0MM 3L3OA 3SDDA 2FBJH 5FGCB 4BH8B 2VUOA 2AK4B 3RIAF 5E8PA 5CGYD 5KSUA 5L0QB 3WSQL 5J6GB 3JUYA 2B20A 1A14L 2D7TL 3NFPB 3QUML 4MA1B 4OCSL 1I3RA 2QSCL 2DL9A 5FO9A 5EUOE 1XGYH 3V6BR 4UB0H 1AGCA 4M6NL 32C2A 4IBLT 3SKMB 3EFFA 3QB7C 3WO4C 5KZCB 2I9LA 2R1XA 5KSBE 3HRPA 4RFEB 5D6CB 5EU3B 2H3NB 2H2PC 1D6EB 3T0AA 1K6QL 4PJXB 4HPOL 2VTFA 2NY0B 3MA9L 5GHWH 2ZG1A 2E6JA 4L4TB 1FFPB 4G3YH 2XG4A 5D1QB 1AGFA 3ILQC 1QNZL 1WBYB 4RMVA 3S98A 3TFKD 4UQ3A 2BSSB 3OB8A 2ERJC 4HUKB 5GRZA 3UPRB 5GZOD 1WJ3A 2BOCA 1F3RB 4NRZB 1WTLA 2R0ZL 2Z35B 4RMWA 1EMTL 4N0CC 4QY8B 5KVGH 3FJTA 4WHCA 1WGOA 5HHVL 43CAB 3D3VE 4NHUB 4M6OH 1OP3H 1NGXB 3DROA 4YH6A 2LAGB 4PLOB 1QVOA 5GRXG 4Z7UA 4UOJA 5E9DD 3CK0H 3QJFB 2OTUB 1A2YA 2H1PH 4UAOB 5F89B 3HR5B 4WVRA 5HHMB 1PYWA 4M7KL 5ANMB 4AEIH 5KVMC 3U4EA 3KJ6H 1YUHB 2FIKA 1BIHA 3TO4B 5BZWA 1KSRA 2EDQA 2WUBH 4LVNC 1NSNL 3R1GH 1QFUH 4AH2B 1U3ZA 2BXYA 3NPZB 3PDOA 4Z5RB 1UH4A 2DQCL 3ARTA 4K94H 5IR1A 1NBYB 4Z7NE 2AJUL 5CSZA 3L5XH 3BZEB 2CXKA 3C60B 2R15A 4GG8B 5IM7A 4JM2D 2R2BA 4LHUA 3LS4H 4FTVA 4LEOA 3TO2B 2CO6B 2IALA 4G8GD 2V9TA 3PABB 5EBWA 5ID0B 2NX5A 4HS8L 4LRNH 2M1KA 3U1SL 4AEHH 3O6MH 1NKRA 3T4AB 2ID5A 5DTFA 1U6AL 3O41B 2A9MH 4QOKA 2DLHA 5BVPL 1ZVYA 4P2RE 2C5DC 1CD9B 3WUZA 5JQ6L 1MCNA 4L9LB 1A64A 1U91A 3R4DA 1JYWA 3H3KA 4UIKL 1N0XL 1BM3L 4AL8H 2R1YA 1FL6B 3BQUB 3GI9L 5DZOA 3S36H 4GMSL 3EO0A 4E41A 5BXFB 4ZUTB 3MJ6A 5MERA 1ZLVK 4G8IA 4PJ5D 5E6IA 5HPMA 5DWUL 2VLRD 4ZS7L 3K1DA 4Y4HA 1KEGH 1UH3A 2DDQL 1ZANL 4K7PH 3HNTL 3LQAH 1CD8A 1IBGL 1B0RA 4QTIH 1PD6A 1A6TA 5TDPA 5HGBA 3V6OC 4N0RA 4PB0L 3ARFA 1EA9C 3SE9H 3QUXB 5KTEH 3MV8B 2Q7YA 3MQIA 3DIFB 4OZFA 2FSEA 3I3EA 3QDJD 1EERB 3B9VA 5AUMA 4L9DA 3HR6A 5GISH 2XN9A 5F6IC 1UACH 4LBEB 4EI5C 4HAGA 4JHAL 4XXDA 5DD6B 3MMEB 4U1KB 4M1DH 1LEGB 1FDLH 1NC4A 4C56D 3G5VA 2VO5A 4GS7B 2QSQA 3H0TA 4WHDA 1T2XA 1AKJD 5LKNA 4IRSC 3W5NA 3ARQA 5I2IB 5GGSB 1KT2A 3CSGA 1MLBB 5ISZE 3KR3H 5LCVL 3BAEL 3IRPX 1B0GA 3PGFL 1TJHH 3HG1E 5DQJA 1QKZL 4KDVA 5F1OB 5K9OB 3QFDA 5A2FA 5GS3A 1H5BB 1ZHKB 2F53D 2RFXB 4KKCD 1A4KA 4X4XA 5ALCL 4JE4B 4U1NB 3ZDZE 3SKOA 5LGKA 5EU7C 1XGQB 3RUGB 5BO1L 1A7BA 1YY8A 4L8SA 2VLJD 1NEZB 1IVLA 3V6ZA 3O11A 4DOHB 1GCFA 3TC9A 3ULSB 4NKOA 4MNHA 3MJ9L 4X6BA 5DDHA 3RDTC 3OF6A 3EAKA 1OSZA 4BH7B 1NCAL 2FR4A 4PRAB 1U8MB 4O9HH 1TTUA 5ESVB 3QDMD 5C0IB 1A9EA 1E4JA 4FNLL 4NCC1 3SO3C 1EXUA 1E4WH 5HGAB 3GMMB 1ZLUK 2FJHA 2Q8AH 3ISWA 3L1OH 3MGAA 1T89C 4M7ZC 2IH3B 4LK4A 4ODVL 4WGVB 3IXTA 4EOWH 4NQDA 1PKOA 1C7TA 3P11L 4U6VH 3QEUB 4G5ZL 1TPXB 4PJ8B 4K3DH 3T4YB 1KIUA 1QLRA 4NN5B 1T20A 2NXZC 4J7RA 4JZNB 3AFLA 4S0TD 4NNYB 2VL5B 3TBSB 1WT5C 5B38A 2NY6B 3C9NB 3LZFL 4MNGA 2VLMD 1HHJB 4OV6F 4XNUL 1YDPA 4J4PD 4LSTL 5DMYA 1ZV5A 2CDEB 4P5TC 1FO0L 3BSZH 1UXSA 1X5HA 4G6ML 4QRSA 2G5BA 5DYOA 1S8DB 1ZS8A 4KQ3H 5A2IH 3MRDB 4PJEF 4YDIL 5IK3A 2AK4D 4KTYA 1X5AA 3WUWA 5HI3C 2IBBA 1I1FA 2VH5H 1HSBA 3SQOL 3QUZA 2PW1B 4ZUSB 1FIEA 4GRWE 5IQ9A 3VFNA 4F3FB 4HJGB 3PG2A 5IBUG 4OLZL 5JHLL 3UTSE 2HT3D 3LV3A 3OTTA 2V5MA 4ZO7A 1L7TH 3HPJA 4IS6A 1KIQB 4JJHA 5KZCD 5A40E 5J9PA 1F3DH 1RZKC 5T3XD 4YR6B 5H94A 4R7DA 5EU6A 2NY0D 4JFYA 5D71L 4BSWA 4L4TD 2QJDA 3VXMA 3ZTJH 1QLFA 1FAKT 1K2DB 5D1QD 3QQ4A 4PJIF 1Q0YH 4OQ1A 5IQ7H 5BVJB 4UNTA 4WUKH 3FO9A 2C3XA 3ARDC 4U1SB 3BFOA 4XNQA 3NIGE 5FYJL 1J8KA 2IADA 1F3JB 1SQ2N 3S88L 3FONA 2CLRA 1DBMH 3QDGB 4HKXB 4CU6A 1CXKA 3NCMA 4KRMB 3KS0H 3X3GL 1FGNL 1CGUA 2VE6A 1ZHNA 4WW2B 4UV7L 3KPMB 1L9NA 2IH1A 4QHMB 1H15A 4TNWK 5E94B 1QRNE 4OIIL 4KGLA 1R6VA 4M43L 2OP4L 3QWOA 1HEZA 3U2SA 3V0WH 4QXGH 1P9MA 5HYEA 3O9WC 1MAKA 2DWEA 2EXWC 4TUJA 5HHMD 4ETYA 5JDSA 4NQEB 1WZ1H 2FECL 2GTZB 3MRBA 5FDWB 3QNXB 2O5ZH 4KTDL 3L3JB 2EIZB 3WS6C 1B2WL 3JSSA 4ZQKA 3RVXC 2YKLL 4OZHB 1PG7X 4UT7H 3CJJA 3TO4D 5HHXL 1AP2B 1F45A 2DAVA 1XZ0B 2VDKH 3U82B 3ROLA 2G5RA 3I6GB 4JB9L 2IPUG 4D8PB 3F7YA 4G6AD 5L88L 1DUZA 2NW2A 4DZ8A 4GRMA 1A3LH 3SOBH 5JOEA 3U6RA 3PIQA 2BVPB 3C60D 1H9VA 5DJXA 5E8OA 4R3SB 2AS5M 1C5DB 3IRZA 2VZ3A 3F7PC 5DMGD 5D6DC 2AJYH 2CO7B 3H42H 5F1NA 2FH8A 5BV7L 4RISL 1JHKH 2SEBB 3WFEH 4KRLB 3QO1A 4JFPB 4M9OA 4U31A 4D0DA 3DUSA 2ZSVB 3RY6A 5ICXB 4JPKH 4HFUH 4U7KA 4N5ED 5A2LH 1MCLA 2CPCA 4Y19B 3VFGH 3HI5L 1NBVH 3HZYB 5LGJA 4NM4L 1P1ZB 4HAFA 5IVZB 4ZXBC 1QA9B 2XQYK 3S5LA 1OWWA 3SKJL 1CGSH 3MNWA 5E8EB 5DVMA 3BRFA 1XGPB 3LQMA 1NCCL 5HY9A 3VXNB 3PWLA 2IGFH 2H9GB 3KWWB 3QI9C 4JM2A 5DO2C 4D9RD 1MY7A 4M93C 3FOLB 3P30L 1BVZA 5DJ8A 1N6UA 4G8GA 5EWIL 1KYOK 4QCIB 3EBAA 4MB4A 3W39A 5I30L 2NY3C 4F15B 3DSFH 3ZSTA 5CEXB 3MV9A 5I1HL 3DHMA 1JRHL 5IMLA 2BY0A 2GUOB 4TNVF 1D3CA 3O45B 4AIZB 5B8CB 3VFTA 1OAYH 4TVSa 1MCHA 1OAUH 1XIWB 3V95A 1N64H 3L3GB 3QUXD 3MV8D 1MIEH 2DS4A 5IBLC 5EO9A 4PJDF 2K9UA 3LD8C 5E9DE 3BDYL 3MCKB 2X9WA 1JV5B 4ENEC 5D9SA 1JZ8A 1HWGB 4NP4H 1MRCL 3O4OB 4JDZA 2DQTH 4IDJL 1ZMYA 3QPQD 1NGPL 1BOYA 4M00A 5GRJH 2X4OA 1IGIH 4GW5B 2JB6B 4F8QA 2X4TA 3AREC 4I3RH 1MJUH 1OY3B 5JIPA 3WL9A 4OZIA 4PJ5A 5JDJA 3ULVL 1A1NB 2VLRA 4PJFA 3TA3C 1QSFB 2F19H 4HHAA 2BNRB 3CSPA 4PRHE 3WFDH 8FABB 1LEIA 2J8UB 5I1JH 4Q7DA 4YGAB 3IGAA 1U3YA 2H41A 3SE3A 1WFTA 3LKQA 4ZMAT 3BWAA 1FFOA 3NCYP 4RBPK 3Q2CA 3O3EA 1C16B 1MCDA 3LKOA 5C70A 1C7SA 4NSKA 1FV1B 4NO2A 3HS0A 2AV1A 1LP9E 2CKBH 3UJTH 1F4YL 4G8FA 1DQDL 1MVFA 4Z0XA 1FORL 4D3CH 2IPTL 3RTQB 1U3HC 3BKJL 4C56A 4M1GH 2ICWB 1EO8L 4U3HA 3T0DA 3SKNA 2OM5A 4DEPC 2E6PA 3GBNH 4HK3N 3UTQA 2VDPL 4KUZL 2A6JA 3X12B 3RFZC 4JJ5B 1XH3A 1DTUA 4PJ8D 1SYSB 2F53A 3LKSB 1HHGB 3FO1B 1KIRA 4NNXA 5ELIA 4AG4L 1JPFB 2NY6D 3B9AA 1EBAA 3PGDB 4LGSB 3WIHL 4PRBB 1CI5A 2XT1B 5CJ5A 3SJVE 3FB5B 5CBAB 1J87A 3FO0L 4XI5C 3K4AA 5E5MA 1KN2H 1ROWA 3VD4A 5IIEB 4M6AA 1JGLL 2O61B 5KVFL 4TTDC 3MV01 1IEHA 4UT9H 3UMTA 6FABH 4UOW0 1FYTA 2UUDH 2CGRL 5D2NA 5JQHC 3V7MA 3OHXA 5ESAB 4W68A 4LARH 5D1XD 4F33B 1J0JA 4G7VH 4D0BB 4OZ4B 5HVHB 1W0WA 2BFVH 5C09B 5IVXF 3QDJE 3K4DA 4JFOB 1JF6A 3SGDI 3VWKB 4ODHL 2RQ8A 2WQRA 4JPVL 3FT3B 3WXVL 1BIIB 3ES6A 4CDGC 4JM4L 5A43C 5DC0A 1BJ1H 1ETZB 2XIDA 4M7LH 3UPCA 3WV0A 5JMRA 3O3AB 3FQXA 4Z7UF 2P24A 2IEPA 2D2OA 4X7FC 4BH8A 4PRPA 4W4NA 2ICWI 2R2HB 3CFCL 5FUOL 2APWA 1SY6A 3W2DH 4AIXA 2I24N 5DJDB 3RWJB 1GC1C 3O6FC 1KPUB 3QDGD 2DB8A 1QZ1A 3NFPA 4PJ9C 5C0AA 4RSVA 1E4KA 5TE4H 2VLJE 1U8IB 2DM3A 4RGNB 3RPKA 3OZ9H 1NCNA 2GK2A 5GSRA 1J1PH 4LLUB 4RFEA 5D6CA 5GGQL 5EU3A 2DM4A 4Z9KB 2H3NA 3WXWL 1D6EA 4PJXA 5I1KH 4RMRA 3EOTH 3QDME 3ZHDA 4R8WH 3K8KA 3NVQA 5GPRA 4NQED 4L4TA 4XVJL 3ZT7A 1FFPA 1F97A 3AAZB 3GJFH 4OJFH 5CGTA 2HKFL 4APQC 1IGML 2ATPB 3ZDXE 1WBYA 4H8WL 2BSSA 2GHWB 4K71B 4DUWA 2PTUA 1FN4A 3TM6A 3UPRA 1ZE3C 3H9HB 4ORGA 4LHQB 4R26H 1CU4L 3LEVL 4NRZA 5FB8B 1OAQH 4DVBA 4ONFL 3BZFB 3W9EB 5L2JA 1CN4A 1ZKAA 1INDH 2VLME 2WQ8A 4WFFE 43CAA 5E7FA 4NHUA 3QIBB 3MODL 3QFJE 4FHBD 4KY1L 2P1YA 3QJFA 2OTUA 2AK4E 4RIRB 4X4MA 4PJCA 5F89A 4JR9H 3HR5A 3K8LA 3D18B 5JXEA 2GKIA 3IDIB 2N7BA 5AYQA 3VWJB 4AT6B 1JGVH 3MJ8B 4IMKA 4P3CL 1Z9SA 1WFOA 5L8KB 5EA0L 2B0SL 1LE5B 1YUHA 3WDJA 3VXPB 2VQTA 1AR2A 3TO4A 4OCRH 3S36X 4MA7H 4MA8H 4AH2A 4MZ2A 1MEXH 1V05A 2YMXL 4Y19D 4YFLI 5C0GB 3ARBC 4JFHD 5BMFL 3RKDD 2E7LA 1NBYA 2J88L 5D96B 4MAYC 4U1GB 1X5GA 1VEOA 2ZCHH 4FS0A 4PLKC 1I9JH 3PQYB 3BZEA 4K7PX 3VFMB 4LF3B 4XBGB 2GTWB 4GG8A 1PEZA 4WTWA 1HXYB 2BSED 1UM6H 1HI6B 4GQPH 1W72L 5IBTH 3EDEA 3HAEB 1YPZA 1BAFH 1JMZA 2NMSA 3TO2A 1BF2A 1T1YB 2HRLA 3WO3B 3T0WA 3PABA 5ID0A 4LSUH 3HAEG 3NH7H 1XCQB 1OHQA 3VFRB 3T4AA 4OGZA 2DQJH 4X9BA 1QP1A 3O41A 2VSCA 4KKAD 4LSDA 1YC7A 1JTPA 1XIWD 1ZOXA 3B9KB 4AYFA 5J8OA 2IF7A 3OR7B 2DQUL 2COQA 4Y2OA 4L9LA 2XQBL 3GIZH 2ATKB 3MRRB 5IB2A 1NBZB 1KCLA 5ANME 5IESL 3EFDH 1Y0LB 3WD5L 1FL6A 3BQUA 2VDMH 3ARPA 1YNKH 1OVZA 4ALAH 3BH9B 3ALXA 3GRWA 5BXFA 4ZUTA 4X7SH 3VE0B 4DCQB 2XZCL 5DHVB 3ULUF 4Y16C 9CGTA 5BW7A 1TQBB 1QSFD 4ODSL 1I3GH 3DURB 3DXAE 3D48R 4YXHL 5AYUH 3KGRA 3BPLB 5GGTL 4RQQA 4UNVA 3VD9A 2EH7H 2BNRD 1R3HB 5HHOB 2XZQL 4JCMA 3QUXA 3MV8A 3SO5A 1KJ3H 3RVVD 1NAMA 3WYRA 2X1OA 3DIFA 2XWTB 3KLDA 2WK2A 1DBKL 1S9XB 3CXDL 2D9CA 1YJDC 1BZ9B 2OMBA 1MRDH 4DVRH 4LBEA 2JJWA 2FEDC 5DD6A 1CF8L 4U1KA 1LEGA 4U7SA 1SVCP 3RTQD 4NDMB 1AI1L 4ONGL 4L3EE 4AK1A 5D5MB 1WEJH 2YD3A 4YHLH 1VPOL 5C6TH 1FZOB 4MAUL 3U7WH 1LNUB 2HT2C 3GSQA 2VABB 4YBQD 5I2IA 1M71B 1RJYB 4DZBA 1MLBA 3LY6A 4WI3A 3W81A 4IOIB 4V2BA 5F9WB 5K9OA 1CD1A 1ZHKA 2RFXA 1FVEB 2FL5A 4U1NA 1F6LL 3WJLA 1XGQA 3RUGA 2AJXL 1WVZA 1MJ7L 1WFNA 3TVMB 3VDCA 2DWDB 4D9RE 3D2UB 4LSQH 3ULSA 2YPVH 4I3GA 4YUEL 1JGUH 3C87A 4JN1L 3VI4E 4WWKB 4AM0B 4GQ9H 4BH7A 2L7JA 4PRAA 1U8MA 2IPUK 4P3DA 5EN2B 5ESVA 1QRKA 1NAKH 4W4OA 4KVCH 1YEHH 4LRIC 4R97B 5HGAA 3GMMA 4JPWL 4F9PA 2YUZA 2WBWB 1QUNA 5EZIH 3EYQD 3WFBL 2ZPKL 3FN0L 2IH3A 3LOWA 5FUCC 1FNHA 4HCRL 2A77L 4XP1H 3JV6A 3QEUA 4Z95H 5C09D 1UYWL 3VWKD 3T4YA 5IT2H 2CDFB 4NO5B 1J7VR 4JZNA 4NNYA 2VL5A 5ACLA 5BZDB 1HHJA 2NY4C 4L8CA 1LO0H 2CDEA 2MMXA 3I3DA 3QEGL 1OTTC 3V9FA 5CIPH 3G6JB 3BN9C 2ZCLH 1S8DA 3AS2A 3MRDA 1EO7A 5I8KL 2HLFD 1ZVSB 2ZCKL 3ZLQC 2ADIB 3RJDA 2VDOL 2Q8BH 2PW1A 2FHBA 1NBQA 2ITCB 3QJHA 2VC2L 4F3FA 1YZZA 3IDGB 5TGBA 4FXGB 4HJGA 1WWCA 4X80H 1Z6JT 2QBWA 5I6XB 1UADC 2D31B 1OCWL 3FB7B 4RGND 2A6KB 1DFBH 3IETB 1AGDB 1KPVB 4K9EH 1C5BH 3L3DA 4OB5H 4YR6A 1GGUA 4MGXA 4YK4C 3SBWA 1HQRB 3RJQB 3GKZA 4O5LH 3DX7B 4EUPG 1QSEA 3IAQA 3PJSB 4N0UB 5BVJA 1K5NB 1LD9B 3MNZB 4U1SA 4WW1A 1F3JA 4ZTOH 3EUUA 3CH8A 5FEBA 4OF6A 4KRNA 3O4LB 4FZ8H 4HF5H 4DQOL 4XNZC 3SGKC 4HK0B 4WW2A 1ACZA 1FNEB 3KPMA 4PBWD 3AU1B 4LPYA 5GGVY 5E94A 3QIBD 5JTWA 1ZGLP 5DD1H 3VGAC 4KPHL 7FABL 4KJWD 1GHFL 3L3KB 4KK6C 5DEFB 3IJYA 3HNVL 1SJVA 5C0RH 1R5IB 3OKDB 2DYPA 1UJ3C 3VWJD 5C2UB 3H2WA 2GTZA 3QR2A 4JM2F 3DX8A 4HG4K 5FDWA 4J3SA 3TGXA 1KOAA 3FRUB 3PXHA 3L3JA 2EIZA 3S7GA 4GAYA 4ZFFB 2VZTA 1M7DB 4OZHA 3CVHH 4BELD 1AP2A 1AXSA 4R4NC 4ODTL 1KCRL 1XZ0A 3I6GA 2AQ3A 3WFCH 4D8PA 5T1LA 1W8OA 5FKPB 1WAAE 4JO1H 3PQYD 1FH5H 5GRUH 4MDIB 4P2OC 3TN0B 4DFHA 2CSPA 5K93A 1FYHB 4TUKH 1C5DA 1PGRB 1AXTH 5DHYB 1OGAA 2X70B 4OFDA 3K81A 4TNWF 1A7RL 3GZKA 4L3CB 5FHBL 5CZVL 1IAII 4FQJH 3DPBA 3QDGE 1KB9J 3WSQH 5IB1A 2D7TH 2SEBA 2VLKB 3QUMH 4OCSH 4TSBL 5JOPD 4JFPA 2QSCH 1TIUA 1H3GA 4PRIA 2ZSVA 4CN6A 2QHRL 5ICXA 5JPNA 4OZIF 2XA8L 4ZPTB 4M6NH 2VZVA 3B9KD 2BCKA 2W92A 2WBJB 1JPTL 2A2QT 4POUB 4OFVA 1LO5B 4Y19A 3HZYA 1F13A 1FPTH 5J13C 1JZ7A 3A0OA 4BQBA 5IVZA 1NMCC 1QA9A 4G7YL 1M1SA 4RGOH 2X7LB 1K6QH 4YHOL 4HPOH 4NQEE 3MRKB 1XGPA 2D7PA 4BFBD 3MA9H 2APXA 2QTEA 3WEXA 2H9GA 3KWWA 4Y5YB 2X4RA 1HXMB 4H25B 1RMFL 2C26A 3FOLA 2VN7A 4L29B 4NQUA 2HTLC 5EOCL 1QNZH 5DFVD 2WMPA 4QCIA 2ESVE 12E8L 3NBNA 1DEEB 3DJ9A 5EB9A 4HUWA 4QT5B 3MRPB 2GUOA 2R0ZH 3O45A 1EMTH 2F9BT 1KB5B 4JANB 2FD6L 5HHOD 2GJ6B 3ZTNL 2I25N 2W0FB 1UCTA 1XIWA 1BJ1J 2DQDL 3L3GA 4NQXB 5HHVH 2V9QA 1X5IA 1RURL 5J1TC 3T65B 3MJ7B 2MKLC 1IILE 4P46C 1TTGA 4TQEL 1MWAL 1C1EL 2IANE 5ENWB 1CDHA 4R7NB 1NANH 4GW5A 2JB6A 3N9GH 3NFNB 1IQDA 3BWUC 2R1WB 5JIKA 5I1EH 1MQKL 2FWOB 1NSNH 1H3WM 2CJUH 1U8HB 1QSFA 4YPJA 3RZCA 1HQ4B 2BNRA 8FABA 2E9IA 2J8UA 3UP1A 2AJUH 1MIMH 4U33A 3RBGA 1ES0B 1UEYA 3TVMD 5KSAA 3KPPA 2NLJB 2R0WL 3D2UD 4YHYB 1C16A 1JL8A 2DKUA 2V5RA 4WWKD 4CU8A 1FV1A 4WJ5B 3GMNB 3EIFA 3U1SH 4UOW1 3RTQA 3TBVB 4MQTB 2ICWA 5EU5B 1U6AH 3QXUA 4G9FB 1KG0A 1KIPB 1VGEL 2R4SL 5ICYB 2BY3A 1V8HA 3GSNB 5I8CB 2BVEA 5BV7B 5DHXB 5C0JB 4JJ5A 3L7EB 1B0WA 1NFIB 1A3RL 1OW0A 2EE9A 1YYML 4WTZA 1HHGA 1C08B 5IVXE 5INCB 1N0XH 5L9DH 5HDOA 1U92B 4MJ4A 1JPFA 3PGDA 5HBBA 4WI7A 1BM3H 3D9AL 4PRBA 5CJOL 1JN6B 5CBAA 4J3UA 1ADQL 1XR9B 3MSPA 1A0QH 3CAFA 1IGJB 3F7QA 4MJ5A 1S3KL 4PYGA 4NGHL 1BD2E 4PJXF 3NCYS 1MVUB 5ERWB 3RGVB 5ITFA 4Y4KC 2O61A 1U8KB 5DWUH 4F37K 4ZS7H 1VEPA 2DKSA 2DDQH 1ZLSH 1ZANH 3HNTH 3PP4L 1IBGH 4M48L 3DMMC 5E5UB 3P4NA 2NYYD 1ZA3A 5E99L 5ESAA 1A47A 4RMSA 4PB0H 5C0BB 3VGFA 1G7HB 3IFPB 4F33A 1Q0XL 5J4MA 3AXLA 1AC0A 3BVNB 4OFYD 4OZ4A 5C09A 4UTAL 3VXUE 4JFOA 4JZJC 3VWKA 4UINL 4OSUL 2HA1A 3FT3A 1BIIA 1L9MA 3JWOC 1ETZA 3Q5OA 5FYKL 1KJ2L 1LE9B 3CFEB 3S3PA 3O3AA 2CMRL 2HN7B 2P46B 1OP5K 1OTUD 1UM4H 3UZEA 4PJCF 4Y5XB 2DTMH 2R2HA 5IG7B 1WCBB 1NLDL 2P7TB 4GG6E 1MFNA 5DJDA 4JFEB 3RWJA 3OB0K 1KPUA 2X05A 3U0TB 1IAIL 4I0PB 2VERN 5LCVH 2Y4SA 3PGFH 3O4LD 1QKZH 3RWEB 2J6EA 3SE4C 5ALCH 1U8IA 1O0VA 1I1RA 4NFCA 1NUGA 4UDTA 4GAJL 3E8UL 2V2XB 4P59L 3GK8L 4LLUA 3KLSA 1Q1JH 4QRRE 4ZSOE 5TDOB 1B6DA 5IJKC 4Z7OE 4I77L 1I8IB 3SDAC 1P7QD 1NCAH 1J05B 2AEPL 3AAZA 3G9AB 4U4BA 5EC1B 2RB8A 4YHZH 3HC0B 5C08A 4EVNB 1TVBA 3MPCA 3JTSB 1YPZF 3F58L 1NL0L 5GQBA 4ODVH 3DRQB 3H9HA 3HPLB 3P11H 4UZGA 3LPGA 1UJTA 4G5ZH 5FB8A 1XGTB 4P5MB 2DLFH 3VFVB 3KXFB 3BGFC 2ICWJ 1LO2L 3BZFA 1T66D 4LPUA 3GI8H 3W9EA 1ED3B 3H3PL 3HUJF 5I1CL 1QYGL 3GMLB 3LZFH 5JUEL 3QIBA 4LSTH 4LCCC 5DQDL 1FO0H 1CDJA 4JQVA 4XWGL 1KFAL 1UWXH 5GZNC 4G6MH 4YDIH 3BPCB 2ARJQ 3IDIA 4AT6A 1UXWB 3MJ8A 2ZUSA 1S7WB 1YECL 1BJ8A 3SQOH 2NR6D 2VLKD 3AM8A 1PVHA 1EJOL 3QIUB 3VXPA 4LOUD 1A7PL 1BEYL 5JHLH 5SWSB 2BSRB 2WBJD 3ARGB 3MLRL 4M9PA 5C0GA 3L3HB 4GKOA 3B43A 3V5KA 3PQYA 2DD8L 3VFMA 3NCEB 2DMKA 4RAUB 1T03L 1RFDL 4LF3A 4XBGA 2GTWA 4TTGA 1HXYA 5DZLA 4LVOC 1J11A 3FAXA 3HAEA 2XRAL 4P2QB 3UAJC 1ZGLA 1T1YA 5DVLA 5FYJH 2D03L 4XNMB 3VRLF 3ZE0E 3S88H 5ADOL 2YUXA 1XCQA 3VFRA 3ULUE 3UO1L 4GBXC 1IAKB 3PHQB 1GGIL 1HIML 3EOBB 3X3GH 1FGNH 5D1ZD 5DA0B 4FQXB 4HGMA 4Z7VB 5LBSL 2GJ6D 2C4FU 3EYFA 1H3PL 3DVIA 4UV7H 3B9KA 4PY8J 2YC1B 3OR7A 2XTLA 1MCWW 4OIIH 4LKXB 4OGYL 1EFXB 2ATKA 3MRRA 1NBZA 4ZTPH 2OR9L 2VAAB 5D7JB 3RUGF 1Y0LA 2ZSWB 4O58L 3EZ8A 5AAMA 2FB4L 4H26B 4KTDH 2Y5TB 4OM0L 3BH9A 5DRZB 1HHIB 1NC2B 2YKLH 1WZKA 5CJXC 3VU2A 4R0LC 5HHXH 5DHVA 2HFEB 5GGRB 3OWEA 4FMKA 2JK5B 3DURA 4HX1B 3W9DB 1URLA 1IQWH 4ETQA 5K9JL 5L88H 4LLVB 1R3HA 1JF5A 2C3HA 3FZUD 2BC4B 3QH3B 3OJDB 2BDNL 1PSKL 5EORH 2EXYC 2XWTA 5HVFB 1S9XA 3QCUL 1JGDB 1RVFL 3GSNH 3O0RL 4O2FA 4R4BB 3ZKMC 5BV7H 5JOPE 4RISH 4YGVB 1CT8B 1WF5A 4NDMA 5D5MA 4RAVB 1BBDH 2C3WA 2QEJA 3QQNA 4YHNB 3G5XB 4G9FD 5HXMA 4JPIB 1IFHL 1I7ZB 3C5JB 2EEAA 3B2UD 4DGVL 1FZOA 5JIHA 1KNOB 1JWUB 1LNUA 1S9YB 2VABA 1RJYA 2B8OT 2P43B 4IOIA 1DVFB 3H9SE 4NM4H 3TZVA 4PGCB 2NZ9C 4OT1L 1FVEA 3BP7B 5GS1C 1AE6L 1GC1L 2YPKB 3SKJH 1RIUH 4KI5F 2APVA 3TVMA 2VIRB 2DWDA 3ZYIA 3D2UA 1OPGL 1ZEAL 1JF1A 2VB5A 5EO1A 1AGEB 4TN9A 3T1FB 1OAZL 4O4YH 4AM0A 3BKML 3RGVD 5BJTB 5EWIH 3FQRB 1ACYL 5DI8B 3LN5B 4MVBD 2XY2A 5I1HH 3T0EE 2JJVA 1JRHH 5HHOE 3SY0B 1OSPL 2VN4A 2R23B 1X4YA 5C0BD 3MRJA 4NPYB 1A5FL 1WISA 4PG9B 3MBXL 3SDDC 1P69B 2HT4C 4WO4B 3X17A 1MCPL 3E1F1 4ZUVA 3BHBB 4MJIE 5H37G 3IVKB 1MCEA 3BDYH 5HJ3A 4L5FH 4NO5A 1TZGL 1XR8B 5IEHB 4X5LA 5BZDA 4HPYL 3GNML 3UBXG 3MACL 1E6JL 4IDJH 2R2EB 1NGPH 1XF3B 3G6JA 3X14B 4HUVA 5I15L 2WWMC 4FMFA 2HYMA 4PJAA 2ZUTA 4X6DE 2IQ9H 3ULVH 1P84K 1UB6B 4JFED 4WFHD 2R39A 4I0PD 2ITCA 1D5IH 3UYRL 2A38A 4OZHF 5LQBL 5EFIA 3IDGA 2PCPB 1RZ8B 1U8JB 1N5AB 2D31A 4YDLB 4YZFF 5E6ZA 2A6KA 2GCYA 3IETA 3DI2B 2OJZH 1EHNA 1CBVL 2DQHH 2W9LA 3RZWA 1NFDB 2ARWA 2DI8A 1DBJL 3VXQB 4HBQA 2OTPA 4U0RB 2Y72A 2WUCL 3I3BA 4F80A 1HQRA 4EUPA 5FO7B 4Q2ZB 1A7QH 1F4YH 5D7IB 3DX7A 1FORH 1MCKA 2EYTB 3RWGB 2IPTH 3FT2B 2Y36L 3LKPB 3BKJH 3PJSA 1N5YL 3GSXB 1EO8H 4YHML 1K5NA 3U7YL 1LD9A 4LCWD 4ELKB 3MNZA 4PJ7B 2DM2A 5JZ7C 1N3NB 2BJML 1TXKA 1JPSL 2VDPH 1U2CA 4KUZH 3MBEB 4QWWC 3O4LA 4OM1L 3PP3K 4HT1H 3UBXI 3KXFD 5GJTL 5F44A 1TNMA 1T7YA 1H3UA 4HK0A 1IGCL 1FNEA 5TE7L 4QXUL 4AG4H 3AU1A 3D0VB 4TOYL 3WIHH 5I1LB 5J89A 4LLQB 1J5OL 5A2JH 3E6FB 1MCFA 5C07B 3L3KA 3FO0H 2XFXB 5DEFA 3UDWA 2EDBA 3QNZA 5JO5B 1MFEH 2EH8L 2H32H 3T3MF 3FRUA 3IDJB 3QIUD 5C86A 4ZFFA 3LEXA 1M7DA 4JVPA 5F7HA 4DAGL 3PV6B 4I4WA 2AXJA 5MI0B 4OIBA 1V7NL 4P9ML 5SWSD 2FIRT 3ARGD 1Y6NR 3DO7B 3TBYB 4Z0BH 3HMWL 3U46B 1F4HA 3C8HA 1JZ4A 1BJMA 4ODHH 4JPVH 1P4LB 1Z5LB 3WXVH 4JM4H 3N0PB 3KYKL 3TN0A 3BDBA 1P53A 4CVZB 4EQ2A 3ECBB 3ILPA 4N0UE 5DHYA 2ERJB 1P4IL 3VXOB 3CFCH 3QP3A 5FUOH 4L3CA 2WV3A 4IJ3B 1KC5H 3BDXA 5TQ2H 1YJDL 1RPQA 2VLKA 2Z91B 4OF3A 2GYSA 3ZL4L 1J1OL 1EHLH 1T5XB 4FQXD 3SN6N 4ZPTA 5KW9H 4HUXB 4LAQL 3VH8G 1LO5A 4Z18A 4JRWA 1S9KC 5DMKB 1S7SB 4KK8D 4JRYB 2J8UF 5E6IC 3CFDB 5MHSE 5GGQH 2AQ2A 4Y4HC 3WXWH 3WKMH 5D7JD 1TQCB 2X7LA 4AQ1B 3MRKA 5EIQA 4I0CC <